The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
183
|
structure length |
183
|
Chain Sequence |
FFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of EHEC Intimin: Insights into the Complementarity between EPEC and EHEC
pubmed doi rcsb |
| molecule tags |
Cell adhesion
|
| source organism |
Escherichia coli o157:h7
|
| molecule keywords |
Intimin adherence protein
|
| total genus |
40
|
| structure length |
183
|
| sequence length |
183
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2010-06-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02368 | Big_2 | Bacterial Ig-like domain (group 2) |
| A | PF07979 | Intimin_C | Intimin C-type lectin domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
| Alpha Beta | Roll | Mannose-Binding Protein A; Chain A | Mannose-Binding Protein A, subunit A |
