3ND5A

Crystal structure of phosphopantetheine adenylyltransferase (ppat) from enterococcus faecalis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
152
Chain Sequence
MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 51
structure length 152
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nd5A00
2A7XA 3L93A 1JECA 2WB2A 3UOWA 2QJTA 1O96B 2XRYA 1N2GA 3Q4GA 1TYBE 4MW0A 1R6TA 4JYZA 1H1TA 3MLBA 1S4MA 1EFVB 4WNYA 5KWVA 1Q15A 3UK2A 3RBAA 1WZ2A 3A04A 3H9BA 2TS1A 1G8GA 1MRZA 2CUZA 3CLTD 1QU3A 3AFHA 1O95C 4PBTA 5TS2A 1IHOA 3IH5A 1YI8A 2DUMA 5DB4A 1GPMA 3KT3A 1KH2A 2A88A 1J20A 3FWKA 1X8XA 4ND7A 1TYCA 2CSXA 3CVUA 4MVCA 1JEEA 2A4MA 3SZGA 2YWCA 1NUTA 1EFVA 4G5YA 4YP6A 1WQ4A 2IP1A 3D6UA 4A91A 5JBNA 2EJCA 2GKSA 1KP3A 2DEUA 3AL0C 1P7PA 1KR2A 2PZ8A 1GTRA 1H3FA 4JXXA 1EE1A 4P2BA 2O8VA 1F4LA 4HK4A 3IMCA 4GU5A 3LCJA 1VLHA 1Q19A 3COYA 1R6UA 4DE5A 3TZLA 4JXZA 2DETA 4CDNA 2I1LA 1EUYA 2ZUEA 1MAWA 3HV0A 1NUUA 4MVYA 3TZEA 1IQ0A 3CLSC 4MLPA 4QBTA 2AKEA 1KAQA 1IQRA 1ZH0A 1O95D 4L2IB 1QJCA 2QTRA 4EG8A 4EF6A 2HMAA 2OV4A 1K4MA 1JIJA 2CFOA 2RD2A 1JZQA 3DLAA 5KCMA 3NV7A 5TEWA 2X1LA 4KR7A 2Z08A 1X6VA 2X3FA 1F7UA 5EKDA 2J4DA 2A1UA 4HJXA 1YIDA 3COVA 4RUKA 1PFVA 1J70A 1U3DA 3FNRA 4AS1A 3NBAA 4G5FA 4MUFA 1EJ2A 4ZCQA 3CVXA 4J76A 4MAFA 1T6XA 1F7VA 2WQ7A 4MUKA 1QRTA 1VBNA 1K97A 3COWA 3CLTC 3IUEA 4JZYA 1K4KA 1YUMA 4U7JA 3ISJA 4L2IA 1XJQA 1WQ3A 1A8HA 1J21A 3INNA 2J09A 1PFUA 1M1ZA 1NURA 1IRXA 1OWNA 4MW9A 1MC1A 4ZT6A 5K0SA 2CV2A 3X1JA 1EFPB 3HFJA 4EG3A 1KAMA 3A4IA 1T6ZA 4MULA 2VTBA 2PG3A 3CLUC 4R0NA 4CQNA 1ZJWA 2G36A 1O94D 1MB9A 4JFAA 4Q93A 1OWOA 4MVXA 1IH8A 1KKUA 1JZSA 1U7DA 3DO8A 3ND5A 5K0TA 5KHAA 3FH0A 2H2AA 1TEZA 1WXIA 4BWVA 1IVSA 2JA2A 2QUKA 3IMEA 4DJAA 5IJXA 5J5AA 1GN8A 4YMIA 2E89A 4EGAA 2J5BA 1LI5A 4MWBA 1VL2A 3MUEA 2ZP1A 2PXHA 4MQ6A 1XNHA 3H05A 2YWBA 4X0EA 5BNZA 3CLSD 3D6VA 4I6GA 1O97C 2CYCA 1JHDA 1QTQA 4HJRA 3OP1A 3HL4A 4EG5A 3P0HA 1T6YA 3HZRA 5FNZA 1G8HA 1YULA 2E0IA 2ZUFA 4FZJA 4ZCTA 4EG6A 4DDMA 1COZA 1O5TA 1GZUA 2EL7A 1FYDA 3GMIA 4ZCSA 1N2EA 2RE8A 3G59A 4ARIA 3LOQA 1Q11A 4KR6A 1QQTA 1IFXA 1UFVA 2PZBA 3MMXA 4ZT4A 1O0CA 4H3SA 5DEOA 2CV1A 2DXIA 3FETA 2JANA 3ZGZA 4J75A 4EFKA 2C5SA 2NZ2A 3C8ZA 4NATA 3X1MA 4MUJA 1KQPA 1N2JA 1WJGA 1LI7A 1O0BA 5HUHA 4F3RA 2PIDA 4GRIA 1ULHA 3BL5A 1KP2A 4OUDB 3PRHA 3N05A 1OBHA 1J1ZA 1ZH6A 4ZT7A 3ZJTA 2BYTA 4MUNA 3TQIA 1KH1A 4ND6A 3IODA 1D2RA 4EG1A 3FHJA 3CLRD 1WKBA 1O6BA 1G59A 2V0GA 3F3MA 1G8FA 1XNGA 2AG6A 3QTBA 4MWDA 4KPUB 3KT0A 1FFYA 5LFAA 4QRDA 1OWMA 3ELBA 3IUBA 4MW7A 4QREA 2NSYA 3VU8A 3CVWA 4ZT2A 1Q77A 4MW5A 4MUHA 2J07A 4HPWA 1PG0A 1NP7A 2YXNA 4I6EA 1N78A 2A1UB 3ZXIA 3ZUGA 1MBZA 4YP7A 3NBKA 4OUDA 3SYTA 3VGJA 2D5BA 3RFFA 1ILEA 3CVVA 1N75A 1SURA 1M8GA 3N8HA 2WSIA 3IVXA 1O94C 1TYAE 4ZT3A 3A05A 1TQ8A 4CT0A 1WXFA 3ND7A 4K0RA 2HZ7A 3I05A 1I6LA 1WXEA 4MWEA 1NUPA 3TNJA 1EUQA 2D54A 1GTSA 3UMVA 3L92A 1R6XA 3RK1A 1QRUA 3JXEA 1F9AA 2YY5A 2VTBB 1NUQA 4ZCPA 4K03A 1N2BA 3G5AA 4R2MA 3SZ3A 2CT8A 2A84A 1RQGA 1MAUA 3FI0A 5J59A 1N77A 3ZJUA 3KT6A 1YUNA 3QTTA 3IVGA 4ZT5A 3CR8A 4EG7A 1B6TA 1NYLA 1N3LA 4S1OA 4ARCA 4XSVA 5LM3A 5F23A 1TFUA 2QUIA 4PY2A 3AG5A 4KR9A 4YP5A 3SEQA 5H7XA 4TS1A 3TQOA 2CYBA 1V8FA 2A86A 1N2OA 1JGTA 2HGZA 1EFPA 4MW2A 3P52A 4OJMX 4MUEA 5H16A 1M8JA 1BS2A 3AG6A 4R2LA 1KORA 2CV0A 3E27A 3IMGA 3H99A 1M83A 2DERA 3A2KA 2A1TR 3M5WA 4NAUA 4WSOA 3GUZA 3SDBA 5FO1A 3AKZA 1NZJA 1WXGA 3SEZA 1N2IA 3IVCA 3ZIUA 1YIAA 3CLUD 5FO0A 1O96A 1LW7A 4MW4A 1V47A 3N2YA 3QE4A 1OD6A 5J58A 1QU2A 1J1UA 1NI5A 1WXHA 4XFJA 3SP1A 4DNXA 2JAXA 4MW6A 1DNPA 1I6MA 3X1KA 4DDKA 3CVYA 1CT9A 1I2DA 3FG9A 3FY4A 4DLPA 1Y42X 3K32A 3PNVA 3KT8A 1U7XA 3AIIA 3H9CA 1T9GS 3DV2A 3RHSA 3IOBA 3COZA 4ZCRA 1TYDE 2J08A 4YBRA 3CA8A 1M8PA 2VXOA 4U63A 1NSYA 3FIUA 3N9IA 1VBMA 1KQNA 3PNBA 1JMVA 3KFLA 5TEVA 2OQ2A 3ND6A 3RK0A 5TGTA 2O5RA 1HYBA 4KKVA 2E18A 2BTEA 5IHXA 4NAHA 2Z3VA 2CYAA 2WQ6A 2QUJA 1I6KA 1H3NA 3U1VA 3Q12A 4XFDA 1OWLA 3TS1A 4E1AA 3G6KA 3HMQA 1U3CA 1XNJA 4KPUA 1ZUNA 4MW1A 1U0BB 2A1TS 4EG4A 2X1MA 1OWPA 5HG0A 2X0KA 1EXDA 3P0IA 2QJFA 2QTMA 2XRZA 1IQUA 1KH3A 4MWCA 3ZXSA 3MLAA 1WOYA 4UZFA 1H3EA 2GM3A 2DLCX 1O97D 5DASA 4NZPA 1JEDA 4CDMA 3RJZA 2B7LA 3IDFA 1PFYA 2V0CA 4MVWA 2E21A 3P0JA 1OBCA 3K9WA 4I6JA 1GAXA 3OTWA 3Q10A 1VBKA 3FDXA 4RPIA 1WY5A 1JIIA 1MOPA 3MXTA 4Q16A 2H29A 2QUHA 3VRHA 1MB2A 3PXUA 1M8FA 3DPIA 4F4HA 5HUJA 5LLTA 1J09A 3S3TA 2IELA 1N1DA 1MJHA 2PFSA 1QNFA 3ILVA 5DK4A 2GOYA 4DDHA 1JILA 4MUGA 1PG2A 3H97A 3IOCA 2PZAA 3HGMA 4NDAA 3ZJVA 1N2HA 2DPLA 1GLNA 1PFWA 4PBSA 2QTNA 1K92A 1M8KA 2QJOA 2IJGX 3FOCA 2AZXA 3LE8A 2D13A 1JIKA 3IOEA 3GLVA 3UC5A 3PNYA 2Z09A 3CLRC 3UY4A 4PBRA 4AQ7A 4G6ZA 4U8HA 1KQOA 4NX2A 2R5WA 5AHWA 1T9GR 1NUSA 2DR2A 4MUIA 1QRSA 4UZEA
chains in the Genus database with same CATH superfamily
1ECCA 2C9ZA 1XKLA 1BRMA 2RHBA 3W9YA 4C0KA 1MHPA 4QTYA 2ZIVB 5F2KA 1N2GA 1RYYA 2BHLA 2JGLA 3REGA 4XIJA 1EXVA 1S4MA 4F6CA 3LXMA 1GKKA 2NPOA 3C3DA 2H3EA 4S3MA 1OX4A 3JQBA 1X3SA 1UUFA 3VOTA 4UTOA 1A8SA 1VL8A 3DUFB 2JLAA 3K15A 4Z0NA 1FFGA 1AT1A 2OZPA 2V7UA 2PS3A 3QRWA 3R7BA 2JCYA 1B0PA 4UE2A 5JRJA 2JEZA 4ZO6A 4U2BA 3G68A 4NI5A 2O3TA 4ZQGA 2BFFA 4Y9DA 3TIFA 1EWRA 2J9GA 1KYXA 1CIJA 4OMDA 4TWBA 2QIPA 1CLEA 4BKOA 5EJ7A 1V37A 9ATCA 3FWKA 3ECAA 4U4AA 2LZ0A 3NTOA 1E1YA 4YJ3A 2WAYA 5JSUA 4CM3A 4S1WA 3AHJA 3I83A 2PU5A 3M5DA 3CH5A 4B73A 1U0FA 2AG1A 5T41A 3THWA 4GGOA 4ND8B 2WFMA 1LLQA 1F2DA 1ESDA 4W5HA 3ZBTA 3ZDEA 3EEOA 4MR9A 1XPUA 4GG1A 4LTNA 3LRPA 4RK6A 1JIVA 2LPMA 5E7QA 3UMSA 1U4SA 1E99A 1WMDA 1VB5A 1VJ1A 1FW6A 4XD7A 1NQVA 2GBLA 2PZ8A 4YCAA 4LISA 2GFHA 3LRXA 1EE1A 5H59A 1UBTS 1X8LA 2HHCA 3WQQA 2VPYA 3WKEA 3PJEA 1Q19A 4FFNA 4ZDWA 1NYRA 2RGUA 3KOXA 5HZGA 1D2AA 3JQQA 4YDHB 2JA1A 2PHZA 3E7WA 3MGGA 4JN6B 4ZHQA 4QDZA 2PKRA 3T99A 1WG8A 4EJFA 4E4YA 3CLSC 3UGJA 5IAAA 3DTVA 1V95A 3NHAA 2ABWA 4AT1A 1TU0A 3Q0TA 4JLBA 2OM6A 4NXMB 2H3HA 4EG8A 3QBTA 4LNHA 4YCLA 1I7DA 5EKXA 2OV4A 5BR4A 3PEYA 4KRXA 1PV2A 2VPQA 5JHGB 2YYAA 4B0PA 1HYGA 4KQWA 3JWIA 3L7BA 4YROA 2HU2A 4L51A 1U5BB 4LY6A 1SIBE 4Z4FA 4QXQA 4LV5B 5LIPA 3F4KA 1OFTA 5GP1A 1CF9A 4WMLA 2GRAA 5JROA 1P3DA 1E9SA 4H08A 3V8NA 1V7CA 1Y80A 4K88A 4IHJA 4M1EA 4G1VA 1MRSA 1LPMA 2Q0XA 2RAFA 4IWXA 3WLMA 2XA9A 3NLLA 3G89A 3PXXA 4KJXA 1HFJA 1S2GA 1SMKA 1YMQA 2HM7A 1M2KA 3MD9A 4MI1A 4FDAA 2E3JA 4FNOA 4QDOA 2WK1A 1DBWA 3E3MA 5I4KA 2HCBA 5JS8A 3ZD7A 1N57A 1J0CA 3KZMA 1XJQA 3MJCA 2XQFA 1JIUA 1SXPA 3QBEA 1NKVA 5EZQA 5DN6A 1Z74A 4MYCA 3BMNB 3PC6A 1T91A 2H1CA 3FYUB 3KUUA 1NRJB 1JUDA 4RXTA 3EH2A 3WTBA 3IJRA 5K0SA 1US8B 4R1UA 1KAMA 4H59A 1QTNA 4N3CA 4IY1A 4ZGGA 2J87A 3OE7D 3DUFA 1WDTA 1L7RA 1V16B 4BKPA 5IDXA 3DOEA 3EG9B 5AOVA 2G36A 4M6WA 1KDPA 3O8OA 3A6DA 3CUTA 3LHIA 1N5OX 1YA4A 1CY7A 1EXMA 1Z6AA 2PFGA 3N8DA 2IWRA 2E4YA 3LUDA 3DO8A 4GYYA 4D92A 4UU1A 5B36A 3BCSA 4BVHA 4E14A 1N6RA 4JQOA 1WUYA 1LBIA 3VJLA 5KKCA 3SR3A 2HBYA 3Q98A 3FF4A 3G17A 2ZQ5A 4NBUA 3SC4A 1KAEA 3I53A 4XYMA 3L4KA 1QGDA 5D86A 3KAQA 2XAUA 3KQOA 4KMOA 1HDRA 3VR3A 4G56A 3X44A 3IGFA 4YJ3B 3CN7A 4G4IA 1IZ0A 3OJCA 4DIDA 1L8XA 4DSTA 4EGAA 3UXEA 1MV8A 1SKAA 2BR3A 4AKEA 3LGSA 3JQAD 3PWSA 1D0IA 1G9SA 2OOKA 2ACWA 2Y1XA 2ZYTX 3PQFA 2G7ZA 2WAOA 3QLVA 1PR5A 5BRJA 1JAXA 1U31A 5K8CA 1VIDA 1ZL0A 4BQOA 2C1XA 3KQPA 4QPNA 3Q7EA 3W05A 4IIXA 1V5IA 1E96A 5ALRA 1NHWA 2ZROA 4HAXA 1TJ4A 4IJQA 4JMPA 4A7PA 2EX0A 5A5FA 4ZCTA 1YQGA 2NOAA 3FUWA 6AT1A 2OBBA 5BVGB 3CVOA 1XRNA 3PA8A 4G4JA 3ED1A 2W2KA 3JRXA 1YRHA 2AG0A 4Q16A 2OFFA 3VMMA 3DLBA 4DY4A 4DR7B 3K94A 1FMJA 1OA0A 4YMVA 1L6RA 4RZHA 3FCAA 1OZFA 2QMZA 3IUSA 5L95A 4EFMA 1SU4A 5DM2A 4B4OA 2BR4A 3U39A 2D7JA 4J0JA 4XUDA 5DEOA 3BVPA 4J9UE 4JJ7A 3D6JA 5E3IA 4YA6A 3C3PA 1ENPA 3PCXA 4EFKA 2FN9A 3QI2A 4RH0A 4GMKA 3EUAA 2NZ2A 2P91A 3KHTA 5AHKA 3GG9A 5HCNA 4CT4B 5C1DA 1RM4A 2FGKA 2GT1A 3RNOA 4MPJA 5IJ9B 3A6GA 5ALTA 4GFDA 3WK6A 3LS2A 1H0RA 1KQ3A 3S2EA 4FHEA 1XZPA 1CW2B 4EB8A 5C52B 1LC0A 2J30A 3LPAA 4U7HA 5ALWA 4F4DA 5K0BA 5EHGA 2RGNA 1F5NA 2HA6A 3SQMA 3VZPA 3ZCTA 3NCTA 1CJMA 3SI7A 1NLMA 1T2EA 3MWEA 2ZSKA 5CFPA 2C2MA 4GYWA 1G4HA 1TECE 3P9KA 4R69A 5DBIA 3WRXC 3ZJTA 4C1BA 3GLHE 2QRHA 1P5ZB 1RABA 2CEAA 3QKUA 4ND6A 5FWDA 3WLJA 4FE7A 3ZZMA 3QGMA 2B8JA 3UB2A 4E1VA 1KS2A 3PQ8A 3CLRD 3CNLA 4CI0B 2QTGA 5SZJA 2OVBA 4CPDA 3R24A 4IZOA 5JG7A 4CLDA 3IDSA 2WHEA 4W9NA 5ER9A 4JBIA 2ZG6A 2QIOA 1R8SA 3J7AC 1BKSB 2NNLD 4PHCA 1OLUA 3VPGA 1RWBA 3WLSA 5JISA 4YP0A 1SQGA 3Q7IA 2BF4A 2PVSA 4PYLA 5JTUA 2J07A 2BISA 2YMPA 4LMPA 2G8NA 5EXEA 4RSGA 3OQMA 4EHKA 4OAPA 4OK3A 2CXOA 4LAFA 1N0IA 3RFFA 3SHWA 2IQIA 1ULAA 4DOMA 3M82A 5FBWB 4BEVA 3EMDA 4C87A 4K46A 3RTCA 1NNEA 4AO8A 3NRCA 1NIPA 3I1YA 3TOZA 3WYCA 2OXIA 3F78A 1RD4A 5IFKA 3QFFA 5JD6A 4JI4B 2ZWPA 1DAOA 1JHXA 3UATA 4IDQA 3CX6A 3NZEA 2H16A 3M1LA 4G0OA 4GLJA 3JASB 4Y1RB 5AW3A 1SCIA 4GP7A 1R6XA 1QGZA 1UODA 2VH1A 3H5LA 2DBZA 3K2IA 4EEXA 3N6XA 1KF0A 3CNBA 4UVGA 1FNSA 3FYCA 4HNUA 2AG5A 2IZ6A 3F74A 3L0YA 1JDJA 1Q0QA 1L1FA 3EZLA 1Z37A 1NUQA 2POQX 3L43A 1VIAA 4B09A 4K03A 1EVYA 1P17A 1A9QA 3FXAA 1L1RA 3OPXA 4HAUA 1I4WA 3KFVA 5FBQB 3NWJA 4EBFA 1LPBB 1XRMA 1IU9A 4FFSA 4OYLA 3U4AA 3WK4A 1EGVB 1VOTA 3GCXA 3CH7A 2HUPA 2RBEA 3CR8A 4DCUA 3EZYA 1ZH8A 2NUTA 3I9MA 3DMNA 4KH0A 2O8EA 2HEGA 5LM3A 3ND8A 2AD1A 3WFZA 1NBEA 3F2IA 3CZQA 3RFXA 1M0EA 5CR9A 2QUIA 2Z4TA 4INJA 3GWGA 3PUHA 1WDMA 2ZATA 4KQFA 4EYKA 4F72A 1JLSA 2B6NA 2P6NA 1BYIA 4DNPA 1EZ1A 3CGWA 5CB4F 3MUFA 4MS1A 2IIBA 4CEHB 5HBGA 2WWGA 1PEAA 2EIXA 4OXIA 1QAQA 3OPQA 4ZEOA 1RLOA 4DSAA 3RH0A 2J3QA 1Q74A 1EFCA 2AFIE 1UL1X 3NANA 2O6HA 4QPDA 4HVLA 2IOYA 4UARA 1CZRA 4QBHA 5HCUA 2ZTVA 3EG9A 1OC4A 2XQJA 3HA3A 5T67A 4O4HB 3H87A 8LDHA 3H11B 4J16A 4OGWA 5LXTF 3M6AA 1G6HA 3L7JA 4I08A 1ITZA 3GLHA 2B61A 3L0OA 5AHOA 1QQAA 4BQRA 1KZ9A 2PXCA 1H9AA 1G66A 4LVCA 1OXSC 4XYEA 4OCZA 3PI7A 4JC8A 5KHOC 3FHTA 4QQKA 1YE3A 4WSOA 1L7MA 1HE8B 5CDTA 4EUEA 3UV6A 4BMVA 5K0EA 2ON6A 1ZGHA 4EUHA 2VWHA 2QA5A 4FNGA 4GX5A 3ZGOA 3JAWA 2HT6A 2FZKA 4R8LA 3HABA 3HSKA 4FX5A 1KYZA 3I37X 4ODIA 4TV9B 1SBZA 2CBZA 3HUUA 4WERA 5CP8A 5DM70 3OTOB 2BR5A 4MQFB 3GEBA 3QLJA 3LBAA 1J24A 2ZSJA 3A9SA 2AKYA 1T1RA 2Y92A 3NTVA 4JUDX 4QVKA 5LCXA 2J4CA 2NIPA 3EFHA 3X1KA 1PS0A 1CRZA 2FSSA 4KQCA 1CEYA 5L3SB 3MGBA 1LDGA 1J9ZA 4H7IA 1BVUA 1UMKA 3LUFA 4RVSA 5ETJA 5GGXA 2FUEA 2V7WA 4ER7A 3EAQA 4HV4A 4IS2A 4LF8B 3OPYB 3P9NA 4NK4A 3N58A 3I0MA 4TV8F 4R8SA 2GZ2A 2W2LD 5DSTA 1EIZA 1HDYA 1SCNE 3OF3A 2BELA 1JNXX 3UMGA 3E6AA 4C7VA 4L6AA 1VRWA 2B5VA 3H1PA 4U63A 5IYZB 1P5FA 1X19A 1PE0A 2BSXA 1GOTA 2FPPB 3C70A 3N9IA 1IN5A 1ZRMA 3KFLA 3UAXA 4X9XA 4ONEA 1YS6A 3ER6A 4EKEA 4JQZA 3RSHA 1K8YB 5CFNA 5AVWA 821PA 5M04A 3HYNA 3FPHA 4BLSA 3TLMA 2BTEA 1T10A 5IM4A 3K8YA 4M8IA 4ZN6A 2BFAA 4MP8A 5EWMB 3PD1A 2AQHA 4QG7A 4YJ2A 1Z4KA 4PWZA 2V5UA 1E4EB 3INRA 2ZR7A 1EB8A 1RXEA 1YJ8A 3K6JA 5JRZA 3FYHA 4J3FA 4M1TA 4GEGA 2QU7A 1JG2A 2WJVA 2EKBA 1PGQA 2OV3A 3L8DA 4L5BA 1T25A 1F12A 2H7XA 3FYTA 3Q7TA 4M0DA 1Y9DA 3NOQA 4PLGA 4J94A 1EXDA 4INPA 3G3EA 5T5QA 3WI7A 2HO4A 3H2HA 1EK0A 4GVXA 2R8ZA 4X1IB 4OY3A 3TBHA 4X64B 3MLAA 5ILGA 2H1FA 2FPRA 2F8LA 2WKQA 3B7GA 5HVNA 5EWJA 1TAUA 1JHUA 4Z0PA 1V48A 2QD1A 4O02B 3QUSA 3KZCA 4G0VA 1KZYC 4DDTA 1Z4JA 1ZOSA 3N2IA 3PPYA 1FXWF 1XUOA 2EFJA 1ZJZA 4OSPA 4PRYA 2G0TA 1SXJB 5LQUA 3LH5A 3SICE 4WBNB 2ATCA 1C7JA 2FRVA 3GI1A 4KAJA 4UNSA 3S99A 2DPGA 4UPEA 3FLEA 4FKMA 5JMWA 3TJMA 4JODA 4OI2A 4P1ZA 3KZ1E 3FDXA 5IF9A 1WM1A 3EIUA 4C4PA 1PJBA 1JFLA 2JGMA 3H3XA 1WHSA 2AI2A 3W6ZA 4RU1A 4R8MA 2I3GA 4IO0A 1FZTA 4US2R 3HP1A 4OHYA 1NW8A 4O4HA 4RHCA 3ZHOA 4JEMA 4A3SA 4X8LA 4G1UC 1RWWA 2FOXA 5LZ7A 5A0TA 4ZTZB 1I0LA 2J48A 1N1DA 4EJ0A 4OREX 3HUTA 5KNBD 1DJMA 4TXMA 5GTDA 2OK7A 3HYRA 1KI8A 4MB2A 3BXEA 4P93A 4R98A 5IW8A 2QT0A 2RJNA 1JILA 4P98A 1HDZA 2BFBA 5EEHA 5SICE 4DKXA 4HI0E 4ESOA 2NTEA 2GM5A 3R09A 4MDYA 2FKAA 3K0CC 3RANA 2DPLA 3C4QA 2QE6A 1AF4A 2ZBUA 3MWFA 4RC9A 1GM5A 1E2BA 2IJGX 5CX4A 5DE3A 4FVTA 4PINA 4NPAA 3WJAA 1EU1A 1YTUA 3IBTA 5AK6A 5FPYA 2JDIA 3ZBQA 4D57A 4LF5B 2O4CA 1Z29A 4EA7A 2H6EA 5B57C 4HB2A 1ZI6A 2WWWA 3FCCA 1YF3A 1SA0B 1N8SA 1L6IA 1Y48E 2X6TA 4BBAA 4HLUC 5H3CA 3IA7A 1YCHA 2AR7A 5I9SA 1X77A 2WF9A 3H1AA 3VUFA 4A8HA 3MC1A 1U2TA 2O0LA 4PYIA 1QDEA 1E2KA 3CW9A 2UV8A 3HR7A 4DA9A 2ZAMA 2AC4A 4UJ5A 2FSFA 1DWUA 4KWIA 5FOSA 3EFEA 1D0VA 2PMDA 2GA8A 1PWYE 3AR9A 5ESXA 2G83A 3LTEA 5BSRA 4DDUA 4PXAA 4XA8A 3FPJA 5F1PA 2WILA 4O4IA 3VA7A 1QB7A 3TNLA 1RPZA 2WIAA 2H51A 2C42A 4R68A 1VIYA 2GK4A 3KOUA 4G2NA 3W3ZB 4AZWA 5AK3A 1SZJG 1OHHD 5BY2A 3D9QX 4HUQA 2BZ1A 4B2PA 5B12A 4F2PA 1DC7A 2ZBRA 5KWVA 3S44A 1A96A 4ZODA 4M1WA 4DXDA 1CUHA 1FP4B 3A8TA 1NKTA 5KVAA 1PAUA 1A5BB 1EQ2A 3ME5A 1CCWA 4DARA 1YL6A 1U8UA 2I87A 1GA1A 1EB9A 3H2GA 2ZB3A 2XT9A 3UAYA 4D98A 1DC4A 2ECFA 2AOUA 2GI4A 2Q49A 3IP5A 2PGXA 4TT3A 1DXHA 4PZPA 5TS2A 4CRWB 2DOKA 1PZNA 4KG7A 2ZRCA 5KOJB 2XQVA 4O2LA 4GX0A 4DQLA 2WY2D 2NU9B 1XL1A 1D4ZA 7ADHA 4H0FA 4JVLA 4Q4AB 4UUBA 2HSWA 3KJNA 1QZZA 4OO3A 2O2CA 1S3SA 4NYMQ 4B3CA 4ND7A 1OHHA 2K2QB 1TYCA 3VDNB 4C6RA 3VR5A 1E5DA 3DNFA 4WZBB 2JGDB 4D4JA 4MVCA 1HG1A 2GSDA 2ZM6B 5GIPE 4KVAA 4RM3A 3ZHVA 3KAKA 5CU7A 3DOIA 1I7LA 1SXJA 2KX7A 1A1SA 1YR6A 1JAHA 1Q0HA 3D4IA 3FPEA 3IALA 3PPXA 4MJLA 4RMNA 4Y30A 2PJDA 4UVDA 3VOAA 5CA1F 5JD5A 5IVIA 4Y6QA 5FQNA 3D3EA 1WNTA 3JRNA 1VCOA 5DWQA 2X15A 1A4UA 2ODNA 2FFQA 1QIEA 1MXFA 2Y1GA 3WNZA 1U8ZA 3D8NA 4I50A 4LNUA 1H3FA 1QYWA 2AHRA 3C85A 3ZYCA 3U3XA 4HGZA 2XYRA 1OLXA 5BO5A 5T6MA 4J0IA 1FEZA 4JXXA 3I2JA 2P68A 5JADA 3TGLA 3F0TA 4YK7A 4OH7A 4XJXA 4EKDA 4CQJA 3B9BA 4D79A 4WOJA 5EHZA 4R8KA 4YS6A 1IN1A 2A59A 2VWGA 3HDJA 4D4HA 4JXZA 4RJLA 1NYTA 2AZTA 3LHSA 1Y6QA 4WZAA 3OIDA 2G4LA 4MRVA 4EQ6A 2BFBB 4UQOA 2WD9A 4GPD1 1GZSA 1OW3B 2BDEA 2RBKA 1IIRA 5FEMA 3T5DA 3K09C 3WL7A 1PNOA 4YJHA 1GXSA 1KI9A 1EVLA 4CQMB 4WLUA 6Q21A 4TLMB 4R7TA 4OQDA 2BE7A 1DEHA 3LW7A 3D5QA 4UFNA 1WU7A 4XQ9A 3AB8A 1RFLA 3AU9A 3M0EA 4Q00A 5BN5A 4HAYA 2VCHA 5IBCA 4FNMA 2W98A 2R97A 1CNEA 2HF9A 2R87A 3RRYA 4RLFA 4UM7A 4TL6A 4ZCLA 1THTA 4I1UA 1OLOA 4FR0A 4UREA 5D3QA 2ZIAA 1EJ2A 1KC3A 1R37A 1ZY2A 1X1TA 2VK8A 1JSRA 3BXXA 3K70C 1F7VA 5SZKB 1YSCA 4CV1A 4MCIA 5I7HA 3OKCA 2OHJA 1Y3IA 2EC5A 5L7WA 5J4LA 4AYTA 1LGYA 2Z1DA 4JLKA 5J2TB 2D06A 4L2IA 1G42A 1E77A 3CQ9A 2R0QC 3N0XA 1XOIA 5GQSA 2I2XB 4RCZA 4GIBA 1OIXA 2J09A 3AGPA 1JALA 1M74A 1NURA 2E48A 3S1LA 2OGTA 4F60A 1JX6A 4QGFA 4FFMA 2V7QA 5CNKA 2AYXA 2CGEA 3THXB 5BT9A 1UT5A 1ZM2A 2PG3A 3CLUC 1NI3A 3LM8A 4JP3A 5DM4A 4CQNA 2Q7OE 3I62A 2CLEB 3UMMA 3LLCA 1WPQA 1FJGB 4OEHA 4NCBA 4NECA 4EENA 1MX3A 2WSSA 4IVNA 3ADKA 3MIZA 5KJ1A 1DCTA 3U19A 1P2DA 1Y1QA 2JL1A 2KWIA 2J9YB 2QMUA 2HL6A 3CLVA 2YQ4A 1XJ0A 4QPPA 1N1MA 2V55B 2VPXA 4IX9A 3ORQA 5E1BA 4FLMA 3IBFA 2ZB4A 3HN6A 4JUCA 1VLQA 1SIWA 3JX9A 3IR7A 2I6FA 2FMTA 2VZ8A 4DG5A 2Y2UA 5BV0A 2ZIFA 1ZGGA 1MJNA 3ZH9B 2QKYA 2PR7A 1XB2A 3C97A 4Q1VA 4E88A 2G9VA 2N1BA 3GFVA 1NJSA 4ILKA 2XGMA 3G88A 3O1JC 4BFXA 1NF8A 4GWGA 2BY4A 1SA0A 4WJKB 1RRPA 4C6TB 4GBJA 3A36A 3LP5A 5BSEA 1JLRA 2R751 1PL6A 3AEUA 3RKRA 4MDEA 1YULA 4UHCA 4H7HA 1NNUA 4QDTA 2YNMA 3SOPA 3TYXA 1DBPA 3VYRB 2XYQA 3E0XA 2WFLA 3G8CA 3PDWA 5LP6F 2OECA 2SKEA 5BQOA 2NZXA 4CM8A 3I9V1 1NWHA 1VL6A 3DZBA 4IXDA 5CNIA 2HREA 4WCFC 3LOQA 1LBHA 3FGPA 4DJEC 1QH0A 2G28A 2RHOA 2G5TA 4FE4A 4QYIB 3Q8MA 1P5JA 1FSGA 2WMYA 3E4DA 4HNAB 4IFBA 4C01A 1HWYA 2PKWA 1VZ2A 4LVUA 4BNDA 4L0MA 4UVEA 4CUKA 3CINA 4TT8A 1LSUA 2ZR8A 3OX4A 3ZDYB 4WXPA 4K6HA 3KOMA 4WINA 3R6TA 2RGXA 5WRFA 1LBSA 3RC1A 1OAOC 1XXLA 5DTEA 3SBOA 1J00A 3NYRA 2TMDA 3X2FA 1O5OA 3KUXA 4B79A 5J3JA 4PO8A 5L9AA 4M7RA 4KYTA 4F85A 5BR1A 3W34A 2QU8A 3K0BA 3H7IA 1A5AB 5HRAA 1DRWA 4ERNA 5KYXA 1Q14A 1UM9A 3V32A 2VZ0A 2YWXA 3OJLA 2H63A 4CYMA 4PFKA 4CUJA 2XR1A 3TRKA 3LCVB 1QM5A 4B4UA 1WV0A 1U98A 3OEHD 2V3CC 4ASUD 1Z4PX 1AGNA 2X4DA 4YREA 5C1PA 4QAQA 1TEXA 2EJTA 5DYWA 1QH8A 4PG5A 1A88A 3SE7A 4BC1A 4DAOA 3V00A 7AT1A 2PQ2A 2OGUA 4QRDA 3NWPA 1G38A 4MW7A 2X42A 1XDUA 4IRMA 2V7TA 3H83A 1BIFA 4A26A 3JVEA 2H4YA 4KOEC 2XQGA 2PLRA 4YAOA 4I50B 4LNUB 2W8BA 2VSYA 3R5TA 1FMTA 2IODA 4LY3A 4PAOA 1J8MF 1RXUA 4OXQA 3L7YA 1DEOA 2YMQA 1MBZA 1M0WA 3T12A 5LL6P 2LCFA 1K2WA 2W6ID 3C2QA 1QGED 3GGDA 1NY5A 1TVKA 4IDEA 4CF6A 1RW4A 3GIDA 1GG8A 3KYDA 4RVOA 4I5FA 3H9EO 4Y2GA 2JASA 5LQAA 4FYHA 3VHXA 3U61B 2B3TA 2JC3A 3OEYA 4D8TA 1ADYA 2XNKA 5ICMA 3EEBA 2QBYB 4KQIA 2GXUA 3EC1A 1E9VA 3T7TA 1KFEB 2JLRA 1Z6TA 1PFGA 1UDXA 1CRQA 2R48A 2XBLA 3TNJA 1JVBA 1EUQA 4PPQA 2WKPA 2JCSA 3DBLB 3ONEA 5BRAA 2HSGA 2UZIR 1J5EB 4P4TA 5HF8A 5BORA 3WP0A 1YB1A 5DX0A 2QGZA 3ZCXA 4NMMA 1AA6A 1XQYA 3AI7A 3MS2A 4FJ0A 2FTKE 5FUMA 1RTTA 4GVLA 1VJCA 3KKZA 4HWRA 1T2CA 1GL3A 3KWJA 5ITWA 3VSDA 4GI3A 3O9VA 3RVRA 1N77A 2WZCA 4REOA 3PIDA 4YJDA 4D0GA 1G5HA 4JBGA 3GJRA 3HR4A 3IVGA 2P2CA 4QLOA 1JSCA 1KS9A 2P7IA 3AJ9A 4NLLA 4DMLA 4YT2A 4Z7QB 3VH2A 4IHJF 5CM8B 3CPEA 4P3NA 3SQOA 4N3AA 2ZT8A 1GSIA 2GFIA 4LI0A 1WUJS 1LFDB 3F5FA 4QPCA 4YPFA 3IKJA 3ADCA 2FJUA 3NEAA 4GKJB 2LD4A 3GO4A 5JJCA 3M4XA 3O91A 3SJZA 3BWYA 1GU1A 1T3TA 4P3PA 4CVNA 4EJSC 4KITB 4NBSA 3EVCA 4NK5A 1RIFA 3ZGYA 2R8PA 2VNSA 3VPBA 1YK0A 3TQFA 4TZ6A 1U1GA 3OT4A 1AHHA 1I4DD 1SKBA 4AY6A 1A9RA 2HQOA 2CV0A 3BGSA 3OFKA 1R4NB 3H99A 1NFQA 2W4MA 3KB6A 1OBFO 3PK0A 3WZ2A 1RBZA 3E2PA 4D9FA 1W7AA 1SCKA 1UEIA 2B21A 2VJOA 3DDNA 3TM5A 4P4LA 1VGRA 5TPZA 1JBQA 4J4TA 5AI5A 5FO1A 2P3SA 1K68A 1XZEA 2R6DA 2ZWVA 4HKTA 4DEVA 5KTTA 5I8WA 3U9LA 2VP9A 3B3GA 3WYEA 3L1UA 3LY9A 2ZT5A 1HNNA 4RABA 4URYR 3NJRA 5EUQB 3U4MA 1M6HA 4DA6A 3B3QA 3MWKA 1Q1AA 3GJZA 4JLAA 5GAJA 4CV0A 4TUYA 4KIJA 5JR3A 4BRSA 1XZFA 2NV2B 3SQWA 3L6BA 1E2UA 1D8AA 1ZRSA 1ZVVA 4QXAA 5F5XA 4G86A 3V5NA 4H4DA 4ZI3A 1ISGA 2I8LA 1LNSA 2FR1A 2JAUA 5BXQC 3CBGA 2B35A 5TMBA 1N4AA 3TEJA 1JE1A 1Z5WA 3B51X 1LPOA 4G3XA 1UXKA 2B4TO 2ODAA 4OKSA 3SGLA 4CKZA 1TM2A 1WVMA 4TV9A 3RJTA 4E94A 4J0HA 4YYZA 1EVJA 4Z51A 4ZCRA 4KPYA 1XWWA 3TGPA 1ORWA 2Z1NA 4MPDA 4X95A 3AFOA 3LPLA 3QX3A 3RRZA 4QGGA 1J33A 2XIQA 3DFUA 3K6KA 4H1HA 1XTJA 4B85A 4KKVA 2DG2A 1GGJA 2FEMA 2OFWA 3FCUB 4REQA 5JNSA 2PUGA 2C4TA 3BG5A 3CVJA 4L57A 4X85A 2V9CA 1M2GA 3G8YA 2ZREA 3KXLA 1II8A 3UUWA 5ERYA 2WQ6A 3OQOA 2VRNA 2VNJA 4TZ0A 3A1EA 1SC6A 4UHFA 3TL3A 4BO9A 1FFSA 4MV0A 2CWWA 4MARA 3TS1A 3QMPA 4JLJA 4P5PA 4ZARA 2V3VA 3ICCA 2FFJA 4KPGA 2G76A 4II3A 3E03A 4GE0A 3IEUA 2XYGA 3JATB 4FOPA 1LX6A 2O2ZA 4G63A 4YRTA 5ARDA 4ETMA 1UF9A 4PXYA 4Y9RA 1JN0A 3KSRA 5TE9A 5IFLA 1G8SA 2QQ5A 2FF7A 4IUBS 3T3OA 1U8EA 2HBZA 3BJEA 3N0VA 3OURA 4Q4JA 1DQNA 1QHEA 4KUHA 1JSXA 1NA5A 1ID1A 3THSA 2P65A 2H1LA 4C2BA 3V7YA 2C7OA 1YGYA 4X6YA 1AQJA 5A02A 5H9WA 1HQYE 1CQWA 1QPGA 1MJGA 1W8IA 3FDZB 2IBTA 2O8DA 2CXTA 4HTFB 2DCMA 1MFZA 3SDSA 2YIJA 2BZ0A 3QIVA 2EZTA 1E89A 3JTMA 4M98A 4TL9A 5BV7A 5JZBA 1UKCA 3EZ2A 3JSXA 3RJZA 3IB6A 4AL4A 1NONA 1Y89A 3RF6A 3B6IA 1QH8B 5HEKA 5CXQA 2XUZA 4ETNA 3MBKA 4MVWA 4EL0A 3GOHA 4GQAA 5DO9A 1U0LA 5DNWA 3WWZA 3K9QO 4PRLA 4F3KA 1VI5A 3TSWA 2ZEJA 4B9AA 4PLYA 2P78A 4DV1B 1NVBA 1G20B 3Q10A 4YP9A 2XLBA 3TTUA 1JIIA 1MOPA 2DAPA 2O7NA 1Z4IA 2PT9A 2VJKA 3HVKA 4HDNB 4RV5A 1KYIA 1SHUX 5JHHB 2NSJA 1KEEA 2OD9A 2VZ9A 2C5GA 5IBQA 3EVZA 4I1OA 2IYVA 4IKOA 3STXA 4W9RA 4WXHA 1RP1A 2VYCA 3MT9A 2NUAB 1E9FA 2PR2A 3IERA 1OFGA 2IOFA 4JI3B 1TVKB 2AR0A 1IE3A 1WB5A 2IPOA 2ZSEA 3HN7A 4RJIA 1K7FB 3MJTA 2XGJA 4WOBA 3ERCA 4JLVA 1GIAA 3RF7A 4D8VA 4C9BA 1BE1A 4XIYA 4RE5A 5G0VA 4RVHA 2J59A 4MCAA 2WTNA 5EKSA 4MYRA 1T4DA 2I3BA 2ZKLA 3D02A 1E5QA 4EYEA 4ZZ3A 3GROA 2WTBA 3DBLA 5ECDA 4FJ2A 1DKMA 3BD9A 2QJOA 3DJYA 5C5CA 1R9JA 2VC2B 4WGFA 5BOSA 3CUVA 3AUAA 3IKLA 2SECE 2HR1A 3V2HA 4QOEA 2AZMA 4N1AA 4Z9XA 3RIHA 2Y3IA 1XE3A 3IAM1 4AQDA 4NU6A 1L5SA 1V6AA 2JK0A 3ENWA 2PL9A 3W6UA 1G9XA 2Z09A 1QG4A 2P0YA 3FWNA 3KIPA 5C9ZA 1Y8RB 4G6ZA 4JUIA 4NJMB 2IYRA 2QSZA 2GPTA 2WOJA 3DD5A 5CG1A 2VSQA 4BZQA 1DL5A 1YBHA 2CMFA 3AEZA 2JGIA 3ESDA 2UZ1B 1S8NA 1WUIS 2QTAA 2I6QA 3HBNA 2PQ0A 1R16A 1I5EA 4BNZA 1ZD3A 1SH7A 4F8JA 1CUSA 4MUIA 1GCGA 1QX4A 4G84A 2HXSA 3L0PA 4GGPA 4UZEA 2HAEA 4KQGA 4XB6B 3MZ0A 4EL5A 4RTRA 5EIHA 1L5GB 1C0LA 3JQRA 3I9NA 3V2IA 2FH5B 2MR5A 1TW3A 1ZPDA 4D4LA 1K7EB 3HC7A 1ISMA 3LWZA 5FXMA 5C7LO 3R0VA 4BB9A 2PY6A 4IDDA 4ID9A 4K6MA 3DA8A 2R7KA 3T7DA 5CDGA 2V98A 1PVVA 3PNMA 2MR6A 4MGIR 4ZMBA 5U4XA 2EWWA 2CUZA 2XUHA 5HPYB 1C81A 3B6JA 3LHFA 5SYNA 3OZWA 1GU0A 5A4MS 3JQBC 4KRFA 1R4NA 3LP6A 3NBQA 4Q4JB 4B82A 4GMFA 5BMVF 1ATZA 5FQOA 3EDMA 2FFRA 2EP7A 1Q0ZA 2RBGA 1IHOA 1EINA 3A9VA 4L75A 2X8AA 1Z6XA 3WRYA 4E5MA 3MFYA 2VJNA 3DH0A 3SZUA 4A1FA 2NSDA 1LY1A 2R85A 3AVQA 3HB9A 3LG2A 5BVHB 1E0AA 5BQFA 1H2ZA 3LUHA 1OPXA 1URPA 1UBEA 5EAIA 3MYRA 5IANA 4DHEA 3IE1A 1AZWA 4EKIA 1OKKD 2BCJQ 4C0WA 2JFXA 3VBCA 3LO8A 4XQCA 3VYTB 3IQXA 1IEQA 3DLTA 3Q6IA 1M75A 4Y0AA 2A4MA 3SZGA 2MMGA 1IHDA 4ZMRA 5B6IA 2RMKA 3HWWA 2ID9A 3DAGA 4EABA 4G0WA 4HXFB 2GZSA 1GGFA 3TH5A 4CMBA 3KV3O 3D0RA 2GXSA 3PNOA 1SVUA 4EYSA 1CR2A 3C16C 1TW2A 2AMJA 4RJJA 5ELMA 4TSFD 3TQCA 1FLNA 2AF3C 3A1UA 1BMFA 5I8PA 1DIGA 1SVWA 3ZN2A 4Z7JA 4B76A 1VP9A 2FGJA 2NUAA 4UDXX 2FPGB 3R0XA 3Q7SA 1Z3CA 2H2FA 4A0QA 3CRZA 2XGGA 1WVIA 3I9OA 4QOSA 4OA8A 4CG3A 1R5NA 4S12A 1HYHA 4C3OB 5MGBA 2Q9BA 3FKSA 3PLRA 4Z3OA 1GRRA 2YIMA 1P8AA 1NUUA 3A31A 5ALDA 5B1SA 1A5SB 3I12A 4QVGA 1MN6A 1G7TA 3MMNA 4HDRA 4D45A 5EKUA 5G1OA 3G5TA 4TRRA 2F1RA 1F06A 1QJCA 2GILA 4B87A 4F04A 3GNSA 1XZHA 2R8RA 4RGVA 4I3HA 4A4DA 3THWB 1CUBA 1IBCA 3NWEA 4XUGB 2AXPA 3A0RB 3VSBA 4F96A 2Q07A 1JZQA 3GUVA 4ESVA 1Y1SA 1SQ5A 5IN5A 4GSYA 5CT4A 2X1LA 5L4LA 4JB8A 3TOVA 3B12A 3LDUA 2ZYDA 1QG2A 3QEAZ 4PX9A 5GGYA 1YFJA 1USVA 4IAOA 4ZQEA 1ZG3A 4GRAA 6PFKA 1MJ5A 5I47A 2PS9A 3SBEA 4J0KA 1U3DA 3VVCA 4NJMA 3ESQA 3O8OB 4RIFA 1YU9A 1NVEA 3FPFA 1GZVA 4ZCQA 4UUOA 3UK1A 5KWSA 1GHTA 3ET5A 1SXGA 3BHIA 4V0RA 4H6VA 3IR5A 4ID3A 5HIAA 4FCTA 2X0IA 4B81A 1M3SA 3ZJ4A 4C7KA 1E4VA 3AV3A 5IG2A 1YXMA 3KOWA 1FDWA 3ZVNA 3BE8A 4OMCA 3DKRA 2FZCA 3GMTA 4Q1DA 2Y0BA 4JA2A 5IK2A 5KBYA 1NG9A 3DVLA 3GGSA 4WKCA 1UM8A 5EZYF 5KYYB 5AR1A 1CY0A 4O2BB 5IEJA 3CCCA 1QRRA 3C48A 3L4EA 1HTWA 4TGLA 4G5HA 5K2OA 5TX7A 2R96A 2BF7A 2VNIA 3VNVA 4H3HB 4D41A 4DCCA 2SCUA 5AO9A 4DLAA 4RTOA 1PZEA 3SS9X 3HKDB 1ZK0A 3ANLA 3OH8A 1DPGA 1TADA 2X9VA 3K53A 3FZYA 2OP0A 2HBRA 5DF1A 3IPRA 3IXQA 1KZ4A 3TTWA 4FWIB 4Q93A 2WYVA 1P0IA 1OWOA 1VHJA 2EDAA 5FUVA 5FBHA 1U2GC 4KXXA 2BGJA 5HE9A 3ZWMA 4ZJUA 1ZD4A 2DQYA 4MQBA 4OGLA 3KU4A 2X7XA 4W9MC 4MQMA 1RXYA 4YV2A 2F8MA 2EARA 2WSMA 3A6FA 3DXFA 3F5SA 4TYPA 3QELB 4TTRA 1F51E 3FCYA 2AL7A 5BVHA 3O38A 1ZXLA 1BX1A 1YZGA 2ACKA 3G49A 1MDBA 4YPOA 1D04A 1RYDA 1UANA 3AXTA 1T2UA 3JZMA 2E89A 4BO7A 3BWMA 3CFYA 3AM3A 2C58A 3VOBA 2I78A 1FDOA 3OD5A 2W0SA 4F97A 4MWBA 3MMXA 3FE2A 5ICSA 1GPH1 4JGBA 1KBQA 4L4ZA 3F3YA 3H05A 2A0FA 4X0EA 4RGBA 4ZYXA 1WMSA 5K05A 1KI3A 2VHTA 4ZYUA 2QV7A 3TMYA 5IJ9A 4QE3A 1XRPA 5ALXA 3OTGA 3SCZA 1NW3A 3BH6A 3DNPA 4KO3S 4R9NA 3P0HA 3BMCA 3R7DA 2UZ1A 3NGMA 4U7GA 1SEPA 2WIBA 4P80A 3UTDA 3WIBA 1UZUA 2RGYA 5EJEA 2PXAA 3RUHA 2V0NA 1NBMD 3H3JA 4TKUA 2EERA 4QU9A 4RSRA 5LXTA 1C3VA 4JV5B 1AM4D 1SOAA 2V8OA 1KARA 1PFQA 5EXTA 3H2ZA 1ZESA 2CEKA 3AUUA 1TYZA 1J6UA 1ORHA 3NHUA 2F3QA 1TUGA 2OGSA 2XZLA 1N6HA 2WM8A 5E9QA 3L40A 2HSEA 2W0MA 2CV1A 3D3KA 1KK1A 2VDOB 2YOFA 2FEAA 5J63A 5KJEA 5KDOA 4N3GA 4ZCMA 4OLBA 2RAPA 4FILA 2IHZA 1WV1A 2RK6A 4WZAE 4JVSB 2UYHA 1XRLA 2PKYX 1NVGA 1EE2A 4PS0A 2X9LA 2IYTA 3UEOA 2ZYUX 2BFDB 1ZMBA 4DSUA 2CL0X 1GYQA 3UIEA 3ZNQA 4LOKA 3OQVA 3T1YB 3L0CA 1N2SA 3JU3A 5COBA 1O6ZA 3OP4A 2OC9A 2IH5A 4FDLA 3G9ZA 3NDRA 2VF5X 4XEHA 2BM0A 4KVZA 2QM8A 5F35A 3RKSA 1KH1A 4F5DA 2P2SA 4D9KA 2B8EA 1AURA 2EFEB 3N7AA 3RFUA 1Y7TA 1WKBA 1VKZA 1VL5A 2COEA 1WVGA 1VXOA 2OR3A 4IX1A 1JHOA 4PLHA 5G02A 3FMIA 4Z2YA 1NI4B 3RJMA 3OOJA 4DIBA 1PO7A 4CF4A 3KT0A 1FRNA 5L6LB 4KQ2A 4BMOB 1FFYA 2O5CA 4I8IA 1VCMA 3MERA 5JSKA 4DNOA 1OYWA 4ENWA 5G40A 4P92A 1BJKA 5AW6A 1OVGA 4JLSA 3UKJA 3W9SA 1AB6A 3OICA 3OESA 2OG2A 1UDAA 3WLFA 1XCPA 1GGMA 5AUPB 1RLMA 3ZWQA 3BIFA 3JPWA 4TYWA 1UQTA 4XR9A 1ISIA 5K8UA 4X66B 1AD2A 1JHRA 1RYHA 5ESWA 1U0EA 1GAJA 2QLFA 4NONA 3SVLA 1MO3A 1T9HA 1DZ3A 2PAFA 3CUEF 5B58T 1SUFA 4DLNA 2FDRA 3K1TA 2AE2A 3HP7A 3OQHA 5KWJA 2GJKA 3QELA 1A50B 3V4RA 2NUTB 2O3RA 1KMHA 4INOA 4MWTA 3DFFA 3N0TA 4WD3A 1G5PA 2DFDA 1YR1A 2H1VA 1KRHA 1V8PA 3DHNA 3O47A 4IIYA 1FA9A 1TF7A 2OG1A 2XWJI 3V48A 4ZHQF 2O59A 1TK2A 3E1GA 4RAOA 2ZJ7A 2F3TA 2SNIE 2I29A 1S4QA 2ADMA 4X7RA 2J0VA 4WXYB 3L92A 3E8XA 1QRAA 3I01M 3N6VA 4L9WA 3QU2A 5DH9A 2A58A 3RIEA 4ZYLA 1OLUB 1PS9A 3KQTA 1ZUD1 4B46A 4F56A 2CUTA 5AKLA 1P74A 2B4RO 3RIYA 2JHFA 1YZVA 3ROTA 3VOSA 4YCNA 4LJ4A 1WB4A 4QOFA 4KIUA 4ZICA 3DR3A 3G5AA 4R2MA 3ISTA 3CUSA 1JIXA 2YQZA 2VBCA 1KA9H 2PRIA 3KEFA 3KFXA 3Q9SA 4IIJF 4KB5A 5EMLA 3GLFA 2AFRA 2R84A 3GA7A 2CJYA 2H1IA 3ENVA 3THRA 3OPMA 4ZT5A 4C7MA 3CKMA 3WL3A 4EG7A 5KDDA 3NH9A 4Y2SA 5G0WA 4BP8A 2QQ0A 3LPNA 4E5DA 2WYUA 2WMNB 2ZETA 2X9NA 3AH8A 1W5TA 3EXIB 4W9NC 4DQKA 3JAMA 1FTYA 3RE1A 5I7RA 3AG5A 1I10A 3L4BA 4GR9A 2PT5A 1BX0A 4OAQA 1YD7A 3LCUA 1OAOA 3L6RA 2CYBA 1B6SA 1OMOA 2A86A 1NQOA 2C2WA 2VZEA 4L9AA 4OHCA 4P82A 1L5HB 2VPPA 4Q3OA 1A0OA 3IQFA 3AVUA 3SJBA 2YYSA 2Z4RA 4WDRA 2APJA 3KD3A 4D44A 3SSNA 1I4LD 1JJIA 2PD3A 2H2DA 4X6UA 3AU8A 1Q6YA 1OFIA 3O3OB 2Q3DA 3IIKA 1Z5NA 4FDMA 4R7GA 5KREA 4JUFA 4MUYA 3DWGA 2C4NA 1ULUA 4XOUA 3V33A 4FW9A 4Z4IA 2O2SA 4U5XA 3OPYA 4J91A 1KFJB 3MGCA 3PIIA 2AKAB 2D2XA 4WA8A 1XHFA 4TYYA 1GAQA 1ZAYA 1R4MA 5FD8A 3T1NA 4DF3A 1RADA 4I9NA 1L4EA 4RY8A 1J8YF 2Z6QA 1NC1A 4Y7DA 3CZPA 4J1TC 3PGLA 3I4CA 1Q5PA 4IFTA 1LV8A 4K86A 1N2IA 3HKEB 3GLIB 4LDJA 4DIFA 1P1CA 3G7NA 1PJQA 4HTAA 4J43A 1CPYA 1ODKA 1SG9A 5DLDA 1RPJA 3KCNA 4E70A 2BW0A 4YJ2B 1J1UA 4NVRA 4IDHA 2C59A 4F6RA 3S2YA 2HMSA 3HCNA 1JTEA 1UXIA 4V1CB 4YAJA 3ETGA 1BNCA 2VK4A 2ZVDA 5HHTA 3KCQA 3NIWA 3H1BA 4GNRA 3ILXA 1DCKA 2QPAA 4GOLD 3UOGA 3KE9A 5CD9A 1JU4A 1G6KA 5FADA 2HV9A 4JLMA 1UADA 1J0XO 3GP3A 4LHVA 3SKXA 4RK1A 1YZHA 3HVUA 3R7NA 1WDWB 3QKSB 3LC0A 4KQHA 4MIYA 5JAIA 2LKCA 3PUIA 1AUPA 2ZI7A 2GCNA 2CVQA 3V8VA 2IYEA 4JJ4A 5LMCA 5TEVA 5C8XA 1QB8A 5JVDF 5K20A 1YQXA 2IW3A 3W2GA 5E7MA 1G21E 5FHQA 1QYCA 1UEXC 2YRFA 3P2JA 3ZXYA 4Q7JB 3ITEA 1Z26A 2XRFA 4U2EA 1I3MA 2NZYA 3RDPA 4BS9A 3H1FA 3ZE9A 5BXYA 2ZUDA 3L0BA 3P71T 4IJ6A 4XFDA 3CT6A 3O74A 3EEQA 3KB8A 3GEEA 2Y9MB 4DR2B 2X7JA 5KYWA 5F2NA 3LBHA 3SC2B 4OLJA 3PF8A 4J7UA 3HBJA 1TQ4A 4Q1FA 1EESA 4C21A 1HEUA 2NT3A 4MI9A 2WWYA 2DPHA 1K2VN 1L5WA 5IAEA 1ABFA 1SOUA 4IIHA 2Z8YA 3GVXA 4OYHA 4B40A 3C7DB 2K7FA 2RHLA 3F6RA 4W6QA 1VECA 2XTAA 5H3LA 5AW7A 5BQ5A 1IQUA 1B73A 1J90A 5EE3A 4EFDA 3KETA 1DMRA 3K72B 3VQTA 3HY3A 1T8PA 4L3OA 3WYNA 3HI4A 2VCYA 4ITVA 3PTZA 4QZVA 3LY8A 2FRDA 4LYFA 3SPXA 4K2AA 3HCRA 3PWTA 2OL4A 4XQ0A 2ZTUA 4UTRA 4ZVNA 1HE4A 3H0CA 4JDUA 2R2GA 4AJ2A 1CUZA 2HF2A 1SG0A 4QHSA 1B14A 1D2HA 3LQ1A 1USKA 3CJQA 1RBYA 1E0SA 3L4SO 3LFTA 2WZQA 3M6LA 1A9TA 3RC7A 4BUCA 4CL2A 3BN3A 4D25A 2BMAA 3NJ4A 1VIMA 3FPGA 4UTPA 3ETHA 4X44A 2ZRHA 1T5TA 4MPRA 1U5BA 2EKPA 5M3BA 4AN1A 2H2GA 4RORA 4D9JA 2XH8A 1E59A 2DE0X 3EPKA 1J39A 4WECA 1L7EA 3A4YA 3PQ4A 3QVLA 4ZVKA 2ONJA 3C7KA 1NJFA 1T24A 3VO2A 3VRHA 1FFDA 4IZHA 2AZ4A 1ULZA 2HRZA 3KYIB 3PL5A 4WK0B 3TO5A 1C1XA 3EVEA 1DOAA 1AGRA 2D8MA 3SOZA 4IYRA 2IZ7A 4KW7A 1RWVA 5TSDA 4TM7A 5TT0A 3TPZA 1RMTA 5CT5A 3X43A 1BA2A 3CHYA 2VK2A 3E48A 1Y3CE 3OE5A 3KKPA 2N42A 3QJGA 2D1FA 5E6RA 1U99A 2OKGA 3B1JA 1ZVJA 3QBJA 5FPTA 3PG5A 5K3SA 4BLPA 1O6GA 1G2IA 2HK8A 2X14A 3R0JA 1V0JA 1Z34A 4QOGA 4YMWA 2CHUA 4R0MA 1DDIA 3TTTA 3KHKA 1SHLA 1H2YA 5FX2A 3E9DA 3AF4A 4F46A 1J9EA 1WXDA 1XP5A 2JGKA 5EQJB 1XN1A 1Z0ZA 1VIVA 1PT9A 1KJYA 4JJEA 3AESA 3R7SA 4OTZA 4DB2A 4M6WB 1Y6JA 3UY4A 1E9CA 1ORDA 2R1ZA 2Z0MA 3LLMA 1MF7A 5C5DA 1OB5A 1MAAA 4PIMA 4L78A 4L73A 2AOUB 1NXSA 1AQ6A 5HMLA 1TL7C 1ZBDA 4YYEA 2IYXA 1BW9B 3DV9A 3RUCA 4AUEA 5JFTA 1VPWA 1GKIA 4FYMA 4INZA 1VE9A 3GYBA 2Q3HA 4Y2RA 4KFRA 1WMEA 2CNLA 3TTVA 1NSTA 2XNDD 4TVKA 1DXOA 2JH9A 2B1RA 4YCMA 1XHEA 2A9KA 1XD8A 2FQQA 2CZCA 3BB3A 3SZLA 1NU6A 4RELA 3MJSA 5EL0A 1R64A 1RAHA 4ZXFA 4RBNA 4UULA 2IYAA 2QRZA 1Z9BA 1V3VA 2R62A 3SS8A 4F2DA 5LNK6 1J8VA 2N0SA 1KGDA 1T8RA 4GLOA 1OZAA 2E6UX 2I1QA 1V9SA 3CYFA 3IBYA 2DRIA 2YFQA 1SO8A 1C80A 1NBOA 2ZW9A 2BEJA 3KDAA 1U81A 3L1VA 2F3PA 4NYJQ 3DOOA 4RD0A 4DLYA 5G1NA 2ORYA 5EESA 4QPZA 5K6AA 3TB4A 3PFFA 2O8FB 3PYXA 4ZVRA 4C4XA 1YJQA 1QO7A 2H0AA 3NHFA 4PBTA 4CDGA 4FC6A 3MA0A 1PZHA 5EQFA 5LA6F 2RI0A 1RWKA 3DKKA 1DIRA 2XODA 3WNCA 2D4AA 1E2GA 1BMFD 1VG8A 1ZW1A 1FK8A 1O95A 1ISRA 1P60A 2ZAIA 3QKIA 4J90A 4MS4B 2X8WA 4OB6A 3HKEA 5I9LA 5DNYB 3OZGA 3GLIA 2ZWMA 3GA0A 3U81A 1X13A 1CQPA 3W3AH 2A9RA 1ZAKA 2Q5OA 2Z5VA 4ZKEA 5C5EA 2RH4A 3GFQA 4ZO4A 2FP4B 4MLZA 1AZTA 2HJ9A 1MC8A 2RG7A 3WBBA 4AJHA 1G17A 3LCCA 2HMVA 3WQRA 4LXTA 4LWQA 1ODFA 1CUYA 1ACMA 3CZ9A 3I8XA 3O8QA 1DFHA 5AVKA 3M5CA 2JFZA 3RU7A 1ECPA 1RYFA 2QSJA 3D3WB 3L7DA 4DIKA 4EX6A 1OZHA 1RYMA 1YZYA 5H3HA 1BXRB 3TDMA 4TQ9A 3KQKA 1N4DA 1OH7A 2PRZA 1R6VA 5ALUA 1TJ3A 5JVDB 2BM9A 3BJRA 4I55A 5BNWA 1FU8A 1J06A 1PR2A 1TFRA 3CZ4A 4KBYA 3KLMX 5F2OA 4GP6A 4KLNA 1GPYA 3MTAA 4DPLA 1TQ6A 2OKCA 3K9HA 1IBKB 3GH3A 1W85B 1XZNA 4N40A 3QVGA 1U2GA 5HP4A 3HBMA 1EUDB 1HZJA 1W581 2P2DA 1KBZA 1K5GA 3CF6R 4CMGA 1EK6A 2JGDA 4YO7A 4L2IB 4M46A 5CBKA 5LOVF 3ZU5A 4ZAWA 3RVNA 4BP3A 5EVCA 1HF3A 1ZXXA 3DLPX 2VAXA 2HMAA 2ZBGA 3CRRA 4W5JA 5C46F 1U2DA 4RA9A 3NYQA 4OQFA 2O2XA 2EW8A 4LF4B 3FPCA 2RI6A 2H85A 3DLAA 4FSHA 1WCIB 3RTEA 1NMXA 2OHVA 4C30A 4CG0A 2Z08A 4EJ2A 3TW6A 1B7GO 3CG4A 5GM2A 1ZBQA 3SEFA 1F7UA 4V1CI 3ZD6A 4GNKA 3C6ZA 4JOQA 2GZDA 3UM9A 1ND5A 4R81A 2XAAA 2ENUA 2DHEA 4IJVA 1RXSA 1E6KA 1OJ7A 4DLBA 4TXNA 2PPVA 4O2AB 1U9JA 1CQJB 1TAQA 2XVMA 4PU0A 4M1MA 4TQUS 1BFDA 3NS7A 2GQ0A 2Z57A 1Z4QA 4GOOD 4MUKA 5I7OA 1AY0A 1YZKA 2OILA 3A1WA 2FSVA 4YV1A 2O7VA 3HFSA 1YNOA 3IUEA 1QNLA 3P27A 4R01A 4WN9A 4Y2JA 1LX7A 5FWAA 4DMMA 2QXTA 4HXGA 4EW1A 4YRSA 5KQRA 1YL7A 4CIYA 2WFAA 1ZQ1A 4DV0B 4MICA 2PGOA 3E23A 3BK1A 2WF6A 2E87A 1OWNA 1L9XA 1EFPB 1N36B 2EJBA 1TC1A 2B7CA 3COPA 3OIGA 3QZUA 4Q3EA 1G98A 1NHGA 4R0NA 4NKRA 4C4AA 4S35A 1EQAA 1VLJA 3H5AA 3LPMA 3MCWA 5DP2A 3RWMB 4EY5A 2IHUA 2IPMA 4J2TA 1E5LA 4P32A 1MB9A 3BA6A 3AR8A 2P2NA 4HGPA 5DLYA 3CM0A 2DSNA 5FUBA 1U7DA 1CJUC 4UCQA 3ZDXB 1I1NA 2CB9A 3W0LB 2V7EA 4JP2A 5EY5B 1LBQA 2UVQA 2L82A 2LDXA 4O4HF 5EHQA 2H1OA 3KB1A 1U63A 3AHGA 1UJNA 4HFMA 4MQUA 1FY2A 4QUKA 4V24A 1NVVR 3TJRA 2OLJA 2FW8A 3B9RA 4Y2UA 2OYRA 4BKMA 3T52A 3FOEC 3IMEA 2JKZA 2P4HX 3HU2A 3NTQA 1PDWA 2EFYA 2QD4A 2R7AA 3D1VA 3IAHA 2AXQA 2XOKD 3ESAA 1M67A 2HWKA 4PZCA 3RU9A 4OQZA 1HFEL 1BH2A 3P4YA 2XNDA 1MV5A 4PZAA 4GVPA 3UYLA 3A1TA 3PXEA 2C9YA 3KZXA 4URWR 5EIWA 2VZLA 3PENA 4FX2A 3EC2A 2NUPA 3AHFA 3AESB 4ZV4A 1OFVA 1XEFA 4AJ1A 4UD2A 1P1FA 5FF9A 4BFUA 1DO8A 1SWVA 2ZRNA 1JHDA 3EGVA 4NU8X 5EI5A 1H93A 1Z13A 4YAUA 3VVLA 5KIAA 5LZ4A 1VFNA 1FF9A 3AHCA 1ORRA 1ZMXA 1EX9A 5EC8A 3UJAA 3VTAA 3ZK8A 5EMKA 1FFEA 3D6FA 3PQDA 3H8WA 1E3DA 5EXXA 4DDMA 4F9EA 4C3VA 2QSYA 1JQLB 3HBLA 4MR7B 4MRSA 3R8FA 2R6FA 2VYNA 3QPCA 4BQQA 4YRPA 4ARIA 3ON5A 1D3AA 2WHPA 4X3CA 1ZP6A 3LUKA 1COWD 1T1EA 5DBHX 4X63A 2OCPA 1E1LA 2YV2A 4XAQA 1P2UA 4ZT4A 3J81k 4LXYA 4Z0HO 4D4MA 1I1OA 2XNSA 4W4TA 1S9DA 1NG1A 4EY7A 2ATIA 2BMJA 1UPFA 2ZSDA 3GD5A 3ILHA 3JQ7A 1V9CA 3IJPA 1LBEA 5JH7B 4IQ8A 1OI2A 4LDPA 3DMTC 1WKCA 2XD9A 1IY9A 3R4CA 4ZQIA 4C6TA 3I76A 5HTKA 5JMTA 3IJEB 1KJZA 3ONNA 5FLKA 1EEXB 1G9TA 3H9JA 2I4NA 4YJ3F 1TEVA 2BTQA 3RC2A 2PWAA 2YZGA 2RARA 3AF1A 4CBVA 5K09A 3LAWA 5JWHA 5HQJA 1PDOA 5EUCA 2HRRA 3PC8A 4PHFA 1H23A 1ZH6A 2W6PA 4MS4A 1K89A 1GGKA 3BAZA 1NVTA 2BMVA 3JR3A 4HB3A 5HUQA 4PCAA 3TNDA 1Y5NA 1BS1A 3RQSA 2VSFA 1QH9A 3DUWA 1IEXA 3KL4A 2AT1A 3HACA 5E95A 4XM1A 3WGMA 1LBTA 1BE0A 5BQ3A 1XROA 5AVTA 2PZFA 5ADHA 4AP5A 1N3BA 4W1QA 4DQ0A 3AF3A 5LFAA 2J5XA 1ML4A 4ZJYA 4OOFA 2VHWA 3BAFA 1FRVA 2IPNA 2C84A 3F9CA 3FN4A 5F52A 2NPFA 3U37A 1MDFA 2ZSUA 3BWEA 1M2HA 2Y1OA 1T0UA 1YK1A 4I6EA 4HHEA 3T0FA 2VDMB 3O92A 4BQIA 1HE1C 4X1IA 3M5PA 2ZUCA 3EOAI 4M1KA 4MLDA 2IEYA 3PFCA 4OUDA 1Z7EA 3ESCA 1SUEA 2GARA 3H86A 2PMKA 4NENA 3T5AA 5BW8A 1FYWA 2AVNA 3RVPA 3GLUA 4DA7A 3AL2A 4V2IA 4A10A 3HFGA 2EHJA 1PTJC 1CDEA 1F0PA 2G82A 3AOGA 4GF5A 2VT7A 4YASA 5ARCA 4H16A 4B83A 4ITRC 2ZJ6A 4KV9A 4UAUA 2Y68A 3S7TA 9ABPA 2FX5A 3C7TA 2O4UX 5L3RA 1LDEA 1XVAA 3ORRA 4IOLA 1WXEA 3KELA 4DQDA 1SHJA 1VLZA 5ICFA 2D54A 2IY9A 4EHAA 1QQBA 3A4NA 4HWKA 3O95A 4CLEA 1JR6A 1KSFX 2QTHA 3IXLA 5E4TA 2C9BA 3PUKA 2UXCB 2QD2A 2PCJA 1JA1A 2DBQA 1Q1EA 3TVDA 2R4QA 1W9MA 3MD0A 4LRYA 3IPAA 1TRHA 2W2TA 1A9SA 2A84A 3IQDB 3PRYA 4NU5A 3DE5X 4NV0A 5D3ZA 5HJEA 1XX6A 4RZIA 4HQNA 3IT3A 3FLAA 4KVGA 1UEJA 2ZSBA 3KT6A 4OSEA 3EEFA 4EELA 1HURA 5K0CA 3CY6A 3R9WA 4TMYA 3NYIA 3VNUA 1QHHB 3EW7A 4N3NA 4G5RA 3VHXB 2HJSA 5AW2A 4BVBA 4N0PA 4XSVA 5ALGA 4MR7A 8GPBA 4Y18A 5CLHA 1CIPA 4IIJB 4CEJA 3RSZA 2Q2VA 5LMUB 3X3HA 5C1BA 1HLFA 1RLJA 2EG5A 2ZITA 5AKZA 4TS1A 1D4AA 1ULBA 4J0FA 3E1SA 4PZZA 3W6NA 3ZXXA 1QO0D 2CWDA 3QEBZ 1WETA 1VSUA 2MSLA 2VHUA 4FW8A 4L5YA 4RGQA 4TRJA 4IZIA 1KAGA 1UBOS 2ZT7A 3GL9A 2G70A 2VRWA 3L0ZA 3QE0A 4GZLA 2OENG 2V6GA 1R12A 2VI5A 4M1OA 5AOAA 4LBWA 2Q28A 4EYOA 2CVZA 3RRXA 4MDHA 1U7OA 1VJRA 3AUKA 2NVOA 4GAEA 3JZAA 3E27A 1JVSA 3IMGA 4I3GA 4CF7A 1NATA 1AMNA 3ROMA 1UOQA 1XTZA 3QJ5A 1BWSA 4MGYR 1SUIA 4W8GA 2B0CA 2PWPA 5ALEA 5FFMA 3TLZA 1HRKA 5IF3A 3O8RA 2A67A 4V39A 1ZGCA 2W8ZA 4R9SA 3PDIA 3MAAC 3ZQJA 1ZWKA 3ETJA 3N8IA 3PQCA 3QNMA 1W34A 2WJAA 3USZA 4HH1A 4PLCA 5K0FA 4DLZA 4RDXA 3D8SA 4JHXA 4BAZA 1X3LA 1LV7A 1W2WB 3N2YA 3PDHA 2IZOA 4HMQA 4JFRA 4K8RB 2FFAA 2J46A 3FZEA 5HE8A 4CM4B 2A33A 2O2DA 4M9SA 1HR0B 1FP4A 5AJZA 3W5AA 1JFVA 3DFKA 5DFAA 5I01A 4F12A 1R3DA 2I1VB 2GCPA 2IHBA 2ZJ3A 1CT9A 2FWIA 1KAHA 1BU8A 1OQAA 1CR4A 2A30A 3E5NA 3OEHA 3UJ7A 2DT5A 1LS1A 1PZGA 1CY2A 3SSOA 3A27A 3RB8A 4FINA 3T5GA 1U2SA 4TYMA 3DV2A 3NRJA 3RHSA 1C0KA 1HE3A 1O57A 3HCOA 3NI2A 1NT2A 1V6SA 3WB1A 4NENB 4CTKA 2EX4A 4K81B 1AQNA 1GADO 3ESYA 3C6MA 2QX9A 1WXXA 1DJPA 2QLBA 5HZKA 1SAYA 3MFQA 4XX1A 4Y6OA 2DBRA 1B23P 4PZLA 2YWDA 3LCMA 4EO4A 3M6XA 4LZNA 1C3OA 2H4XA 5D5HA 3JD4A 4UZSA 1Z22A 5F3RA 1EVKA 4E1BA 3CZCA 1E1QA 5DI9A 3WLEA 3GFBA 3KTAB 5IUNC 4NARA 1N1GA 4Q9HA 3RRJA 4AS2A 4Z2AA 3PFIA 4E5NA 3KM0A 2CD9A 3AB7A 3PX3A 3RSLA 2I7TA 3EIFA 3UMCA 1FNNA 4YAIA 2XRMA 4RD4A 5JH7A 4AI6A 4ENRA 1NRXA 2I9PA 5ER6A 3AI2A 2EFHB 3AZQA 4DJDC 4BVJA 1N0HA 4E2FA 1HOTA 3HCPA 1OV4A 3L6OO 4KSYA 2BTQB 5H83A 3DXYA 4N8EA 1HI9A 3QH4A 2G7MC 4LF6B 1A7JA 4AJNA 5TF0A 3CPJB 1E69A 2QMHA 3F6BX 1VKHA 4L8YA 3FHOA 1E3IA 3QSGA 1XEXA 4EQ6B 1O97D 2EKZA 3N2ZB 5JSQA 3M9XA 4CDMA 1DEKA 3U26A 3VC1A 3EC7A 3QLVC 4ZQHA 4NBTA 4UU0A 1X1BA 4CCYA 1H5UA 1DOZA 1NVDA 2D2VA 3AL3A 3EAGA 3WLHA 2OLKA 2NU6A 5B1DA 2BVNA 5IXYA 4N41A 1JW9B 4G9GA 4LBVA 3PX2A 4DR6B 4OHKA 1E3TA 5EHIA 3H2YA 1XLVA 1G8KA 2J6CA 1P3Y1 5EINA 4BTLA 1GWNA 1NJ1A 4OI4A 1IXRC 1XN4A 1M8FA 2QPTA 4CNQA 3QU7A 1DTWB 4YRQA 1JR3E 1U1EA 5G3YA 1G19A 1NXWA 4HTFA 1KU0A 3V8BA 3WAKA 3AR5A 4D3XA 1U65A 4UTVA 2GXAA 4CL0A 1QNFA 1I2BA 1S2OA 3DS8A 4M9QA 1JYSA 2YFKA 4CW7A 2PFKA 5F78A 2RKWA 2X5JO 4ICIA 1ZW6A 4AX8A 1N0UA 3B5EA 4AY2A 2YJ4A 1PR6A 3GELA 1QHNA 2GLXA 3U44A 4QD3A 5SZHB 4AY5A 4PBSA 1ZC3A 2QNBA 3Q2OA 3FMPB 1Z25A 4HDSA 3GX1A 1P1KA 4AD8A 4DMFA 2V59A 3CNQS 1NWCA 3B89A 4I46A 5EIXA 4G5GA 2JFQA 5EJ9A 1HT2E 4L8WB 2D13A 1E2LA 1H2BA 1NN0A 1QG0A 1V2HE 5KEIA 3LL4A 1W4RA 7REQB 1SXQA 3L2OB 1B1CA 1E7RA 1TU4A 4AMUA 3WGVA 3E9YA 5IUJC 1AKWA 5DZSA 4AQ7A 3W7VA 1L3IA 2X22A 1A77A 2ZS7A 4V0QA 1IN6A 4NZMA 5BW6B 3RYIB 5C7YA 2CLFB 1BDIA 3P0FA 3HLYA 4FCVA 1OGYA 1GZ6A 4ZOLF 1NLUA 1WZIA 3U4QB 1Y0BA 2QT1A 4Q3AA 1YTLA 4M60A 4BQEA 1PL7A 4IIJA 2HPZA 4NY1A 4BO4A 1G7SA 1XYGA 2QUAA 2TMYA 4B6FA 1NMYA 4BQSA 5FPKA 3CX3A 1C3OB 2YXDA 4JJKA 4RZ2A 4Q9AA 4WW0A 2PZKA 2WU1A 4WRRA 1O96B 2XRYA 4AICA 4YMLA 4DSNA 3S1SA 1E58A 1Z35A 4L5JA 3T06B 4BNIA 5AVSA 2OO5A 4JKYA 4EMBA 2IEGA 3GRRA 3TXAA 3CXUA 3V4LA 1MO5A 4KN9S 4C08A 2JZOA 1U2PA 1FFAA 2GNAA 3G5UA 4FDVA 3UT0A 1TTPB 1NBME 5INTA 5KINB 2FMKA 2WT4A 4WACA 2VF4X 4Q6BA 3O26A 2VJDA 4IH9A 3WGGA 5CCEA 3AFHA 2ESRA 2Q29A 5FTLA 5AI0A 1B0UA 1O95C 1V39A 1Z4LA 3CEAA 4JLPA 1KI7A 3BWCA 5AIBA 4UTNA 2W71A 2X9GA 4S05A 1QQ5A 1MGPA 2H7CA 4WI1A 1PG5A 3MAJA 1U0NA 3ZW7A 3QFRA 2RGGA 5JLJA 1UBRS 3O7MA 2EZ8A 2GBLC 2XUJA 2RGWA 3EIXA 4RIHA 1KDZA 4CKEB 5B37A 1PT6A 3EIOA 4XWOA 2YKGA 3IP3A 5CGZA 5KI6A 3IE0A 2Y1WA 2BKUA 2VAWA 4M38A 4R7ZA 1UBNA 1YZ3A 1FUKA 2IHVA 1FP7A 1OU4A 4P3KA 4B7ZA 2HPAA 1F6DA 2QQEA 2WLTA 2VPIA 4YTEA 4ZU3A 4K87A 3A11A 3K5IA 1Z7BA 1QAOA 2C29D 2JH3A 1E7SA 2DQZA 2VDUE 1TM5E 3U9SA 4A91A 5HQ3A 2ZLBA 1KP3A 5KOYA 2D5CA 1CFJA 3F73A 1F0KA 2DFPA 2PQ6A 2DEUA 1UPCA 5CFOA 6ABPA 3EH1A 3FJOA 1S3FA 2ZRAA 2J3LA 2GAIA 5I7WA 4IJKA 1V7PC 1N7JA 1XTVA 4AN0A 4ZOBA 1YC5A 3BQ9A 5A7GA 4NDZA 2JZNA 5JS1A 3O1LA 1TTHA 2QQGA 4GU5A 3LCJA 4LNAA 1C9NA 4OFXA 2P8JA 2YC4C 3FTDA 4LXUA 2HK7A 5DIFA 5HR5A 4ZAYA 4DXHA 4CDNA 3K73O 2NSLA 1TF2A 2CVOA 2IK8A 2AKEA 1LEHA 3NOVA 2QN7A 4BYMA 4BKUA 3AZPA 4JS0A 4QL3A 3FLMA 2GJ8A 4RAQA 1UFOA 3MBIA 2GCOA 2XZOA 1JIQA 3QVOA 4TPKA 4GLBA 1FVFA 2AH5A 1R9NA 3LOPA 3G0HA 3CTPA 4YJFB 3LZCA 1JIJA 3OKFA 2QVYX 2QM3A 2C3UA 2OBNA 3S8YA 3NDPA 4QU0A 3CCBA 3PICA 1Z06A 2CE2X 2FSPA 3DR5A 2R8EA 3HKDA 3L02A 2RAVA 4HJXA 4I1YA 4I81A 4O4IF 3NDBB 3KV1A 1VB3A 3R5JA 2V54A 3QIAA 2FPGA 3A3PA 3ASZA 1SQFA 1JPJA 4FIZA 1QGUA 1SCJA 1G8YA 3NHPA 4PSUA 5CH3A 5A5DA 4WK6A 4NESA 5J4VA 1Z5UA 3OBBA 3KKOA 1YBVA 1ZN2A 3C8HA 4ARUA 4IIGA 5CB4A 3ZVLA 2J0QA 2XB6A 2Q4EA 1T8UA 3FWPA 3W7AA 1I32A 2EQAA 3DTNA 4CMEA 4HSGA 1NVMB 1WSWA 3M89A 4LJYA 3ZK9A 5A4AA 4NF2A 2DULA 4KXYA 1QYRA 1RQPA 1T0BA 2HMTA 2ERYA 3BC1A 3Q11A 2IHYA 4J8PA 4V38A 3T38A 3DOJA 3R7WB 2FN3A 2KS6A 3BCUA 2RSLA 2PZLA 4MW9A 1D07A 1IAVA 2AIRA 3EGXB 5FYDA 1SD2A 1DAFA 5EZ5A 4C3UA 4F5WA 2PWZA 4MULA 1TF5A 1FVOA 1U2RA 2YV4A 1X42A 4UEWA 1CYEA 2JJ2A 3W2FA 4YUWA 5NULA 3AKEA 2WFZA 4PTZA 3ZHBA 2H07A 4AAYA 4YUAA 3VR2A 3HA7A 1N2CB 3QXHA 3G2MA 1DTWA 2VNKA 1IH8A 3TQRA 3WOHA 4XJVA 2ACVA 1JKFA 3ILYA 2ZTHA 3VPFA 721PA 1SCUA 4YVFA 5KNDA 5K0TA 1XVTA 4EI9A 1TVCA 2WJYA 2DPMA 2YW9A 3AERA 3ZNPA 4EHIA 3W5BA 5LP6C 4ZQCB 1J2TA 2D00A 3WLQA 2OD2A 4K9KA 3GFOA 4DJAA 3M81A 3F46A 3WLTA 3F6CA 2WB4A 3MPUA 2PZEA 1G64A 1QOQB 4KYUA 5BSFA 2QVZX 4JDPA 4R2KA 4N47A 1LI5A 2AWOA 3WGOA 1BD4A 4M8KA 1VL2A 1QIDA 1TZ2A 1XCBA 1QV7A 4ND8A 3QVVA 1GPBA 4HH4A 1B15A 1YGPA 4GI1A 4TS9A 4WK4B 5E8JA 4CLHA 1MEEA 2Q46A 3AVWA 3S2UA 1O97C 3GDHA 3SIRA 3IAAA 2BEWA 3B5IA 1I0IA 4URUR 2ZTSA 1Z0FA 4KO1S 3OQNA 3HB4X 3OP1A 4FYJA 2KM1A 3NAQA 2ZUFA 1MMFB 5ALNA 2QYOA 2K87A 3GLRA 1FNBA 2E55A 2ZE7A 3FNQA 1V8BA 3A1DA 2LTAA 3L8HA 1KEKA 1X7WB 1COZA 3OHPA 4J0QA 3CUYA 4UHEA 4X54A 4BBPA 1GLVA 1Z0IA 1N25A 3H6GA 4HG2A 5G4KB 4F2GA 1RE1A 3EULA 2VBIA 3F5MA 4DCVA 2H65A 2I03A 3PHBE 3ICPA 1OXVA 1XQ9A 1SPXA 3KJIA 4YRFA 3WMEA 1Z3IX 3DMRA 4OU5A 2MSDB 4M9CA 2I65A 2SHKA 1DWQA 1KP9A 4Y2QA 1NE7A 1OX4B 2A92A 2HK9A 2J9FB 1QZTA 3OLZA 4HWPA 4EJ6A 1IMOA 4CMHA 3D8TA 2F7SA 3FPAA 4K6FA 2PPLA 3L07A 2GEVA 1OFUX 3EF0A 4MUJA 2NXJA 1AQUA 5HMMA 3VYWA 1LRLA 1CE8A 4IQGA 3R0QA 1MO4A 1RIIA 2PH3A 2IVFA 5KX5B 3TQQA 3WLPA 2FYTA 4OP3A 4D0LB 3BORA 3FDJA 1M5RA 1RSZA 5EIEA 1GKUB 5TJHA 1QC5A 1YR2A 1XEAA 2GZAA 1QDLB 3M6UA 5CT6A 1IJKA 2JEOA 5DDIP 4EW2A 3I34X 3K9GA 3OQBA 2ECOA 4ZVSA 4EVRA 1II8B 1RM3A 3GT4A 2YRXA 1Q12A 4NR0A 1AK9A 1LPSA 1ZX1A 4CI9A 1ZGBA 3DTTA 1G59A 4KQJA 5B6JA 4DIMA 3K6RA 4V0KA 2Z83A 3FR8A 3B8EA 2VCEA 4EI8A 4MR9B 2GBIA 4RD2A 4BFLA 5AJUA 5TXGA 5K8LA 1UPXA 3CVWA 4CIXA 4C0BA 1N5JA 4BCDA 4WLVA 1W36D 1HYQA 3OX3A 3TQSA 2WWHA 4GKAA 1Q7EA 3L05A 1QO0A 3WRXA 3IJ5A 1KZ1A 3O4VA 4BX3A 1FYXA 3PC7A 3RVDA 4DRZA 2BFOA 2FXVA 1PDVA 3E3OA 1OOEA 2OYSA 5AUQA 3SE0A 1N75A 1O4WA 5DYIA 2X19A 5DTJA 3TAHA 5IDQA 3GLFB 4F8EA 4WCFA 2PCLA 2AEJA 3ZQ4A 3DO5A 3OY2A 4WNCA 1X14A 2KQUA 3HU5A 4Z6KA 4JCOA 1TQ8A 3P9PA 1UINA 2A6PA 3AERB 3HZHA 3VV2A 4CT0A 2P9GA 2QR3A 1NBMA 3D7SA 4RHYA 3DZHA 4QEZA 2XKKA 3HO1A 1MVOA 2GWRA 2WV7A 2X0NA 2H92A 3GXBA 5TARA 3X2SA 5TS3A 1MB0A 1GG5A 1U5CA 1VA5A 1XFDA 2RG1A 2PDAA 3B36A 3T15A 3ORFA 4YJGB 3RK1A 1QRUA 4OX9Y 1GILA 2BWJA 3IBCA 3F8WA 5KTOA 3E9QA 3GAFA 5C3UA 5KYNA 4JJAA 5IBRA 5K8JB 2J5KA 4M9UA 3OJXA 2HY7A 2HPVA 1P0CA 4GO1A 2JIDA 5F77A 1DB3A 1Z88A 4ZVUA 5K0LA 3LXRA 3EXG1 4Q01A 1A2OA 2AX3A 5KVQA 3V1LA 2IWHA 2PZGA 1P7WA 5J59A 2FLVA 3H65A 3WYAA 4F3CA 1K5HA 2YYYA 3E05A 1K66A 4P3YA 4E46A 2Z6UA 1OI4A 3SZOA 3I9KA 4QICA 1U94A 1AF7A 1JPNA 2DHRA 2LRHA 2P40A 3EGIA 4MB0A 2XB8A 1LTQA 4LSGA 5ITZB 2HIGA 2CHFA 2RC5A 1C2YA 1V3UA 3LQYA 4HVTA 1XMJA 3WWCA 5F1OA 4BNJA 3MCAA 4FI3C 5EMJA 4BEJA 4M49A 4CQLB 3I9FA 1GTJ1 5KYWB 4OX9B 2P9FA 2CUKA 2WTXA 1P72A 3YASA 2DSTA 4ALNA 1SBYA 1Z39A 1H2XA 1DFGA 1YDFA 3AJAA 4ARSA 2CNWA 1E2DA 3BMNA 1ZNXA 2DBYA 3O4HA 3P9XA 2CFSA 2XE7A 4H7EA 4QYXA 3L1HA 5FIUA 3TQOA 2XI4A 1PLKA 3KUDA 1T1SA 4XRRA 1OGIA 1Z08A 3EGXA 3PKJA 4B7XA 1PJLA 2Q8NA 5F7JA 5C31A 3IUPA 7ABPA 2Q2OA 2HMYB 2VNHA 3H7AA 4IMPA 3T3GA 3ZHZA 1M6VA 1WOMA