3ND5A

Crystal structure of phosphopantetheine adenylyltransferase (ppat) from enterococcus faecalis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
152
Chain Sequence
b'MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 51
structure length 152
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nd5A00
1O94C 3S3TA 1QRTA 3F3MA 3SZGA 1EFPB 3ZXIA 4AS1A 4MULA 4ZCTA 2PZBA 1F4LA 1XNJA 1YULA 4JXXA 2DLCX 1O97C 3QTBA 4OUDB 4G6ZA 1MBZA 1S4MA 4EFKA 5J5AA 3SYTA 3FH0A 3IVCA 1WY5A 3IUBA 3N05A 1PFWA 2I1LA 2HZ7A 3PXUA 3CLUD 3IMCA 1MB2A 2CSXA 3FG9A 1H1TA 4KPUA 2PXHA 2QTRA 1TFUA 1MC1A 1ZUNA 1N77A 1KR2A 2G36A 3VU8A 2ZUEA 3ZUGA 1WXHA 1M8FA 1PFUA 2HMAA 4ZT2A 2ZP1A 1F7UA 1KH2A 3Q12A 3UOWA 3COZA 2GOYA 5LLTA 3PNVA 3KFLA 1PG2A 2A1UA 3RHSA 1QTQA 2PG3A 3FOCA 1OBHA 4CT0A 1KH1A 3CLSD 3DV2A 3IOBA 3HFJA 1KQNA 3UC5A 1N2GA 3P0JA 4EGAA 2RE8A 1U7XA 1N2OA 3P0HA 4RUKA 2X3FA 4EG6A 1WJGA 1NUQA 2A1TS 4GRIA 1EFVA 1GZUA 1IHOA 3N2YA 2H29A 3CLRC 2CYAA 2QUIA 3H05A 5LM3A 5DB4A 3HV0A 4ND7A 2R5WA 3ZIUA 4UZEA 1B6TA 1OBCA 3E27A 3ISJA 2AZXA 1O95C 1R6XA 1COZA 2DUMA 3KT0A 4MW4A 3FNRA 3FETA 1KP3A 3GUZA 4U63A 1TYDE 1K4KA 2Z3VA 1QU2A 4WNYA 4YMIA 4DJAA 1V47A 3MXTA 1KAMA 2VTBB 1FYDA 3IOCA 1U0BB 3L92A 4PBTA 3CVYA 4XFDA 4K0RA 1NUSA 4NATA 4KR7A 1PFYA 1I6LA 1M8PA 4EG1A 2DR2A 1WKBA 4F3RA 1WXFA 4K03A 1Q19A 3AIIA 2ZUFA 4NX2A 3KT6A 4PBRA 1NI5A 1WQ4A 2BTEA 3QTTA 3Q4GA 2A1UB 1U7DA 5DK4A 4CQNA 1O94D 4R2MA 1LI5A 1LW7A 5H7XA 2XRYA 2QTMA 4HK4A 4XFJA 4PY2A 1O97D 3HMQA 4HPWA 2J07A 1ZH6A 1N2HA 4MWCA 1GTSA 2O5RA 5FO1A 2DETA 2X0KA 1OWNA 3RK0A 1N75A 1WZ2A 3DO8A 4EG8A 1K4MA 1I2DA 1T9GR 3X1MA 4DDKA 1G59A 3ND7A 3ZJVA 1J1UA 3IODA 3K9WA 3CA8A 4JYZA 3TQOA 2CV1A 4AQ7A 1PFVA 2A84A 5TEWA 1MAUA 4YP5A 2OQ2A 2CUZA 2YWBA 1JECA 3PNBA 4MVYA 1NUTA 1WXGA 1MRZA 1VLHA 2CV2A 4MW5A 3NBAA 3Q10A 1WXIA 1MJHA 3VRHA 4JFAA 4CDMA 1HYBA 4DE5A 5HUJA 4J76A 1NP7A 3TZEA 4R2LA 1QRSA 2CFOA 3ZXSA 1O96A 4I6GA 4P2BA 3CVVA 5DEOA 1MAWA 4QRDA 1O0BA 1IQRA 1YIAA 1K97A 2PZAA 1IVSA 3A05A 3X1KA 5BNZA 4MW1A 3CLRD 3AG5A 2JAXA 3SZ3A 3UK2A 4XSVA 3I05A 2J4DA 5KCMA 3ND6A 4MUEA 1BS2A 2DERA 1O95D 4MW9A 5KHAA 1YIDA 3AKZA 4ARCA 4ZT7A 1NUUA 3SEZA 1JGTA 1G8GA 1RQGA 5FO0A 3DLAA 2Z09A 1H3EA 1EE1A 3H9BA 1ULHA 1NZJA 1XNHA 4A91A 5TEVA 3FHJA 1N78A 2Z08A 2DXIA 4PBSA 3D6UA 3HZRA 4EG4A 2VXOA 3L93A 3PRHA 3OP1A 2E18A 3RK1A 1XNGA 1ZJWA 2A1TR 1JZSA 3C8ZA 3D6VA 5HUHA 3NV7A 3G59A 2X1MA 4JZYA 1YI8A 3FI0A 3INNA 3A04A 1UFVA 1N3LA 3CVXA 3COWA 3IMGA 5K0SA 5IHXA 2CV0A 5KWVA 4MUGA 3SP1A 4I6EA 3BL5A 2E89A 4YP7A 4MW7A 3ELBA 3ZJTA 4NDAA 2EL7A 5TS2A 4CDNA 1GPMA 3PNYA 3JXEA 4KPUB 3IDFA 2QUJA 2A7XA 1IH8A 2QJFA 4L2IA 1K92A 3IOEA 1Q11A 4JXZA 4ZT4A 4X0EA 4MAFA 4DNXA 3IH5A 3U1VA 3OTWA 3G6KA 1EFPA 3TZLA 4J75A 2GM3A 1TYAE 1J20A 4HJRA 1KAQA 4OUDA 1YUNA 2X1LA 1T6ZA 3TQIA 4F4HA 5J58A 1EJ2A 4E1AA 1N2JA 3HL4A 4MUNA 4RPIA 3X1JA 1JEEA 1I6KA 1EFVB 1R6UA 3SDBA 1OWMA 1X8XA 1J1ZA 3CR8A 3IVXA 4H3SA 4MVXA 2IJGX 2BYTA 4U7JA 3CLTC 1H3FA 1J21A 4QREA 2D13A 3KT8A 1KKUA 3IMEA 3IUEA 3MLBA 1H3NA 4MLPA 2QUHA 4MVCA 2CYBA 1JIIA 2WQ7A 1WQ3A 2YWCA 3N9IA 3AG6A 4DDHA 1ILEA 1JHDA 4EG5A 2YXNA 1XJQA 3ILVA 1A8HA 2AG6A 4MUKA 1JIKA 1OD6A 5TGTA 1O0CA 3AFHA 3COVA 1MB9A 1JEDA 4ZCSA 1ZH0A 4L2IB 2B7LA 4ZT3A 1YUMA 1TEZA 4G5FA 1D2RA 2WSIA 1MOPA 1N1DA 4Q93A 3SEQA 1QRUA 3N8HA 2H2AA 3M5WA 2QJOA 3TNJA 4YBRA 4GU5A 1LI7A 3TS1A 3UY4A 3KT3A 2JANA 1Y42X 4HJXA 1EUQA 1IQUA 1R6TA 4U8HA 1F9AA 1PG0A 3CVWA 1O5TA 3P52A 1JZQA 4MQ6A 4ZCRA 2HGZA 3H9CA 2A86A 3LCJA 1T6XA 1J70A 2YY5A 1V8FA 4G5YA 4NAHA 4MW6A 2VTBA 1KP2A 3MUEA 2DEUA 3ZGZA 2PFSA 3RFFA 3P0IA 2V0GA 1IFXA 4FZJA 5H16A 5FNZA 1KH3A 2QTNA 1SURA 3COYA 1GN8A 3QE4A 3HGMA 1QNFA 2QUKA 1O6BA 4EF6A 4EG3A 2CYCA 4NZPA 1M8KA 1I6MA 5EKDA 3RJZA 1N2EA 4YP6A 2QJTA 4MVWA 5LFAA 1EXDA 2D5BA 2EJCA 5DASA 1EUYA 2JA2A 1DNPA 2TS1A 5F23A 1G8HA 3A2KA 3AL0C 4MUIA 1JILA 3FDXA 1X6VA 4TS1A 3CLUC 1WOYA 4ZCQA 3FIUA 2WQ6A 1O96B 3FY4A 1F7VA 3CVUA 1KQOA 4MW0A 1GTRA 2OV4A 2PIDA 1VBMA 2GKSA 1VBNA 2C5SA 1IRXA 2IP1A 4I6JA 4DLPA 2E0IA 4DDMA 3UMVA 1Q77A 1G8FA 3NBKA 4MWEA 4S1OA 4WSOA 1TQ8A 3CLTD 3GLVA 2A88A 3ND5A 5HG0A 5J59A 3LE8A 2AKEA 1NSYA 3CLSC 1OWOA 5K0TA 3H99A 2E21A 1CT9A 1M83A 2NSYA 1M1ZA 1VL2A 1GLNA 3MLAA 4Q16A 4UZFA 2J5BA 2O8VA 3IVGA 3VGJA 2V0CA 1M8JA 1M8GA 1N2IA 2IELA 1U3DA 4BWVA 2A4MA 2D54A 1J09A 4MUFA 4ZCPA 1FFYA 1OWLA 4MWDA 4KR6A 4KR9A 1T6YA 3FWKA 1QU3A 4KKVA 1QJCA 1WXEA 2PZ8A 4R0NA 3DPIA 4MUHA 1NUPA 4MWBA 2J08A 2WB2A 1TYBE 5IJXA 1Q15A 3ZJUA 1TYCA 1OWPA 3GMIA 2J09A 4OJMX 4ARIA 1KORA 2DPLA 1P7PA 1VBKA 4EG7A 3K32A 1JMVA 1JIJA 4MW2A 1NURA 1T9GS 2NZ2A 1KQPA 4ND6A 1IQ0A 2RD2A 1QQTA 5AHWA 3MMXA 4MUJA 3A4IA 1N2BA 4QBTA 4NAUA 2CT8A 3RBAA 4ZT6A 1NYLA 3H97A 1U3CA 2XRZA 5JBNA 3G5AA 3LOQA 1GAXA 4ZT5A
chains in the Genus database with same CATH superfamily
2NV2B 3S3TA 2PQMA 2NYAA 3O90A 3F3MA 3SZGA 5JNWA 2NO6A 4KRXA 5CFZA 1ZJ5A 3GROA 4MULA 3DXZA 4POOA 1UKCA 2OMKA 4MQEB 5L3ZA 1WABA 2JC3A 3H11B 1IUOA 4QJ4A 1P77A 1V95A 2GUWA 2HV9A 4AB1A 1AQIA 3AH8A 4FM9A 1WZIA 3LLSA 1NOJA 2Q0QA 5CB8A 4CR6A 3FHLA 2O8NA 3ECAA 3HB9A 5E7JA 1Y4DE 4L8LA 4P81A 1PJTA 5F78A 3CLUD 2HU2A 2B1IA 5BUCA 4XCVA 5I7AA 1I80A 1NBWB 3MIIA 4K81B 2QTRA 4PFKA 3PPWA 4ME6A 2X6TA 1ZUNA 3DHWC 3KR0A 2WHXA 5AVQA 3KG2A 1X7WB 4DJTA 2ZETA 5I7HA 3ROEA 1WXHA 2I3GA 1O7JA 3CTPA 4Q1CA 1MZVA 2OV2A 4XCQA 4Z99A 4MNTA 1OIWA 4CG0A 8LDHA 3UOWA 1JJIA 3CLHA 1S89A 1Z07A 2P6UA 3P94A 3KXDA 1S7CA 4OQEA 5K09A 1NNEA 1QYDA 4IX9A 4H27A 3NP7A 2R5NA 1GZ4A 1NRIA 1Z17A 3TZQA 3VR2A 4GOKA 2I34A 3U5TA 2NO4A 4ZOLA 4GHWA 1ZXLA 3ZG6A 3ZX4A 5DDIP 2HIHA 1T15A 4OJNA 1N1MA 4B40A 3RJMA 1E2GA 5BV7A 3U1TA 2J0QA 2Y6VA 3OF3A 4YH1A 4HQRA 3H7AA 1UDBA 3OPQA 5G1OA 4B5LA 5IDWA 4CFSA 4QXMA 5IJZA 5C81A 1Q84A 1JEYB 4HNTA 1Z08A 2ZS9A 2A1TS 4KJXA 4FWIB 1MG0A 1XX6A 4EENA 3J81k 1W49A 3IKMB 2CYAA 2IYRA 2QUIA 1HL7A 4JLOA 2IYVA 4CDGA 1XSEA 4HNAB 4J0KA 4WKBA 3L7IA 5ESWA 1QH0A 3SIRA 5B7GA 4ENPA 1IOWA 3PJRA 2N42A 2NM0A 4ZQBA 4DIKA 4GQIA 1HETA 1PT6A 3GCWA 3KXIA 4E2XA 4L02A 2ACVA 2TECE 4RIIA 4W7HA 3VZSA 4Y7DA 3RKSA 3L0BA 2JFVA 3ESQA 1JJBA 2F3PA 3QXHA 4J9UE 2HUNA 2IXTA 5FV4A 1QOZA 5E7QA 3D0QA 3I2IA 2P9QA 4JIMA 1I14A 3H9EO 2OL4A 4BWGA 1CV2A 4C03A 4KTVE 3QA9A 2HQ1A 3WB1A 2C94A 3HKBA 3ROZA 5KO2A 1RYBA 5AJXA 5KNDA 1DZIA 1GTMA 1MIOB 1QFJA 3RS8A 4CLOB 5ICFA 3T1OA 3M6WA 5KC8A 4AZVA 1S8NA 2X3UA 1UBOS 2EBWA 3AESA 2JARA 1I6LA 2VJMB 3MBOA 4EG1A 4IZIA 4M46A 2ZVPX 1LBSA 4R5MA 2VP9A 2A8YA 2CMHA 4HPJB 5KKNB 1OPXA 1NW7A 2PJUA 1YKGA 3DE4X 4CMIB 1ZM2A 5EYPB 4D02A 2IYEA 4K8OA 4LF5B 1XRSB 4DCTA 3DB1A 1JQKA 5AXCA 4EMBA 2ZWOA 5FI5A 5H7XA 5DW0A 2Z04A 1OXUA 3WFZA 3DXXA 1YOBA 1YAHA 4J7UA 2GPYA 5HNKA 3AEUB 4LXIA 3DQPA 4IFIA 4N54A 2OG1A 3KB6A 2EZ8A 1RBZA 2XXJA 1H42A 5EWMA 4Q1DA 2N46A 2BY4A 2HDWA 3V7NA 4RTSA 2JHFA 1HE3A 5F2KA 3X1DA 3HMKA 5HX7A 4ZJUA 2XGOA 4YRTA 4NHOA 3OZEA 2RI6A 4ZZ1A 3IFSA 3K31A 4ZARA 3RLIA 1WZ2A 2TYSB 4EAAA 4D3XA 1YXMA 2H1SA 2FG6C 4PF1A 3PTZA 4ROTA 3UV6A 1ZHHA 1CRQA 2J0VA 4MOWA 3LVBA 5C8YB 3SR3A 3K9WA 5IXSA 3CZCA 3K70D 3DEKA 1F2DA 1Y0BA 3FB4A 2IZ5A 1JKMA 3FBGA 3GEPA 3AB3A 3N2LA 1ZCAA 1X7YA 4OGFA 2MU1A 1TZKA 4BKPA 5EKXA 1W1UA 4IJQA 1OR8A 1TO1E 5AK4A 5K51A 5JYBA 1OSNA 5KYVA 1OHHD 1Y5IA 5BNIA 3U7RA 3BB3A 3O1IC 3TTVA 5FF9A 1PCXA 2A2ZA 4RH1A 4IVNA 5MN5A 1XA3A 1D0IA 1H85A 4CTNA 1VGVA 1I94B 3MRXA 3WJAA 5HUJA 3TZEA 4QU9A 3VKWA 3G2IA 4R7GA 2HGSA 3EZFA 1EVKA 1FLVA 1GV0A 1T9HA 3GFPA 3QEKA 2OCKA 4ND4A 4J2OA 5EQDA 3TNYA 1HR0B 4IDBA 1WUHS 1DAIA 2C5HA 4R0VA 3WB0A 2C2MA 3A05A 2BCEA 4ZVQA 3GVHA 4CV1A 3FMGA 4Z0PA 3OF2A 3M81A 2H4WA 2Y1FA 3QENA 2V7UA 4PRZA 4QYSA 5K99A 3KOYA 3F3YA 3HL0A 3FDIA 2FVXA 3V6LA 1ISGA 2GN2A 2OESA 4PM4A 5ER6A 1WA5A 2LIVA 4WVFA 2V45A 4YMLA 1SU6A 3AKZA 1VCNA 4H16A 4RZXA 2JF0A 2CMFA 2PMCA 4M0EA 1KAGA 3O8DA 5ABPA 2BSAA 3D4OA 3DOIA 4EB3A 1D9XA 1Z47A 1GG5A 4KXXA 4ZHSA 3MT7A 1T13A 3MUNA 3BRSA 5C4GB 4RD1A 2GEJA 4IGEA 3K35A 3R3YA 3GAZA 1QKIA 3DLAA 4MVJM 3RVPA 1A0OA 4F06A 5JTUA 1VBFA 3CV3A 4X1OA 1XNHA 1VYTA 2ZTLA 3OM9A 4IOKA 1I5RA 2OZEA 3V4VB 1FXUA 1KOFA 3NHUA 3MINB 4PBSA 2F4VB 1GTZA 5GADl 2OV6A 1HTBA 1U0SY 2ZTMA 3L4JA 1PD1A 2C8KA 3FI9A 5LVAA 1ZY2A 5TMDA 3OQJA 2AKYA 4WK2B 3C8ZA 4RTJA 1K4YA 1JWAB 1OZFA 1T4DA 4FDLA 4A2PA 1TQ2A 1XD9A 4KP7A 4F96A 2OXRA 4OP3A 1KZ6A 3PB3A 1ZC3A 3R4VA 4G85A 1RCUA 2QNRA 1B73A 4LW8A 3AVVA 2I7TA 3SQMA 4QC2A 1A8QA 1KFKB 1UC4B 1VGRA 2BFDB 1G8AA 1UFVA 3A4NA 3NCTA 3P4YA 2NOAA 2XT6A 3OSZA 1JLSA 4IRMA 4JJ6A 3T3MB 4EZBA 1GL6A 3LY5A 3BL5A 4MI3A 2ZB3A 2GHTA 3DCIA 3UXMA 5DTMA 5CMLA 4YMSA 1U90A 4NG5A 4ZVOA 5MFPA 3QH4A 4C2AA 3D7RA 3IEIA 1UPBA 3OECA 5LZ5A 2C9YA 4G0ZA 5FWYB 2EEZA 4RQBA 3BRWD 2Q0SA 3DTVD 3OLVA 3BXPA 1PGNA 2HV8A 4K9DA 1E32A 3BDVA 1VCMA 2FFQA 1TNDA 4FYPA 3L3BA 1VJRA 1YZQA 2QRNA 3N8IA 1U8ZA 2O57A 1EZ4A 4R9SA 4HV4A 2F1IA 5HF9A 4AX8A 4HVCA 1AQLA 1X86B 3ADCA 4CF5A 1FJXA 2P0EA 3QVVA 1ZRMA 5IWAB 2QXTA 1SVMA 5I9NA 5KNCH 2ZI4A 3KSDO 1CRLA 2M98A 2BONA 4N5LA 1XTQA 2J9FA 1SD1A 2FXIA 4O4HA 2IUTA 3R3HA 2Q5IA 2VLBA 3RUCA 3VPHA 5TV2A 1NFFA 5LQJA 5DI3A 3TOXA 2A78A 3WQRA 4NMHA 5J2UF 1K7CA 2XF2A 4UM9B 1DPFA 3PD1A 4RPIA 4KPGA 5JQGA 2ERXA 4MYTA 2C2BA 2B1RA 2Q3LA 1JIVA 3C39A 3SDBA 1SXJC 4QRHA 1KYTA 3RIXA 3IKTA 3T7KA 3F5QA 3IVXA 5ALLA 3QM1A 4YRQA 4OXKA 3ZU2A 3ELDA 1JNYA 2XQIA 1RCTE 1TZCA 2GASA 4CEJA 2P67A 1XVIA 2I4NA 4MLPA 1FQOA 3FVRA 1XTPA 1M76A 4IWNA 4JD5A 2OGTA 1M6VB 2FUKA 1NYQA 4DMGA 5DBHX 1S3SA 1U1FA 2YWCA 1QZUA 3QLVC 2PMFA 2RHDA 5LJIA 4WY5A 3B1VA 2Z3WA 1WHSB 3QHPA 4OSPA 3WTBA 5D01A 2XUZA 1HT1E 4QXOA 1HLPA 3IAM1 1RQ2A 3FAZA 4LYEA 3DLPX 2OB2A 4HGQA 4YJ2B 1NJGA 1KKLA 5JRZA 2I8AA 1P44A 1E4EB 3SZUA 5AOCA 4E11A 2JK1A 1QCDA 1MAVA 4J2TA 2NXJA 1N4AA 5DTIA 3BXXA 2GVNA 4G63A 3AF0A 2WSIA 1ADFA 3GUUA 4HGZA 3T7TA 5DRTA 3U3DA 1FSSA 3KJGA 3O2QB 2ZJFA 4M7OA 4XLZA 5JTTA 5KDOA 1P18A 4KB5A 1XJWA 2VH1A 3DEZA 3NTRA 1D0VA 2RFLA 2OCLA 2JAWA 3U48A 1V1RA 1XEXA 4F86A 3WKCA 4RZSA 1OV4A 2QTVB 4MV5A 4MI1A 5DLDA 1ZNQO 3GLKA 1C7ZA 4KGXA 1U4OA 2PZGA 5H3LA 3T0IA 5D3ZA 3T4EA 1LNZA 2J4CA 3W6UA 3PYXA 2AVDA 1D3AA 3P9PA 2HJSA 4DZRA 4IQGA 2QT9A 4F5YA 4CF3A 2D0PB 1VOTA 2CWDA 1QORA 3NHSA 3HVUA 4MQLA 4C0LA 1EEHA 4LMAA 2NU7A 1RFGE 1EM6A 3OVMA 4AWAA 4R81A 1UBTS 2P2GA 5AOVA 5TDHA 1K7YA 1K27A 3FPBA 1R0CA 1DKMA 3C70A 1LLFA 1YVRA 4PC6A 3RV3A 3ZGOA 4PXYA 2CLSA 2B1GA 4N6OA 3B1KA 3OSUA 3OJLA 1TAGA 1E3MA 3W9UA 1H66A 1SBNE 4Q9NA 1QCCA 1LFAA 1P1KA 3UJAA 2V6JA 3GRVA 1ZZGA 4LDPA 4CQLA 1GOTA 3LQRA 4TQAA 5DASA 4WK4B 3SBEA 2UVDA 1MTOA 1N5JA 3I9NA 2OYRA 4A6XA 3KXPA 2ZRAA 4IO1A 3CRW1 4UU8A 2C2XA 2OBNA 1THZA 2KBEA 4RHUA 2HIMA 3SGLA 4B4DA 2GD1O 5IFKA 3T9AA 3KLPX 1L7BA 3DZHA 3F5DA 3KO8A 3NEJA 1UK7A 3CLUC 3VNAA 3D5TA 2R3SA 2RKOA 4G84A 2WHYA 5FR2A 3DUFB 1WVIA 1NPDA 2V7EA 1JMKC 2VP6A 2WU3A 4MO9A 1PI3A 3FTQA 2QIPA 2YV3A 1IULA 4MW0A 2ZJ2A 3ZK9A 3KKEA 2AC2A 3ZZMA 621PA 2YJZA 2WU1A 2H6EA 4BVBA 2EC5A 4KO1S 4ZOEA 2A0XA 1G2IA 1KL7A 1M5UA 2EWWA 5FPQA 1E79A 1T1IA 3T9FA 3Q3VA 3IIIA 5C8DA 3ITEA 4JJZA 4K05A 2J0SA 2XUQA 4JJIA 1XXHA 4TXNA 3RTCA 3T5CA 3EFEA 5HILA 3OQIA 3WMXA 5M2QA 3BSWA 1SKQA 4LJSA 4I4TA 4PLCA 4RYDA 5DNDA 3RVDA 2MYNA 4EHNA 1DIOB 4GUAA 3R2JA 5C4MA 2OHXA 3HCWA 4RD2A 4AMVA 3ENWA 2XUHA 2EL9A 4IJUA 3TRIA 4WX2B 4IHJF 2ZB4A 4A0RA 2WKPA 4JQOA 4FJ2A 4F8JA 5EZ5A 1OT5A 4BP9A 2D54A 3NIDB 1Z7EA 3CWZA 4GYYA 1II0A 3OI7A 1XEAA 5FORA 5LIPA 1VLQA 2PNFA 3W2GA 3COSA 4FDVA 1QJCA 4CGZA 5A6VA 3PDUA 2TMGA 1WXEA 3V2IA 3CX3A 4MUHA 1RHRA 1F2TA 1JR3D 4ZU6X 4IDAA 5B4VA 2GMWA 4AL4A 4BFYA 3SHOA 4X7RA 2H9IA 2X42A 3BTUA 4L72A 4R83A 4JB8A 5IYZA 3ZDDA 5CGZA 3VUEA 1Y8ZA 3N3AC 1H0HA 3LRTA 4RGQA 4AT1A 5BV8A 3NO4A 1W2GA 2QTAA 1EX6A 1U7OA 2PRKA 5BW6B 2QN2A 1BXKA 5DV9A 4DUGA 3GRAA 1P7PA 1KEWA 3I9MA 2GN6A 1GGFA 4R2XA 2GCPA 3TAHA 1RHJA 2BBSA 3T9CA 4ZYXA 5FWAA 1VIYA 1JPUA 1ZGCA 1HDCA 3L7DA 3TRHA 5IM4A 3NDRA 1IQ0A 2FF5A 4NYMR 2ZXUA 1QQTA 2LBPA 2BSQA 4ZOBA 2X1VA 5I6DA 2FG5A 2FMKA 2GSWA 4IXWA 8ABPA 1EUCB 1PS0A 5DOVA 4NBRA 5HIJA 3ZZTA 4ZCIA 4LHSA 1SO8A 4EUEA 1EP3B 5BSWA 1KEKA 1RLMA 1KZYC 4J4HA 5F33A 1K68A 1EDDA 3JS5A 4NCNA 1GQ2A 4HNQA 3Q7QA 5BRAA 5JW6A 1REQB 3LOQA 4R51A 1U2GC 4HAZA 3NHWA 2P69A 2WWFA 2Q5CA 1SXJA 2CCKA 4ZZ0A 2PU5A 1XMXA 2JFZA 2VAWA 1CR1A 2YINC 2WNSA 1LQ2A 3LRPA 1Y8AA 1MOSA 3PC4A 5HMMA 2G25A 1WB5A 2HF9A 2VN8A 4E1BA 4P7BA 4BKMA 5F98A 3RFXA 1YULA 4YNBA 4FB5A 8ATCA 1C4WA 2QUBA 2DLCX 3NT5A 1GL3A 2RGRA 4G6ZA 3HR7A 4HH1A 5JAMA 1LCIA 4E33A 3CRMA 3ETNA 3QVLA 1AKTA 1GQFA 1YACA 4IIVA 4PCVA 4WKCA 5K8JB 4RA6A 3QLVA 3VR6A 1TMYA 1W9HA 3IVMA 5AFSA 3WE7A 4EHBA 3FPEA 5DPMA 2G40A 4MA4A 3K70C 4JEUA 4V2UA 2V98A 1JRLA 1YHNA 3ORSA 5KKCA 1D4AA 4LYJA 4M88A 4WZ6A 3EVZA 1XZ8A 3K1ZA 3QW4B 4NBUA 5F51A 3X1ZA 2ZRIA 1KTIA 1JFSA 1E2HA 1V5EA 4N65A 4DV6B 5KWEA 2CL6X 3GG9A 3B6MA 1SBTA 3D3NA 4AY6A 5ALEA 4C0HA 1WG8A 2PYZA 3Q12A 4D57A 2ZBFA 5IPFA 1WVMA 1RNLA 2NYRA 1NVKA 3HR4A 2IZZA 3N2GA 3LQ1A 2ZYTX 3DZFA 2PHZA 3FF1A 4YB8A 3W5SA 4B6SA 3BWBA 4Q24A 1PG2A 3L0DA 5JLAA 3V7YA 5KYUA 1QBGA 3GLRA 2VHYA 3SLGA 5CA1A 2HRCA 2D8AA 1S02A 2W5UA 3E9YA 4WLOA 5IVDA 1RAAA 3CU5A 3EGIA 4RD3A 2MSLA 2PS3A 3G9UA 5KVSA 1XQ6A 2QHXA 5K0FA 4JQZA 3O1LA 3EWSA 1KU0A 1W88B 1Q95A 2AFIB 3O92A 4MCAA 4OSEA 4V2IA 4X1IA 3NWPA 3F67A 4K9RA 3FDZA 3GRYA 3OKFA 2R1TB 3KFXA 5C1IA 1KYQA 4YRRA 3OZGA 3AJRA 1WR8A 2WTEA 3LP5A 4CIWA 2O8DB 1OGIA 1E4OA 1DKQA 1YA4A 3RUPA 4MPPA 2FJ0A 3NAQA 1AO0A 2HA4A 1BVYF 3AM4A 3RWBA 2HHHB 3O83A 1O77A 1QFYA 2WAOA 3E8MA 4JUIA 1FQWA 4UE6A 4BPRA 4R71A 1PO7A 3EZGA 1XIVA 2O0HA 4JCOA 2X7HA 3TEFA 2O05A 3LWBA 3ZHQA 1IJEA 1TVKB 4WNYA 1UOQA 3VR5H 2XYRA 2GK6A 3K9QO 4N5HX 3BC1A 3OCWA 3PWSA 4OBXA 3R7NA 4DQUA 1XROA 1A5SB 1GZ7A 1E69A 2BEKA 1WW8A 1ELOA 3U4HA 3IEVA 5MFZA 2QGNA 2A92A 1FDWA 1Z3CA 3KQTA 1EZ1A 3A2LA 1C1XA 3KOMA 1TPZA 2RHGB 3ZGXA 5CDSA 4X66B 2DR2A 2P9GA 3VAYA 2VWGA 4KQ6A 4IO0A 1CUGA 2OHOA 5LMUB 5C5IA 2XMPA 1ZM4A 2C2HA 3HJGA 2G5PA 3O8OB 1JU4A 3PFKA 4PBRA 4HZUB 1MR3F 3VQTA 7AT1A 1TC1A 1Z2EA 4B17A 2XNDA 4ENTA 2Z2JA 3Q4GA 1GNLA 1K98A 4MS3B 3WX0A 2LCIA 3GLIA 1W29A 2BPOA 2GRJA 2NU6B 4DNFA 4ZD6A 5BSMA 4DARA 4NBTA 2XZDA 2X9VA 5KYGA 1Q7TA 2QTMA 2Y1WA 1RVDA 4I4NA 4JC8A 1UM9B 5KVCA 3BMQA 3HMQA 4HPWA 3JAKB 4OCZA 3AIMA 3HACA 1U7ZA 4L28A 5CTAA 3LBAA 1IJKA 4IZ6A 4GQAA 4YC7A 4YONB 3CYFA 3W5JA 1KYVA 2X0KA 2VPQA 2XWQA 3RK0A 1SVNA 2QYOA 1L8AA 1DDGA 1T9GR 1GRVA 2OCXA 3L0YA 2V74B 3X1MA 1XMIA 3IODA 4FYXA 4ZOAA 4BGEA 1ZJ4A 4YI5A 4N7MA 3IVAA 4ODIA 5JS2A 3ZU5A 4NRDA 1APBA 3HLKA 2DT5A 3U3RA 3VSEA 4II3A 3AZOA 4W5JA 3D4BA 5F7JA 3ADBA 2JLXA 4RHEA 1FTSA 3LY7A 1S2IA 2AW3A 1IE3A 4GG1A 5LSAA 4HR7A 2IDJA 4L4RA 1JSRA 1G7RA 1C7IA 1NQ5A 2WFMA 1XK6A 3N1UA 4XDHA 4F5DA 2R1VB 4LZWA 3HUTA 1E5TA 4MXDA 4LC1A 2FPPA 4OLJA 1USUA 1E9SA 4X6UA 4ZA2A 3STVA 3H42B 3D8BA 4ZV9A 1II8B 4AP5A 3QI7A 1U8EA 3TVYA 4BQNA 1JHOA 1FXWF 2R6R1 4LJ6A 2O07A 4Q4HB 5AK0A 4XIFA 4QPJC 4P7KA 2DUNA 4L7QA 4B43A 2VVTA 2CFOA 2XDQB 4Z2YA 5JSHA 3LC1O 3N8GA 4D4KA 4LFAB 1K97A 2YVKA 3IE1A 3QELB 1W35A 4LYYA 1UDCA 3I6QA 2Z5FA 5DOZA 3CUYA 3VOSA 3GOQA 3FKSD 2YW9A 1P75A 2IDMA 5HKOA 3D2LA 1E2KA 4EX6A 4HQOA 5COQA 3ZK7A 2RGNC 3MN1A 1PBNA 3MCVA 2ZITA 5FHRA 1F8FA 1U2GA 5LP6C 1BDHA 2IT1A 3PIIA 1KF0A 2RH9B 4A8JC 3A4VA 4P3NA 1E2DA 1GN9A 5EC8A 3A1TA 4V39A 3CHYA 4GRDA 3U39A 1JSCA 2JIQA 5ETJA 3VX3A 3THXA 4TTPA 2Q3DA 4JVOA 3H0EA 4YBZA 2OHHA 2J1LA 2Z08A 3C6KA 4W4TA 4P34A 3WGQA 1EUDA 3DBRA 4YMGA 5J1SB 2IK8A 1NJ8A 1P8JA 4ZYVA 5EXPA 3FFWA 3DVLA 4GL4A 4EIWA 1SXQA 1B8UA 3KUKA 3H4TA 2FLWA 2JIOA 4U5XA 3U26A 2FR8C 1ODKA 2Z4SA 2O3UA 1WEKA 4C4OA 3H75A 1G64A 2HY7A 3R5KA 3TB4A 1DLIA 5FEMA 5DXJA 2VK2A 4BQRA 4TMVA 2I66A 3EZ9A 3BN3A 4O0LA 2IIVA 2GCGA 1OHHA 2XRFA 1BDMA 3H3JA 3EFBA 3HJAA 3HYSA 1LEHA 2BFCA 3SWWA 2WUEA 4PZCA 4ZYLA 1XEFA 3QKSB 1G20A 2H1CA 2J33A 1WMFA 4CG1A 1GPMA 3WRWA 1RC8A 2PU7A 2XA2A 1CJCA 3PNYA 3PZRA 1DOAA 3KC2A 3WLTA 1E2LA 4EKIA 5CK5A 4KDFA 2IEYA 2F9FA 1ZUNB 3H6KA 2C2KA 1LPMA 1P2BA 3BGSA 3OF5A 2XAAA 3MD0A 4HQFA 3E4CA 4BV9A 2X22A 2FWBA 3PFBA 2PSJA 1UJ4A 4J0HA 4F21A 5BOVA 4V0QA 2P2DA 2C5FA 3IBYA 3MC1A 1P3JA 2F62A 4JBGA 5LQDA 4E7PA 1PR4A 3H1PA 4JBIA 3PTAA 2R7AA 1SHTX 1UEXC 2YW2A 3HDTA 4ENQA 1RRMA 2HNAA 3OCVA 3PKJA 3HWRA 1V9SA 3CX6A 4CKEA 4D98A 4EF5A 3T0FA 2IS4A 5DGXA 4PYIA 3RTEA 1E20A 2E7ZA 3WAGA 4BAZA 5B1YA 1WDMA 4C2BA 3KEMA 4FP9A 2ZWAA 2PGLA 2WIBA 1PL0A 3KE8A 3OCUA 3HL4A 5EP2A 2HA0A 3OZUA 3DZJA 1ZLYA 2X40A 4D9CA 5IRCD 4KNYA 4GO1A 1USWA 4IUCS 5ECWA 5LWQA 1HDXA 4DANA 4DPMA 2QM0A 4DQKA 5C3MA 3V4RA 4UNSA 5FULA 3L8CA 4QNNA 1J1ZA 1ZIDA 4HOYA 1XKXA 3C3EA 5FTWA 2C42A 4Q4AA 2KPOA 1YS6A 5M04A 4UBNA 1KK2A 5E9AA 1B26A 1TADA 4HC4A 4NIMA 3MYRA 2HJGA 2Q6KA 5LMZA 4DSNA 1H3NA 1XR3A 1VKJA 1SKBA 1M0SA 2OGWA 2HXYA 2V58A 4NK4A 4R9VA 4TT8A 3E3OA 5ESRA 521PA 1H5UA 1ULAA 5KTMA 1EH5A 1NP6A 2GNAA 4QQRA 4BB5A 1JQDA 1FTGA 3DNPA 1JHDA 2ZI5A 3B8HA 3K9CA 3ZGNA 3X0DA 3HDYA 4G86A 1L4UA 1U0FA 2I3ZA 4L6IA 5F7OA 3N2EA 3TR6A 3WV4A 1HK7A 2TMKA 4MUKA 1N32B 5JJKA 1R7RA 3HKBB 2YFQA 5JY1A 3FROA 1O0CA 1E3DA 1TPYA 1U63A 1JDBC 4Z4GA 1JEDA 3B5JA 1UPCA 2H5LA 1FQJA 4GBMA 1DXQA 4NR0A 2WIAA 3QOFA 2VNAA 3TPFA 5K0LA 1NBOA 3AKEA 1TJ5A 2HWKA 2JZCA 5AW2A 2A9KA 5AW4A 1RZ3A 5H8WA 3LYUA 2ORWA 1QIIA 3BRWA 1AK2A 1YU9A 4MUMA 5THKA 3DTVA 3QF7A 3TSYA 1SHLA 3ZEIA 3BXEA 1QB8A 1YZFA 4J1NA 4M36A 3T7EA 2D62A 2I91A 4URWR 2J48A 1BWPA 1EE2A 1N1EA 3I4CA 3TNJA 2JD1A 1K3TA 1YOVA 3REGA 1ENYA 3IP9A 4RQUA 3EZ2A 3FNFA 4BTLA 3EODA 1M6NA 1E1RD 1B1AA 1ZS9A 2K2WA 2QLMA 3FTEA 3DOFA 1P9NA 4CCYA 1CRPA 1D2NA 3BQ9A 4J0IA 2OC9A 1NX9A 4ZCRA 1JYFA 1QIDA 3RVLA 4Q3CA 4E15A 3JVEA 1LWOA 3D2AA 1VIDA 1ODIA 3FUWA 4UVIA 4ZQIA 3FMIA 1SC4A 5T4FA 5AW6A 4S0XA 2E4AA 2VTBA 3SXUA 5SV2A 4BKUA 4D81A 1LPNA 2ZBEA 1PDVA 3ADPA 1U02A 3N59A 4CLXA 2ANBA 2FP3A 3KPWA 4OKNA 3AR9A 4CTJA 5JO9A 4YVFA 2RHWA 1Y7HA 1HT3A 1YDFA 1R0BA 1EU1A 5HJ7A 2DUWA 3QJYA 3V8MA 2RHMA 1E6CA 4S04A 3OZTA 2H92A 1WETA 5H5JA 3LUCA 1DADA 5A2QA 1X7YB 2DQZA 2FG7C 2IUFA 1DL5A 2ZCVA 4NKRA 2EFYA 1NMSA 3WI7A 2O8EA 1U6JA 3HHEA 1X0VA 1Z5VA 3VOBA 4C4ZA 1FLAA 4XIJA 2QKYA 1U0LA 5E4TA 4NAVA 1PX0A 2IY8A 3O8LA 1DBSA 3IO3A 1D1TA 821PA 3C1AA 1VC2A 3F9IA 2KJQA 3O74A 3ZY3A 1WEHA 3WNCA 2RGNA 3F49S 3L7MA 4C7OA 1NW3A 6Q21A 4D6YA 1JLMA 4UHBA 1JLHA 5EA2A 5LP6A 4Y2GA 1GU1A 3Q3GE 2L2QA 1GFIA 5CPBA 2ZT6A 4H1VA 4FVTA 1CWUA 1EVQA 2A0KA 4A8JA 1FNNA 4MS4A 3AI7A 5ITZB 1DHTA 1YRAA 4R2WA 1L5WA 2Y2VA 5ALZA 4MWTA 4YDRA 1OH5A 2B21A 1F38A 3MWGA 4OHFA 4GI3A 4D0LB 1I9GA 4I6JA 3IJPA 3AVTA 4D25A 2FQXA 1VLVA 5DEIA 3SZMA 1W48A 3RBXA 1ECCA 1H2XA 3W2HA 4RVHA 5J47A 3O31A 1QVVA 1SUEA 3LIPA 1YNOA 3N0RA 4ALLA 2C9CA 4DR6B 1KVRA 3WMRA 1GGVA 4INPA 2AT1A 2J6CA 3M2PA 3P9XA 5NLLA 5KNBH 4NBNA 3GRCA 2EIXA 3L6EA 5GGXA 4B3GA 4D8VA 3QVGA 4YASA 3CSUA 1P0FA 4EPTA 2FR8A 2IHUA 2BL4A 3RGWS 2YIJA 4QLOA 5K8IA 5SYNA 5A4AA 2F8MA 3LKZA 3VGJA 1BO6A 3I01M 2JASA 4WOPA 3KFVA 2O14A 1SUSA 4NS4A 4QG7A 5AOAA 3RE1A 3TPZA 1JXQA 4OG2A 4MUFA 4EA8A 5KZMB 3TIFA 2WI8A 1NZDA 3AT1A 1AZWA 4MWDA 5DJ5A 3I32A 3OESA 1T9CA 4UCQA 4B6FA 2EJWA 4Q9KA 2ZYRA 2OOSA 4PX9A 3BFXA 3F6SA 3OZDA 3KZMA 3GFOA 2OZLA 1X1AA 4RY0A 4MDEA 4CF4A 2VZEA 3NX4A 2P6MA 3Q1KA 1T9KA 1MF7A 4UNPA 3EWAA 5JDIC 4ICIA 3M7IA 1ZMTA 4KAXA 4O2BF 4UHEA 3TM5A 2QY9A 2N1MA 1VLJA 5G40A 3PIRA 4OMUA 2CL0X 1JJFA 1B2RA 4B3TB 5E6UA 5HOEA 4KI7A 1R6BX 3UAVA 3KWFA 3F8TA 1DMRA 3ND8A 1Z2PX 1J90A 1DAOA 1T9GS 2HWYA 2RARA 4MDHA 4NH4A 4DM7A 4B83A 5EJ4A 1OROA 2WJ6A 4D4LA 2PSFA 1ZKMA 1IN8A 3DOHA 4I4CA 5F76A 1NBEA 1HE1C 1WZUA 2ZULA 1CIJA 1HI9A 2GJKA 2PLRA 2ZAIA 5FFMA 3SU8A 2JA1A 3WNQA 3GLGA 2XE4A 1LVHA 3E15A 3TNDA 1RDFA 5JBNA 3G5AA 2X3YA 3OPXA 4LYHA 1OYVA 1UOEA 4QWWA 4R1OA 4CCSA 1DEHA 2RBGA 4B4WA 1WCYA 3OWXA 3QE2A 1UBHS 4MVJE 5KCZA 2X6RA 4GKVA 3ILHA 2VJCA 1XK7A 4AS1A 1Q0LA 2G88A 2GZMA 4HRYA 3MUFA 1KI6A 1ZZEA 5CVJA 4MMZB 4N8DA 3AHEA 3JWPA 4Y1GA 5F2EA 4KQHA 2J9FB 2REBA 3ZDRA 3JQ7A 1QAQA 4O4HB 4PO9A 4D8XA 2WUGA 4RKWA 5IMSA 3DDOA 2ZT7A 1RCFA 2QUAA 3DL2A 1V1JA 3HKCA 4FONA 3ZD8A 4ECEA 5A9SB 2BH9A 1FW8A 4H15A 1V8PA 4BO8A 5DI3B 4DYHA 2V6FA 3JQRA 1N7JA 4EJ0A 4CNBA 4E5MA 3W6OA 5HFJA 1M1NA 1VJGA 1VTKA 3MWFA 1CVLA 3O8BA 4L9SA 1MU0A 4TS3A 3UN1A 4E03A 1SC1A 2VAPA 5JQGB 1XVAA 2RK6A 2W22A 3EA4A 3W34A 4BNXA 2PXHA 1VA5A 1WV1A 3VDXA 1F8YA 2QLLA 2QRMA 1DU4A 2GT1A 4OXRA 1EBUA 1EQAA 1I8TA 1C8LA 3UAXA 1WB6A 3DM9B 3G5UA 1FFGA 3QOXA 4YAUA 1Z16A 1ES9A 2G3YA 4R9NA 3DDSA 2JLWA 1MO2A 3U2QA 4O4LA 3DQQA 2D7DA 2AEFA 3WL3A 1BEZA 1JR3A 3ZU4A 3UUGA 3A0RB 4BNGA 5CB4A 1K6MA 3KFLA 3O7WA 1U31A 4TRMA 5JO0A 2CC2A 3KS9A 2I6QA 5TPZD 4QM7A 1MV8A 1JHXA 4QXPA 4L57A 4HWSA 2Y0PA 1P4RA 1WKCA 2D2FA 1TA0A 3DULA 4IDNA 2Z1MA 2YWDA 2EU8A 4Y2RA 3ZHSA 5A3RA 4ARVA 3TGPA 4E07A 3HWX1 3BCSA 1ZD8A 3I3SR 3AVOA 4ER6A 1C4OA 1ZRSA 2FWNA 1NXVA 3VDRA 1D04A 4HDNB 4ZVKA 3REFA 3NV9A 4HVTA 4OBWA 2G5CA 2IYZA 2D2EA 1EG2A 1GT6A 3EUAA 1A76A 1Z0AA 1WSDA 1B6TA 2CN1A 1DAFA 5CA0A 1V1RB 1DBVO 1OGYA 1XEXB 3E1SA 4OBBA 3TIIA 3UWPA 3L77A 3IUJA 3TCKA 3K9BA 2NG1A 5BO5A 2PUJA 2JIDA 1Z7WA 5HTKA 4GLLA 4RZ2A 1I51A 3SHFA 1ADGA 2PKXA 3HU1A 3VU1A 1KQ3A 1TRKA 1RU3A 3P32A 1M6EX 3FF4A 2YHIA 1IN7A 1GFZA 1SUPA 3V4LA 3VVLA 2G72A 3PDCA 3AUFA 5JECA 1LJ8A 2HF7A 3BHJA 3DB2A 4YPOA 3RJ9A 2H7YA 3G2MA 2NU7B 2CCGA 2O1EA 3ZE0B 3DXYA 1NKSA 1C0KA 2CJFA 1DZ3A 3FPKA 3MS2A 1M8PA 5G0TA 1QHSA 2AK2A 3EC1A 4A16A 2W6OA 4M1TA 4OQZA 2QIOA 3FCAA 4UAJA 4J7XA 1K6IA 3HY6A 1L7VC 3AJDA 4Z7QB 1QGAA 2W70A 2V0NA 2ZUDA 4FWBA 2NGRA 1Y89A 4PTZA 3KXLA 2JGEA 1ODJA 1Z4JA 4FI3F 1JLRA 3CNBA 1YVPA 4PSCA 1ESZA 2XYQA 4UOEA 4C0XA 2Q5LA 3PVSA 4Y2QA 4KDCA 2WABA 3MJEA 2J07A 1P2VA 2R6GA 1NLZA 1W73A 4QYTA 4X94A 4ZANA 1NU8A 4HAVA 2CHVA 4UDYX 5K6AC 1D4ZA 2RAUA 2BFWA 4RGYA 1IEWA 1QFZA 4F9GA 3DO8A 4P7JA 4K2AA 1I2DA 4G5GA 5BWOA 4BMXA 3WK4A 5CTJA 2UZIR 1XELA 5ULLA 3VH2A 4Z51A 1ECFA 1HLDA 5HHTA 2GM4A 1L8OA 1WKVA 2IIBA 4M7PA 4CGYA 2VOJA 4C4YA 3I1FA 3VYTB 3RTGA 1PWEA 3DHYA 2NUTA 4Y6LA 2J5QA 5E3JA 2VFAA 3SLKA 2CUZA 1W2HA 2YWHA 3C98A 4IINA 4HYTA 3ANNA 3JRXA 5ED0A 5BT9A 3REQA 5HZHA 2JLYA 4UNRA 4ZEXA 3HFSA 1E5DA 3OQIB 2BKVA 4GBED 4V0RA 2NU9B 3EEOA 1JV2B 3CUWA 4I4TB 5AVYA 4Q00A 1RT9A 1UJ2A 2DJIA 2PS1A 4LK3A 4YRNA 1PK8A 1EFRD 1WUIS 5JDIA 2IP4A 1V2GA 3I3OA 2GRUA 1PR3A 2IIQA 2HJHA 4Q7JB 3R23A 4XGRA 3TI7A 4CMKA 1NNLA 1OYWA 2B61A 2YJ3A 2ID4A 4DDUA 5HIKA 1QRSA 1IZZA 2CZGA 3QZUA 3PNOA 2CHUA 4PC7A 3ZXSA 4NABA 3H8JA 6NULA 4BPBA 3LS2A 1SRQA 4BZQA 4HVLA 2EF0A 2H0QA 3I23A 3OD1A 3WWCA 2EWVA 2BHNA 3SZLA 4YAIA 1JEJA 1QG0A 2ZBRA 3L04A 4PIVA 1UPUA 3A6HA 4BO3A 1F2TB 4TXJA 5F5LA 3N86A 2JAXA 1M2NA 1IOVA 4M98A 2YMQA 1XVLA 3DOUA 5KCMA 4BV8A 1EVIA 1CY7A 1C30A 1Y1QA 2V8BA 3FE2A 1DC6A 3P9SA 4LXYA 1U9IC 1HNWB 1HQCA 2HK8A 1OI7A 3IUNA 2CXXA 2WA2A 4V0MA 3PVZA 3K9GA 5DM60 2A0UA 4KMSA 4Q9LA 1B7GO 3GUYA 5FP0A 4HX5A 2DQSA 4FJ0A 2YFYA 4MR7B 1R16A 3HCNA 4UMVA 1AHHA 3G82C 1Q17A 1KEEA 1E2BA 3NTVA 2VCEA 1UXKA 3KKQA 2K87A 4ZDIA 1SIWA 2GX6A 4LJAA 4R1NA 5JMTA 1NZJA 5F2NA 2Y66A 1EFKA 2NADA 2JI9A 4HDRB 5TEVA 2DWPA 1BOFA 2WU4A 4CN9A 5HCUA 1Z0SA 2YOFA 2YZNA 2IV3A 2E5LB 3QRWA 3C3WA 721PA 2TMYA 1XE3A 1RHQA 3OE4A 4MYSA 3INYA 4O5OA 5C52B 2QU7A 1JZSA 1PV2A 4QYIA 1SXJB 3KKMA 2O8BA 4BNTA 1XMQB 3VPSA 3VZRA 4Z3KA 1MX3A 4FLEA 3ZV5A 1W4ZA 4QFCA 3RO7A 4PAMA 3QFSA 2B20A 3WWEA 3NBXX 4X8HA 2C84A 1UADA 1N3LA 1UJBA 4YJFA 1TW3A 2H1VA 3U7EB 1D4FA 5IHXA 2PE5A 1AMNA 1GT91 4RA6B 3R76A 4C43A 2H1WA 3GWGA 1MQAA 5T4HA 3TOCA 2JRLA 4XTCS 3A9WA 1WAMA 1WULS 3ZWNA 4QTYA 1J0BA 2GK3A 1L5ZA 1VMEA 2OEPA 2XMCA 4AXXA 3E1KA 4WNCA 1PKEA 3D7LA 3GGGA 3IDFA 4HKTA 4M8IA 5AJVB 2A7XA 3U19A 4PQYA 2QZSA 3A4MA 1F1BA 4GOMD 2DECA 4LHVA 2GKGA 1K92A 1SHUX 5HDQA 5A5GA 1A9PA 1TCCA 5I7OA 1W2WB 3N2GB 3AM1A 1QV6A 3OTWA 3PICA 1PJBA 2NUBA 2CXRA 2BBOA 1PRYA 3CFYA 4TQGA 5IBQA 3SD7A 4DXHA 3OFND 2CV0A 3D8NA 3PQ7A 4KOAA 3RM3A 4YYZA 1ZQ9A 5JAIA 5KYUB 1PHRA 3CZ4A 1GNTA 2AYYA 4UJ5A 5DW3A 5CDFE 1H2WA 4IX1A 2XQFA 2C4VA 2PKWA 4MICA 1QLHA 4MEBA 3HO6A 3ISVA 4EB0A 2RJNA 2Q4RA 3EUWA 1MEJA 1TK2A 3Q3IA 4H7IA 1JVBA 4CUZA 3UMRA 2PPLA 1EKXA 2JJ2D 4ZYTA 4AFNA 2ZIEA 2OGSA 3I9OA 4DJ5X 3AF3A 3DEAA 3OC6A 5FUQA 1QX3A 1VSUA 3U7IA 3K9FC 2PQ2A 5JALA 4W5OA 3WLHA 1RAHA 5C2JB 3JYNA 4KVGA 2AB0A 2B7BA 2RGXA 3ICEA 2BKUA 3DKPA 2WAYA 3L40A 1NW9B 2WPDD 1BWRA 4ZAGA 1N8NA 1Y4SA 3AY6A 4E2ZA 1FFEA 1J21A 1GDDA 4C6SA 4WLFA 4A10A 3LNCA 2SNIE 4UXHA 2MHCA 1ML3A 1TMGE 1WD5A 2UZ0A 1I3LA 4URZR 5EXTA 3VC1A 4BVLA 4ZMBA 4OLHA 4EM6A 1J56A 4YWJA 3RTAA 4RK7A 1A82A 2JDID 4UAVA 1VE3A 4QVGA 4M21A 1NRJB 2EXXA 4GMKA 4JOCA 1A8HA 1UT8A 3KPVA 4MV7A 4Q3NA 1OD6A 4F3NA 1PS8A 4ZV7A 1F2VA 4MX8A 1KQFA 3EQ9A 1CUBA 4LZOA 1CQWA 5GV8A 2GBPA 1C1XB 1WF6A 3JR7A 4UTNA 3K3PA 1ANKA 3O91A 3K20A 5A5VA 2PYIA 2PSDA 2EG9A 3O3NB 1KK0A 1Y3IA 4Q21A 4PLPA 1WMDA 2DH6A 4ZCMA 1U2RA 1KPIA 1IXZA 3I58A 2EJVA 1EHIA 4ZQCB 1UBKS 2B5OA 1CUZA 2FPGB 2KW5A 5KVAA 3GNTA 1MB4A 3C74A 4XB2A 4ZI7F 5JMOA 3B6EA 1GYRA 3GLIB 3E8SA 4IIJF 4AF7A 3LTNC 2AKAB 4CEIA 1N5IA 2VPTA 1EUQA 1C0EA 1T0IA 1N0HA 2X9LA 2CHFA 2Z8ZA 4G9BA 1JA9A 1S1CA 1Y5NA 4LDAA 4E2FA 3CVWA 4KODA 3DE7X 4B2YA 2AN1A 2V5UA 3ZVLA 2A86A 4F1KA 3BMQB 2O0LA 1NG9A 4J7CA 4JLUA 3A11A 3LLCA 3H6HA 4HWRA 4M4SA 4R1MA 4ZRNA 5GJCA 3E05A 4I3FA 4DA7A 3QFCA 5B36A 5KQPA 2Q21A 2BUBA 2ZTHA 4RSHA 5DULA 4BGVA 1SZCA 5A3JA 1Z73A 3JD0A 2O2IA 5EWJA 3ELWA 2I7DA 4PLGA 1QTIA 5AOBA 4ESHA 2BEUA 3C7DB 1JN0A 1TF2A 3G68A 4ZEOA 3S2ZA 1E9FA 1GA1A 2VL7A 1QANA 4KUGA 4NZPA 5A03A 5EHQA 1DC7A 5E8JA 3U44A 2QRVA 3ZS8A 4TKLA 4U2CA 2WSLA 2EQBA 2A5DA 2PBLA 4KBGA 1FOEB 2FCRA 4QBHA 4X8OA 1FVFA 4UC0A 3RT7A 3WLSA 1EXDA 4UQOA 4HAOA 1EXMA 1XA4A 3ASUA 2B92A 4G5OA 1NVUQ 3QPBA 4I5IA 3S28A 1K9VF 1XZKA 2JA2A 4EPVA 2BR3A 2TS1A 2JLBA 3ITDA 1CUVA 2FPPB 1JJVA 2HCBA 3D6MA 3U7HB 2W8ZA 3AI1A 1BVRA 3V7UA 4ZVVA 4P5PA 1CYDA 1U9IA 5F12A 5SZJA 3WZLA 5ALOA 4NF2A 2IS6A 1Y7PA 2IYOA 4DWVA 3MWEA 2JGMA 2YZ7A 1KQGA 4N0EA 1IG0A 1P39A 2A3RA 1BFDA 3DR3A 1I7SB 3EK2A 3NMUF 3ESYA 1C14A 1WW3A 4BNJA 4OGKA 5CBPA 5LQUA 2JHPA 5C1BA 1VBMA 4IV8A 1CG6A 3R20A 1IN4A 3USZA 2Q6VA 1BJTA 1V26A 3UMVA 1Q77A 5E1BA 2FV8A 5DLPA 3GG2A 3SE7A 4RHYA 2DU8A 1RM4A 3ZI4A 1HX7A 3ADOA 1MA0A 3C6QA 3GW8A 4LDZA 4TV9A 1RZVA 5J59A 1I5EA 4B7ZA 3KP1A 2ZIVB 1NF9A 3TL3A 4DUYB 3WNDA 3PC6A 4FOTA 1Z8DA 2XLCA 2ZU6A 1E1RA 2H59A 3P19A 1VE9A 2VQ6A 3A8TA 3UJ6A 3WL8A 4AZ3A 1VFPA 1XKTA 2D1FA 5DYIA 3CRNA 4Q16A 2HCRA 5LQRA 5C8VA 3W2TA 3THXB 3D8HA 2EFJA 3W9YA 1I4EB 1Q0UA 2GS9A 1JH9A 2Y4NA 4G1VA 5BXQC 3DCYA 1OPRA 2AYXA 1Z4PX 3WB2A 3EAGA 4Z0TA 3M1IA 1Z0UA 4WUTA 3BWMA 3NATA 4CEHA 3QOYA 1DIAA 1Y4AE 3DBRB 5EKTA 3K4HA 3PDIA 1CR0A 3SFZA 4D9HA 5D1NA 5HK9A 4YN3A 1J0XO 4B34A 4HO1X 4B73A 3CR3C 1NVVQ 4TWZA 4RACA 3DW1X 4BP8A 1V8OA 2VWQA 3BFVA 1U11A 3H4MA 3SYMA 1CP2A 3ZWXA 3VOAA 2CVFA 1Q92A 2QTWB 1ZIXA 4HWKA 1ADBA 3DDHA 3P5BA 4ZC8A 4PGGA 4QUJA 1FLNA 5BN5B 4D44A 1R6VA 2GM9A 4TSFD 1JHUA 4K1XA 5GONF 4JUDX 4HG2A 4BJ5A 4BO4A 1FMCA 1UCFA 5EUQB 2LIPA 3CZ9A 2VYFA 5JRDS 2BFCB 3WGJA 4LJ4A 2AS0A 4F4IA 1G20B 4JWKA 4AJLA 4BAGA 3SG0A 3FBWA 2QMHA 1P73A 1PJQA 4U3JA 4QUGA 1JQ3A 1G5QA 3C4VA 3CNQS 3FPFA 3R24A 1F2UA 4KAAA 5AQEA 3UO8B 3D54D 2OCDA 1GNSA 3PHBE 4B6EA 3B51X 4F71A 1BH2A 5HR5A 3CC8A 1DIGA 4QHSA 3TFWA 5KU7A 2HQOA 3UK0A 3FNHA 1H6DA 3I5YA 4G5RA 1OA0A 3ULKA 2WSBA 1EP9A 1HPLA 2H5EA 1KOLA 1ONSA 4BLTA 4F97A 4S1WA 3ET5A 5BWNA 1IK6A 4JELA 1MB3A 4JJAA 3ZJ4A 2IYUA 4RMIA 3A3PA 3RRXA 4ABYA 1IUKA 2G63A 5K3SA 4BFLA 4KQGA 3HN6A 4D4MA 4QFMA 5C9ZA 3L82B 5HYVA 1XXLA 3NBFA 5JATA 1XNJA 3SJUA 4D92A 1KO1A 1V39A 2LW7A 1NW5A 3TLZA 3RYIA 4QM6A 3ID6C 4GLJA 5CB0A 2HMYB 4OM8A 1S4MA 4LVCA 2QVXX 1XMJA 5I4CA 1YAJA 2AUTA 3SOZA 3ZHUA 1L9KA 3RAFC 2IYTA 3QXGA 2Q5FA 3LUDA 2DX7A 4MV0A 3VR4D 4B3HA 1VL0A 4FD2A 5DCWA 3VO1A 1DV2A 1Z6AA 2EFHB 1Z6PA 2WTAA 3HPQA 1OE0A 3I30X 5C8YF 1U3WA 4PPFA 3NVKI 2HBRA 5ER9A 1Y5RA 2R1UA 1Q0SA 4JP1A 3HRIA 2WRZA 4Y2SA 2VUSA 3JYOA 4HDQB 4Q4AB 1E99A 1QZTA 3PSHA 4Q7EA 3AR4A 1M8FA 2KI5A 4FPXA 4DBZA 3L79A 3UMJA 3G7SA 3PGMA 5HDBB 2ZP1A 4B9EA 1H1DA 1ZMBA 3AF1A 2GN4A 1U80A 2XA1A 3DAPA 3U7GA 2UVQA 1Z5UA 2JGLA 3PNVA 3EASA 2CJWA 4GMXA 1DEKA 4M3NA 1H65A 3RHSA 4EBFA 2I7CA 5EMNA 3ZBUA 5A7GA 3S55A 4OHRA 2M1ZA 1FSZA 3LKBA 1CQJA 1AMUA 4UOQA 2E4XA 4O6VA 5DCUA 3UC5A 1KOJA 1YA8A 1U65A 3HEBA 4LVNA 4CM1A 1BDJA 4XB6B 4QHYA 1NYRA 4YR9A 2Z6UA 4LYGA 5HEKA 1JA0A 4OP1A 5C34B 2HYDA 3SDZA 2RH5A 2C0QA 1Q57A 3CMCO 3G1UA 1Y4ZA 3QU2A 5ANRB 3TL6A 4X90A 3V4ZA 1MLDA 3OMXA 2PT5A 2X5KO 3JTMA 3AGPA 3WQHA 3WWYA 1WSWA 2NACA 3PD0A 2ZYDA 1QAMA 3DTVB 4GBJA 3WBFA 3S40A 1RMYA 3SNHA 3PDWA 1XC7A 1T8PA 1PYOA 5LDGA 2OO3A 1YOVB 4OKIA 2ZYVX 1PZHA 3I6YA 3HTXA 4PZ0A 1UWKA 1Y9AA 2G07A 1POWA 1XWWA 4HH4A 2VZ8A 3ANLA 4F85A 1U7WA 2C29D 5C51B 1FJHA 1R6DA 1Y37A 3F90A 3G5MA 1KOGA 3GLTA 5FA6A 3WQSB 2V55B 1PR5A 2OC4A 2OXTA 4DJAA 2FPXA 5LQAA 2FWMX 5GWXA 2Y1OA 1CUFA 2E4YA 4ALKA 2VTBB 5I3CA 2QL6A 3LH5A 2AUNA 3AETA 3L92A 4TM8A 3ILYA 4WGGA 3G2JA 2AXQA 1F4PA 3E2IA 3IS3A 3NEPX 3P4XA 2QQFA 3R9IA 5JZMA 3HXQA 3NWEA 3NBQA 3HBJA 4LQDA 5BSHA 2E5WA 3LQQA 4HMOA 2V4ZA 1OUMA 1FJ2A 4XVQA 5JFTA 3N0TA 4L16A 3HSKA 4FYJA 4XX1A 5FPYA 3ONVA 4DYVA 3IX7A 1KI2A 3EQ7A 4Q3BA 4CG2A 3PR2B 4D26A 2FOIA 1T2CA 2VNIA 4OH1A 5HIIA 2AG5A 2J3KA 4IOMA 3LDFA 3T1HB 2O8EB 3K5HA 5DK4A 4EUSA 1LQTA 1UQTA 3GARA 4WZBE 3DCJA 3LHFA 4GYKA 3A6GA 4B3XA 5L51A 3B2QA 3VPXA 5DP2A 3VYWA 1W34A 2XCIA 4LZAA 2PR2A 3RD5A 1GPWB 1A9SA 2DQKA 5AI4A 4FE7A 4J8PA 4C7OB 2Q46A 2L18A 3JQAA 1T5OA 5FNVA 5LP6B 1FRNA 5TPZA 1GUBA 3ZZUA 3RKRA 3HUEA 1A5TA 1QG2A 4U2GA 5FO1A 4NECA 2FGJA 4A8JB 4MS4B 2WM8A 2VXYA 1K8ZB 2B35A 2C5BA 2HJRA 5I7EA 4QYXA 4KFCA 3GIDA 2PZEA 3GJTA 5DF1A 3S7ZA 3SX0A 1ZD3A 4Z54A 2O5EA 5LLTA 1KAOA 4OAOA 4CLRA 1QTRA 1XU4A 4FUQA 2GWHA 3JARA 1CQPA 3TJMA 3TQHA 1KRHA 1TJPB 2PUVA 2R8OA 3D31A 4CM9D 2HW8A 3E9ZA 4M0KA 5EFOA 1R10A 2FA9A 4DV7B 2VHWA 3C8UA 3W7VA 1G3QA 3WGVA 1J4AA 3VSBA 1R4MA 1JECA 2SKEA 2D5IA 3CF2A 3QU5A 3KEGA 3HYLA 3RF7A 4MH0R 1L4GA 2DB3A 4M37A 5IAEA 2GPBA 3HU3A 1K6JA 2UV8A 2YN2A 3F6BX 3QVGB 1QGZA 4P3OA 5EP3A 4F8EA 2OTCA 1I7NA 2HF2A 4TWIA 1UFRA 3GBVA 1LC0A 2QVLA 3BD8A 1F8UA 3LPNA 3D1JA 5EJEA 1I36A 3AEYA 2WVJA 2JVIA 2WZDA 4UFOA 2BGRA 2C88A 2J9YB 4NU5A 1A7AA 3OZBA 3AUKA 3FPCA 1OXBB 4P2BA 2BN4A 4UKDA 2DM6A 2HL6A 3PEEA 3JVVA 4EPYA 2Q2NA 1M33A 2RGAA 2VR1A 2OZLB 2GESA 3H0KA 1EWRA 1QYRA 2O3QA 4RNDB 3CCCA 2C4WA 4DR7B 2B25A 3QPVA 3JZFA 1MH1A 5AHKA 5CXSA 5JASA 2R1ZA 2QTHA 1NC3A 1N5RA 1EK5A 1M7GA 4JU8A 1T6NA 3PHHA 3L7OA 5DP1A 5I9BA 3RVNA 1RWXA 4AM8A 3LF2A 2G4LA 1T3GA 1LH0A 2IDKA 1T29A 3EEIA 3L7YA 2CL7X 3FZQA 4R1PA 1JG6A 5E6UB 1QVWA 1XTTA 7YASA 1NUUA 3E5MA 4B4VA 2XEXA 5TQJA 3FOZA 2X9NA 4YJ2F 4FWTA 5FO0A 5B1HA 4UARA 2HSGA 1P1HA 3L0CA 4BQFA 3Q0EA 4JY7A 2FZ5A 2WF5A 2CBZA 2GTHA 4G3XA 2EYQA 3A6PC 1KBZA 1E2FA 2WIGA 1HSOA 3FOBA 1T24A 3FZGA 2QRUA 3FHJA 3QWBA 1XL1A 4MQ4A 2K6GA 1L1FA 1ZK4A 3D6UA 4E6PA 4FT2A 2H00A 3WL4A 5LOVA 5LQMA 3GLGB 3RAGA 1A27A 3DFFA 2E18A 3MTBA 5J2TF 4N8EA 3RH0A 1MVNA 3QG5A 1KVTA 3BB4A 3IAEA 1CZHA 1UZAA 2I1WA 4M1OA 5FI3A 5I7FA 1YB4A 4KR2A 2RKBA 2W2PA 2PQ6A 1V37A 2ADFA 1JB9A 1SCKA 3HE3A 3G59A 3N39C 4MGKR 4QDXA 4PN7A 4Y0AA 3IP5A 2ZTUA 4OY3A 3A3NA 1T5LA 4LDQA 5CIWA 4AY3A 4F9TA 1KO8A 4ENUA 3JQ7B 4O02B 1MGPA 5FA8A 3UXEA 1QV7A 3HKCB 4MO2A 3IMGA 1Q1AA 3CEPB 1Q6ZA 1VA4A 1TJNA 3LLVA 3NC0C 4OYHA 5DYNA 3UM9A 3AUTA 5CW2A 2Y6UA 2G4VA 4DQDA 4I2NA 2BTOA 2WG2A 1AKMA 1EFRA 1M1NB 4YGXB 1OTHA 2QT1A 3C5HA 3FRHA 3GGJA 1KERA 3OOYA 3G9XA 4IL5A 4YGYA 5GVSA 5JWHA 4JI4B 1NUHA 1UDRA 1WSBA 3JZDA 1A4XA 3AONB 3T34A 3ETCA 4F91B 3RRYA 3AKCA 4O29A 4DHWA 4CM7A 1ZN9A 3QWHA 4BMCA 4RZIA 3LX5A 4KEAA 2MSKA 4QARA 2NV0A 5GJWC 2SKCA 1FJGB 3W1VA 5J3JA 4KO2S 1KZ9A 4O4LB 4X0EA 4Z0HO 4ZT4A 4Q39A 4V3BA 2JLSA 2FK7A 4IMRA 4QSHA 3UANA 3F4BA 2FXVA 3MZ0A 2PH3A 4N0PA 1SBCA 3WKEA 4WA7A 4J75A 3ZIAD 2HFKA 5CB4B 1F51E 3R6LA 3TQSA 5M29A 2CY0A 1QIEA 3KR2A 4PG5A 4N0MA 3EVTA 4R54A 5GP1A 4BJ6A 1VL6A 4QJ3A 1UDXA 2PX3A 4UBLA 1UP4A 1NJFA 2CDBA 4KG7A 2GEUA 5HFNA 1JDPA 2AZMA 1EJ2A 1YT5A 2XB9A 2HCJB 4IVRA 3RC3A 3W90A 1C8VB 3D6NB 4E1AA 4EP1A 4HH3C 4QOFA 4V03A 5LYJA 3O4RA 3UAZA 3HUDA 4NXMB 3R6TA 3IULA 5A04A 1AQJA 4ZODA 4MMYB 1SCNE 3A9RA 5CT4A 4ZDKA 1SD5A 4XD7D 1MG5A 1OWMA 2AC4A 2XTAA 1PT9A 4YACA 3QQ5A 1CUUA 2GZHA 1XI2A 2IJGX 3PE6A 2YJTD 5AI5A 1DWQA 5G4LA 5CA0B 3F7OA 3NQ41 4MGEA 3OOWA 3KT8A 3TLCA 1IZYA 2J6IA 4Y18A 1NBHA 1SJ9A 4QTUB 3DFIA 1X3LA 2PZJA 4HXFB 3B3AA 5IT5A 4TZ6A 5K8TA 3B6KA 4ETMA 2YHIB 1FF9A 1JS1X 2I4MA 2PVPA 4DUPA 3GLFA 3CN9A 3BJRA 2HUPA 3IELA 4AF8A 5EOVA 3P7MA 2OSBA 2PLFA 3P0EA 4CTMA 5JYDA 1Y6FA 3V4FA 3V9PA 1I33A 4TMXA 3EMDA 1BIFA 4IHAA 4Q66C 1TT7A 3G8DA 5FFFA 5HTOA 2X4LA 4HGOA 2WTMA 1R3DA 1G7SA 3OUTA 4IGAA 4L5CA 1XTJA 2GZSA 4FOOA 4TS4A 2ODTX 4OQDA 2FWIA 3FW1A 2W6QA 4DSUA 2QMUA 2JFWA 4ZT3A 3GFBA 2XR1A 2J6HA 4MAMA 2O2ZA 3TOSA 3C2QA 1N5KA 2C7BA 3I0NA 3N28A 2G28A 2VDJA 3WWDA 1V8BA 4G26A 3IEXA 1FUYB 3LXRA 3TMYA 4AJNA 2H08A 2H2AA 3FWYA 1VKRA 5DO9A 2PBRA 2DWUA 4GU5A 1G4HA 1LI7A 3FMVA 1RYYA 4QOEA 4US0R 2WMYA 3CUTA 1LS6A 3DE6X 1SH7A 3CXRA 2QU8A 3G2HA 3U3XA 3VNVA 1UBRS 1GL7A 1MQSA 1KBQA 1EVYA 2LDXA 5ALTA 1YQ9A 1BC5A 2C98A 2WW8A 2QXYA 3OX3A 2HLNA 2PYDA 5A71A 1LRJA 3U7QA 4CZ2A 2PGOA 4UBOA 5DGDA 1T6XA 2RB5A 1OY1A 2BDTA 3V97A 4DNOA 4G89A 3QU4A 3AR8A 2JGFA 2CVHA 1H93A 2NZXA 4B84A 3KSZO 3H3XA 4IRXA 1DT5A 1QF7A 3ZD7A 2HKIA 4X60A 2RK4A 2HRRA 2JJ2A 2H2FA 3HDGA 2XTMA 2YJ5A 3RSGA 5MN4A 5L95A 5JOQA 2UZ4A 2JG3A 4ROSA 2CUKA 3HA2A 3F6CA 1Z5PA 4U2BA 4E2WA 3FCOA 5JNTA 2B8NA 4QECA 3RUDA 1FDVA 3NPMA 1XRPA 4PVDA 2WPDA 2ZWMA 2YCLA 4EATA 3FZEA 1T4MA 3QWIA 2YHAA 3OX4A 3G5TA 1PSWA 3T5DA 2GAIA 4LY3A 3IQHX 4LF8B 3VPBA 2BRUC 1G8HA 3H18A 1RHKA 2Q4DA 3K1AA 5CXUA 4LF4B 2FPUA 2XNKA 3M5PA 2BOVA 2X1HA 4UHKA 1AQNA 3C6ZA 5I9TA 5CLQA 3CQ9A 2IYSA 2V7PA 4MP6A 1EG7A 4DUZB 3PUYA 4AJ4A 3EXHC 3RC2A 3AJEA 3QVXA 3IESA 1N8TA 2DFVA 5DYWA 4B7XA 2AFIE 4D96A 3SDSA 2H5IA 4GPZA 2FEWB 5JPDA 1WCIA 3MRVA 3QY9A 1NG1A 2E0IA 4HEQA 2F7SA 5GOZA 1AM4D 4WLNA 2H06A 1C30B 1RPAA 1S1MA 2Q4EA 3G13A 3GLVA 3X43A 5JPIA 2EFEB 3RHFA 1ZCZA 3IAXA 3FTPA 1HWYA 1E7SA 3NAZA 2RHBA 3GLQA 4XR4A 4GVXA 1VSBA 2IEAA 1YO6A 4RIFA 2ERYA 1OFVA 1HNXB 3GVIA 3OZWA 3BVPA 3GHYA 4YCDA 3FPSA 3BGIA 3RODA 3RRNA 4BZPA 1Y6GA 2UKDA 2XKJE 2FFHA 1R9NA 2YC4C 3M3PA 5AM4A 4JI5B 5AXAA 2A3NA 1M8JA 2BJWA 1YE8A 3OT4A 2IELA 4F04A 1EBFA 3CISA 3VSDA 5JU6A 1U1GA 3D7NA 1PJ4A 2P3QA 1Z4KA 4D46A 3MRTA 1RE0A 4KR9A 2DUJA 1LZKA 3A7DA 1CBUA 5ITVA 3AM3A 2H9AA 4TLBA 5IAGA 4G0YA 2UZAA 4J07A 2H51A 5D5PA 4QYIB 2J08A 3PQ6A 4L4XA 2O8BB 3KLMX 3GCGA 2CW5A 3PX3A 1D2CA 3I53A 1Q15A 3UV7A 1KE2A 2OV8A 4PGMA 1F5SA 3FPGA 5K8VA 1IY2A 4NCAA 5MHTA 2CD7A 3WLQA 5TSDA 2EBFX 4KYTA 5LCXA 3LC7O 4JHXA 1DVRA 4HYYA 2CDAA 5LZ4A 1EHCA 3KAPA 5K0ZA 2PT9A 2J41A 3TBHA 4QXQA 4EG7A 5L3SB 3CEJA 3LC0A 1CCWA 4DV5B 2JNWA 5G4KA 2O52A 1BE1A 1U4NA 3I9V6 2DFNA 3GJZA 4KC0A 3B48A 3L7AA 3C7CB 3D64A 2KSQA 5C7YA 4IGKA 2AC7A 2DY1A 7REQA 4ARSA 5GMOA 1J8QA 2PEZA 4KU4A 5EJGA 1NL3A 4QBTA 4W1RA 4Z4EA 4JYPA 4WD3A 1C7EA 2NXEA 3AXTA 3JASB 3P2JA 4MINA 3H97A 4PXSA 4ZT6A 2QMZA 4R05A 2Z98A 1U3CA 4UHDA 3OD5A 4LWQA 1T3TA 3FSRA 3G2QA 1U1CA 4UUOA 4BOYA 3J80A 3A3OA 3VHQA 3RAPR 2YRWA 1CIVA 2FFAA 3DYBA 4Y2UA 4BN5A 4UUAA 2B4RO 4DLZA 1CZLA 4ZOCA 1PBTA 4NZOA 3UJDA 1M0TA 2GZDA 3QTBA 3U4AA 4DJDC 3IR6A 5K20A 1L9XA 3I5AA 4Y6SA 3T6KA 5LQSA 4A03A 4CCAA 4UOZA 2PUBA 4FXPA 2HXGA 4FHFA 4LJ8A 3KIPA 3F3SA 4JL8A 4DWOA 2IE8A 3SYTA 1WPGA 2VDPB 4DA9A 2I2DA 2QMOA 5FB3A 2NQ2C 1TQHA 1X7XA 1E61A 2XYHA 3CONA 4JBYA 4RELA 3DBLA 3ESCA 1JLKA 4LRYA 5AICA 1TD1A 3ZV4A 1P5JA 1VL8A 4ZFNA 2OQVA 1NDUA 1FTNA 3VPCA 4FFVA 5CEJA 1ESEA 1PJAA 3QBVA 4WOBA 5CLLA 3QEMA 4EL0A 3OWOA 3DZGA 3NI2A 1CDDA 3SQWA 4IV0A 1NXXA 3B20A 4KQIA 3DDCA 3GMDA 3K8YA 4WJLA 4MQUA 4OMFG 4WJZA 4TMTA 3QA3E 2RAFA 3T7SA 3RASA 3HB5X 4DLYA 4LA4A 2Z95A 5KYNA 5IAJA 4B6GA 1RYHA 1V7QA 1X15A 3KU4A 2AN9A 1DIBA 2ZUVA 1E7MA 3DO6A 1Q7EA 5EUBA 3MQ2A 2EKDA 2SCUA 4GVPA 3T5PA 3FOCA 5A6SA 4QOGA 4CT0A 2D4HA 2HDNB 3RBZA 4TSFA 5DISB 1P5HA 4R40A 2ZBDA 4RA9B 2XYGA 4Y9RA 4M1QA 4EI8A 5JJ5A 1N2GA 3JRNA 1D8AA 4OSOA 1UQUA 3SX4A 4P3XA 5K03A 1SKMA 4D0SA 3A9UA 3ZV6A 3KYJB 2G7MC 4PYLA 1E66A 3U3ZA 5D7BA 5HM6A 4NCIA 1EVEA 2GBIA 1D2EA 2WYHA 1GQQA 3VZPA 3SICE 4GKKB 2EAUA 4ZGWA 1AQUA 1MUUA 2NQTA 5T6MA 1TDJA 4FLMA 4JNCA 4EDHA 5JEDA 3DKIA 3WA7A 2R5WA 3IEMA 3ZIUA 4AC9A 1PG5A 4YLYA 1DFGA 2F90A 4BNMA 3Q41A 1UZUA 1ZSNA 3BH6A 3PE4A 4LWOA 4X97A 4G0OA 1C4XA 3W4JA 4BVKA 1G5FA 4ZK2A 5JI2E 1FC0A 2FKAA 3C3MA 4MV8A 4CEIB 3LXMA 4M9ZA 1E89A 1T4BA 1Z83A 3B6ZA 3D3WA 3LPLA 3WQBA 2RGEA 3W5HA 2ODAA 5COBA 1KP3A 2ID7A 2VCYA 2WT8A 3LDHA 5E8RA 4OQMA 4E1VA 3UNXA 2AJBA 3HXPA 3HI4A 5ALKA 1VDZA 2QV7A 1V47A 1SOMA 1T10A 1L7PA 1I2ZA 2CJPA 2JIRA 5E4FA 5IJ0A 2ZRNA 2BRUA 2J5XA 3LQYA 4RBNA 4BXOB 2ZIWB 2BMWA 4L5JA 4K0RA 5C0OE 2HSDA 1SXPA 3I1YA 1AKUA 4IIEA 1GSHA 1LBQA 2BEUB 3VR4A 1WKBA 1M2EA 3I2FA 1T4CA 1LRKA 4H6XA 5GZ6A 1QKJA 4DMLA 3U44B 1W76A 4FKZA 2QRVB 1PEYA 4NEGA 4NMLA 3KT6A 1T1GA 3H5VA 5JZVA 3EXHA 1Z75A 2GVZC 1IWBB 2J9XB 3UTCA 2IL1A 4UUNA 1C8BA 1ZA2A 3UJBA 4B6QA 4DV2B 3R5XA 3JWEA 1FBTA 1E9BA 2R44A 3OLYA 1MHPA 1CUXA 4C22A 1Z6ZA 3MGGA 1T34A 3EZNA 5JZOA 1KJJA 4QO8A 4S2EA 1F0YA 3R7DA 4ISBA 4GNRA 2DT8A 4CMBA 4HK4A 4FEYA 4JL5A 5D84A 5SY4A 1UIMA 4N82A 2I7XA 3LHIA 2QYSA 3TRKA 2DETA 1RKVA 4JBXA 5A4MS 5AVTA 1Z13A 4YRDA 3ZDQA 2UXCB 1CULC 2C99A 4AJPA 3C8HA 3K9HA 4B6OA 5CBPB 2UU9B 1AUXA 2VSXA 3NHFA 3DDZX 1MTZA 1E7WA 1F60A 1RW4A 3JX9A 4IDEA 4MQ5A 4OJYA 1UXIA 5FOVA 3TG8A 1ECBA 1JAYA 1SAYA 4UUBA 1DXYA 3TQOA 1A1VA 1R12A 2EVWX 3PGLA 3I73A 1WBJB 3GRUA 1O6GA 5T3YA 4D3DA 2H4ZA 3BK2A 4YP5A 2JGDA 2V7XA 4MKHA 5F5XA 3O4VA 3VHRA 4DCVA 2VTEA 4NICA 2O54A 3AWIA 3ITKA 3ZHBA 3LI2A 1Z0KA 4MVYA 1CF4A 1GQRA 1KEEB 2IC5A 1G4AE 2GAFA 4A1OA 1HQYE 2Z4TA 4ZTBA 3A1DA 5EJFA 3OX1A 4B47A 4C7MA 4CDMA 4XYGA 1MDFA 1Q1EA 3UAGA 3VO9A 4EITA 2GN9A 4B3CA 6ABPA 4M8SA 4XM0A 2O06A 5H81A 1RKQA 1B15A 3EEQA 3V1UA 3GEIA 3QYPA 2QMQA 2Q3MA 3WA6A 3KV3O 3SR4A 5EN4A 4JT9A 1NXTA 3PJEA 4N03A 3OIGA 5CPFA 5EUCA 4CEHB 2IYLD 1MAWA 2A9OA 2YBDA 2MSWA 1AK1A 2ZWVA 3M9WA 3PDIB 4FU0A 4LY6A 3HZOA 4L3WA 5DHFA 3ZTWA 1YI1A 2RSLA 2P9BA 4FEGA 5DTRA 5ENVA 3Q6MA 1YZGA 2RHRA 2WHPB 1P2SA 4FLFA 3ND6A 2J85A 1V8ZA 2CXQA 3WMEA 2GH1A 4YCCA 1FUEA 1MHTA 1Z74A 4MTLA 3TJZA 5D51S 3ZIDA 5FTLA 3DFMA 3LYAA 4PZZA 3DT8A 1Z68A 4LC9A 3WIVA 4CDRA 2H1FA 3ZXYA 1AV7A 2OHJA 5FXMA 5TJ9A 1U94A 2P6NA 3IBTA 2QYTA 4J94A 5EXXA 4IUBS 1ECGA 2P2CA 2TMDA 5ALJA 3WYAA 4P35A 5I9MA 3O4FA 5HUQA 4KAFA 4U3JB 1EE1A 1Z0ZA 1ND6A 3H9BA 4F3YA 4ND5A 5MF6A 4A91A 1F2UB 3CT4A 3HA5A 4KSBA 3EXIA 4X64B 4BIIA 2O3SA 3JVDA 1TKAA 1XRJA 1YJBA 3DMHA 3PR3A 4RLHA 2PWPA 3DMPA 3SMVA 5KDDA 4EG4A 1PV4A 3CEHA 3EVEA 1FYVA 1PR6A 3EC2A 5AP9A 3SYNA 5IBRA 1ZJWA 3W0LB 4KPYA 4GKAA 4P80A 1BD3A 2X2OA 4JYMA 4WXPA 3S5UA 3WY9A 4MV6A 3BMNA 5TJHA 4BX0A 1XCGB 1YBAA 2QMYA 2WT4A 3A1WA 4GXNA 4QTZA 4CM9A 1RLUA 2RAPA 2M6LA 3RPEA 3OLZA 3UB2A 1TKBA 1D6MA 1H0RA 1XRLA 3TQFA 4KVAA 3RYIB 1NRXA 2V1UA 3PU6A 1B43A 1BXRA 1WW2A 2FZGA 2OBLA 3AEZA 1V43A 5FOWA 1N0WA 3O4GA 4M54A 4FR2A 2VDRB 3IPAA 1RJ9A 3T0GA 3NKFA 3R3SA 1R0WA 5TS2A 1YMQA 1B8VA 1T35A 3EBOA 4GI5A 4TL7A 4UHCA 2Q3HA 3ZHVA 4JI2B 2GNPA 1SG9A 1BMFD 3ML1A 4GM1A 5E1MA 3NHKA 3WIDA 3RAJA 4JBWA 4D8YA 1O6CA 1QH9A 1XT6A 2Y1GA 4QDKA 3A6ZA 1EFCA 4PIMA 3VV3A 3ZCUA 3DD1A 3LPDA 2XMBA 1QGUA 3N3BC 5TMEA 2F55A 1CXZA 3L4EA 3MM4A 5IM4F 5C7IO 1C4KA 3QVMA 3MJTA 2HQSA 3SFTA 2QX6A 3AF6A 3PC8C 2CJWB 4MVJP 4PX2A 1HRDA 4DXDA 2IY7A 3VUFA 4PGAA 2Z2IA 4MA5A 3ROXA 4AMBA 2KWIA 3PA6A 4C08A 4ND8A 1GCAA 4HJRA 5IASA 1YL5A 3DZCA 3E22A 1OXXK 5EXDA 1CQJB 2X1LA 3PHCA 4IP0A 4QBKA 3AR6A 3TQIA 2IIPA 2YV1A 1QYWA 1ZXBA 4IR7A 4X93A 1YZTA 4Y2JA 3SVZA 1EYZA 4DCJA 3PFIA 1GUZA 3LSYA 1PZXA 3WBJA 1H0KA 4PHFA 1I6KA 1IHPA 3KZCA 3QIVA 4DCUA 1VECA 3GRPA 5BURA 3HJNA 5EZYA 2QAGC 2H7VA 3BH0A 3J81A 2QZ9A 3BDIA 4ZYWA 1IEVA 1P1BA 1DC8A 1WMBA 3IEKA 4MVXA 1DX4A 5ALGA 4ACAA 2DBZA 4U7JA 4XX0B 2WP8J 1PLLA 2IQ5A 3BMCA 4QREA 1S2GA 1U3VA 1YDHA 4IXDA 4RS4A 1MOQA 3LGSA 4R84A 4DEVA 1F48A 2AK3A 5EJ9A 3ICCA 1OTYA 3WMFA 4B3MB 3ONDA 4H7HA 1U04A 3F98A 2VI5A 3N9IA 2Y1DA 3V2HA 3KOXA 2GEKA 1X7GA 4O2AA 1Y82A 4OI1A 5JNVA 4B71A 3G02A 3VKUA 3LKDA 5IZCC 4D4JA 2W7TA 1NI3A 3EGDA 4I1PA 4ID3A 2ENUA 2LR0A 2Z6QA 2ZUWA 1O0SA 3AR2A 3ZUPA 1IM2A 1BMTA 3DVAA 3LCVB 5T67A 1NASA 4F1JA 4MS1A 4IF4A 3KQYA 4MB2A 1Q2XA 3JPYA 4B3BA 5CM8B 4ZQHA 1AGPA 4HDKA 1Z36A 1AX9A 4B1FA 4BB0A 3R0IA 2ORED 1QS0A 3W3ZB 3BB1A 4NDNE 1GRRA 2JD2A 5BVHA 3IV9A 4YHBA 1S6YA 4MLDA 5B5SA 3RT1A 2NO1A 3GFVA 3IQXA 2XD9A 1RWVA 2PMWB 3MSXA 1AURA 4C21A 2HF8A 2YWRA 4Y3UA 3R7BA 2ECPA 3ZIAA 2AV6A 5TGZA 3JQAB 5FNVB 4H1HA 2XB2A 2E1PA 2JHCA 2PXAA 2R6HA 3OICA 1S8AA 2P7IA 2ZPUA 4KXNA 3AU8A 4MTCA 3OQPA 4MW6A 3LO5A 3OHMA 4P4GA 4RGVA 3TAXA 3ZZ0A 4MZDA 1E5VA 1G21E 4OUKX 2P4QA 4DG5A 3EVDA 1HORA 4HN2A 1QHHA 4BRZA 2DLNA 1Z37A 5E2BA 3V8EA 2QTNA 5I01A 3QE4A 1KJ8A 4OYLA 3VNSA 4CLRB 1J5PA 1WCV1 2YQZA 5H3CA 4F4UA 1TIKA 3JARB 2AXPA 1P0CA 1C0PA 2VHVA 1AXRA 3H7IA 4JGBA 3HY3A 4MLZA 4XD7A 3H9QA