3ND7A

Crystal structure of phosphopantetheine adenylyltransferase from enterococcus faecalis in the ligand-unbound state and in complex with atp and pantetheine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
152
Chain Sequence
MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 57
structure length 152
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nd7A00
1COZA 3ILVA 1F4LA 2A1TS 3FETA 3LE8A 4EFKA 1OWLA 1IQUA 1JMVA 5J59A 5DEOA 3PNBA 1N2HA 4MW9A 1HYBA 4KPUB 2X0KA 3CVUA 3L92A 3ND7A 1J20A 3CLUC 1KKUA 4G5FA 3TQIA 4KPUA 3ZUGA 4Q93A 2I1LA 4AQ7A 4R2MA 1VLHA 4ZCQA 1N2OA 4K03A 3UOWA 1JIJA 2QUKA 3ND5A 1QRUA 3FG9A 5TEVA 1ZH0A 2DPLA 3OTWA 1U7DA 2RD2A 2IELA 1V8FA 3IH5A 1M83A 1ILEA 2VTBB 1KP2A 1J1UA 2QTNA 3AIIA 1TQ8A 3AL0C 1IRXA 1MBZA 3RHSA 5IHXA 3NBAA 1O5TA 1N2GA 1QRTA 4MULA 4NAUA 2J09A 5DK4A 3H99A 4KKVA 3TQOA 2CV1A 1TYDE 3MLBA 1YUMA 1N2BA 2CT8A 2DUMA 5J58A 1NURA 1O6BA 1KH1A 2HZ7A 3KT0A 3COYA 3Q10A 3TNJA 3FOCA 1GPMA 1D2RA 4CDMA 1WXHA 3FHJA 1GAXA 2WQ7A 2X1LA 1G8FA 3UY4A 1ZJWA 2D5BA 2CFOA 1LI7A 3A4IA 1QRSA 3G59A 2PZBA 3BL5A 3IDFA 4K0RA 4MWEA 2EJCA 4MUFA 1QU3A 1KP3A 2C5SA 2QUHA 1N2EA 1WXFA 3K9WA 2A86A 1O0BA 3HFJA 4NX2A 2YWCA 3G6KA 1TYCA 2V0GA 2E0IA 4HK4A 1WJGA 4MW7A 3D6UA 1YI8A 3ELBA 3CLRD 5DASA 1MRZA 3KT8A 4I6EA 4DDHA 4KR6A 4MVXA 3ZJTA 1VL2A 1EFVB 3ISJA 1QTQA 2CV0A 5LM3A 4ZT7A 3HMQA 1DNPA 4XFDA 3KFLA 3F3MA 3HL4A 1LW7A 1N2IA 4YP6A 2JANA 4YMIA 1YIAA 1KAMA 4MW5A 3IOCA 1JZSA 3N9IA 4NAHA 3NV7A 4PBRA 1MB9A 4X0EA 1U7XA 1EJ2A 3P0HA 3SZGA 1GN8A 2CV2A 2E21A 1QNFA 4EG5A 3ZJUA 3FH0A 1JGTA 1KQPA 4I6JA 4EG1A 2X1MA 3SEQA 1J09A 1IQRA 3AG6A 2Z09A 1EUYA 4ZCTA 2D54A 3IMEA 4NDAA 1T6YA 1ZUNA 1KQNA 2GOYA 1EE1A 4MUJA 2XRZA 3OP1A 1WXEA 3COVA 1YULA 3H9CA 1KH3A 3CLSC 3ZXSA 4YP5A 1H1TA 3M5WA 4EG4A 1O95D 2DR2A 3ZXIA 4ND6A 4DLPA 3KT6A 2HMAA 2J4DA 4MQ6A 1BS2A 1EFPA 2OV4A 4UZEA 1GTSA 5J5AA 1GLNA 3IMGA 3VRHA 5HUJA 2H29A 2QUJA 4U7JA 3H97A 2IP1A 1OD6A 4OUDA 4DNXA 4EG6A 4MW0A 1PFWA 1O96B 1MAUA 1Q77A 3SEZA 3A2KA 3PRHA 1OWOA 2CYCA 3N05A 3ZGZA 5K0TA 5LFAA 1T6XA 1YIDA 4CDNA 2QJOA 1WQ4A 2GKSA 1T9GR 3IOBA 2OQ2A 4U63A 4ZT5A 1TYAE 3FNRA 4QREA 3H9BA 4ZT6A 1O94D 5H16A 1H3FA 5H7XA 1G8HA 2J08A 5K0SA 4EG3A 3FWKA 2PZAA 2VXOA 1Q11A 3Q4GA 4DJAA 4Q16A 1NSYA 1H3NA 3MXTA 1WOYA 2A84A 1X6VA 3DO8A 3U1VA 1PG2A 3TZLA 4MWBA 4TS1A 1MJHA 1OBHA 1JIKA 3JXEA 3IUEA 3L93A 3CR8A 3GUZA 3DV2A 3GLVA 3RBAA 5AHWA 1TYBE 1NUSA 3RK0A 1F7UA 4JXXA 3IVGA 3SDBA 3P0IA 5KWVA 3IMCA 1XNGA 2QJTA 1J70A 3CLRC 3P0JA 4JYZA 1NUPA 3CLSD 4MUGA 4JFAA 2EL7A 1Y42X 1KH2A 4MW6A 4ZT3A 3A04A 3K32A 2NSYA 4KR9A 1JECA 1LI5A 4HJRA 1N77A 4L2IA 1Q15A 1O95C 1N1DA 4MUKA 1O97C 1ULHA 1TEZA 1N2JA 2A4MA 2YXNA 1U3DA 1PG0A 1PFUA 1VBNA 2ZP1A 4MVYA 2IJGX 4MLPA 1VBMA 4BWVA 1Q19A 5IJXA 4MW4A 3DPIA 1OBCA 2B7LA 1NUTA 2NZ2A 3HGMA 3Q12A 1MB2A 2O5RA 1GTRA 2QJFA 1KORA 3RK1A 3G5AA 2DLCX 2A1UA 3I05A 4XSVA 3UMVA 1MC1A 2R5WA 2BYTA 1JEEA 2JAXA 3PNYA 1WXIA 3HZRA 4WSOA 1OWMA 4EGAA 3LCJA 2JA2A 3A05A 1V47A 1T6ZA 2H2AA 4UZFA 2GM3A 4MWDA 1U0BB 2O8VA 3H05A 1MAWA 3RFFA 1J21A 3CVVA 2PZ8A 2YY5A 1F9AA 1U3CA 2HGZA 2Z08A 3AFHA 1IQ0A 4R2LA 2J5BA 3CVYA 1EUQA 1K4KA 3GMIA 2AG6A 1PFVA 1O97D 4CQNA 2E18A 5FO0A 3KT3A 1O94C 5KHAA 3LOQA 1N3LA 1G59A 3COZA 1EFPB 3CA8A 2A1UB 4R0NA 4A91A 3CLUD 3NBKA 3MLAA 4HPWA 1NP7A 1WKBA 3PXUA 3CVWA 1MOPA 3FI0A 4G5YA 3P52A 2BTEA 3X1KA 3HV0A 1M8GA 3AG5A 3IVXA 3ND6A 4MAFA 2V0CA 1P7PA 2YWBA 1NUUA 1S4MA 2G36A 3TS1A 3IODA 2PG3A 1ZH6A 5HG0A 3RJZA 2AZXA 3SZ3A 4YBRA 4ZCPA 2CSXA 4L2IB 3FIUA 4MUHA 4JXZA 3D6VA 4EG8A 1XNHA 1N75A 3SP1A 1XJQA 4I6GA 2ZUFA 4WNYA 1X8XA 1A8HA 3IUBA 3X1JA 1R6XA 3COWA 3INNA 4G6ZA 2A1TR 3S3TA 2Z3VA 3N2YA 2DXIA 3ZIUA 2AKEA 3QTTA 1K97A 4ZT4A 4AS1A 1KAQA 4FZJA 4S1OA 3PNVA 2RE8A 5DB4A 4DDKA 1F7VA 1R6TA 4EF6A 3DLAA 1GZUA 4ARCA 4YP7A 4NATA 3MMXA 1J1ZA 1YUNA 2QUIA 1N78A 4RUKA 3IVCA 3E27A 2J07A 1WXGA 2CUZA 1RQGA 1WQ3A 2PXHA 3MUEA 4P2BA 1EXDA 4ND7A 1I6MA 4PBTA 4E1AA 1UFVA 1NYLA 4QRDA 4DE5A 5FO1A 1VBKA 1EFVA 1IFXA 5LLTA 4MVWA 2A7XA 4XFJA 3CLTC 1B6TA 2PFSA 1IH8A 1IHOA 1M8PA 3QE4A 1FFYA 3ZJVA 4JZYA 1NI5A 1I6LA 4ZT2A 3TZEA 4F3RA 4PY2A 2DETA 1M8JA 2X3FA 1PFYA 1FYDA 2DEUA 4PBSA 1JILA 3IOEA 5FNZA 3VGJA 4KR7A 5F23A 5BNZA 4MW1A 4F4HA 1JEDA 4J76A 2CYBA 1NZJA 1SURA 1JZQA 3CLTD 4MW2A 4QBTA 1QJCA 1QQTA 4OJMX 3SYTA 3AKZA 1O0CA 1O96A 2CYAA 3VU8A 4GU5A 5KCMA 5TEWA 2DERA 1I2DA 1KR2A 1T9GS 4OUDB 2ZUEA 4RPIA 2D13A 1NUQA 4HJXA 4MVCA 4MUEA 1IVSA 1WY5A 2PIDA 2XRYA 4MUNA 1XNJA 4MUIA 1QU2A 3N8HA 1JIIA 4MWCA 3UK2A 4ARIA 4EG7A 1I6KA 2WSIA 2QTRA 1K92A 4GRIA 1H3EA 2TS1A 1OWNA 4DDMA 1KQOA 3UC5A 1M1ZA 2WQ6A 1TFUA 3FY4A 4J75A 1JHDA 5JBNA 2E89A 3FDXA 1M8FA 5EKDA 5TS2A 1OWPA 1K4MA 4ZCSA 2QTMA 3CVXA 1R6UA 1M8KA 2A88A 1WZ2A 4H3SA 2VTBA 1CT9A 5HUHA 5TGTA 2WB2A 4NZPA 4U8HA 3C8ZA 4ZCRA 4CT0A 1G8GA 3QTBA 3X1MA
chains in the Genus database with same CATH superfamily
4YYZA 1ZH4A 4Q1CA 3JQAB 3FMGA 3L0PA 4FKBA 4JENA 5DOZA 5IZCC 2WYVA 5GZ1A 2NQ8A 4FINA 3WZ2A 1ZNZA 4MAAA 1KIFA 5EKUA 5A7GA 5HILA 4A7PA 1FTSA 1RLIA 1TD9A 5THQA 9ATCA 1MCZA 1MFPA 1KBZA 3OX2A 3VPAA 4DLWA 3CO0S 3VR6D 2IOYA 3L92A 1GVHA 3UMJA 2FJ0A 2TMYA 4E3WA 1GPBA 1LSOA 3C41J 3L01A 4IMPA 4I1PA 2EKZA 1GILA 1S2MA 1NL3A 4UBMA 5IVIA 1G8AA 3D8TA 1DXQA 4F6RA 2UUAB 2IUFA 3SXPA 3SYRA 1OPXA 2VYVD 3PWKA 3VAZA 4ZI7B 1JQ3A 4RPGA 1JVNA 4H1WA 1JIJA 2QUKA 4M22A 1OTYA 1P2SA 1ZD1A 2EJTA 2GJ4A 3D2LA 2E49A 2RG1A 1SZDA 2B8TA 3MSXA 2QNIA 1HTWA 4OQMA 5JNRA 2PSSA 4DV1B 3AI2A 4IDEA 3AV0B 2Y9MB 3KBOA 3N2LA 1TIKA 1T8YA 4NSNA 1FFAA 1F4VA 5A9TA 1ZA2A 5LYYA 2YMQA 2J09A 4JGIA 4K6KA 3AOEA 3DAOA 3EY9A 5FI1B 1E5QA 3E7WA 1H8EA 1FPMA 2XT9A 3V4LA 2NZUG 4O2AF 4E7PA 1BDHA 2ZBEA 2FQ1A 5EZQA 2P9TA 4DMFA 4ABTA 1O89A 2AT1A 3AVVA 1V7CA 3E8SA 4BGEA 4PQGA 3ABIA 3SOPA 3V4VB 3GRZA 2AOTA 3D7LA 3OZ7A 4XAQA 3R9IA 2DUNA 4KXYA 2ZYTX 4IICA 4R8VA 4JDPA 4OQLA 3KJEA 5CLGA 5JATA 4R2JA 3UB2A 5AFSA 3IAEA 2YCBA 3B6ZA 3VPFA 5HQ3B 3F1KA 1BN7A 4W8GA 5MHTA 4N47A 3PLNA 5AXDA 3A3YA 2X14A 4ZCMA 5KOJB 3THYB 4FJ0A 4V0LA 1EFHA 2PZBA 3AF5A 3I2YX 2JI8A 4GMKA 1U0HC 1SB9A 3PDJA 2CXNA 2JAQA 4II3A 4ZWNA 4CEIB 4FX5A 3ZVKA 4F21A 2H59A 3LQ1A 3IMKA 2ZULA 1QHSA 1G21A 3BXEA 3BWCA 3H75A 1RRFA 2NIPA 3I58A 3HVUA 4HDNA 3VSBA 1LW6E 5IVHA 1PNOA 3OO0A 1CJMA 1MXHA 5B57C 3K9WA 2Q6TA 2GAOA 4KPGA 3UT5A 1G4HA 4C4RA 4DRZA 1O0BA 3ZZ1A 2JBHA 3P9YA 3K6JA 2DKOA 2Y0PA 5ANRB 4C2BA 2JB9A 1M7BA 2QWXA 4IVRA 4OLJA 1ZA1A 4LN1A 3GLTA 1P2BA 2HXGA 3WMWA 1YR2A 3CLRD 4PNZA 3AB3A 3THSA 1YFJA 5HZHA 1F5NA 3LP6A 1YC5A 4BNKA 3ZJTA 3ER6A 3HDQA 2ZBUA 3ZV6A 4M7OA 3KAPA 1Q7RA 5A7FA 1HWYA 3BSWA 3UAWA 3HC7A 3PFKA 1VE1A 2WWWA 3JRWA 4TL8A 4UC0A 2C9OA 3LUKA 4BRZA 2GD2A 2W42A 1O4WA 1NVDA 4ERXA 3O8QA 4CL2A 4N76A 4KPFC 3DBHA 4GECA 2KBEA 1U2GA 2QXYA 2IV7A 5TV2A 2OC4A 1QCCA 1IXZA 2Z2XA 4M8IA 2JAPA 1E6EA 3BN3A 5ALDA 4CJXA 1X7XA 3H87A 4FHGA 2GTPA 4XWGA 5LCXA 2E4YA 1RQXA 2ZIXB 3UUFA 3NH6A 2NUPB 2GN9A 4EG1A 3VU1A 2OGTA 2FHSA 2GK7A 1DTEA 4Q3OA 1QB8A 5GOZA 1Z0FA 1KE1A 2ZJAA 3JWHA 3C74A 4S1NA 3MUFA 4MCJA 1YZ3A 2NU6B 4IXTA 3BFPA 3IBTA 4C3ZA 3LUHA 1M2GA 1CIVA 4LDRA 3ZEAA 5BUZA 5L95A 4MYRA 1K7SN 3COVA 2HX1A 3QOWA 2OPHA 4WFQA 3K2BA 4P0QB 3NRBA 1X8LA 4MUBA 2DT8A 1FP4A 5G0UA 2QE6A 1UM9B 5EWMB 5A2QA 3EXFB 2ZQ5A 3EYWA 4P3KA 2PIAA 1DARA 5J4LA 1WCXA 3PQEA 1IN6A 3OBIA 5D6OA 1LDGA 4ECAA 2JCYA 3TB6A 1YNOA 4HUQB 2BFEB 1HMPA 3HZZA 3REGA 1WLYA 1BE8A 2GDZA 1TZJA 4MVJD 2NYRA 1Y8RB 2IYZA 4D0NA 3GZNA 4AICA 1RQ7A 3MF4A 3SNKA 1CR0A 1B8VA 1DTWB 1BS2A 1OFVA 3AEYA 3I9V6 3IQZA 4X63A 3S28A 5JSQA 1EVKA 1GLNA 2WWGA 3DULA 3DEYX 4HGRA 2WPDA 1T2EA 2MSCB 2O3QA 4L3WA 4YCSA 5KTOA 4OLBA 1ZHHA 1UZUA 4HDAA 4D96A 2KHZA 1GQFA 1GRRA 3BERA 3EN0A 3OQ6A 1YZLA 4NYMR 3AILA 3UZUA 4Q4HA 4AG3A 2V54A 3F3SA 1N5LA 4CLXA 4TQ9A 1I6WA 1JWAB 1V8PA 3N05A 1LPBB 3PP8A 5B58C 1FS5A 3KUCA 2QZ9A 3ZC3A 3DQZA 2A67A 2J4FA 4YT5A 3INRA 3F6BX 3RSFA 3BWYA 5BURA 5I01A 2OAGA 3OU2A 3FW1A 2ZSHA 3OEWA 3OLYA 1Z3IX 1PQWA 1TM2A 2KBFA 2RBKA 2XNHA 5IEBA 1E1MA 1J23A 1UEJA 3M70A 2VNAA 4LV5B 2R7KA 4GI1A 4I3GA 3WNBA 4AECA 1RRGA 3KOMA 1LFAA 4DIKA 1C3XA 3L5OA 4UM9B 5G0TA 1NSYA 2AYYA 5KNDD 3D7NA 3DNMA 1E8NA 5CIQA 3ZJ5A 4FMBB 4U8GA 3OFJA 4P58A 2ALJA 1PR0A 3CZRA 1UBKS 1VLVA 3UMFA 1HDGO 3CB2A 1MU0A 3MG9A 5GVSA 1UKZA 4RE6A 1FTGA 1OA0A 3JQCA 3HB7A 4JB8A 1E7QA 5IG2A 3RU2A 3I3OA 3ORFA 5L4LA 1F8UA 5TY0A 4WOBA 2WU3A 4AN4A 3OZSA 1I7NA 3O1IC 2R5FA 3T3HA 1RXWA 3WJ1A 1NUPA 2W2OA 3ISTA 4BNWA 5CA0F 4UUAA 1GU1A 4DY4A 3EUEA 5JDIA 1KH2A 2QI9F 3SSNA 2BGGA 3C3XA 3D0QA 3FNEA 2Q3BA 1WMDA 4PS1A 4A2QA 5LIPA 1BG6A 4BNDA 4H6PA 3WI7A 3K70D 2NSYA 1TCBA 1XTVA 2WP8J 3B48A 5AJVB 4ITVA 4BFSA 1KS2A 2JZOA 1H93A 2PSEA 3W3ZB 1A27A 5L3QA 4LYHA 5ESXA 3IDOA 2V3VA 4XIFA 1V5WA 1NC3A 4IJ5A 1N1DA 4MUKA 4R3NA 5FOUA 4HVLA 4B09A 2HLHA 5K8UA 1A9SA 4OBXA 3B52X 4CDGA 4I55A 1V4VA 3LT1A 3MEQA 3ANXA 4WNAA 5HCIA 5FBZA 1BDIA 4MP8A 3UNXA 1AM4D 4B5LA 1VBNA 5EXDA 3W4JA 1DCFA 4L8YA 4O4IB 3IOMA 4FYIA 5HWSA 3ZIDA 2CXRA 4C29A 4ESVA 2GK6A 3TEJA 1CS0B 4K9LA 2NZ2A 1MB2A 1EGVB 1CDEA 1ZIXA 2AXNA 2YIDA 1D0VA 3AFMA 1I0LA 4YX9A 4QOHA 1QOPB 3RO7A 4LS3A 1K8XB 4JODA 2E48A 4CV1A 2MIIA 2Q4DA 3KJGA 5JDCA 3W9YA 3GPLA 3H5OA 3K0HA 1BKDR 1I7DA 4RPJA 3K72B 1NBMD 3DOOA 3LCJA 3S2SA 4EGAA 1OXBB 3PRKE 4ZVQA 4YH1A 5A6SA 4Y6SA 1SXQA 3GP5A 3RWOA 5CW1A 2G8NA 5IYZB 3GARA 5FUVA 1V9LA 4BZPA 4FYPA 1Z0JA 4M87A 4PGAA 1T3TA 4PZLA 4RVHA 3HCEA 1T43A 2CVHA 4RSGA 1GVNB 4Z9BA 4Q1VA 1N6IA 3LVBA 3ZBQA 2LRHA 1EUQA 3N39C 4YN3A 2WSLA 1GYQA 4XVRA 2PGOA 1JZTA 1KHTA 2FY8A 4CODB 1Z28A 4OMUA 4TQGA 4W5OA 3GCDA 4PXSA 5JPCA 1FW8A 5EMJA 1XRSB 4HTAA 1WL8A 1H6DA 2VQFB 2R6R1 2ZEJA 4S1TA 1OLUA 1R12A 1YQDA 4K6GA 4B79A 5A62A 5KDDA 2A58A 2CHQA 3F74A 1USUA 3OCJA 5EY5B 3TBFA 2EIXA 2A7QA 3GGPA 4E33A 1YHYA 2QR3A 3E18A 2BGKA 3GBPA 2JIPA 3WYGA 3VO2A 4Z8YA 2OOSA 3QZUA 3QKRB 4AZ0B 4Y2RA 2G36A 1H2ZA 4L4UA 1XZCA 2C78A 3MUNA 1UMBA 2VBGA 2PLRA 3FGPA 3MWFA 3TSAA 2XWQA 1E96A 1R88A 1WVMA 3JZIA 4RV5A 2C2XA 2WDPA 1ORWA 3HJRA 4C0SA 4DILA 3UHAA 1Z18A 2RARA 1P18A 2OCDA 4EKYA 4MS1B 4RKRA 2IS1A 3FIUA 2OZEA 1R8YA 3AEQB 4B3BA 2I3GA 3SVLA 3NU1A 4HHEA 3QSGA 4JXZA 1ZIYA 4EG8A 1DKLA 1OLXA 2P4EA 3DJFA 1N75A 1KKLA 4CCYB 4MA5A 4E5PA 4LC0A 3RG2A 5KHLB 1HNXB 1X8XA 3H3JA 3NDPA 3D6HA 3U4MA 2BI8A 1CEYA 3X1JA 3GFBA 3P26A 1BFKA 2H2FA 2AJBA 4UE6A 3PD1A 5AH0A 2RH5A 2V4ZA 3QTTA 4JNCA 2IYSA 2ZJ3A 5KTTA 4BCBA 1RCTE 4M1KA 4F4JA 4D80A 2AZ4A 1E7MA 3OZWA 4UAUA 4BB0A 4EQZA 3BG5A 2C7OA 2EZ9A 3CLHA 1JIUA 4RESA 4AMUA 1A71A 3CMMA 4OHOA 1IG0A 1UZAA 1MVNA 2OLKA 3CB4A 1KSFX 2BGRA 5BW6B 4ARCA 3SHWA 1U9IA 1XVUA 1ZP6A 2JLVA 3UKDA 4ED9A 3V7NA 3EASA 1S8FA 2LV8A 2QY6A 4MS4B 5I7HA 3IEMA 5K05A 2QB5A 2YOGA 6REQA 2BEUB 3IVCA 4PWYA 4M86A 1FQWA 3KE8A 4HWSA 2OD2A 5MFZA 1V1RA 1X2BA 2H7VA 3CZAA 1SRQA 3VZPA 4PZ0A 5DHTA 3H2BA 4YP0A 1PT7A 2QORA 4MQ5A 4GE0A 1NNSA 3BYZA 1JQDA 2QL5A 1R0SA 1IY2A 4Q15A 1IFXA 2BAGA 3AF4A 1JEAA 1PJAA 1DAKA 4PIVA 4ZV7A 4BMVA 3OESA 3OC6A 3PJGA 4FOSA 4GGOA 4IIUA 1TAGA 4U6QA 1DAMA 3ETHA 3SDZA 2W6JD 1I6LA 2XLBA 5BOSB 5IH7A 4ZT2A 1FE8A 1L7OA 3H86A 5J4VA 2X3FA 4BRSA 5JH7B 4H7HA 4ARAA 4DLRA 2I62A 2I6GA 1XRJA 3GGCA 3VGJA 1A1SA 5ADVA 2QRNA 4TV8F 4YK7A 1MTOA 2VF2A 1QF7A 3CIOA 3V4PB 1T9AA 2QX8A 1Q3TA 3H5NA 3NETA 1KJ9A 3LX8A 1H9BA 1K98A 4OHRA 3CLTD 4QXOA 2XB6A 2IODA 3IIMA 4LECA 2O6LA 3A4TA 2GPSA 3SYTA 2PQ2A 1YR1A 1XA4A 4AURA 3GW8A 1VL6A 4YJGA 1T9GS 3B6MA 2CWDA 2FUKA 4F8EA 2PJRA 2PT5A 2WTBA 4G23A 4KDCA 2XDQA 3FPBA 3JQBC 3W78A 3RVBA 5FULA 1SU8A 5G0VA 2VHZA 4TLMB 3NO4A 1CUFA 4JH0A 2FFHA 4JD5A 1JIIA 3KXPA 2VXCA 4MUMA 4EB3A 1MZPA 3ZX4A 4HSGA 3RU7A 4JVLA 4FSDA 4DCSA 2PX5A 1ZJ6A 2NV2B 4M1QA 3ERCA 5EHZA 3D6MA 1HC7A 2V55B 3ETEA 5I3ZA 3LO8A 3FTNA 2VCHA 1DEXA 3C1TA 4DDMA 5KYXB 3W8NA 4JX9A 4GIBA 1A9OA 3UC5A 4MV0A 1VLMA 1Z62A 3A0RB 4PXAA 5I4IA 3EK2A 1Y48E 3AT1A 1MT3A 3OX4A 1SZCA 5A9SB 4L02A 2DSTA 1WNTA 3WQRA 2SECE 1EGHA 2CVPA 5K3CA 2CNKA 4X1KB 1M8FA 1VJGA 5AW7A 2JGRA 4PQFA 5BUSA 4AJ4A 5D5PA 5KVCA 1IM5A 3WO0A 3CN9A 5BSGA 5KYWB 2AXEA 4F8JA 3ICWA 4MDYA 5J2TB 2FVYA 2IYXA 5KJCA 4L4SA 2JLYA 1P4JA 4HZUB 3WLIA 1ZH2A 1SA0B 2G07A 1Q0LA 1J24A 2JNWA 3FCUB 3LT4A 4RIGA 5I4KA 5DEIA 2O0JA 2HQSA 2JIRA 2QGFA 1PO7A 1YJAA 1XZQA 5EXPA 4DQXA 4AVYA 3H13A 3ZNNA 3P1JA 2PV0A 3FROA 5E1OA 4BC0A 4G0VA 5J59A 1A77A 3OHMA 2PRIA 1GUBA 3PRYA 1MW9X 4NY1A 5FPTA 3UXMA 2GM5A 1QP7A 2FAXA 3NBFA 3EVTA 3I2GA 4HQNA 4ML3A 4RSMA 3H9EO 5MDHA 4RZUA 2DKFA 4DQVA 3TE7A 2K87A 4G5FA 3WWDA 4BU0A 5JD4A 1X86B 3DUFB 4EVRA 1ZDMA 3ZUGA 1W19A 3SK0A 4I5DA 5C37A 3WLFA 3ILSA 5AOAA 1IVYA 3BKWA 4TWZA 4IIYA 3ZJ4A 2IKQA 3IKLA 4K03A 4P32A 2B2CA 2WJJA 1KQFA 1OIVA 3W6PA 4RMHA 1M10A 1QRUA 3VNUA 1O8BA 2WFLA 3MWYW 4N8DA 5BRNA 5TEVA 4BVEA 1VMKA 1U7DA 2DPHA 4LJ6A 2F48A 4ENQA 4XM2A 2VHXA 2FPPA 1KP2A 4ZYXA 1A50B 1KPIA 1YS9A 2Z2JA 1HLFA 2B8WA 1MJ5A 3MTIA 4NMWA 3ZKWB 4H3KB 4LBYA 3O95A 3FWHA 3PTLA 5CBPB 1VE3A 1TTQB 2OXFA 3KOZA 3A9TA 4B43A 4S0ZA 4GAEA 2D0OB 3W7BA 3ANSA 3M6WA 3RV4A 1QVVA 4ND8A 1YUMA 2Q3CA 2CZQA 2ZRBA 2HQBA 2I34A 3HZOA 5B1IA 5CA0A 1E0KA 4AO7A 2OBXA 2CT8A 3LT5A 2BW0A 4EVIA 5J58A 1LK0A 2L17A 2NUBA 2HZ7A 2Q99A 3IVRA 2WA1A 1VZ2A 4IEIA 1QKKA 4JC8A 5FEUA 3V00A 4M1OA 5ICMA 4JYCA 4NJMB 5CBKA 2ZS7A 1XHFA 3ASVA 3M6LA 3OOYA 1WXHA 1DELA 1C7FA 1E0JA 2D2IA 3VTAA 1JIVA 1JMYA 3HYSA 4OBWA 4Q12A 3WBJA 4E5NA 4J7UA 4KAJA 3TIXB 4YAUA 4WRRA 4AP9A 1T1RA 4O1IA 1G3UA 2FB9A 1TCUA 3UXEA 3KSBC 1XKQA 5HIIA 4L07A 4PCLA 3GG9A 1QRSA 1AUPA 4H18A 3M5PA 3QY9A 5GONA 3ZS9A 3FVWA 3M6XA 1KO7A 1GPWB 3QOFA 4U3JA 3ZV3A 4IKPA 1ZVVA 3U0BA 1YQEA 4PX2A 1BMTA 2QTLA 5BN5A 2RGWA 1C7IA 2P5YA 4XDZA 1RXVA 2MHCA 3JZAA 3PUXA 5LBUA 1OAOC 3G5LA 1XCBA 2C5SA 2AI3A 3A9VA 3OIDA 1N2EA 4NFHA 1N1EA 4E6EA 4L3VA 4N5NA 2FFBA 1XK6A 1PR1A 3I01A 1FXWF 2D2XA 2X8JB 1LDBA 1NVMB 3HABA 3U48A 4CU5A 4OA8A 1BCRA 1VB5A 1GYPA 1TXGA 3V9AA 4GG1A 4HT3B 3FHTA 1M73E 4J1NA 1UKYA 4RZ3A 1ZVQA 1LLCA 4W6QA 2OP1A 1Q84A 5GZ3A 2CCKA 1H65A 3DVSX 1Z63A 5DM2A 3K1TA 2P0EA 2IYOA 3OZRA 2YJ5A 1JDUA 3OICA 4DUGA 1JIQA 5SYNA 2AH5A 1R4MA 1NFRA 1Y1LA 2PUFA 1KI6B 3FVRA 5CYFA 4D74A 4DCGA 1CX9B 3DBOB 2FXVA 3K6SA 4PXYA 5AVRA 4Q1FA 3AUSA 3AXTA 3G8YA 4INJA 2NP7A 3T34A 5LNK6 3KAQA 5TF0A 5CEFA 3UN1A 3A6GA 3KLOA 4HL6A 1PK7A 4YIHA 1KAMA 1YIAA 4WL0A 4FU0A 1SZJG 3ADPA 3IOCA 2RGCA 3NKFA 4HB4A 2SCUB 4PNEA 3JD2A 1GTMA 4W5HA 3JD3A 3RTDA 4GKVA 5IAKA 3UV6A 4D6YA 3P0HA 5KPDA 4RNCA 1IULA 1PUXA 2JS7A 2V7TA 1VRVA 3BD9A 2EERA 1IUKA 4U7FA 2I91A 3EJ6A 4XZ3A 1SXGA 1NYRA 1TYZA 1JEQB 2ZJFA 4QYSA 3N28A 1DHTA 4DV5B 4MYCA 5EYPB 1D2GA 4Z51A 5KTNA 2JGLA 3DZJA 2GLXA 3U49A 2WF9A 2O3JA 2X1MA 3NHFA 4M1TA 4UU1A 5BSUA 5JC8A 2JCSA 3TVYA 3CW9A 4D4JA 4ZEXA 5DGTA 2VJBA 5KWSA 1IBCA 4ZCTA 1RHRA 1OIXA 3RYIA 2ZPUA 1RSZA 1D03A 3U61B 1S9HA 1N0WA 4C0QC 5F9FA 5JNSA 4I5FA 3BJMA 2DT5A 2XRZA 1FDWA 1NJ6A 4R2XA 1OUMA 2OKGA 4IOMA 3NDBB 3VU0A 3ZBTA 4DRYA 3EQ7A 4TXNA 2V0NA 5K3AA 1C1DA 3QXSA 4HGPA 5KYVA 5FUQA 4ZYZA 4KYTA 4GOXA 4YP5A 2IHKA 1I5OA 2WWIA 4FJ1A 2ZR8A 2X0IA 1OXMA 2NWQA 1PNRA 2HJVA 2W6IA 1DAOA 3RPEA 1J8VA 2O8DA 1W9HA 2RKBA 4GOKA 1UIMA 1R9MA 4MH0R 4MI1A 4Q0MA 4Q5IA 2C8KA 4NCAA 3ZXIA 2Y4NA 3M7IA 3AUJB 2IFTA 2YUIA 3KDSE 1VIYA 4RZSA 3BWDD 4RTKA 3A6HA 3QWHA 1DC8A 2XE6A 4U2KA 1RZ3A 1Z4LA 1Q57A 1UBRS 1YXMA 3EW9A 1P33A 1N77A 1JS1X 4U7JA 4UFOA 2G6BA 2ZJYA 2DBVO 3P97A 3FYHA 4GDMA 1G9TA 3THXA 1SB8A 2OK8A 3AMVA 4XASA 2N75A 1KHHA 3HJFA 2G09A 2Z43A 2DZDA 4QUIA 2QM0A 1PFWA 1U0RA 4GXQA 4PGFA 2INGX 1QQ6A 4JKOA 5GGXA 1ENZA 3RU3A 2R5NA 3B6JA 1FLNA 2W4QA 3IJPA 1SBIA 1BVYF 3PRHA 5DLYA 5EE1A 4RDXA 4D8VA 2CYCA 2G9NA 1HNWB 1FDIA 2JFNA 3ROKA 4DSTA 1KZHA 3CVOA 4RY8A 4PLWA 4WKOA 4M36A 2HKIA 5ICEA 3RFXA 4YRFA 4QRIA 2UVDA 3S2IA 4OHKA 4KSBA 1YTLA 5TSDA 1EXNA 4ETWA 5HXAA 3E1GA 3IHWA 2B2NA 2VDWA 1L8XA 1BFUA 4B7CA 2QLBA 2WE8A 3L4BC 4BLTA 1KBOA 4TV9B 5F1PA 3BIWA 2O0KA 1QBGA 4FGKA 3SBEA 3M2TA 1P19A 3N53A 5H7XA 5CPBA 2GF0A 5K0SA 4PPYA 1DPGA 2RG7A 4CF3A 4R5HA 1ZHFA 2CVQA 4EG3A 4TTQA 2PVCA 3DE1X 4JLKA 3WRXA 4DMRA 5JZVA 4HADA 1Z35A 2H1LA 1PT8A 3BTOA 1L1QA 5K0LA 4O5AA 4J16A 3U1VA 3SICE 1V3TA 1XU9A 3H4IA 2PLNA 3Q2IA 4FWIB 4XQGA 3CX6A 2RK4A 3L4EA 3H7AA 4TM7A 4U6SA 2JHFA 3HCRA 4X91A 4CF5A 3GFFA 4CG0A 2BFNA 1SGWA 1Y37A 3K5WA 1OE0A 3FUXA 3F3YA 3OZXA 5AHWA 2VNKA 2REXB 2ACWA 4I1VA 4OLHA 1G6OA 2GEFA 1EDEA 2GFIA 2M6SA 2WMNB 4D3DA 1WU8A 4JLVA 3R5XA 4PO3X 2Z5FA 4LHXA 5CCEA 3EDCA 3AR5A 1H9CA 1L3BA 3GGSA 5IDQA 5TDHA 1J70A 1UXKA 4K88A 3P0JA 4RCYA 5IRCD 1Y1PA 3LL4A 3EGDB 4O2AA 1SVIA 7REQA 5KDOA 5GADl 2D2VA 2P6RA 5GP1A 2GX6A 4LV8B 3K1AA 3C5CA 3TRJA 3FNFA 1CZOA 2J46A 2WT4A 2IIPA 2ORWA 4GNKA 5DN6A 1Z22A 3LPMA 1JHAA 4P53A 2QZ4A 2HR1A 2TMDA 1XVVA 4MPJA 4Y67A 1YS2X 2AVDA 2EKBA 3G85A 3H8JA 3VU9A 3H4VA 3ASYA 3KTAB 4YCBA 1KYIA 3O8OB 4E46A 4KFCA 4WH0A 1Q92A 1CZLA 3R7NA 1O95C 2VJOA 1NPTO 2OHJA 3C15C 3O7MA 1VHWA 5EWLB 2QG9A 1YQTA 4JJ6A 4UMVA 5FBLB 5J1TB 1SAYA 4R7ZA 3ZYCA 2R6AA 1VL1A 3GAZA 4LQ4A 2YY6A 4D9KA 1K27A 1UWVA 3GVCA 3M34A 4FGZA 2F1HA 3UWPA 2XCTB 4B3GA 2Y67A 3R4VA 4MLPA 5KU1A 1HYHA 4FN5A 4JBHA 3IE2A 5EZ6B 2IUSA 5DBGA 2W58A 1I32A 4R4JA 4RJ2A 4CNQA 2JLUA 2ZDGA 2B0CA 2YN0A 3RYHA 1KEZA 2CXXA 4HQOA 4IDCA 1CXZA 3ESBA 2HWUA 4GZMA 3VTFA 2CEAA 3PGMA 4B7UA 4KO4S 3B9QA 3I01M 1J22A 1QH8A 1Z39A 2VQDA 2VP3A 2BFDA 4Q21A 4R3WA 1SUEA 4E6PA 2IQ5A 1X7YA 4AT1A 2FSGA 2P9FA 5DHUA 3SQLA 1E7RA 2J85A 2MOKA 4TL7A 1Y6FA 4UJ5A 2H2AA 1PYOA 2QR5A 1GQOA 3CWQA 3DS8A 4TV8A 4W8HA 1TKCA 2W6JA 5E7JA 4Q7KA 4YRPA 3V1NA 2G5CA 3MQFA 4UFPA 4AUNA 1L7MA 2Z1NA 2EVWX 2QN1A 2GYYA 3PDWA 2X41A 2IOFK 5J47A 2HSWA 1GPH1 1OT5A 2C2KA 4H7DA 2Y2UA 4M8LA 2C4TA 3N87A 1CJVC 2W93A 4P4SA 4UHDA 5B37A 3GP8A 3PPYA 4E1BA 2Q28A 4DCOA 2VN8A 4QOSA 1WEHA 5BORA 2YN4A 1SZPA 5EWJB 2QRGA 3PUVA 1RDFA 1HDCA 3OI7A 2XYQA 1RQLA 3KT3A 4FYKA 3CCCA 4ZZ3A 3BWXA 3AVWA 1GQYA 2FG6C 3IE1A 1N3LA 1TVKA 3K9FC 1DC5A 2K7FA 1JLRA 1GZ4A 2ZRAA 1TPZA 4GMHA 4RAQA 3ROPA 1RJFA 4N65A 1MEOA 1IY1A 4C78A 1VRWA 2QX6A 1F4PA 3A2NA 3VH4A 4DSOA 1KIAA 4E70A 3DFIA 1K8RA 4OGKA 1DQSA 2XVZA 1CRWG 5I47A 3H3FA 3M9WA 4GI3A 1AC5A 5KJ6A 1CY4A 1M6HA 3PHLA 4X7PA 3OEHD 5KYUA 2RCYA 4DEXA 2P4UA 2YWBA 2VRCD 2YWHA 4REQB 3TS1A 2EC5A 2MSDB 4G85A 4FDTA 1MOZA 5ICCA 3DFFA 3SZ3A 2XA9A 2VT6A 2L42A 4C0XA 1W4BA 5I6DA 3A3NA 1DWOA 3KDAA 2R7AA 5G4KA 5IF9A 4C4PA 3EGVA 2RHWA 2P6UA 4JYBA 1YWGO 2E5LB 4WJKB 3A1CA 5EQJB 1I3NA 5K0NA 2DBZA 1TX4B 2F6RA 1KAHA 4RGVA 1C3OA 3NTXA 2ZUFA 2VT3A 5A3SA 1R6XA 2WD8A 4IJMA 3QIAA 3INNA 4E5UA 2BV3A 4XCQA 2VF5X 5GGYA 1QQ7A 2IYUA 3L6CA 5P8WA 2Q27A 4YRZA 4NOMA 5A4MS 4EB8A 2JEZA 1G3QA 1Y6ZA 2CXPA 3OOSA 4IG9A 2ATVA 1RI5A 4QOEA 3PNVA 2SHKA 1Z38A 2WAYA 5T64A 1AZLA 4D3YA 5AHKA 2QBYA 1W88A 5FLEX 2JF0A 1NT2A 4BIMA 4W7IA 4EF6A 3NYIA 1A7AA 3DUWA 1Q3HA 3HJNA 2BDEA 2BGTA 2WU4A 3SX4A 4FZRA 3QI2A 3EQ9A 5AKEA 3F97A 3KPYA 1R64A 1CUJA 16PKA 3HB5X 1SKAA 2WTAA 3I8SA 4HEHA 5CJJA 1NQWA 3LRTA 4CUJA 2WF5A 3PLAE 3FNBA 4IJWA 2P77A 1BJTA 1C3VA 3GJ7A 2OCXA 1XJ0A 1PEAA 2OTCA 3RYCB 1QIIA 1GPDG 1EM8B 4LI0A 3I61A 3U7EB 1FUEA 2J9YB 1QGED 1TECE 2P40A 2IXDA 2QN7A 3LDFA 3PDCA 4DCTA 3R9WA 4DDWA 3HY4A 3M1AA 2GETA 2QQGA 4CHTA 1DO2A 4JZYA 3V7WA 2BRUA 4OHUA 4F3RA 1G41A 2TRSB 1MEJA 1W581 1TUBB 3PYLA 1M8JA 4OK3A 2H4YA 4IIJF 4DLLA 1BU5A 4X6YA 2FKAA 1NNUA 2JC3A 3ZI7A 4PRZA 1DJMA 4EG0A 3JCZA 2IYQA 1Q0SA 1JEDA 1T4CB 3DP7A 4CUKA 3T3PB 4C4SA 1JAXA 4ZQBA 1Q2XA 4H16A 2Z4SA 4UBIA 4JVMA 1Q7TA 4AJKA 2R6HA 2ATCA 1TZBA 1SWWA 2IPAB 1O96A 4W7SA 1D6JA 1J2UA 5L9AA 1DWPA 1VL0A 1XWIA 4TSRA 4XGIA 1N2CB 3SFTA 4JNKA 3HCWA 2IEIA 4LSGA 4JDUA 4O0MA 4HJXA 2PS0A 5F5NA 4CF6A 2I87A 2ZQZA 4CM1A 3HXMA 3CE6A 3AHCA 1UBEA 2GPTA 4R01A 1W6RA 3A2MA 4KDRA 4HCJA 4B3XA 4CKYA 5AT1A 3WADA 1TA4A 1QU2A 1USWA 1NU6A 5AKLA 2ERCA 1YHNA 2BEKA 1TAUA 3KKOA 4EG7A 1NQTA 2NGRA 2WSIA 1HI9A 1KI1A 4E1VA 5G1NA 3H2GA 2P2CA 4DLTA 1XT6A 4MB6A 2AOVA 1GPYA 2JHPA 3HVKA 1O7JA 1SUPA 4MCAA 3GX1A 1MO6A 4KR0A 2CE7A 4CMIA 2B98A 3WKCA 1MJGA 4Y9RA 5CEJA 3L1IA 3JR3A 3NTLA 4QLAA 2YZNA 1PTKA 4NMXB 1U3VA 4Z99A 4D82A 4OSPA 3RAGA 1T0UA 2GPBA 4O1MA 1EZ4A 3GXOA 4DSZA 1UK7A 2WSYB 2G88A 2FZWA 2CEKA 1UMCB 1UKAA 2WIGA 5AW0A 3ESZA 3VZQA 1I4TD 1RYEA 2ODTX 3RAPR 1G38A 1F6WA 4J4TA 4OTZA 1R74A 2HADA 2QD4A 2GA8A 1EWQA 2R87A 3AO0B 2AFIA 1XQVA 4KH1A 3IT1A 3OY7A 3GA0A 2JJMA 4HG2A 3U7JA 4O2LA 2NO0A 1K68A 2AJCA 4LYYA 4R05A 5FWXB 4QEKA 1UK8A 4N54A 4LF7B 4RFLA 4ILKA 4LZLA 1W0CA 1DKUA 3T41A 4NTZA 1CF9A 3OUTA 1YO6A 3Q2KA 1TU3A 4RK5A 4EF5A 4YUAA 4GOND 1H4QA 3IP7A 3O3OB 3U4DA 1KRWA 3QVVA 2HPVA 4UM9D 3PQ5A 4CWAA 4R2IA 2GSDA 4OGGA 1P77A 4PSVA 3TX2A 2P78A 3ENNA 3K9GA 3M9LA 2YZ7A 4X97A 4X7MA 4YJ2F 1OCEA 5JVDA 3NOQA 3RADC 1ZN2A 3EXEB 4PFJA 5FWXA 4MGYR 1SG0A 3P4XA 5ALWA 3HY6A 4RD4A 1XZHA 1Z6TA 2RHLA 3UMBA 1IK6A 2B4RO 3PNOA 1I7PA 3T99A 2QVBA 3VO9A 1FDRA 1YGYA 2MJLA 4P08A 1JG3A 2FSVA 2IDMA 4C0JA 3QU4A 1KMIY 4DW8A 5FWNA 1Z4IA 3UC9A 4I8IA 1ZL2A 3V4ZA 2IHUA 5BV2P 3ZIAA 2VEOA 1P1CA 4DVGA 3OKAA 5F7JA 2QRLA 1WUKS 5H80A 4EJSC 3SS9X 4PQEA 4B40A 1Y1RA 4HB2A 3HV2A 1K4YA 2NZ8A 1XJCA 1S1MA 1ZNYA 2XYVA 3PNLA 3QJGA 4BMZA 4HMOA 1DKQA 4X8MA 5AI0A 1XP8A 3Q8WA 4KWCA 1I2ZA 5M34A 3LXXA 5FNVB 5HF9A 3TNJA 4CMIB 1GPMA 3AGQA 4P0PB 1HYEA 1KKMA 1K5PA 1Y4DE 1P4RA 1DUVG 2QSJA 3G2NA 3NDIA 1J5XA 1K7EB 3JY6A 4HLCA 1LB1B 3NUGA 4S35A 4IRUB 3FBGA 1TTHA 4QFBA 1SC1A 1CZNA 1F12A 1Q91A 2EGUA 2I7TA 3DE4X 3DB1A 3DBLA 3Q6IA 2QG6A 4ARVA 3EC7A 2D6FA 3A4MA 4LVUA 1GKIA 4FEEA 3DE5X 2BJWA 3D0RA 4BTLA 5AUOB 2ZYUX 5ARBA 2H0RA 1G3MA 2GVZC 3GELA 5JYBA 5L53A 3U44A 2I3BA 1CQWA 2AW5A 3UAYA 4B3HA 4JU8A 4ZHSA 4DNFA 3EG5A 4ZXPA 3O3CA 1A2BA 1FK8A 1Z4OA 4ZIRB 1A82A 1XDDA 3P0RA 3BEOA 4BNUA 3RH0A 2Q4RA 2X5KO 1VL8A 4RV9A 1IOWA 1IZ8A 1WABA 3HFJA 5AI5A 4JVOA 2JVIA 2N0SA 3KUXA 1TJ4A 2ZYVX 4H7FA 2BMDA 5LU8A 2IZ1A 3BXFA 1CK4A 4Q7EA 3RD5A 4HAUA 1RXEA 1U0TA 3LI2A 1TUBA 3OSZA 3UHOA 4L7VA 5HKLA 4ZDWA 4BYMA 3FA2A 3FVVA 1KWGA 1W5FA 4HLUC 1R5JA 3H2IA 4ZI2A 5DTEA 2PKXA 4DJTA 4W1PA 4LOHA 1FVHA 3JVIA 1L7RA 3MM4A 1P8AA 4WY2A 2A0FA 2VJYA 4JZKA 5CM9C 3QBEA 5BVHA 3KKNA 4DZRA 1HLDA 1RWPA 2DHDA 1J2YA 2YJ4A 1R6BX 3HMQA 4XFDA 2VJAA 1EGMB 4KQ2A 4PFSA 2AEEA 1L4EA 2BGMA 3GFGA 2QZJA 4KQEA 4OSOA 3ZE9A 6ABPA 2HLDA 2B4QA 1HDXA 1XPJA 3QLVC 1ELOA 4XGKA 1UP4A 2FRDA 2FGKA 3EQ2A 4KVAA 2QN2A 4J03A 5AM5A 2I8LA 5LDGA 5THKA 1KOGA 3PXCX 1S1CA 4BNVA 1NMEA 4DPMA 4GUDA 1YMVA 3IFSA 4NEQA 3MC1A 1G5RA 2LZ0A 1S9DA 1M0SA 4CVNA 5AVUA 1F1JA 1FXUA 3I04M 4JR1A 3MJ4A 2QBYB 4ZAVA 4K9PA 1R8QA 4U0KA 3T0GA 1C9DB 4R8MA 1RWNA 4QODA 1RS0A 4PC3A 1RI2A 2FR0A 1P0IA 1G4AE 2L69A 2PAAA 3CPJB 1BEZA 1XQWA 3FSRA 3QMWA 4U2CA 1ZIDA 2KWIA 4N1AA 4N7MA 2R60A 2UZIR 1VPTA 3K0BA 5E7QA 5ALLA 4DREA 2OC9A 1GG5A 5DN9A 4EI9A 1OAOA 1RYZA 2AZMA 1EXMA 1OFGA 1M1YB 3OZEA 4N7JA 3REOA 3ZLUA 4DWWA 2P9QA 5KTKA 4RTPA 2RIPA 2ZUUA 3K09C 3FLBA 4IY1A 1OLSB 1ZYUA 3QM1A 3T1YB 1P7VA 3GPIA 5JXGA 5A5FA 1T2AA 3GD5A 1GQQA 2ZSFA 4GPBA 5LPNA 4I4TB 2AUNA 3TQCA 3T1NA 5BWMA 2PZMA 4ZXFA 5TMBA 3IYLW 3L7IA 2P27A 4JYPA 2C4KA 3EX7C 3I72A 4OHVA 2IPLA 4I2VA 3RC8A 1S2DA 2H4FA 2HA2A 3UQYS 2DR2A 1ZUIA 1NTOA 2HLNA 3FHLA 1NY6A 4YP1A 5TPWB 4MPTA 4WAUA 4DZTA 3PPWA 4AZSA 2XKKA 4MOWA 2ZRKA 5CUQA 2HMAA 3CG0A 1WSBA 3OPQA 1CY2A 1SHLA 1WEKA 1CUGA 4KGDA 7MDHA 3KIPA 4EYKA 2Q9CA 4IDPA 1G60A 1R0YA 4XKJA 3NVAA 2ID9A 5BOVA 2O8BA 1OILA 2FA9A 3PPVA 1TVKB 4NV1A 4F3KA 4JI5B 2CLIB 4CMEC 4QDZA 3GJ8A 4C6SA 3I42A 4RK0A 3H97A 3MN1A 4PC2A 5HOEA 4BXOB 1NE7A 5BPHA 3P9XA 1T3ZA 1NDHA 4DNXA 2FRXA 1FNCA 5LKAA 1ZOPA 1NQOA 3GEIA 1U11A 4RFSB 4W5JA 3ITKA 1FOEB 4URYR 2RJOA 5AKJA 3CT4A 3WYNA 1Z08A 4C06A 2XZLA 1V5IA 1QVAA 2REQB 1LDNA 3G9ZA 4KE7A 4WZBE 4EGJA 2GVDC 1Q7GA 3GWZA 3WLAA 4HNGA 3QE2A 5ECGC 5D1NA 1J00A 3ZTTA 3GCWA 1JW9B 5SYMA 1U8FO 1ZC3A 4I9NA 3UOAB 2BZGA 3FNRA 5JD5A 3OLXA 1K6IA 1JJ7A 5IF3A 1G2PA 1QONA 1SK9A 3B7GA 1QHGA 3F96A 2XV1A 3VO8A 1ZUWA 2BFDB 1QH8B 3QYPA 1G9XA 4J2TA 5I45A 3T3NA 3FFAA 1EK2A 3IAFA 4ND5A 2FQYA 2ZR7A 1MX3A 1SG9A 5IT9A 4CKCA 4R1QA 5J1SB 5EUQB 4CIYA 5LXTA 1ZD2P 1TRHA 1JLHA 3EZFA 4QUKA 5F1OA 3G88A 3SAJA 3TK1A 3EIWA 1R0LA 2HHAA 4X1YB 5AUNB 3E9MA 2VO1A 5KNCD 2NTVA 3L93A 3P20A 1ZD3A 4Y2YA 1OBFO 4ZODA 3AETB 3E9YA 1XHEA 5EOVA 3H8VA 1USVA 3U37A 5C1PA 1QG0A 3Q3VA 3EIXA 3KS9A 4DG8A 1U81A 1XAGA 5HM8A 4N49A 5JXJA 3OC0A 5KWVA 4YEDA 3LNTA 3IMCA 3ZV7A 1XPRA 2VJMA 3TO5A 1XCOA 2Q5IA 4XYMA 3KTAA 4BY9E 2F1OA 4ZKDA 3T1TA 3VPSA 1QIDA 3LF2A 2G83A 4FMCF 4IIBA 4D0LB 5B4VA 2DBRA 4RACA 3LF1A 4BO8A 1K6EA 5C0OE 5LP6B 1VHQA 4EUFA 1MMFB 2HZBA 1F6BA 1E1QD 1H2XA 1PNQA 2CVZA 2YIMA 2FDXA 2F9LA 1SHTX 2W37A 4V03A 1QRDA 1SXJB 5AHXA 4ENTA 5BWNA 2X5XA 1X87A 4G5OA 1GZ7A 1GL7A 2OBBA 4PM4A 4RBNA 3WVNA 3BGDA 4INOA 4DMUB 2C31A 1LBSA 1ZLYA 3IAXA 3O1JC 3PWSA 3LC2O 4B3SB 3B2QA 1DG9A 1Z5NA 3EZLA 4BLWA 2XDYA 2JZNA 2P67A 1K63A 3BKXA 3QEKA 1L7XA 5F7OA 5EAIA 3HDTA 3VR2A 2D06A 4BUZA 4QO8A 2V6MA 4B3JA 2CKDA 1BDJA 1F0YA 3E4CA 3EVZA 2OK7A 5F77A 3AEXA 3OIFA 1ST2A 2VP5A 5HDQA 4V2UA 4CMHA 1FX0B 1GM5A 4O8CA 2C29D 1AY0A 4DTIA 3LC0A 2GVNA 3UMVA 2Y1KA 1TM4E 3SZUA 4QHSA 4Q9LA 4MKHA 5DH9A 3D4LA 5A4JA 4RVFA 4HRAA 3V32A 3WGKA 4M3NA 4QASA 2OV1A 1PUIA 1RC1A 1N7GA 4KXQA 1RP1A 2QE7D 3WGLA 3WNZA 4XUGB 1IOVA 1W1UA 5K0CA 1C0LA 1BEUB 3PDIB 4YQYA 2XUAA 3BIOA 2J6CA 2NXJA 3E3OA 1JNXX 3RT7A 5JCPA 1WU7A 4K9MA 2JKZA 4FFDA 4BCDA 2Z08A 1Q20A 2UVPA 4M21A 4TMZA 1IXKA 1CRLA 1E9AA 2ZTLA 1NA5A 3OQJA 3U31A 5DHSA 4BX0A 1M2VA 3KQKA 3G49A 2JJYA 4HXYA 5IX8A 3THXB 4CQNA 1VKNA 1ZCBA 2YMMA 3TPZA 1QH1B 4XXHA 3TRIA 2Z83A 3LOQA 3V1LA 4N5MA 5JSUA 4I5IA 1C80A 1VYVA 1TUGA 3MWJA 3OURA 4JHLA 5EXSA 4G9GA 1J07A 3MLAA 1NP7A 2WJ6A 3UTDA 2IIQA 2EFHB 3O84A 1FQKA 4RHEA 3ADKA 3QBTA 1X92A 3W5DA 2D59A 3C48A 3V33A 1JFTA 3PIRA 3ETCA 3TXYA 2XF8A 5EMNA 1WDTA 3OLVA 5ALQA 1RACA 2J5KA 1XQYA 2HIGA 421PA 3KP1A 1UJ6A 2IHJA 1AGPA 1GCAA 3QWAA 5GINE 1KVTA 1ADYA 4ZCPA 2Q5EA 2AMLA 3V1MA 3ZDQA 2FHPA 1L4LA 4JN6B 1KK1A 1SQGA 1IN8A 4ZZ2A 1T3SA 1YVRA 2IYRA 2JIZA 2QDKA 3PC3A 3H2ZA 4HFRA 1CHNA 1MVOA 1ZLXA 3OTQA 1HE5A 1U94A 2F3PA 4YPFA 5DHFA 3T5AA 2BUCA 1J5EB 2DB3A 2WBLC 1OGIA 3AEUA 4N40A 4WNYA 2DUJA 2WG0A 3OPYB 4H27A 2MTBA 1LPMA 2GBIA 3TXXA 1KI2A 2GYVA 3LG2A 5EVJA 3OZTA 2GBCA 3COWA 3RS9A 1LNZA 4KQFA 3WC4A 2AKEA 2I2DA 3JYOA 1MJGM 3SG0A 1H2AS 5DMHA 3VPGA 3FZGA 5CHYA 3T9DA 3ZIAD 5DK6A 3RW9A 4CU2A 5DCYA 3HGQA 4E31A 2YFKA 2J0EA 3E70C 1AKQA 1CRQA 3KKZA 2IZ7A 2ZJBA 4PAOA 3H5WA 5LMNB 1L8LA 1XD8A 2AG8A 2VZ0A 2XNKA 1OFUX 1XD9A 1EE2A 3A28A 1KC3A 2AA3A 3CGGA 3Q0IA 4C01A 2AHRA 3WDKA 3KCNA 3RSOA 4Q05A 4WGFA 2JZCA 2PGLA 4LZWA 2FPRA 2IZ6A 3O38A 3MMXA 2VNHA 4P22A 5YASA 3QUBA 5B7QA 3DOEA 3KV3O 5CDFE 1Y82A 3GIWA 1F7UA 2HQ1A 3W2HA 4MV3A 3AM1A 2HRQA 3LKZA 1SEPA 3MWDB 5LR6A 1W5BA 2OD7A 2YUTA 4AKTA 1M2NA 3F46A 4MUYA 4ARSA 1UFVA 4YDRA 1NYLA 2NOAA 3BXHA 4R1MA 3T54A 1MQSA 3SNHA 1SQFA 2ODEA 5BRAA 4MVWA 5D7BA 4F2HA 1R4MB 1I3LA 1M8PA 3WGYA 1HR0B 1BMDA 4RYLA 1OYWA 2Q3HA 2SKEA 5IBRA 3K16A 3W90A 3TRKA 2DETA 3T3OA 2ZIFA 3H11A 1J9GA 5BWBA 1DG1G 4JYAB 5K51A 1AQNA 4CM9A 5E7IA 2G63A 1EFRA 4Z4HA 1JDSA 4QA9A 2IOQA 4OEHA 1PE0A 4DABA 1JFLA 2IEAA 1GA4A 2FN3A 1BA3A 2F8LA 3MT9A 3NZEA 2PX6A 1SURA 4QICA 4YV1A 3UMMA 4RVGA 2Z4TA 3NEYA 3CUWA 2WUVA 4X6UA 2IE0A 1QCDA 2H4JA 2WZBA 4NU0A 1C3JA 1SBNE 5TEWA 3HG7A 1KR2A 4RLQA 1E4OA 2IOFA 2XCIA 1HFEL 4JCCA 3ZDZB 2AE1A 1KVSA 1FJHA 1CFJA 4WCVA 1Z68A 5NLLA 5BMOA 5C8VA 1XTUA 4BGDA 2C3PA 5JY6A 3C39A 3FD8A 3HKEA 3TMKA 5CFNA 1W4RA 4WDRA 5E6RB 3T7TA 4HI0E 8LDHA 2J1LA 1OXXK 3GOHA 5EERA 4IMIB 3UK7A 3WHPA 1M6YA 2FUG6 1A8IA 4AMZA 3RR2A 1I6KA 5TMEA 3QX3A 1K92A 2ODBA 1QOQB 5MN4A 1AB6A 2JASA 2BLLA 1ZRHA 3AH8A 1QLJA 4GW3A 1ENPA 2AQIA 4K87A 4NJMA 2VYND 1X3SA 2OESA 2KM1A 2PX4A 3R0VA 4UD6A 3GOQA 3L1KA 1T8UA 5A3QA 3FVTA 4Y9SA 3FY4A 4OBEA 2FPIB 4RO0A 3MMPA 1ZFNA 2GZSA 2RGXA 1U31A 3QXJA 3HUUA 4ND8B 1P1BA 1YL6A 1CSEE 2VAVA 1C29B 5DISB 1VHTA 4PHTA 5FH9A 4MVJM 4DR3B 5CBPA 4H4DA 5FQNA 5IDXA 2Q5OA 1I3CA 3IGFA 2BONA 2HRBA 3TZ6A 1TLLA 2JK1A 4H3SA 4LI3X 2VTBA 3UEOA 2WJAA 4UTZA 2P9ZA 5AQEA 2VLBA 2L0XA 3ZVMA 5ILGA 3A1WA 3LXUX 4MDFA 3VO1A 5DI3B 4HVAA 3M4ZA 4BNGA 5AW8A 2BGWA 4K6OA 3CF4A 4BVLA 3DZIA 4NARA 2PH5A 1A8QA 1K66A 2O2GA 5AKHA 3EVFA 5BT9A 3S44A 3ZGXA 1G98A 4M99A 4BVHA 2L19A 4R71A 1T9KA 4XARA 2RGAA 2QLTA 1G3RA 4L73A 1XC7A 4KPUB 4MW9A 5LMUB 4UCWA 4WESA 3L46A 1Q16A 1K88A 2UUPA 4UE3S 1IXYA 3H0KA 3MGBA 1PJRA 2E9SA 3RM3A 4QPDA 2C3OA 3TD9A 2OSBA 4Q4LA 5F3DA 1BS9A 4FHEA 1T35A 2PT7A 2YXDA 4ER7A 4ZCQA 1H2YA 2TYSB 2ZTSA 3RLIA 5TMPA 3A4VA 4DKXA 2VPIA 4V3CA 4C4XA 4IV8A 3OFKA 4M53A 4QKQA 4LSMA 1NNI1 5BV0A 1HLPA 2W7TA 2IZ0A 5IYZF 4HZUA 4O0LA 3RKSA 5EJEA 2UYHA 2JHGA 1E6LA 2NLOA 3ROEA 1HG1A 3UBTA 3K0AB 2AF4C 2QVGA 3E3NA 3PCXA 1HE3A 3L7MA 5KYWA 2RFLA 4KNWA 3MRSA 4CNBA 1XTQA 1PCXA 4DT1B 1VDZA 1N2GA 1XZIA 5LQUA 2XITA 4FMCB 4RHYA 4ZVPA 2CV1A 4QGSA 4X1KA 4ENSA 1CF2O 3MLBA 3V8NA 1XN1A 5A9SA 4JKIA 3EIOA 1MIHA 1NX9A 2DUMA 3PF9A 2C58A 4OK5A 5B58T 4EGSA 4MP6A 1KMMA 1F0PA 1RFGE 4PTLA 3H2YA 4WGGA 3ZQ6A 3S40A 4QAJA 5I7VA 3FHJA 1U5AA 2VZ8A 3CF4G 4JEMA 4LGYA 4H6VA 3ILYA 4NESA 3ZCUA 1Y7HA 5IN4A 1XWWA 2D5BA 4BVAA 2HW8A 1ZZGA 3BCHA 4LWZA 3JAMA 4R51A 3OQMA 3ZQJA 4YAGA 1C41A 2AN4A 1OYOA 3HJHA 1A7KA 3L84A 1M2OB 4OXIA 3ZOKA 4MMZB 4U9UA 4D5EA 4DAOA 5I48A 1YB2A 1QU3A 2ODNA 2WJZB 4ZEVA 1D2HA 4GBGA 2JH9A 5C7LO 1AK2A 1E1RA 1U5CA 4Y6LA 3DLIA 3ASUA 5I5GA 4YJGB 4DDTA 2PUBA 1ZGBA 3OO1A 3DMHA 1I7SB 1WXFA 1XTIA 3O1HB 1XLTA 5B4UA 1O5IA 4XVQA 1GT6A 3AEZA 1Y3DE 4IHJF 2OBYA 3RK4A 2GZ2A 3TR6A 3H1BA 1IHDA 3OM9A 5ALOA 3OLCX 1TYCA 3GAFA 4KO8A 4Z0PA 2GXAA 1JI3A 4NCJA 1E1YA 3GF4A 3CISA 5JH7A 3KSDO 3D3NA 1N0HA 2HRDA 1H9AA 2ZYHA 2ZOSA 4H15A 1GAWA 4Y2HA 4EHNA 4CIWA 1W36C 5EHNA 2ZJ0A 1CJKC 2O2SA 4DIUA 5KKAA 4M38A 4HRYA 2XNDD 1A3CA 2H0QA 4AJJA 1QTQA 1CYEA 4NYJQ 3H5LA 1EXVA 3TZBA 3WNVA 4RK6A 4E5VA 1EDZA 4JITA 2RGUA 3WGNA 2E6KA 1RKVA 3KM0A 5AVXA 2ZBFA 4KG7A 2ZIWB 4R1OA 1Y33E 4YP6A 1TE2A 1NVFA 2GBGA 2LGJA 2W2KA 1WETA 2FLVA 1Z12A 1RMTA 2MR6A 1V8BA 4JA2A 2D0PB 4UHKA 4ZK6A 5JR3A 3R3WA 4DBLE 1U28C 2BKVA 1JALA 5B12A 5C5IA 2OENG 1U0SY 5AM0A 3ZD6A 5CT8A 4UU7A 4PSKA 2WKQA 4RV4A 3N5KA 4XFKA 1E2NA 1X94A 4KDEA 2AKAB 3FUWA 4DR4B 1H69A 1Z4MA 1DX4A 4KV9A 4MROA 1L5ZA 1Y3AA 2Y9PB 2ZB2A 3LY5A 4KW7A 5JXWA 3HYLA 4GXNA 3OM8A 5D87A 4C5AA 2O8NA 1A2KC 1SHUX 1X14A 2NPFA 2CHGA 5JOQA 1VIDA 3H9JA 1G8PA 3LX5A 1DEHA 1I4WA 1QMGA 3TB4A 5CPFA 3JD0A 4CCYA 1BU8A 3GEHA 4NDAA 2FX2A 1LGYA 4O4HF 5F98A 2CC2A 4CM9D 1K9SA 2G72A 2YIJA 3SBXA 2QEQA 1BDMA 2YJZA 5HJ2A 2WA2A 4D99A 4MS1A 1DIOB 2NX2A 1Y7LA 2VK1A 3LW7A 1O5OA 3KHKA 3QVTA 2O2ZA 4NC9A 3SX2A 3UJ6A 2ZYGA 3CLSC 4K7JA 4UKDA 4WTOA 3WRXC 1OH8A 3WQQA 2W6ID 2OO7A 1ZCZA 2PXCA 3F9CA 4J0QA 4HWTA 1DRKA 4RF3A 4WUVA 3U3OA 3VI3B 2ZE5A 3L0ZA 4W5QA 2PR2A 4QT0A 3D8SA 1C2YA 2WI8A 5KTMA 3CH4B 3ZOZA 1E9FA 1MUUA 2F1IA 2O0LA 4H1TA 4XQCA 4EECA 3GEBA 1U1DA 2QRVB 2FSVC 1MDBA 3C4VA 2PJZA 2FN9A 1VLJA 4BJ6A 2SKDA 1H2FA 2VHQA 5K01A 1ML3A 1CJCA 3U6BA 4WOPA 1C7ZA 1D9XA 4DIOA 3JYNA 2A0WA 4F72A 4AF6A 4V0SA 3KL2A 4Z7OB 4URWR 1A97A 1LX6A 1W87A 4BQNA 2D7JA 2QN6A 4C0LA 5JAZA 1US8A 3L02A 4TGLA 3JAKA 4RY2A 3PSHA 3ROZA 4EG6A 4J0GA 2AOWA 3AR9A 3HNPA 3M5CA 4V24A 5EP1A 4BX9A 1S8NA 3IOYA 3GXBA 1PFQA 3NHJA 3GT0A 3MW8A 3Q3CA 4D8TA 4ZI5A 1U9IC 3VPXA 3BRWD 5DX1A 4GF5A 4BFLA 2IW1A 3C5HA 1KDTA 5F2EA 4G5GA 3TG8A 1T3HA 1XMJA 1JJIA 3Q3IA 1DEKA 4FCCA 4NYIQ 3AF2A 5JG7A 3SR0A 3U3JA 2PKQO 2QJRA 3WNDA 1U1IA 1GZ6A 4HN4B 3DF7A 5CYOA 5D00A 4NOKA 3C3PA 2H54A 3IOBA 5A3RA 5HFJA 4ZT5A 2ODWA 3ZHTA 5IKMA 1GGJA 1QYIA 2XKJE 3CHYA 2QW0X 4LOKA 3AP3A 2WP0A 4WCFC 1J9ZA 1INLA 2PD3A 4L4YA 1NLZA 5TQVA 4JVNA 3B1FA 1IPHA 1ESCA 1G9SA 2PZFA 4HNAA 3ZWMA 2VXOA 3Q4GA 3ZE2B 3IP1A 2IL1A 1X1RA 4C7XA 1Y8QA 1KYVA 5FT9A 2ZXUA 3C7TA 4QTXA 2XJ4A 1E3DA 2AFRA 1YBVA 3T4EA 1CS0A 1X7ZB 3V2HA 3SY8A 3S81A 3C7CB 1R4ZA 2XECA 1W48A 1XZLA 1RXCA 3WOHA 4O4IA 3K0EA 5HSGA 5C3UA 1P2UA 1HNNA 3I9FA 1YHZA 5I7EA 4DJJA 1PJ8A 4EJ6A 2QF7A 5JISA 2DOKA 1PD1A 4PEVA 2WZQA 1P1JA 4PYJA 2A5YB 3QJYA 3RBXA 1RWQA 3I5AA 2AFVA 4AMBA 2WU8A 4OK6A 1CQJB 3QVJA 4HH0A 2V3CC 1RYBA 3ZD9A 5PGMA 2VTVA 4MKIA 2X6QA 5AXAA 4BWGA 3ELUA 1AUVA 2EL7A 3DCNA 3DOFA 3EFOA 3QXHA 2QVYX 4KAFA 4LTMA 4MW6A 4XSHA 5FL3A 4EO7A 4JXJA 2PQ6A 1DZIA 5DHPA 2X6TA 4G26A 4WBXC 4KR9A 3R7LA 2FGJA 4UTRA 1LI5A 1KEEA 1TC2A 1I4OA 1PKXA 3L8FA 4HQKA 2I4IA 4WZAE 3JR7A 5AI6A 5UKDA 3DCIA 1CUCA 4QWMA 4TSFD 1PJCA 1TKAA 2J9FA 4MVJH 4RABA 4YC7A 4CI0B 5LQCA 2HU7A 1KFJB 1VL5A 2O4UX 1YDEA 4IJ6A 4IH1A 1DOHA 3W5IA 3MCVA 4M0LA 2BGLA 2XLCA 1NWHA 1E3SA 2ZSDA 5GM2A 4BFUA 1VBMA 2H1SA 3HPQA 1DJNA 2XMPA 3HB1A 4MW4A 5IJXA 1OBCA 2CLDX 3HR7A 4RD2A 1DQNA 3W05A 1PQ4A 1YCDA 2QJFA 4CQLA 3N7UA 5C18A 1XMSA 1YQQA 2EKLA 2WICA 4X41A 4OYLA 5IM4A 3W5AA 1VJDA 1CE8B 1S8OA 2XRMA 5CLFA 3DZCA 4IO1A 3H0CA 3Q7IA 2D2EA 1PNTA 4XSVA 3ZV4A 3ZY2A 1VC2A 1EJBA 2JGAA 1ILWA 4MEJA 4B4WA 1TMKA 5EJ4A 1EVYA 4JWKA 3QLJA 4KGVA 4BFZA 3QXXA 1MO3A 4W1SA 2GM3A 2LKCA 4DR6B 3EC2A 4YACA 5KSPA 3BICA 1AKWA 4XWTA 1P60A 3H05A 1TCAA 3WYDA 2QNBA 1MAWA 4V38A 4R6WA 5TX7A 2WIAA 5CXUA 5JEDA 1FIUA 1ZHOA 4M1MA 4Q19A 2YY5A 3NONA 4F5EA 2VSYA 4LAFA 3GCGA 3IC5A 1KDVA 3TGLA 3AFHA 4RDCA 4HWOA 2E5WA 2I6FA 4MWSA 2J5BA 4NBTA 5H81A 1POWA 4Q4HB 3ESCA 5ENDA 5DGIA 2E1PA 4EW2A 1T5TA 3RSSA 3KO8A 1GZSA 3ZHBA 2JJ1A 4MGZR 1TUEA 5CT9A 1MJFA 4H3HB 1FMCA 2OQRA 2PA3A 3GA7A 3FNHA 2DCMA 4NDNE 4R1SA 4WOJA 5AUPB 3MB5A 1G59A 4G63A 1YK0A 1J2JA 1DTWA 1YE5A 3N70A 3VAYA 1D0SA 4AMYA 4YCNA 3B1ZA 4YIKA 3IILA 4YR7A 5REQA 3SC4A 2CUTA 1XL1A 3S5JA 3CVWA 4BGIA 4DEVA 5F7ZA 3UVEA 3C7KA 2I8CA 2B36A 1GUAA 1IM8A 1VIMA 1Z06A 2YBEA 2QS9A 3IQFA 4HDSB 4NV0A 4NZYA 3X1KA 4LXHA 1BOFA 1XCLA 3QKIA 2V0CA 3DYBA 3EGWA 4RXUA 2QTBA 1FS6A 5EJ5A 2XD4A 3EXFA 4MLCA 2IYLD 2IVFA 3AY0A 2P9CA 2A0UA 4Y9UA 2VUIB 2QTFA 5D85A 4PC6A 2GAIA 1ZNQO 1BMQA 1SCJA 4R1TA 3AYXB 3UJ8A 1W36D 4LXQA 4CZ2A 1SXIA 4JA0A 3CEAA 3KU4A 3BK7A 5IASA 3G2OA 3BMOB 3EY4A 4LJAA 5BO5A 4A0RA 1EH5A 2X9QA 5J4YA 1RE0A 1SBCA 1HE1C 2E4UA 3TCXB 2A1TR 2HSJA 1XF9A 1JLLA 3ZIUA 2GEDA 2JG3A 5EXEA 1NT4A 1ND5A 2XQJA 2ZIXA 2IY8A 2PX8A 4EGCB 4AI6A 4LOLA 2EBFX 1DKPA 4FSXA 4I8DA 1X7XB 5KYKA 1EK0A 2AN5A 5AOBA 1M2WA 1R6TA 2QMEA 3WXMA 3F8TA 3DV0B 4IH4A 2GUGA 5E0OA 2V6FA 4LX0A 2W43A 2GTIA 3FJ1A 3E4DA 3GD7A 3GJTA 3NTVA 4NATA 4G8JA 4V0OA 1J1ZA 1YUNA 2W9XA 4ID9A 1QWOA 4IVNA 5FQOA 4YRIA 4ENPA 1ID8A 1Y3HA 4OB8A 3KFVA 2O8CB 3MUEA 1WQ3A 2FEMA 4MGHA 2JKVA 3GY0A 5JARA 5C5CA 3HVIA 4ND7A 1U8XX 4E1AA 2ZI7A 3PR2B 5J3JA 3HCOA 2IYFA 4BPRA 1OX5A 1G8SA 3A6PC 3U5ZB 1DINA 2J59A 3QLUA 4QBIA 3RC3A 2QSYA 1NI4A 2PMEA 3ABRB 1DOAA 1IY9A 3Q85A 1T9DA 3D6JA 3NM4A 5A06A 3O9ZA 5B2FA 1OAAA 3EULA 4BFWA 2O2XA 3LBYA 2DEUA 4LC9A 2ZZNA 1VE5A 2C7PA 2ERXA 1OC2A 2VJNA 3C98A 3THOA 5F23A 1RYMA 4LDJA 3IEPA 1PT5A 4PNHA 3H9UA 1W5TA 3OJFA 3F90A 4UTNA 5FBWB 4IM7A 2BR4A 1M75A 3JQAD 4HDNB 1VTKA 3QGMA 1XNQB 2HSDA 2QVLA 2G1AA 3V6MA 5K8IA 3C3CA 3T38A 4TPKA 1Y5LA 4JQSA 3AR8A 2HXYA 4F1KA 4HLQB 3KB2A 2Y1OA 4UMDA 4TXHA 1JAHA 1XMXA 1V7ZA 1WY5A 3KRTA 5K8LA 5KOJA 3THYA 1ZMOA 1O4VA 2IHBA 5HNKA 4ZVTA 5K8VA 1V0JA 4F8YA 2GJSA 2QN9A 3G3EA 2CL5A 4HWKA 2HLDD 4O2BA 4H08A 4QM6A 1LTHR 3PD7A 1NNEA 4TS3A 3PHBE 3GFQA 1FPQA 1JHXA 4LYGA 3SF0A 2YIVX 3QENA 1E2IA 3PQDA 2QUAA 2AOTB 4WT7A 3D8NA 4WZZA 3LDUA 2ZBVA 1KI8A 5KUTA 3HN6A 4CBVA 5BN4B 4EJSA 4BP9A 2R47A 5FHRA 4KOAA 3TLXA 1HBJA 3HBAA 2ZR0A 3K31A 1OJLA 1DDGA 1G8MA 3I4CA 1XJWA 2GPJA 4FOOA 3QLVA 5E9AA 4EJ0A 5LWQA 2R1VB 2C95A 1L0BA 2AEFA 2CXTA 3E82A 3PUJA 5EKDA 3I3SR 4Q3AA 5FA6A 3WE7A 1NBOA 2OV8A 3FMOB 4RFVA 1S2NA 4JU9A 1ACLA 1R37A 2Z04A 1E3JA 3H3XA 2NAFA 2NUAB 1R6UA 4DA6A 2GFQA 4OI4A 3U9SA 4U7HA 1V96A 1GLGA 4G4SP 3ZDYB 1L5WA 4AIRA 1VJRA 2XUGA 3EEQA 5IDWA 2IRWA 3GI1A 3WG9A 1U7PA 1NDQA 4P38A 4Y2SA 2FR1A 3EPJA 1I7LA 2J9RA 2JHCA 4P6VF 3URMA 4QBKA 4ZI7A 3DC2A 4NONA 2AX3A 1USKA 1OWLA 1SELA 2GARA 1B76A 3KQTA 2IY9A 2F3SA 4HQ6A 1MB4A 1C9NA 4KQKA 4KXVA 4LNUB 1A4RA 5HIKA 3IBYA 3LH5A 1UC8A 4QDJA 2CUKA 4MQ4A 2XMZA 4M0CA 4TMYA 3H2HA 2IBMA 3BCSA 3O0DA 1U5BA 4AJEA 1NF9A 3GUHA 1G0OA 1NNLA 3A6KA 1V7QA 4Q93A 1BQEA 4UTPA 2O7QA 2B7BA 3D7RA 1VLHA 2Y1CA 3ICCA 4ZJZA 4HPXB 1SXJD 1OI3A 3PT9A 1Z17A 2LIPA 3RQIA 3PA8A 5LBTA 4BKOA 3I92A 1O9HA 2B9EA 5KVSA 1UAAA 1K1EA 5L4SA 2C0PA 2NTNA 2RH8A 1RWXA 1SOUA 4PHHA 4B32A 1V8FA 1MV5A 1SD2A 1P6QA 3JAWA 3SU8A 1ILEA 1NXPA 1S2IA 1MBZA 1S89A 3EDOA 3I9OA 4LJ7A 1YDWA 5BSWA 4TRNA 1AGNA 2IYPA 3PKZA 1O5TA 3WGVA 4WA8A 3WK5A 1P0MA 2P2DA 2XUDA 4UEWA 2M2IA 4B6RA 4DC1A 3ID6C 3A9RA 4Q9AA 2NU9B 3F98A 1NC1A 3HP1A 3JQDA 3Q10A 1PX2A 3FLAA 3T4XA 2WUEA 2JGEA 2NO5A 3R6TA 1H2BA 2HWXA 3IPYA 3OJOA 2VK2A 1KO4A 2I0FA 4OREX 3RVSA 3WWPA 2IHNA 3AUFA 3RB8A 2FFQA 2VUHB 2QRPA 5FUXA 2CK3D 4J1QA 4EO4A 5JMTA 2PNFA 3HBMA 2PZLA 1DEAA 2NXNA 2HIAA 3HRHA 1TZ2A 1DLJA 3MJVA 4X1OA 2VDKB 2QLJA 4XIYA 3RVNA 4ZMRA 1HSZA 2G5GX 4I50F 3ZJYA 1HFKA 1KPGA 1PHPA 1ZNXA 4S1WA 3L7LA 1OZ0A 1AVTA 4NRDA 5EGSA 3AR4A 1T36A 4O29A 3CZ9A 1IY0A 3QFHA 1QP8A 5GVRA 1N34B 2J3QA 4TLLB 1B2LA 2WZCA 4HAXA 1JDJA 2BFAA 3F5SA 3IBSA 3ER9A 1HX7A 2WDZA 5FD8A 3VDNB 4N4AA 2EFCB 4WLUA 5HBRA 4EPTA 3R8FA 2YHIB 3V5NA 4MUAA 3FR8A 2P68A 1SKMA 2W2PA 1WCIA 2H2HA 3ME5A 2X8AA 3U7GA 4UCFA 1KRXA 4NCHA 5F64A 1EDBA 1ISIA 5FRDA 1JT9A 3FDZB 4I66A 3FOBA 3H84A 4IOKA 5K9ZA 2VQSA 2X2OA 3GRCA 4J0FA 3RIEA 3TW0A 4ZHQA 2R00C 3L7YA 1GGHA 1PEYA 3CYFA 1SFRA 5EIOA 4CXMA 3ELBA 2B4KA 4UDOA 1ZM9A 2EL9A 2ONZA 1ODCA 4O63O 2QAGA 3IHKA 3KT8A 3DCJA 4NV3A 2DUUA 4V0MA 2HMSA 1EX1A 5T5QA 3HVHA 4DZZA 2XOKD 3KJXA 3RFCA 4UVDA 1EFCA 3WAKA 5C1BA 2GBPA 1U0JA 3B3JA 2E4XA 1UBSB 4B6EA 5KQSA 1ZISA 2N1BA 3CR3C 3IA7A 3KFLA 3RHZA 3PLRA 3PFNA 1SC4A 2YASA 4GSYA 4P35A 5SY9A 2IUYA 4C6TB 1QK4A 1TU0A 1EGQA 1ONOA 2VDLB 3O31A 3RVKA 1JZSA 1MX1A 2JLCA 2VBFA 1B6GA 1VA4A 4CPDA 3R4CA 1V4BA 5FOSA 2FZVA 3RIMA 2PKCA 4EM6A 1E0DA 1IM2A 1E92A 1EJ2A 1TEHA 2G7ZA 3MBKA 3AVQA 5DULA 1H0RA 4AB1A 1QNFA 1MIOB 2XOKA 1TF5A 2IGTA 4HH4A 4R2HA 2QGNA 2P1ZA 1IPEA 5EJMA 3OT1B 2YVLA 4ZAXA 4X3CA 3KVOA 1EQAA 2DHEA 1JBKA 5EJGA 4Y2JA 3TZHA 3WL7A 4NQRA 1Y4AE 4LV6A 1P39A 1SIOA 4OHXA 2G1KA 4CTNA 3CUSA 5BSVA 1JA1A 4NCNA 2R751 3HCFA 4FMDF 3AG6A 3KXIA 4IINA 4TQUS 4FT2A 2Q1YA 1EUYA 3VNVA 3SXUA 5CRIA 5D51S 5I4CA 1SNYA 1UJMA 3WYCA 1UXGA 1Y9DA 4XR4A 4K05A 1NV8A 1YACA 2OHFA 1TF7A 1ZC4A 2ZVJA 1JLKA 1YULA 2PR7A 1AQLA 1G1AA 4NECA 1L1FA 3WX0A 4OHFA 3FFTA 2SICE 1PDWA 4K0KB 2P6MA 3CQ9A 3A6EA 3ZXSA 1VPWA 2OQIA 3GEDA 4Z3KA 2BFFB 1NXXA 1TW3A 1RAAA 4WZAB 5AJYA 5HJ7A 3PXAA 2D1QA 1AKYA 2QTHA 2IU6A 3U4GA 1TPYA 4RJLA 1DADA 1QYDA 2M6KA 3F4BA 3OWXA 3PX7A 1G55A 1NXWA 3IUSA 1TLFA 3PX3A 4K40A 4K8OA 4DM3A 2QP3A 1DHRA 3MS2A 3R0XA 3ZVLA 4DLPA 3NHMA 4L0DA 1E20A 3STYA 3HYNA 4QAQA 4A0HA 4WOCA 3RJTA 5TLSA 1XEAA 1SBYA 2EWMA 1R16A 5BYAA 3WGIA 2IUTA 2C0CA 4FZ3A 4LOAA 2G4VA 1AUOA 4N03A 5HUJA 4V1CI 1I7QB 4I4TF 3QY0A 4A1OA 3BAZA 3ICEA 3K9CA 4DR7B 2NW6A 2UZ1A 3BE5A 5HR5A 1DOZA 5KNDA 3BCRA 4XEHA 5AESA 3NC1C 4HTFB 5F3WB 2VQ6A 4KE6A 2WTEA 3BAFA 4CHGA 3FOZA 3GLIB 2ON6A 2HV9A 1R15A 3TTXA 2ISCA 2XQIA 1RLMA 1QVRA 1XEXB 2R6FA 3FFWA 4OGLA 4RKWA 5JZMA 3QPBA 1PJ2A 3F7TA 1NP3A 2C03A 1K7FB 2VT2A 3EUWA 4LJ9A 4Q9DA 2P9HA 1ACJA 1T2NA 2J6HA 4J0EA 3N7AA 3MT8A 3ODPA 4FNGA 9GPBA 1GYRA 3HY3A 2GRAA 1T9GR 2OBLA 2I1VB 2VSXA 2ERYA 2Y99A 3E23A 2K6GA 1HLGA 2BVNA 4E3ZA 2OV6A 5ADHA 3N58A 1G5FA 1QV7A 3SLGA 2KB0A 4QWWA 1H3FA 2Z3ZA 3A1FA 2R3SA 2PX3A 3HUFA 1YA6A 4BV3A 4F56A 3T9EA 2TMGA 2ONYA 3DAFA 3M4XA 2NTJA 4LE1A 4J0KA 3E1SA 2K7ZA 2JFVA 1E3EA 1RWOA 1V48A 2GZHA 3DL2A 4FKMA 4WXEA 4D9MA 2A84A 1X6VA 2YY7A 3D4IA 1Y89A 5AM1A 4ZOBA 1MR3F 3LVQE 4X8OA 4YI5A 4AY6A 1LRKA 2BZ0A 1BFDA 2Z6AA 2G0NA 3DV2A 1CCWA 1AUXA 4V0NA 1DIHA 2O2IA 1GNTA 4HDOB 4X5OA 3ZGVA 5KOIA 1RM5A 1VMAA 3KOXA 3MELA 3AM4A 1U0EA 4X85A 1GO2A 2YWGA 2YFYA 1P5RA 3WDSA 1YVDA 3L1UA 2DRIA 4LY9A 4ZC8A 1FW6A 5LQSA 1I2CA 4RKYA 4WN9A 1Q2UA 5DT9A 3AZQA 3EHDA 5T6MA 1YZVA 3H2JA 1FMLA 2JEYA 1WPGA 1RKBA 2V9PA 4ZHQF 1WSWA 4WZBB 3RBVA 4BMYA 1JFSA 1PWHA 3V8VA 3CNNA 4F6LA 3NG1A 2FLKA 3C16C 3CRVA 3LUAA 1R66A 2EP8A 2FUG1 1DAIA 3DQQA 3MJDA 4OXYA 5JFOA 2HQRA 2PQ0A 1JF8A 3A37A 5J23A 2RAPA 2JFHA 4QVGA 2WYWA 1UBLS 2EF1A 3RSHA 2Z8YA 4DA8A 1S7CA 4E03A 2G3YA 3JYQA 4FI3F 5KSZA 2YXNA 1HEIA 5GV8A 5AW6A 3NYWA 4NXMB 3LX4A 1O6CA 3CEPB 3CBGA 3S70A 2GZMA 3IE0A 1SVLA 2O4CA 2IJGX 2PS3A 1WMBA 3OT4A 2JAWA 4D0RA 1AKEA 4L1KA 1C81A 1RADA 1Q19A 3RASA 1REQA 1V7PC 1QAOA 1CQZA 2DPYA 2I6QA 3ILHA 2ABWA 2J33A 3LCRA 2NU7B 4M49A 4AUKA 5DLDA 4OHMA 5T67A 4KYUA 4EQ6B 2AFHB 3PVCA 1YI0A 4NCIA 3MMNA 2IEGA 4FFMA 2QRHA 2VDVE 1GKUB 3LVFO 4P2GA 5E2AA 5I9TA 4ASUA 3IQXA 1YZFA 1NRXA 3SEAA 4D2IA 1CS4C 3A4NA 3PNYA 3Q0TA 2OFXA 3IPLA 3GRRA 3ZWPA 1DJPA 1CDOA 1H66A 1MP0A 2E37A 2H5EA 2V5AA 1SCUA 2Q4BA 3FJOA 2IEZA 4DJFC 4FWTA 1P1KA 1V47A 2W2TA 3OZAA 3UGJA 2R6JA 3OCYA 3OLWA 4RD1A 4W5WA 5JASA 5IWAB 4G81A 1JTEA 1QFXA 1J56A 2VHYA 4MCIA 1VGRA 4RJTA 4MQEB 5C32A 3ZI4A 2WJGA 3EF0A 5CYGA 4LKOA 4BO1A 2D5IA 5K7SA 4M0DA 3OHPA 3WKEA 1JIXA 3BS4A 3VTKA 2WJPA 1NN0A 4L6CA 3NT5A 1HL7A 5F12A 4KDFA 5CDFA 4S1VA 4E2FA 1JWLA 2Z58A 1JDVA 4H7EA 2OMEA 1J7KA 1Z29A 3E9QA 4TTSA 2J0VA 4I4IA 3U1TA 3HRKA 1UOEA 1L5SA 4PZZA 3WR5