3ND7A

Crystal structure of phosphopantetheine adenylyltransferase from enterococcus faecalis in the ligand-unbound state and in complex with atp and pantetheine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
152
Chain Sequence
MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 57
structure length 152
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nd7A00
1GTSA 1G8GA 1ILEA 3ZJVA 1QNFA 3ND6A 1ZJWA 2DLCX 3PRHA 1FFYA 1Q19A 4WSOA 4MAFA 4PBRA 5F23A 4CT0A 4QRDA 4MW0A 1KH3A 4MUGA 3RBAA 4UZEA 4HJRA 3CLTC 4K03A 3CR8A 2CV0A 3ZJUA 1M8PA 1OBHA 4U63A 1M83A 1O96A 1Q11A 2CYBA 3X1KA 2J08A 3TZEA 1KQOA 1GAXA 1GTRA 2WSIA 3IVXA 1LW7A 2OV4A 1J1UA 3DLAA 1WXGA 1N2GA 3CLSD 1T9GS 2QJTA 3GLVA 3OP1A 4PY2A 1JZQA 2PXHA 3N8HA 3C8ZA 1XNGA 3TQIA 1DNPA 1N75A 3COWA 1VL2A 1X6VA 1TYAE 1JIIA 3H99A 3ND7A 3IUEA 1QRSA 1WQ3A 3P52A 2QJFA 4XFJA 2GOYA 3H9CA 1KQPA 3PNYA 3Q10A 4PBSA 1M1ZA 1MBZA 1QRTA 4MUJA 4QREA 2JAXA 5AHWA 2X1MA 4MW5A 3CVVA 4NAHA 3CVWA 1MAWA 1K4MA 3D6VA 1N1DA 1QJCA 3RHSA 1R6TA 1WXFA 4G5YA 3AG6A 1TYBE 3MXTA 5HG0A 4AQ7A 2H2AA 1O0BA 2QUHA 1N2OA 4Q93A 1U7DA 2CV1A 1QU3A 2EJCA 1JIJA 2YWCA 2J4DA 5DB4A 4MW2A 3AL0C 2EL7A 1GZUA 1Q77A 2HGZA 3FETA 5J58A 1LI7A 4YP7A 3Q12A 1M8JA 1NUTA 1IRXA 3FOCA 2D13A 2CFOA 4KPUB 4MVYA 4EFKA 3Q4GA 1KAMA 3MLAA 1GPMA 3TS1A 4ZCTA 3UC5A 5KHAA 1U0BB 1N2JA 2GM3A 1NP7A 4MUEA 3SEZA 2DEUA 4HPWA 4EG3A 3COYA 1KH2A 4MWCA 1KP3A 4ZT4A 4R2MA 3P0JA 1I6KA 2PIDA 2QTMA 1O94C 1G8FA 5J59A 4F3RA 4JXZA 2AG6A 1OWNA 1TYCA 1JEDA 3A04A 3DV2A 3PNBA 3QTBA 4KR7A 5FO0A 2A4MA 2X0KA 3MLBA 4G5FA 3NBKA 2AZXA 4EG8A 1V47A 5KWVA 1JGTA 1Q15A 1J21A 4EG7A 1WKBA 3COZA 3G59A 2VXOA 3I05A 3QTTA 3E27A 1G8HA 1FYDA 1O95C 3HGMA 1T9GR 1TQ8A 5HUHA 1YIDA 3IDFA 1O0CA 1ZUNA 3X1JA 2CT8A 4I6JA 4XFDA 1BS2A 1ZH0A 3G5AA 4DDKA 5J5AA 2DR2A 4E1AA 4OJMX 3ZIUA 1N2BA 1J1ZA 1MC1A 2YXNA 1J70A 3RJZA 3UOWA 1NUQA 3MUEA 1X8XA 3SP1A 3VGJA 4J75A 3VRHA 2IP1A 1F7UA 1QU2A 1NSYA 3U1VA 4FZJA 3FY4A 3N05A 4HK4A 3TQOA 4DLPA 4ND7A 4ZT7A 4KPUA 1ULHA 4EG6A 4NATA 1CT9A 4I6GA 4MW9A 2WB2A 3HFJA 5TGTA 1NUSA 4MUIA 5HUJA 1LI5A 3FHJA 1J09A 1O97C 4KR6A 2RE8A 4KKVA 3CLRD 4UZFA 4MULA 4Q16A 4CDMA 4OUDB 2PG3A 3FWKA 3H9BA 3KT8A 1OBCA 2XRYA 1WXHA 2CYCA 1D2RA 3INNA 1NZJA 4DE5A 5LM3A 1XNHA 4U7JA 4ZT3A 1T6XA 3ZJTA 3P0HA 4F4HA 1B6TA 1EFPB 4A91A 3M5WA 4TS1A 2A1UB 3D6UA 4GU5A 1EFVB 4L2IB 4MW7A 1OWOA 1T6YA 2A88A 5IJXA 1WZ2A 3UY4A 2QJOA 2BTEA 1EJ2A 1NUPA 2O5RA 2J5BA 2QTNA 1H3NA 2A1TR 1F4LA 4J76A 5FNZA 3OTWA 2QUIA 1O6BA 1T6ZA 1WJGA 1NURA 2H29A 2PFSA 5LFAA 2ZP1A 2RD2A 2D5BA 3IUBA 2QUKA 3CLTD 1G59A 1R6UA 4ZCPA 5IHXA 3MMXA 1TFUA 3K32A 3DO8A 3HV0A 3IMEA 2I1LA 1IQUA 1TEZA 3HZRA 5DASA 1OWLA 1M8FA 3KT0A 3IOEA 1JMVA 3IOCA 4MVXA 3SEQA 3SYTA 1OWPA 1PG2A 3P0IA 3SZGA 3A2KA 3AG5A 1EUQA 1O5TA 2V0GA 4ARIA 3LCJA 2ZUFA 1F7VA 1EXDA 2CSXA 1M8KA 1PG0A 3A4IA 1Y42X 4MUHA 3ZUGA 4ZCRA 2D54A 1JZSA 5LLTA 1K4KA 1I6LA 3G6KA 3NBAA 3F3MA 2Z08A 3LOQA 2HMAA 3K9WA 1KQNA 3PNVA 4QBTA 4K0RA 2WQ7A 2DETA 2J09A 1GN8A 4OUDA 1JILA 3HL4A 1KR2A 2AKEA 3CLSC 4YP6A 1KAQA 3SDBA 2A84A 1YUNA 2Z09A 4R0NA 5TS2A 1WXIA 4DDMA 1H3FA 1VBMA 3KT6A 4G6ZA 1I6MA 2X1LA 4CQNA 1MJHA 2Z3VA 2E21A 3ILVA 4EG5A 1QQTA 5K0TA 1EFPA 2PZ8A 1H3EA 2DUMA 3FI0A 1KP2A 1YUMA 1I2DA 2A1UA 3FIUA 1MAUA 1EFVA 4L2IA 1F9AA 1JEEA 4ARCA 5KCMA 1NI5A 1WOYA 3S3TA 2O8VA 1IQRA 1U7XA 2E0IA 1R6XA 3H05A 2R5WA 4HJXA 4NX2A 4JXXA 4RPIA 1MB2A 3BL5A 3CLUC 3ND5A 4YMIA 3DPIA 2VTBB 1HYBA 1WY5A 1M8GA 1H1TA 2WQ6A 5JBNA 3CVYA 3KFLA 4MWBA 1J20A 1K92A 4MVCA 3IVGA 3UMVA 2DERA 2YWBA 3FDXA 3RK1A 3AFHA 3ISJA 4GRIA 2BYTA 4BWVA 3VU8A 1OD6A 2IJGX 4MW4A 4MLPA 1PFYA 4JFAA 4JZYA 5FO1A 3N2YA 4YP5A 3GUZA 2XRZA 1N77A 4EGAA 4MUFA 1O94D 3JXEA 3TZLA 4XSVA 1QTQA 3COVA 1YULA 4MQ6A 1JIKA 1XJQA 4DDHA 1KH1A 4KR9A 3IMCA 3TNJA 4RUKA 3ZXIA 4NZPA 1GLNA 3IVCA 4S1OA 4NAUA 3RFFA 3AKZA 2PZBA 1VBKA 1P7PA 2J07A 4DJAA 1O95D 1RQGA 4X0EA 1WXEA 3IOBA 1IQ0A 5TEWA 1N78A 2E18A 1A8HA 4WNYA 1N2EA 1MOPA 3ELBA 1IHOA 4ND6A 5EKDA 1IH8A 2DXIA 2CUZA 1U3CA 1WQ4A 1MRZA 3NV7A 1EUYA 3PXUA 2TS1A 4MWDA 4YBRA 3X1MA 2JANA 1YI8A 3CLUD 2G36A 5K0SA 3L93A 4R2LA 1K97A 2A7XA 1YIAA 3N9IA 4MW6A 1JHDA 3CA8A 4P2BA 3IODA 1EE1A 1IFXA 1PFWA 3CVXA 3HMQA 2HZ7A 4U8HA 2VTBA 2ZUEA 1U3DA 5BNZA 2A86A 5DEOA 2QTRA 5DK4A 3FG9A 1O97D 1O96B 1SURA 2JA2A 3ZGZA 4CDNA 1XNJA 4AS1A 3IMGA 1PFUA 2GKSA 4MVWA 2QUJA 4ZT6A 3FNRA 4H3SA 3UK2A 5TEVA 2X3FA 1VBNA 2YY5A 3QE4A 1V8FA 2OQ2A 4ZT2A 1QRUA 4JYZA 1JECA 1N3LA 4I6EA 2NZ2A 4ZCSA 3GMIA 2A1TS 1VLHA 3CVUA 3CLRC 3KT3A 2IELA 5H7XA 1MB9A 2PZAA 4NDAA 2DPLA 1N2HA 4EF6A 1KORA 4MUNA 1PFVA 2NSYA 1COZA 4MW1A 2V0CA 5H16A 3SZ3A 2B7LA 1UFVA 4MWEA 4ZT5A 4MUKA 4PBTA 1S4MA 3FH0A 1NUUA 2CYAA 4ZCQA 3RK0A 4DNXA 2C5SA 1IVSA 3LE8A 4EG1A 2CV2A 4EG4A 1NYLA 3A05A 3ZXSA 1ZH6A 1KKUA 3AIIA 3L92A 1TYDE 1OWMA 3IH5A 2E89A 1N2IA 3H97A
chains in the Genus database with same CATH superfamily
2BF4A 3MUFA 4CKZA 4DHWA 1JAHA 3TYXA 3IURA 1RDFA 1RLUA 3TTWA 5LU8A 4BAGA 3PC3A 1PDWA 1T0UA 1JG7A 1U7OA 2EFCB 3ILHA 1T8UA 2HA0A 4G0ZA 5TIIA 3S99A 4F3NA 4XD7A 1FRVA 1FK8A 4YUZA 1W88B 1JS1X 1L7PA 2FZKA 1CC1S 2Q29A 3FB4A 4P7JA 4UBKA 4PYRA 4RO0A 4QRDA 2ZUCA 3K8QA 4ARVA 1N1MA 4Y2TA 5CLJA 2UUAB 1I5RA 5BSEA 4UD6A 4MCHA 1DJOA 5H9WA 2WTBA 1WPQA 1SG6A 1T36B 3OE7D 3SBEA 3ZK8A 1KQOA 1MNAA 3BGOS 4WXRA 5DPMA 1QV6A 5JD4A 3TOZA 1QIIA 3R5XA 4Y6LA 3HJGA 1WHSB 1XRMA 5C32A 2KPOA 3L1VA 1BKYA 2OMEA 5GGYA 4EH1A 5A4JA 3KJQA 1F8YA 1VRCA 2JAHA 2N3ZA 3WBBA 1A9YA 1OI2A 2WINI 4FCWA 5EZ6B 1DNPA 2EKQA 4B6SA 1HQKA 2EBWA 4DXDA 4D57A 1XTBA 1P80A 1FUYB 1ZA1A 1X7DA 1QF9A 3KPJA 3E18A 4NNPA 1FSSA 1CF2O 1ZUIA 4YC7A 1GT6A 3JD0A 4IIEA 2QS9A 1LU9A 2FPOA 2OHVA 3EGVA 2ZAIA 3OJCA 2IV3A 5BN5A 4L78A 2X0DA 2DTEA 2HWYA 3EEFA 3IXLA 4AF8A 5HOQA 5AM0A 4Y6PA 4ASUA 4PZZA 1J7JA 3DNPA 1JEJA 3TQHA 3A06A 4G8JA 5CRIA 1PWEA 3UJDA 4JEHA 1XTKA 3ESQA 2ZUTA 2D0IA 4MJ3A 1ECLA 2V7UA 4Y1RB 4Y30A 1Z83A 1GL9B 4J6EA 1G4UR 4R5HA 4DV2B 2GPTA 1YZKA 3NANA 3OOYA 1J8FA 4CHTA 3SI7A 3D0QA 1YUBA 3V33A 2W2OA 1FNBA 3F9RA 2OZVA 2D00A 1XZHA 1NXQA 4ZVTA 4C04A 2PZKA 3DMHA 5ECWA 4AQ7A 1KDPA 1KK0A 1QX4A 3H11B 4QPCA 3CZ4A 1P4SA 1VM6A 2C03A 1WBJB 3AFGA 1NVXQ 2EL9A 3DZJA 4RK7A 2PR2A 2O6HA 3WL7A 2K2WA 1ZI8A 5BQ5A 3BGIA 3X43A 3QVKA 5I7AA 3KOZA 2JGJA 3I0ZA 1LLFA 1JYFA 3KYCB 4TL6A 2SCUA 1JAYA 4E5NA 2OPHA 4DLXA 2EAUA 4Q1BA 3FETA 3VOAA 5K7SA 1G5FA 5JDIA 4RTQA 3E4CA 4LFCB 3H16A 2Y27A 4LZPA 3TSOA 1Z8NA 2FJPA 3TB6A 1N3YA 2D13A 4TRMA 3T7AA 1UM9A 4EJ2A 2CXNA 2AGVA 3DOFA 4CI9A 3QVVA 5B1SA 1JF8A 1PNQA 1P0PA 2GVDC 1RZRA 3NATA 3QFTA 4DJ5X 5F52A 5CPBA 1XDWA 2JKVA 1P39A 1S9HA 4OJYA 3RC7A 1D0VA 2RGNA 3RO7A 1RMTA 2J9ZB 1XELA 3QPCA 3KKKA 1USUA 1U0LA 3DP9A 2B4QA 1QIMA 1XDBA 3F74A 1HE4A 3P7MA 1MPTA 3SAJA 4DR5B 2X3YA 3PL5A 2QSZA 3QJ5A 1R88A 3BMNB 4N7MA 3OT4A 4H60A 3GP8A 1TAUA 1I3MA 4ZI2A 2FEPA 3I28A 5TPWB 1GAWA 1ZUWA 4JP2A 5AJXA 4RABA 1O94A 4BMYA 4MXDA 3V46A 1YB4A 2PKXA 5CNJA 3RTGA 4R81A 5J2TA 3AZQA 5ALUA 3L06A 5EJ8A 1FRQA 3RSFA 4H1UA 2A2ZA 5JV5A 4E31A 5AHRA 1BKSB 4G5FA 4LBWA 1ABFA 2GPNA 2IZ1A 4HLQB 3DVSX 2AZXA 1TA4A 1TUBA 3PQCA 3UZUA 1GKYA 1RYFA 3CMMA 4PGHA 1YA6A 5AW7A 2YN2A 3ZZ1A 3KKQA 4C6TA 1RQRA 1RBMA 3IIIA 4JR0A 3QTTA 3B9PA 4M0FA 1A1VA 3E27A 1VL6A 3BMXA 4P93A 2OD2A 3PE3A 5KYUB 4CUKA 2KI5A 1BH2A 5IBRA 4Z9BA 3TXYA 2O48X 1KI1A 2C88A 2WF7A 3A9WA 2HU5A 3FUCA 3RVLA 4I1VA 4R71A 1SZCA 3HJAA 3G02A 1DMRA 3N28A 1F14A 3R44A 1U90A 5AM5A 4RNDB 3PJGA 2JD2A 1N6PA 1LUAA 1W52X 1OLXA 2CN1A 2RK6A 2VDJA 1YFJA 4TM8A 5EWJB 4E46A 4KO4S 4QBGB 4XTRA 1M6HA 2XYPA 5BO5A 4S0XA 3IQDB 4ARUA 1TCAA 3SEAA 1J1ZA 1BE0A 3ZKWA 3SZOA 2WSMA 3QWIA 4NCXA 4TTVA 3REQA 4CNQA 4DCJA 3O9ZA 5JBIA 4QYXA 3G17A 2NQTA 3RROA 5LR6A 4O4LA 4YLGA 2XBLA 4D3ZA 2WYOA 3TMKA 1AKNA 2ZIVB 1E9BA 1KEEA 3NHZA 3IT2A 4BJ5A 2HRBA 3I4FA 4OH1A 3WYCA 1EA7A 1KO4A 3GLRA 4FTWA 2MR6A 1ADFA 3IP6A 3CTMA 2PGXA 2PNJA 1UWKA 3RYTC 4B8YA 4WT7A 4PINA 1HNWB 3JSAA 2ZZMA 1QK5A 3DAHA 1JDVA 1VP3A 4OVKA 1F6BA 3BHMA 3NXSA 5B5SA 3RJ9A 2WPDA 4LWQA 3JWGA 5CYPA 1CRZA 2XUJA 2QM7A 4E6PA 2FN7A 1BWPA 5JQGF 1J42A 2C54A 4F3YA 4F4CA 2GFIA 2XDQA 3D5EA 1TT7A 1CZUA 4QOSA 5E9WA 4EPVA 5JZSA 5KNCH 3EPJA 2A0FA 1VKOA 4DLWA 3IDAA 1JEYA 5LXTB 1W0KD 3U13A 1K88A 1X7XA 1MQ9A 1YC2A 1PR0A 1E1KA 1CXZA 3JY6A 4LSZA 5DI3B 3M5WA 2W8BA 4PLZA 2A1UB 3SHQA 2HW8A 4Q4AA 4Q1CA 2IPXA 3GROA 3X3HA 1WZ2A 3ZW8A 3E9DA 1AKMA 1R0CA 3WSVA 1PT8A 1TRKA 4LY6A 2OAP1 2VDPB 1VJGA 2L19A 4D80A 2QTNA 4MV0A 2HA5A 2HXYA 5HEKA 5IKMA 2VS1A 3CUKA 4BZPA 5E1DA 4Q6WA 4C78A 1FTSA 1T2EA 3F1KA 3O1JC 3PTZA 4L0MA 4XJVA 4AUEA 4II2A 5JXGA 3VA7A 4IL5A 4FWTA 5IVKA 1C5KA 1NURA 3CCBA 3JATA 3RSHA 3ZZTA 1NW6A 1OROA 1XDUA 3DCIA 1OR8A 3IERA 1BDMA 1DARA 1FXUA 3CLTD 1M5TA 3OFND 4NZZA 5CFQA 3R7BA 4N54A 3UTDA 4ZCPA 4UC0A 3VNSA 4I4TF 4KWTA 4XAQA 5JH7B 1P7ZA 1SOMA 3ABRB 4PFSA 1VSBA 1NQUA 2VYVD 4DPLA 1LX6A 3PXCX 4LQ4A 1M2WA 2H9IA 5DASA 5FOVA 3R6TA 3JQ8B 5AW9A 1VGVA 2JDIA 1JMVA 5DNCA 3SEQA 1G19A 1T5LA 1VXOA 4PLHA 1ZK2A 2P3SA 5HFJA 2XUOA 4OHZA 4G0NA 4I2VA 4FFSA 1KJQA 5AVQA 4L9SA 1R0LA 4UCXA 4FR0A 2BFFB 4DG5A 1VJRA 2ZT8A 4ILKA 5ADUS 1E69A 3VR5A 5BV1A 4ZI7F 3VZQA 4I19A 3FYUA 1AF4A 3CH6A 3TR5A 1DOZA 3P9NA 4I5EA 5HBRA 4ZCRA 5H9VA 2OHXA 5AH0A 4ZAYA 4ARZB 3BKXA 4L4UA 2EIXA 1VG0B 4FXPA 4QJ5A 1ZY2A 2II6A 4BNDA 4ECEA 2O8FA 1RYDA 2WG0A 1B73A 4UUBA 4AMUA 1SC3A 2I2BA 3LUKA 2IV2X 2IHTA 5KTPA 1IONA 2AN1A 3BJEA 3HP7A 3KZCA 2A78A 4OXNA 4BNKA 4ER6A 2FCAA 3QMVA 1QG0A 2W71A 1P0FA 1GN8A 1MR3F 1SD5A 1V8BA 4NE9A 2N0SA 2YICA 1J90A 4FC6A 4L08A 1TGYA 2H0QA 3WHLA 4ZU3A 4WPGA 1TO2E 2VTEA 1YR3A 3ET5A 4H7FA 4M0EA 3GNTA 3X1JA 3FF4A 1T5DX 3PC6A 3QEMB 1TADA 1TEHA 2H17A 2YXDA 3HO8A 1KFBB 1G291 2C97A 3LK7A 3UHFA 1PHRA 2WU4A 4I1PA 3FTFA 5HE9A 1UXIA 3HDYA 1RYEA 1SHKA 5LP6B 2GFQA 4TTRA 3S1LA 3L7JA 2FZVA 4BWFB 2Y0PA 4MEBA 1O77A 4LZZA 3BEOA 3VAYA 4CIXA 4DMUB 4EHNA 2HYDA 1U9IC 4J0QA 5AICA 3BE5A 3C3CA 2I2AA 5CVJA 3ZWPA 5KCMA 2BGGA 2ZJ7A 1W4ZA 5FWYA 1WOYA 1UOOA 3HPQA 2JBAA 2B3DA 3LPCA 3NEPX 2H5JA 4WZAB 3SR4A 3CU5A 4A92A 2QM8A 3VPCA 4PICA 4HZUA 2DFDA 3SQDA 1TAQA 2R5WA 1N9KA 4YJ3A 3RSSA 1X2EA 4I5FA 5BXYA 1YD7A 3B13B 3DPIA 4YV1A 4IH4A 4J03A 4MGEA 3V7YA 1HETA 2WQ6A 2ES4A 1SVWA 3ETCA 3U3XA 3V7NA 1LJUA 1C0IA 1CQZA 2AK2A 4CMHA 1BW9B 2X19A 4F04A 2H59A 5ENVA 3B36A 4MV5A 5F77A 3MINB 1XQVA 2XWJI 3M1LA 1II8A 1U3GA 4D0RA 4YCSA 4ZCLA 2H11A 1IWPB 3TTVA 3BK1A 2VSFA 3I8XA 1RJ9A 3SDZA 1FB5A 1GM5A 1EG7A 3UAWA 4CIAA 4PX9A 4EUHA 4LOIA 6LDHA 4JQZA 4ZV7A 2EJVA 2PVPA 4X1KB 2NW6A 1OVGA 2PKYX 5AKYA 1YC5A 5E38A 4GKVA 3GGGA 4CEIA 1CUBA 2WSSD 4Q3OA 3FR8A 4IOMA 2QN6A 4ALKA 2QR5A 1NW4A 5AUOB 3QVXA 5DTMA 5F78A 2UXDB 2YJZA 3SCZA 2Y66A 2O8CB 1AUXA 1X2BA 4RK0A 1UBJS 4DDHA 3O7WA 1ECCA 4FFLA 2A0YA 2J6CA 2VK1A 4GKKB 1QORA 3B1JA 5D1NA 4TRNA 2M1XA 1KJWA 1G21E 1H69A 2PLRA 3BGSA 3IVCA 2WFLA 3NIWA 3I32A 4OQDA 4P3YA 4BMVA 2PZBA 3DFKA 1VCHA 2PX6A 2G09A 2PH7A 1A72A 2QQ0A 2VJCA 3N87A 1QYCA 1QWOA 4NAVA 2EZ9A 2ZJBA 2BFPA 4QXRA 2O3SA 2GZSA 4RY9A 3RM3A 3KVOA 5A3VA 5BUQA 4AO6A 3KQMA 5KOHA 4G0UA 2QX7A 3Q9UA 3FDZB 5CT9A 2FGJA 5K01A 1EJBA 1OFUA 4LMAA 2RHDA 3DQZA 4HSEA 5EKSA 5AKZA 1L4MA 5LN1A 1VJ5A 1UPAA 1Y5LA 2P78A 2JHPA 2WKSA 3ICVA 1AN0A 2IP2A 2BRUC 3TZCA 2P5SA 3C6BA 2LCIA 3ICPA 1XTSA 2HCRA 3PUZA 4LNUA 1YRAA 4MWDA 2XMSA 3QLUA 4CKCB 4KB5A 4EB3A 2ZTMA 2WWXA 2GFHA 2GCEA 1EI9A 1HOXA 4KNWA 3DHVA 3UV6A 3WBFA 3D2BA 1IUPA 2EIHA 2QX8A 3I0MA 3Q41A 1VPDA 3QX7A 4W8GA 5CYGA 3CO5A 3KEOA 1HTWA 2ZFUA 4P2BA 2J3QA 3S6JA 3TR0A 4C1BA 4IJQA 4CCSA 3JYLA 3EVCA 4RTPA 3P45A 4HAUA 1PV2A 1EWKA 1AUPA 1ZN8A 1U3DA 1OGYA 3AP2A 2JLZA 3NC4A 3ISTA 5DK4A 1M2EA 3UWSA 6REQA 4XDZA 1E8MA 2AF3C 5AJYA 5E6UA 1P1FA 2GGSA 2PD3A 3ZU4A 4HXYA 3R6GA 1M67A 1Z34A 1AK1A 1ZMBA 2DHEA 3G9TA 4QLBA 2QMQA 5KQRA 2ZCJA 2IOYA 3H04A 2XAUA 3IQZA 2GKSA 1AA6A 4OMCA 4P7KA 3ZV5A 5FLEX 1Z7EA 1HDCA 1KMCA 1QANA 1Q83A 2JHFA 3A6ZA 2DAPA 5IDWA 1N6OA 1V95A 3QE4A 2GDJA 2JLVA 2EV9A 3BGWA 3K6RA 3GGJA 3HXTA 4RPGA 2GSWA 5KREA 4QFMA 4CLRA 5ELLA 3GJ5A 4QUEA 3IOMA 5BYAA 4TLDA 4JQOA 1RHKA 4CTOA 3GVCA 1ML4A 3MOSA 4O5OA 2FFAA 1ID1A 3CRVA 4OQPA 3I64A 3ZD8A 1ONOA 2VXYA 3PDIB 1ZEJA 4UNNA 3EC2A 2XEXA 4W8OA 3R8FA 2AYZA 1K0UA 4ER5A 2FPIB 1ECGA 3AEZA 4D0LB 4CFYA 2H06A 1PFVA 1XZFA 2IXDA 3ZZMA 1A50B 1TFRA 3ZEAA 2O8BA 1EAYA 2P77A 3TTXA 3NVAA 3EXHB 4NBLA 1C8BA 2YNMC 3T5CA 3Q7TA 3NGMA 2UYCA 1PU2A 2JLRA 4UU0A 1CY8A 3T7DA 2PXCA 3GFSA 5FBRB 2AR7A 2C5SA 2WU0A 4NMMA 1IVSA 3OOSA 3T3DA 5KJFA 3OZSA 2NZXA 3AEUA 4EG4A 3BQMB 2XUHA 2ECPA 4OKNA 1XYVA 2VHYA 1O95A 4BO0A 3ESBA 2NOAA 4KL8S 1ZRHA 1UBFA 2HT1A 4QGBA 4EMTA 4KLCA 4KRXA 3HR7A 4L75A 1USIA 4LJ5A 4KFSA 3O21A 1X7ZB 1PF7E 5CLGA 3BJZA 4P4SB 3KPUA 3A1CA 1FPQA 1T2DA 4IZIA 5GONA 1NJ1A 2AFIE 2D2XA 3LGSA 5CM9C 4XGQA 3VI3B 1TK2A 3OE5A 4MYRA 3R7AA 3BWXA 4D8UA 3CF6R 1TQDA 4J6FA 5G02A 3PZRA 5CDFA 5BRAA 5I01A 4BPBA 3P0RA 1JMYA 3EBLA 3EG9A 1NLYA 4GLLA 4JJGA 5CFLA 3PA8A 5K0BA 4JYCA 4Y67A 3BWYA 4BUJA 2P27A 5IT0A 2O57A 1S7GA 3DO5A 3MTDA 1R3DA 3B6EA 3KHUA 1OBHA 1XVIA 1Q11A 2V5AA 4OLFA 1VL1A 3V32A 2NP7A 1V1MA 3I9NA 1KYXA 3LUDA 2O6LA 2Z9DA 3AM4A 3HN6A 1R0SA 7ABPA 1GAXA 2ZAMA 4G5OA 1PFKA 4TLAA 1JH9A 1LW7A 2HO4A 5EEGA 1AM4D 3NJRA 4E2XA 3I6ZA 3MZ0A 1N2GA 3MQ4A 2CCJA 4G4GA 1ZK0A 2MYNA 2Q9BA 4INJA 2CVHA 4PHHA 5LDGA 1I4OA 1JZQA 2PXHA 2Z9CA 4ZQFA 5JLJA 2IU4A 1GZ7A 3K20A 5DHTA 3SSAA 3D81A 1A1SA 3RWOA 1D04A 1N6LA 1N75A 3TVDA 3DLHA 2NXNA 1GGMA 1RXIA 5LDDC 3QNMA 4QAQA 2CD7A 1KI2A 1KVQA 1UIMA 4Q5IA 2JAUA 1GNRA 3SQNA 4J0EA 5A6VA 3BMQB 1EFRD 1NVMB 2ZITA 4X1YB 3UFXB 2OHFA 2VRCA 3RUPA 2COEA 3UT5A 5LD2C 3IP1A 2B3TA 1JJVA 2IYOA 3FCSB 2C1EA 2VWQA 4HWKA 5L7WA 1GWNA 3VYVA 2AEEA 1LXCA 4EQZA 1Y63A 3ZHQA 1AKUA 3QOFA 5J4HA 3G8AA 3PIDA 4IIVA 1E6UA 5EAIA 3WQSB 2JAXA 1WABA 3BN3A 3REFA 2AXEA 3KM0A 4NAHA 4BMXA 1UBMS 3BJRA 1OQAA 2VXBA 5IDYA 3M0EA 1E2IA 5PNTA 1MF7A 5K3CA 1WEKA 1QGOA 1ULSA 2XUKA 3AG6A 3HP1A 4B47A 2VUUA 3E5NA 1MFPA 1QB8A 4WNAB 2HWUA 4HRVA 4UUNA 5JD6A 5KNDA 2W6JA 2EFYA 2V3VA 3W34A 1I32A 4OBWA 1CTQA 4QA9A 5A5VA 3GQBA 4EENA 3H5RA 2DLNA 4BNHA 2RGRA 3K72B 2F1HA 3AEYA 5DRTA 2R25B 3E22B 2W43A 3IJRA 1PI3A 1BRMA 5KOJA 1D6JA 4LDNA 1XSEA 4KLRA 1GR1A 4RVSA 3VHRA 1GZUA 2QL7A 4WADA 4NARA 3WICA 4HNAB 4EELA 2O0MA 3BFXA 3ASUA 5BWLA 2ZSHA 3U09A 3OFSA 3W5IA 2QN2A 2FMXA 2Q5QA 3AHDA 3FOCA 2EF0A 2BEWA 2CXTA 3RRNA 5FTLA 2CKMA 1K7FB 1P5JA 3O2JA 3MB5A 2W6ID 5DLYA 2RBGA 3ZGLA 3BCHA 4TWZA 3B1KA 2GNAA 3AUAA 1YJXA 4PG5A 3SHVA 1OB5A 4OHUA 2G1AA 1COWA 4EPRA 4FEEA 4UTRA 4OD0A 2MIIA 3VPXA 3WGOA 3JYHA 3V9PA 3QEKA 3TAHA 1LBHA 3I5XA 1YJBA 3IQHX 1CQJB 1ZNZA 5KKAA 3KSDO 4HPWA 4YCDA 4YRCA 1VCIA 3TEFA 5HGJA 3S2UA 3W90A 4BLUA 1P62B 3KE8A 2D4AA 1CDEA 1Q12A 3F98A 4WBNB 5LC1A 2HFJA 1RQ2A 5C31A 3WGMA 4OJQA 1CJCA 3SXUB 2PS3A 3WL3A 2DBYA 4I55B 1XL1A 1PLJA 4D4GA 1RWXA 2AVDA 2JIDA 3DAPA 1E9AA 2HPHA 4OIFA 5KVAA 1DRKA 2PVCA 3T7KA 4AZ0B 2QRQA 4BOYA 3W7VA 4GBJA 4L8FA 3A04A 4MRPA 1KFEB 4W5HA 2ZWMA 1QBGA 4BV9A 1VECA 5A0TA 4WFKA 4AMVA 3N2EA 5AESA 1A8SA 3TLAA 1O54A 4G4IA 4Q6BA 2VT2A 1T1RA 4OSEA 3PGA1 1C81A 3A9SA 3I05A 4FFBA 3KWMA 1QVAA 3B5IA 4KLNA 4QVKA 2GD0A 2IH4A 1B00A 1Y8CA 1OSNA 2BFBA 4ZMRA 3PT5A 1GNPA 3V48A 4LEIA 1B76A 3RC2A 3EB9A 4LYAA 1H22A 1E1QD 1WSBA 2G9VA 1UAYA 3OQBA 4PPYA 3T5TA 3NH6A 4IEFB 3BQNB 2AH5A 3NBFA 1Z8HA 3BB1A 2OKCA 5FI0B 3RSOA 4EGSA 3X1WA 1PW5A 1M6VA 1BE1A 1PYOA 1Q7GA 2FG5A 1NOKA 5EC8A 1MV5A 5C4GB 4IIBA 3PE6A 4NNOA 1MORA 4R7GA 1GLVA 4R83A 3O73A 1LPOA 1N2BA 4ZTUB 5E2IA 2FU5C 2GS9A 2QIPA 3WL5A 3TVTA 4KFCA 4CEJB 3RUIA 1M6EX 1QH8B 1LJLA 2HLDA 3HGTA 1X8XA 2H63A 5E7MA 3OTGA 1V5GA 1E0JA 1Z5GA 2XOKD 3OT1A 4YJHA 1FP2A 3N8NA 3L7LA 1I33A 1HNZB 3D3QA 5K8UA 3EASA 4PX5A 5I9IA 3I2GA 4KQ2A 3JALB 2C2OA 3JZAA 2GN6A 2R8EA 1MXHA 1F2UB 4DC1A 1XK7A 3C3KA 2VJQA 3KEFA 5T3YA 3EISA 4BVEA 3SHTA 3M34A 1YK1A 1E6CA 1RRGA 2HJGA 1DC3A 2MHCA 2YDYA 4DSUA 4O1HA 5CVEA 3WYDA 2I78A 4ZVMA 3WWCA 2VTDA 2WWWA 2H5LA 4NMXB 1KMQA 1Q1GA 4UBJA 2FHSA 5FOUA 3R5JA 4DV7B 3JQCA 4MULA 5EPUA 1XQ6A 2A33A 3D7RA 2YWJA 2YYAA 2MYPA 3CSUA 3D7SA 3I9V6 5JS2A 1D7AA 1ONSA 1M2VB 5E2BA 2R8BA 3KHKA 5IH7A 1KXJA 1OYWA 1OXUA 3AETB 1D2RA 4RETA 3I1JA 2Z3ZA 2ILVA 4ZQBA 1UBRS 1YHZA 1SD1A 4DLNA 3OJLA 3VSEA 5K03A 3EAGA 2IRWA 1HLDA 5ITWA 1E0DA 2NV2B 4XEHA 1UJCA 4R54A 2ZJ4A 1Z6AA 2GEFA 3I5UA 2Q41A 1SKYB 5DSTA 3I2KA 1DWQA 3G5TA 3KQYA 4ZRDA 1BMTA 3E9QA 5BQFA 3MJVA 1AV7A 1BWQA 2E49A 3EC1A 2CJXA 3NPAA 4ZYWA 2UXBB 3LUPA 4CBVA 2JKZA 2LWIA 1ECFA 1HFEL 2G5PA 4G0PA 4KK4A 4R1QA 4E15A 1W0CA 4ENQA 3ZDCA 2O5RA 1OASA 2A3NA 2OGZA 1H3NA 2O3QA 2P5YA 2QYTA 1TEXA 3VKUA 3DDCA 4RFLA 5L7TA 1NSTA 3BCRA 1A9QA 4ACAA 2HBZA 5J1SB 4LJSA 1JKIA 5G1NA 3WHKA 3EPKA 1O6BA 4WEQA 1OJ7A 1MA0A 2B35A 3MMNA 3RV3A 1CUIA 3ZVLA 2H29A 2J7KA 4B0PA 1IWOA 2ZAOA 3F3SA 4Q66C 2RD2A 4U2GA 2Q2WA 3FZQA 3IUBA 4GZLA 5CX1B 3VR6D 2JCVA 2R6GA 1DUIA 3DAGA 5HKBA 1F3OA 3BD6A 4QVGA 3CRW1 4MJLA 3BSYA 2CHEA 4INAA 3IMEA 2I1LA 3DGFC 3OCCA 2I71A 3X2EA 9ABPA 4M7OA 4HPJB 5LA6F 4Y2RA 1T91A 2JFNA 1OIXA 1LC3A 1VMKA 1M8FA 4DCGA 4KOEC 5E4YA 4XVUA 1GQQA 3EC7A 1DEXA 3LUFA 4FK8A 4QRHA 4FMCF 3B3GA 4MR8B 3RR2A 3HXOA 3WDSA 1U3TA 5TQVA 1D1TA 3DVRX 2BMJA 3H4TA 4IZ6A 4Q02A 4TLMB 1HFJA 2PUWA 2VT3A 2FR0A 3EMKA 4KKXB 2CSXA 1M8KA 2JJMA 3SS9X 4MB2A 1DBRA 3C3DA 1G4HA 1PG0A 1PT6A 3A4IA 4ZZ3A 1BWRA 2Q3HA 2I4MA 2D54A 3LP6A 2QI9F 1JPJA 4S1WA 1E1YA 3U31A 3U49A 4K9RA 3W6OA 1ZOSA 2E85A 3PG5A 4EOGA 2QE6A 2Z08A 3GEBA 3O3NB 4MR7B 3AONB 1CZHA 4KXNA 1XAJA 1UKZA 4YUVA 3ZNQA 4A82A 1PT5A 5F9MA 1HMPA 1T2NA 3HMKA 3Q9NA 1K3UB 4TMFA 1I5OA 1C80A 1M6YA 2ISQA 3HKBB 1XA3A 3D4LA 4A27A 1EWVA 1SBHA 3H13A 1AC5A 1UXGA 2BMFA 5CW2A 1JBQA 1U7WA 2WV9A 5MF6A 4OGWA 3AQ4A 3R5KA 1W581 4OY3A 4Z0HO 5TS2A 5I4KA 1XZLA 4Q9LA 1KNXA 1FSZA 3M3PA 1WVGA 1K6XA 1GGKA 2FDRA 5C81A 2X1LA 5AJWA 4ALMA 3O95A 1FBTA 5AI0A 2Y6VA 3TSCA 1C30A 3CIOA 3QF4B 1CQPA 1I4LD 1XXLA 2DQSA 3G0IA 1PSWA 1W2HA 5JVDB 3CHYA 4MICA 3FKSD 3TLCA 3GJXC 1M7BA 1Q57A 4QDJA 4RGQA 4TTJA 2H00A 3UAOA 1BAPA 4K1LA 4FHDA 4F2WA 1U7XA 2ZM6B 4R2XA 2XH8A 2AR0A 2ICAA 5AUPB 4HTFB 1IU9A 3V7FA 2YJ5A 1Z45A 2VDMB 4DRXA 1X13A 1QH9A 3OM0A 3VO9A 2I87A 5CCEA 3V1YA 2D5CA 5L4NA 4AY6A 2MSLA 4BO4A 4FCTA 3WOHA 2JLXA 4H16A 4PLPA 3KFLA 4B3FX 4I50F 3USCS 4R4JA 3J80A 1N9GB 2WEKA 1SPXA 1RIIA 1ZIYA 5FJJA 2JLWA 3T1QA 4BGEA 3R0ZA 4FIZA 4R8MA 5LIRA 4HF7A 3V3KA 3ISJA 1OZFA 2B6HA 4MR9B 2XGMA 4P7FA 4DJTA 4C88A 1ZL2A 1M2HA 4RVDA 4DUYB 4X6LA 4EPYA 2NXCA 1V5FA 1MNQA 1LBSA 2PH1A 1JRLA 1GL7A 2OHIA 3NFYA 4O4JF 4I9GA 4AKHA 4FONA 2XNHA 5F2KA 4LJKA 2WHRA 5IBQA 3HV2A 2QRHA 5IUKC 4AWXA 4XX0B 1J2RA 2M6RA 4ITUA 4P3XA 2XBMA 1V11B 4NS1A 5CBPA 3RTAA 1MEEA 4KPEC 2QM3A 2B4TO 1ODTC 2H65A 4ZRNA 5FD8A 3BA6A 1Q44A 2Q6VA 1O3YA 4MYDA 4Y9UA 3HXQA 2PGAA 2YVUA 4NF2A 1ZIXA 3WBKA 4QEZA 2GZMA 3N76A 2WAAA 3GJZA 3IS3A 1TM1E 4N5MA 1BX1A 1QCZA 3LDUA 1EVIA 3RT7A 3VJRA 1X15A 5G0TA 1Y6QA 1SOUA 2OWEA 1ODFA 1OXSC 3ED5A 3SC4A 4LQCA 3WA7A 2CDBA 2A14A 2XXJA 2P4UA 3TW8A 4PONA 1H2RS 2X41A 2YV1A 4YB8A 1P91A 3U48A 1GPLA 2L82A 3RU2A 1NVDA 1YFKA 3UAXA 4Q48A 4GR4A 2ILTA 3O5AA 3VR2D 1BX0A 3S2IA 2WT4A 3KV3O 4G1EB 4KFRA 4UATA 3BRQA 1I5EA 1A9OA 1M6NA 4PC3A 4OXIA 3SHWA 3NDBB 2PX8A 2Z8YA 1OXBB 1TGVA 3ZE7A 4C06A 1UPXA 3OO0A 4ZCIA 3PEYA 3SDSA 3O03A 4S2EA 2P0EA 4ZXPA 3I6MA 5CNIA 4B33A 4NCBA 4R7ZA 5BT9A 1JHDA 2DFNA 1Z0IA 4EA8A 3I3SR 1OX5A 5D5QA 5J4KA 1ZINA 2A0UA 2WVJA 2XBUA 3H3FA 3P2JA 4Q1DA 1E98A 2HRDA 3U3DA 3WTBA 1I14A 1O97D 4A6DA 3D4PA 4JYMA 1FU8A 1LDEA 2ZDGA 3C7TA 3IDOA 4CT5A 5BWNA 2GXSA 1R9MA 3DZDA 3L6DA 3U39A 4CI0B 4ZDKA 4CKYA 1NVVR 4ZT6A 1PJSA 1QTNA 4H3SA 3R9IA 3KQLA 2PGOA 4FX5A 4LMPA 1WW2A 4O4HA 3D1JA 4MYUA 1V8FA 1YV9A 4QRIA 3AVXA 2Y92A 1IBRA 1Z13A 2FSHA 4YMLA 4XLZA 3WSWA 1I30A 4WOCA 2C3MA 2FK7A 3QPUA 3WLAA 5ALLA 3QVOA 1TU4A 4DPKA 4HH0A 4QNMA 3W5DA 4FIDA 1RWKA 2RI0A 4WKBA 5C1IA 4DZZA 2XWQA 4TUYF 3I8OA 4UM7A 3NNSA 4FNOA 2VQDA 5KYVA 1FUUA 1KDVA 2Z30A 3C6ZA 3HBJA 4C0WA 1LPMA 3CLRC 4M0PA 3UXYA 2NU9B 1ZBDA 4JB0A 5GVRA 1X92A 4LHZA 4AX8A 1R8XA 2ZREA 2F8MA 3OE4A 4Y7CA 2DTDA 2X1HA 1YS2X 2PN1A 3ECAA 1C7FA 2B7LA 2W6CX 1Z68A 4HG2A 1YMUA 4KH1A 4JUCA 2D0PB 4JJKA 3GC6A 3RT1A 1RM3A 5FWYB 4YRMA 3EVFA 2QTHA 2PCLA 3UVEA 4XWKA 3SF8A 3DOJA 2FR8C 5CLFA 3VHXA 3LQ4A 1P9RA 1W5AA 4M9QA 4AYWA 3T1YB 3G2QA 4UASA 4FT2A 1Z5WA 3U80A 2IHYA 4AIIA 3C74A 4G3XA 5I7WA 2YJ6A 2ZYHA 4UNSA 2C77A 2Z6AA 3NXKA 1NKSA 4MUYA 1GTSA 1CDDA 2FOXA 2N1MA 1B6SA 1F51E 3OIYA 2XDWA 3D3WB 3M9WA 2P3LA 4AU1A 2MTBA 4HDNB 1ACJA 5LOVA 4LXIA 1DKRA 5FIUA 5BSRA 2VAWA 3OHSX 4KXFB 4ENPA 3PLRA 4RL6A 3QFSA 3IVAA 3DTVA 3FVVA 1FY2A 1X9IA 3CXUA 2WIAA 2VP5A 2CLMB 2WR8A 4QPZA 2B20A 3A9CA 2W00A 5FA5A 3UHOA 5A9SA 2YASA 2C8JA 4OI0A 2H2IA 1N2CE 1XDSA 2ARKA 5AXDA 4PPQA 3HLKA 1Z12A 1Q1BA 1O96A 4PQEA 1XXHB 3S0JA 1ZC4A 1X7HA 2FX2A 3X1KA 1V6AA 1ZWLA 3TZEA 2R86A 4J2OA 2C57A 5JW6A 4EGFA 1QLJA 3KZXA 2GTHA 1E4OA 4IBOA 3V7UA 5KU1A 1SUAA 3MRTA 2HMUA 2QORA 1BU8A 2YR0A 4LV8B 4B44A 4BX9A 2C7PA 3HUFA 2JFOA 2WDZA 1KZHA 1XQ1A 3FSJX 1CJUC 4L3VA 4CHGA 4LFBB 4UXJA 3Q9LA 2YXLA 1W4AA 5D87A 5B4TA 3U5ZB 2QN8A 4QX6A 5EJGA 5GWXA 1AQYA 3IBYA 1XLTC 1X0XA 3E8XA 1MIOB 1SQ0A 3Q6NA 1TLTA 1G5QA 3C1TA 4M6WA 4KAJA 3NRCA 1EP3B 4JKOA 3LHIA 3H1EA 5F73A 3TQRA 5CFZA 3I9OA 1HI9A 1DBWA 2WWIA 1YI1A 2Q3DA 4Q9NA 4G8BA 2XKAA 3GLHB 4U6QA 1RAEA 2WWVD 1MVOA 1SHJA 2EJUA 3AVQA 3CZAA 1FNDA 3SFZA 5CCBA 1DQNA 2VP9A 4Q0MA 5I8PA 1YCDA 1HEUA 3AHEA 1XLVA 3KQNA 4DKJA 3REGA 1MAWA 2YV2A 3NUGA 2JFZA 1N1DA 2X77A 2WYWA 4AZ3A 2ZT6A 2GXAA 1MPXA 1P1JA 2CMFA 4NZMA 4G5YA 1TYBE 3FWZA 1S4QA 3MXTA 2I1QA 4HPXB 5TF0A 1GZ5A 5L4LA 2H2AA 2IIBA 3U60B 2JJ2D 2A0WA 1F0KA 3Q5EA 2QZJA 4AY3A 1J2YA 2BELA 1G60A 4TQUS 3GWGA 4PGAA 2REBA 2H9YA 4JC5A 4AO8A 4X8HA 3KTOA 4EZIA 1Y7TA 3LPLA 1QU3A 2HREA 5HDQA 4OA8A 1PJAA 3VR4A 4MW2A 1U8XX 2PU7A 2EL7A 2ENUA 3QU5A 3AXTA 1I2ZA 1BQ3A 4YP7A 5CD1A 4LDQA 2XRFA 4RVHA 5LNK6 3LDFA 2JI7A 3AI1A 4FP9A 2FZ4A 1A2OA 3OMWA 4N01A 1OZ0A 1YQGA 4BASA 4NV0A 2HU8A 2FUCA 4R68A 5HF6A 1AIPA 1U4SA 3S28A 3ROQA 5KTYA 5FBWB 4DV6B 4GS5A 4R8KA 5JSKA 5ES4B 4WXPA 4HWOA 2WJVA 4ZGBA 5K3DA 1U5CA 3OU7A 2BWJA 2Y6UA 4H1TA 4EVQA 4F4FA 2EQBA 3A70A 1JSLA 3DH0A 1KP9A 1ZR2A 4XCQA 4ZJYA 3FLMA 1NJSA 3V00A 5EQTA 3UUEA 2Q5IA 4Z7QB 4DIKA 3DE3X 3WL6A 1NQWA 2RHGB 1RACA 2DPHA 1JG6A 3DT8A 3RYHA 2Z2XA 3VMFA 3RYIB 4RF4A 4CKEB 1FTNA 1ZCBA 4LRQA 2DFLA 1G2OA 4MRRA 3T5DA 3WWEA 4E11A 5CM8B 5DW3A 3DKRA 2AOXA 3TW6A 1AHIA 3N2NA 4I1SA 1DZ3A 1R9NA 2NTYC 3ITDA 4HNSA 3V4SA 5MN5A 2JGFA 2CLLB 1XDZA 4IRXA 1HORA 3GJ7A 4P9NA 1U9JA 1JHZA 2Q5LA 4LSGA 2NU8A 3IDZA 3K09A 3VTZA 1R74A 2GN1A 1G1AA 1Y3AA 3TDMA 3PHJA 4EPXA 2V97A 1ZCFA 3SOZA 3A7EA 3COZA 4EB6A 1H8EA 2IY8A 4LE2A 2JIOA 4LOAA 4OGKA 4O2AF 4ZI3A 4MVJM 3RFTA 4US2R 2G5CA 5KBYA 3EXIA 1PN3A 1TKBA 4IFIA 3GVIA 1YDMA 3AI7A 4O2RA 4RA6A 1JLSA 4F21A 1GFIA 3VU1A 3G7SA 1E0AA 4RK6A 3T3EA 2OLEA 1D4AA 4WLEA 1ZH0A 2H18A 2XUFA 3OLXA 1XK6A 4Q19A 1EFKA 2P4SA 2F4VB 4QC2A 3A2NA 5J5AA 2X0RA 3JD3A 2GAAA 3ZIUA 4E1AA 1DC7A 1RCTE 1Y3HA 2JJQA 5LCXA 3STHA 3ZHCA 3TOXA 1KQGA 4UMEA 2RB4A 4E3WA 1A5AB 3ZNOA 3AJ8A 3UOWA 4TL9A 3MUEA 2Z1NA 4F1JA 2YQ4A 1XMPA 2NTVA 4G8CA 3T7CA 1DWOA 2XWBF 4KRFA 1TPYA 1N2ZA 3FZNA 2ZCUA 1DAEA 5CFOA 1LQTA 1GTMA 3JZIA 3QLEA 4HLUA 3T7EA 4HGOA 4JN6B 2ZTVA 5CT4A 1P3JA 3N05A 4UREA 5IXYA 2NO7A 3BZWA 3GUCA 3QUCA 3D7MA 5ADHA 1WF3A 3JQBA 2XXAB 1CT9A 3F47A 1XEXB 2IHVA 4WH0A 2EP5A 2OR3A 3TJMA 2R1VA 3LI2A 1WDLA 4I1OA 2DHDA 4LN1A 1TMGE 1J09A 1Z28A 2DVMA 4DCUA 5EWLB 5H3CA 1EWYA 3I2JA 3SJBA 2ODTX 3HWWA 3BXPA 1VOTA 3B1WA 3D31A 4GR5A 4ISCA 4URFA 4CTKA 3UO8B 3WFIA 4B7UA 4J7AA 3S2YA 3WZMA 1Z2NX 2H52A 4C4XA 2P65A 3S5JA 3SHFA 1RM0A 1J2UA 4YDRA 2I7DA 1XQXA 4BNXA 1X94A 5EE5B 3CISA 2DUWA 2W0MA 3OLZA 4CM7A 1T2UA 4ZYVA 1VLZA 4G24A 1OFUX 2FW8A 4GZMA 2G77B 1M1YA 5C1OA 4NJMA 1L4YA 1WDMA 1E77A 4EZEA 1EM8B 1VP9A 1SELA 4EA7A 1WIWA 1LEHA 1Y0BA 1Y3FE 4A8PA 4FFPA 2IYSA 1NWCA 4RZHA 4QTZA 3N2ZB 4KIUA 1GCIA 1VPVA 1Y82A 3CEAA 3VAZA 2B8TA 1KJIA 4YRNA 2BHTA 1VJ0A 4YRTA 3WB9A 1H2YA 4IGEA 2YIVX 1DO0A 5IKOA 5AW0A 1IMOA 1IHXA 2VDWB 4LXXA 4OHOA 5FX2A 2CVFA 1QG2A 4HEA6 1AS3A 2RGWA 1DXOA 1K7XB 3HB7A 4PC6A 2OBMA 3KPWA 3U37A 2QBYB 4Z8XA 1NUHA 4KGZA 2V7XA 4OQFA 1V41E 2CW5A 3FX2A 2PRSA 4YO8A 1WJGA 5EPEA 2XF2A 1RRCA 4R0VA 2FG6C 2I76A 5AR1A 5L8VA 5JXIA 3IXQA 1GNLA 2QAJA 5JDIC 2EZUA 1I10A 4J3NA 1UPTA 3SWWA 3QX3A 3KTAB 3EFHA 3W4KA 1KSJA 4BGVA 2F3RA 2X2FA 3DO8A 3FFTA 3TLXA 3HSSA 3SMQA 5K6TA 2OCYC 4EJMA 2VPWA 3N2KA 4RPLA 4BBZA 3OH8A 4MA4A 4P4LA 3HRIA 2DT8A 2EHDA 4PSAA 3UEOA 5JNVA 4JNKA 2P91A 5BVGA 2H8GA 4Z54A 1HO3A 2QTWB 3OIFA 3HTXA 2OHJA 2YH2A 2GESA 4PAQA 3TBKA 4DRZA 3OUTA 4FUQA 4FGZA 2W6MA 3UJBA 4FILA 2QPAA 5D84A 5ITZB 5MHTA 4TQGA 2NO9A 2C2GA 2BCGY 1QVVA 1IK4A 1RSZA 1UBKS 2B1GA 4PC7A 3T7IA 4B80A 3EFOB 2PFGA 4BFWA 1CDZA 1T5BA 1EQUA 4JT8A 4R9NA 1G8PA 1I3NA 4KO8A 2V1UA 2ORVA 3ESAA 4DLZA 4YIHA 3AGQA 3D4BA 5H3LA 1AXEA 4Y1GA 5FOWA 4M9RA 1EDEA 5JASA 3AWDA 4Z3DA 3NM6B 3OE7A 3ZH9B 3RVSA 3I8SA 4O2BA 4GSKA 3MUNA 3A2LA 4CKBB 3AF5A 1Z3CA 3F1LA 4Z4QA 2YHSA 1UIRA 3EA4A 3ML1A 3HL4A 4QQFA 2Q2VA 3FM9A 3NP9A 3MMZA 3ZLTA 4PXAA 4E5KA 4YMUA 1EX7A 1UPBA 3ZJ4A 4JLPA 4QLOA 5T5QA 2RI6A 1NWHA 3LCMA 5IS2A 1Z5VA 1UADA 2HHLA 2QAGC 2J87A 3W78A 5LWHA 2OLKA 3MJFA 2AOTA 2QT0A 2DBZA 3W2IA 5BWMA 2QD1A 4KN5A 2ZSAA 2FN8A 4KQFA 1A95A 4PFKA 2OUKA 4UE3S 5BN4B 4CMCA 2DUMA 1N8SA 3FSEA 2IC5A 5AJZA 4B9AA 3CGGA 1WVMA 4HY3A 4TV9A 5H4HA 3N0XA 2EJTA 2LBPA 2SHKA 4L0CA 4QXQA 3Q88A 1HDOA 3DWIA 1ZR4A 2RGDA 2AKYA 4B3GA 3ZZ0A 4QSHA 4HWSA 5FOXA 5L3SA 3TG2A 1RP7A 1OH8A 2GI4A 1R6XA 2IU3A 1H4QA 1JIXA 4DCPA 2ZB7A 1PS9A 3ZVRA 4TGLA 2ZVDA 4K9OA 5LQJA 1WY5A 2WMYA 4FN4A 1FJ2A 1SCDA 5GPBA 2YC2C 5AP9A 4G5GA 3U0VA 2VXCA 1YR2A 1K8XB 4JV5B 3FGPA 3HB1A 1Y1SA 1K92A 2V8OA 3DEFA 3AI2A 3E2PA 3UMVA 3ADCA 8ADHA 3WQHA 1IN6A 4CEHA 3RK1A 1HRKA 3NU1A 1MG5A 2QTBA 4MQMA 5F9HA 1VJDA 2B4AA 3A32A 2R97A 3P2IA 3T15A 5C1BA 1JKJA 4EAAA 2OXIA 2V6FA 1A7UA 3P9YA 1XTTA 3L79A 2Q7OE 3WI7A 3EQ6A 5BUSA 1MCZA 4RLFA 1AV6A 4RHFA 1I0LA 2CDCA 3LSTA 2BKLA 4V39A 5I7RA 4LMRA 1ADJA 4UM8B 3BTUA 1Q0RA 1D8AA 1XROA 1YULA 1YZGA 1E2LA 1F38A 1U7TA 2FZEA 4ZQHA 4UVEA 4JI7B 5FL7D 3A6LA 2VYND 1UZMA 2IXTA 4KR9A 1TKAA 3WGVA 2WHEA 1NYQA 1VGQA 4AO7A 4CDRA 1WWKA 2BBTA 3KLBA 1K5PA 5IC5A 1G16A 1K9SA 2VPPA 1YAHA 4IGFA 3G2HA 2QDKA 5IK2D 1E0SA 2DKFA 2XUGA 1ZFNA 3KKEA 5IM4F 1XKQA 2D1RA 1UODA 3O93A 4LTDA 3BF7A 3FR7A 4JR1A 2Y3IA 2ZVQX 3S81A 3FE2A 2JJ8A 3JQAD 2VRNA 5H82A 5C5DA 5ILGA 2FPGB 1J1IA 1ZBQA 4BQOA 3RADC 2IEDA 3QVJA 4II3A 4K8OA 4I9HA 3R40A 4D9KA 2UZ4A 1UFOA 1WY7A 4MPDA 3UB4A 1VLMA 2E4YA 4G85A 2O3UA 2QQFA 3QUSA 1KOJA 4QUKA 2PQ6A 3K31A 1AQIA 4YBRA 1N7GA 3GAFA 3UMFA 4C08A 1XZAA 3FUVA 1W49A 4HB2A 1OCEA 3L7NA 4JLUA 1SKQA 4KQGA 5H5JA 3R3VA 2C9ZA 4DY4A 5FWXB 5ALTA 5KX5A 1G2PA 3IUMA 3NW9A 1VHTA 3B53X 3LRPA 3CVXA 3HMQA 2QVGA 2WJYA 5DIFA 1EXDA 1Z4LA 4C4SA 4GRAA 1CQIB 4KYUA 2LNDA 3E84A 4PRYA 1GARA 4NBSA 4HNQA 4CL3A 5A0FA 3SVZA 4ZYUA 1Q7BA 5GY7A 5AJTA 4P38A 1WV0A 3QYJA 1NI4B 3BD9A 3BTSA 4JVNA 3MTEA 4YT5A 4PR3A 2J45A 1H6BA 2H7YA 4R8LA 4F38A 2ID7A 5C7LO 2QUJA 1QM5A 3C3WA 3OG9A 3RE1A 5FI3A 2G83A 3T5MA 3WMRA 1DOAA 1P5RA 4PCLA 1IN1A 1IUKA 1BDIA 2ZSFA 2XCRB 2NO1A 1L1EA 4D6PA 4NZYA 4B8WA 5C18A 3PRJA 3EWAA 1Y3IA 3U7IA 4LYEA 2Q3CA 1DQSA 4GE3A 4P33A 3IB3A 4CPDA 3O0DA 2QX9A 3KXPA 1QGDA 1QHHA 1TK3A 4K6KA 3EOBI 2BISA 4M88A 3UGKA 3W2TA 5IM5A 3BJIC 4GPBA 3GLIE 2PZAA 5IMBA 3ORYA 1PJLA 3OWOA 1V8PA 4HS4A 4TT8A 1CZRA 4E1VA 4PFQA 2LV8A 2VL7A 1QP8A 4P0PB 1T6NA 2EYUA 4L74A 3TOSA 1LVHA 3ZQUA 5EERA 3AIKA 5BMOA 2DQZA 3D3NA 2WMNB 3NAMA 3SZUA 3IBCA 1S4MA 3IKLA 2QVLA 3AR2A 4NCKA 3W4JA 4EABA 3SICE 3P32A 1OYOA 2XWSA 2GYYA 2YCLA 2G76A 1NOIA 2FRDA 1W85A 4D02A 4PSDA 4QDKA 4A8HA 2ZE5A 3DVAA 4DTCA 4OHXA 1XF9A 4FDAA 5LYJB 2WZBA 4QTYA 4JP1A 2CLHB 4X3PA 7ADHA 2EG5A 2BFOA 1JIQA 3LTEA 4ER3A 4J1TA 1KR5A 4ZEOA 1WU7A 5DWVA 5JFGA 4EVRA 4K9QA 4FS8A 4RMIA 4BEVA 1G8KA 3PRHA 3PFFA 1DRWA 3FTEA 5JCPA 3F4BA 1CZOA 4EO4A 2RIPA 2AN3A 1WXXA 2QHXA 3KYIB 3OFNA 4CT0A 2ZRMA 5A06A 3G5LA 3PC8C 4MUGA 2ECKA 2JFWA 4RD6A 1VC2A 4XSHA 4PRLA 2YRFA 4CIYA 1T9ZA 3CR8A 4MV1A 4ZAVA 4GOJA 4D8TA 1IAVA 5TDHA 1KAEA 8OHMA 5DM1A 2QZZA 1QV9A 2VYVA 1CUYA 2UZ1B 4HDSA 4JLNA 5I9TA 5NULA 4HUJA 3U4HA 4OB8A 4JLOA 4KFTA 3H42B 2J08A 1YE3A 2RFLA 2GPWA 3AF2A 1JTVA 4UHBA 3LUAA 5IYZA 1LV7A 1Z74A 3QXHA 4DABA 4HZGA 3UUFA 3VJMA 5I4IA 4C2UA 1J1UA 2V4MA 3KHSA 3P0FA 1SCBA 3K0CA 3TF5A 1Z0AA 2HA7A 4LUCA 4QM6A 3OP1A 3ZI0A 4AURA 4EKYA 1P4AA 1J8MF 1UXJA 5H02A 1NOJA 5KAPA 1LFDB 1L5WA 3CYFA 3LVFO 3LXRA 2HMVA 2ZRPA 3O83A 5EHZA 1U8CB 3AL3A 3OZAA 3TGWA 1B14A 2HSZA 2WU1A 1Q7CA 1CG6A 5DU2A 1E2FA 1K7SN 2YXBA 4P4NA 1TM7E 4GKBA 3UC9A 1RAHA 1QRSA 2CLOB 1YJQA 3GMSA 4JGIA 4KTVE 2QR3A 4DMKA 1Q2XA 1NJGA 1UM8A 3QUBA 1OV6A 4HAWA 4QGAA 4QU0A 4RESA 2J9FB 1U28A 4OTZA 5C8YF 3CVJA 1RZVA 2BN4A 4JBWA 4IMRA 4AUKA 4F91B 1CX9B 1IM2A 1Q0UA 3KOWA 3QRWA 3B7PA 3IMFA 3UA4A 2ZRNA 4C0KA 1MO6A 3IDQA 3M6VA 1DEAA 1E8DA 2JD1A 4TSFD 3RUEA 4GNRA 2GK7A 2BW0A 1G0NA 2ZRQA 2XMPA 1U5AA 4UHFA 1DMSA 2RDMA 1JWBB 1P7YA 4YLEA 4B87A 1ZC3A 1GZ6A 1GITA 5LBIA 1U9YA 1LS6A 5F12A 5I8WA 3SLGA 5LMZA 1CB0A 3HB0A 2UU9B 3GLGB 4KO2S 4N7RA 2R1UA 4A16A 2XADA 3PKJA 4LJAA 2IS4A 5JIBA 3MC1A 1UXHA 4YYZA 5M29A 2G88A 4RTSA 2LKDA 1PQWA 2XNSA 2JFHA 2V9CA 1U7DA 1RFGE 1O2DA 2QF7A 4X1IB 4XIYA 5HDBB 4DAOA 5HCNA 4G01B 3T54A 3EGXB 4D3XA 3K5WA 1RT9A 3LX5A 3R7WA 4V0NA 4AMYA 1D9XA 5D2CA 2Q7DA 4FM9A 4ABTA 1QCDA 4B6EA 1U2ZA 2XNJA 1K4YA 4JQSA 3IEVA 1NUTA 1DFHA 1HLGA 3PHIA 3ITKA 2PSEA 3LXMA 3N59A 4EA9A 3DEJA 4ZVRA 1WXQA 2AI2A 3HL0A 4EIWA 5HIKA 4IJKA 4EQ6A 5ALOA 1L5SA 2NUAA 3GN2A 3D7LA 1ZOPA 2E55A 4PSKA 1CK4A 1G6HA 4GHWA 5EZQA 3GZNB 2C20A 4XEUA 3U4CA 2AQIA 3DAFA 3MK31 5KHAA 1QGZA 4IXDA 3WFJA 3O82A 1U0BB 3HM2A 1NP7A 3MJ4A 4MUEA 4WOPA 1QYDA 3O38A 3O31A 3FKJA 3DFFA 1T1IA 2VHTA 4YMSA 5DN9A 3NR2A 5EZSA 2ZRAA 1HNXB 1K8ZB 4JBIA 4UTOA 4CE6A 4TSKA 2BGJA 2WE7A 3HP4A 4IX1A 3VM6A 5KTTA 4KDCA 2A0XA 4Q05A 3W8FA 2BBOA 1NBAA 4NBRA 4MQEB 1GEGA 2DSNA 4FZ3A 3BMCA 1HYGA 2NLOA 2Q4EA 3ND8A 4CQLA 1UH5A 3FPSA 2WSSA 5B2FA 1IVNA 4TOIA 5J59A 5BR4A 3NNNA 5JSZA 3DEIA 1YASA 4JZKA 1C1DA 2E82A 3GDHA 4LXTA 4YCBA 4HDRA 2BDTA 3PS9A 2A4MA 2W2KB 4ERNA 4ITVA 3KOXA 5I4BA 4PVDA 2NNWB 1R0XA 4ON9A 1JMKC 4YRJA 2JB9A 1SCUA 2XOXA 1ENZA 1RD4A 1T26A 2J32A 2Z8XA 2BFCA 4IW3B 3TEJA 1USWA 1Z9BA 2J48A 1KE1A 4F9EA 1APBA 1F8XA 2YWGA 3PFHA 1D09A 3F3YA 1HQYE 4QXPA 3LBNA 3B2NA 3Q3CA 1SOWA 1TLFA 1F5SA 1O95C 2X8JA 2YS6A 3L49A 3ORQA 4QL3A 3LQYA 4YQEA 1F2VA 1K9VF 2QTTA 3FFWA 2H7XA 2YVLA 2ZPAA 1HX7A 2IYXA 2C3OA 3DYBA 1CVRA 1K68A 2G28A 5T7BA 5F9FA 2VRBA 3QBEA 4DDKA 2G1UA 3O9VA 1IZ7A 4P32A 3RFUA 4IQ4A 4ZWNA 1EG2A 1L5KA 1KRHA 4BP8A 5HQ3A 3L07A 2ISCA 2Q2NA 3C5VA 3H5IA 5A6SB 4QGSA 2O7SA 5C4MA 3RSQA 2GEKA 2B5VA 5J4LA 5E3HA 1GNTA 4NEQA 3ROGA 2YXNA 4UMVA 5L4SA 2ZWIA 2ZSJA 2QNBA 2DKNA 4E03A 2I55A 1TCVA 5E0KB 2G4CA 2RARA 2IP1A 3DZGA 4LY0A 1XZIA 2JFPA 3VJLA 3TQTA 5C80A 1DJNA 1P4HA 3IELA 3EK2A 4QECA 2A8YA 5CA1A 4MRMB 5DCLA 3THSA 3IAS6 1HMYA 2OK8A 3DB1A 5H83A 4YIKA 4F11A 2XE6A 2CMGA 1JDTA 4JA0A 2PNFA 3M4ZA 4OATA 4R2WA 3N5CA 2HJVA 4K9SA 3TBHA 1PJ4A 1QYWA 2VDOB 5DTQA 4DF3A 1ESCA 1CHDA 4KWIA 1HLFA 1DT3A 1MQAA 3OF5A 2FWAA 1XMIA 3ETJA 5FOTA 4Q16A 2OCXA 3MT7A 1ZH8A 1O57A 5F5XA 2TMKA 4MVJP 3WR5A 2IFTA 4TS3A 2CZCA 4BMOB 3CNLA 1WXHA 1JNYA 1GV1A 4RDHA 4Z49A 3IR6A 1GAJA 1XTVA 3M7IA 4KSBA 5LM3A 5BT8A 2FVXA 4O8ZA 3OOHA 1B6GA 1UJBA 2BFNA 1J07A 3PX3A 1EKXA 1B6TA 1RVV1 4G1FA 4B3MB 1YQXA 4TS1A 5CG1A 1PR4A 2HF7A 4M60A 4P5DA 3K2BA 3PSHA 3A9TA 4QLAA 1MH9A 4UDXX 3ILXA 5AO9A 3RVJA 1TYEB 2D5AA 4LJ7A 1EVQA 1T6YA 3SEFA 3TNFA 5IJXA 4EVSA 3ZX4A 4TYWA 4OIMA 1N8NA 1RPNA 1LW6E 2PK3A 2Q8NA 4J91A 4UMFA 3FRIA 2PBZA 3NEYA 4YBZA 5AK6A 5TMBA 4E7OA 4E88A 1MV8A 4WZBE 5C1PA 2VI5A 3W5HA 3LHKA 5A2GA 1KOFA 4H15A 1XHEA 2FMFA 1PVVA 4HQKA 4BEJA 3GLFE 4LYYA 5G40A 1HM5A 1WPRA 2R85A 2ZE7A 3II6X 1J8DA 1P75A 1WTCA 4JLKA 1ULZA 3ME5A 3HCOA 3M70A 4DLKA 4F46A 1CP3A 4Y6GB 2AN4A 1OFTA 2XD4A 3QI7A 1G7RA 2W0SA 5TE9A 2A94A 4GPTA 4XJXA 4CKXA 2GHIA 3HVKA 3DQQA 4WFIA 5I47A 2R9VA 4ND3A 3SBOA 2O7VA 2PL5A 3R6DA 1XZJA 4GP7A 1K5GA 4KXWA 4U2BA 1VCMA 1JT2A 2AWOA 1EX6A 2UDPA 4G89A 1IPFA 4HQFA 2GUGA 5EQFA 4BUCA 4JWTA 1H1LB 1UBGA 3CO0S 1EK5A 4J8PA 3Q5DA 4KYIB 5HKKD 1T6BY 4CM9A 4RIIA 4F5EA 2DWPA 2J6BA 4P3PA 1VKHA 5ETJA 5JTUA 3SYRA 4OHYA 3G89A 4UTXA 1XVUA 4REQA 4ICIA 5JMOA 4AB1A 3RS2A 4BQEA 4FFDA 5LXTF 2NSLA 4WLNA 4QU9A 4BTEA 4KXYA 3QEOA 5E3IA 5AVUA 5KSWB 1NT4A 2LZ0A 3TAUA 2CXSA 2JAQA 2PGJA 5BYKA 3OQNA 5AW3A 5ILOA 1V4BA 4LGMA 2UUPA 2IEBA 4BZZA 3HM9A 2HWKA 2PKCA 5JE8A 4IOJA 4V38A 2PJUA 3AFMA 4OB6A 1BCSB 4PQYA 2A84A 3BMOA 3QV1A 5ABPA 3GJ3A 4DFDA 4I4NA 1ZJJA 1U5BA 2PUVA 2QI9C 4WESA 1VIMA 3HCFA 2GPBA 2QR2A 3D5QA 3ETGA 4G5QA 2J30A 5DSZA 3CIFA 1F3LA 1MJHA 4W1PA 3SE0A 4JDPA 1EFRA 2HHHB 1E9VA 3U3RA 4RCZA 1HE5A 4ZAZA 4QOGA 1OB2A 3WWYA 5CXSA 1XWWA 3HU5A 4N41A 1YRWA 3I23A 1KPIA 3UJPA 1SCJA 1CRWG 3I9LA 4LOJA 3LBAA 5HR5A 3BXHA 1BO6A 3K70C 2AG8A 5L3QA 4O1IA 1W5EA 3EXEB 1JHAA 3TOCA 1ONPA 4ISBA 4K6GA 5JH7F 1NVTA 2NSDA 2O8VA 4KJZA 4MV4A 3R7SA 5F7OA 1FIUA 3AKCA 5JFTA 1P1IA 1K27A 2I7XA 3CN9A 4JSTA 3GLTA 5FTJA 4PYIA 4AJOA 5BOVA 3QELA 3ASZA 4PTLA 3HPRA 1GL3A 4EW3A 1M8GA 2MMCA 4HAXA 3DB2A 4PSVA 1UBUS 2ZJOA 4D79A 3UM9A 3KQQA 1AB6A 2DWCA 2GM9A 2VAMA 3DBOB 1UK9A 2O2GA 1WCIB 2V5UA 3FDXA 1N0HA 1JFRA 2QGFA 1S2MA 4G1CA 1GFSA 2YV4A 1KY5A 1YK0A 3E7PA 1HL3A 4CGYA 1W73A 3PJFA 5C7YA 3AERA 1I3LA 1BNCA 4JLJA 4XUEA 2Q1UA 3EZYA 3BIFA 2FWBA 4UHKA 1QTIA 2YN4A 5FKJA 3DV9A 4YRLA 2CVQA 1ND6A 3V34A 1R0BA 2XIJA 3TE7A 4BNVA 3B9BA 2W6IA 3V55A 4TKVA 4PYOA 3OM1A 5I7FA 5AIBA 4DJEC 4YDQA 3UHAA 1MQ8B 1SAYA 3HYTA 1E2GA 1WB9A 1WMDA 4LA4A 1CY0A 1R4NA 3R3JA 4MPTA 5KYTA 3KYDB 3ICCA 3GI1A 3IJ5A 2ZJ1A 3H5VA 4CMIB 5BMVB 1V5WA 5BP7A 2FW0A 1K8QA 3ZXIA 1VA4A 2QRKA 4KODA 5K3AA 5LP6F 5K0JA 3TECE 2ISSD 4N1AA 5BNIA 5KMGB 1JLLB 3K4QA 2FSVA 3NTQA 4WKCA 4EHHA 2V54A 5KCZA 5J4VA 1D8TA 3VNAA 1W0JD 3OZIA 2QT9A 3HN2A 4LYDA 2V9ZA 1BYUA 2HRRA 1FX0B 4L95C 1GPH1 4UDYX 4F8JA 1BX3A 4LF4B 1MDFA 3KQPA 2J0UB 4JKYA 5HJ7A 4GXNA 4DSZA 4GXQA 3DGEC 4M1KA 1IHOA 2HPAA 5JSYA 2ZIEA 3SNKA 2XVMA 3MM4A 3VXKA 3GVXA 1E9CA 2ZYIA 4IMIB 1KWKA 5B3KA 3INTA 3WK5A 1VHJA 3MTQA 3ZY6A 4Z4HA 3M9LA 3LRTA 4O4IA 2H1CA 3L8DA 3R3XA 3G9UA 2XY4A 5LQCA 1P2DA 3AM3A 4HYEA 2KE5A 3QY0A 1DTWA 1MB0A 2AD1A 2MSKA 5EXEA 1CZKA 1KXZA 3QU4A 2BTQA 5F3RA 3UJ7A 2F9MA 4KI0A 3EXG2 5T4FA 4B7XA 4IEEA 2C58A 3H5TA 1KZ4A 1NMQA 2BGTA 3TL6A 4DV5B 1E1QA 4FB5A 1XJ0A 3ESCA 3GARA 2LPMA 3S2GA 2XOEA 1Z08A 4NIMA 2V4UA 3O3MB 4IIHA 1FSFA 1GPWB 1H6AA 4E70A 2YVAA 2HZ7A 3O47A 1YZTA 3HU2A 3RDPA 3ZHBA 3UPUA 1SKUA 1USKA 3JYPA 1FDIA 1BJKA 3GG2A 3AINA 3KSRA 5E9JA 1U8ZA 2QTRA 2WABA 3KDSE 4COOA 1BMQA 4DADA 1H2HA 3OZFA 3DF9A 4NBWA 3E3AA 4CQJA 3FTQA 3WOVA 3M6FA 3WNDA 1NW5A 1M7GA 2QG6A 4FYMA 4MKRA 2DUNA 1VKJA 3IMGA 3L4BA 2WTNA 1JB9A 1SQFA 1YBMA 1QG6A 1SXJD 2QZSA 5CIWA 4BB9A 1M0EA 5JHGB 3H2IA 1YOVA 5TEVA 1XZEA 3OZXA 2NXJA 2P2CA 3UH1A 3WJ2A 4ZALA 2XI4A 2EKZA 1DV1A 3ZGVA 3BCUA 1A2KC 1C4WA 3I01M 3NHMA 2H4XA 1N3LA 3QWHA 4LZJA 4IDHA 1KK2A 1MXFA 3IQGX 3CCCA 3QU9A 1E3JA 5HKLA 3WJAA 1TB4A 1Z4NA 1TU3A 4XH9B 1EK1A 2YOHA 4XIGS 5E8RA 3T0FA 2C95A 2WP0A 2ZGVA 1FX1A 1YZFA 3RARA 4C89A 1KDTA 1AK9A 1YKSA 2O0LA 4C2TA 3IIJA 2H7VA 4BO1A 4UCFA 1WKVA 5JJ5A 2GYUA 2AN9A 2PU5A 2OHGA 2ZUWA 2PKQO 2XJ9A 1DHRA 3KLOA 4MW1A 4PCVA 4RV4A 1A69A 5DLEA 4BV2A 5JUWA 3RRBA 3CX7A 3I9V1 2FWNA 4MUKA 4PPFA 2CCGA 4UHHA 1NUUA 3NAZA 3B8HA 5ENZA 4M54A 4F7DA 3U44A 1ZL0A 4MHOA 1H4VB 4IIDA 2WD7A 1GD1O 1FSGA 3KJHA 5SZJA 5JYEA 1OBOA 4NZ9A 1EVJA 3K4HA 4RLSA 3PGMA 5E9AA 2C96A 2HIGA 4V0OA 1XVAA 2YIMA 1G5HA 2P2ZA 2XLBA 2Z2YA 4M2LA 3TN7A 3VVCA 3WMWA 4MAMA 4XPIA 1DXYA 2JK1A 2E89A 2SCUB 4H4EA 3ROMA 4XM0A 1M0TA 4UVIA 3VO8A 1ZLYA 4BFCA 2A59A 2NXWA 3COPA 4JJIA 4NH0A 1X86B 2WW8A 2I6QA 5I5GA 1KAHA 4JB8A 2V8BA 3GRFA 4TSRA 2HUNA 2OT3B 4YJKA 1UM9B 1G3UA 2GZ1A 4Q9JA 3EGWA 4F96A 1V9LA 1Q2UA 2FOLA 2TRSB 1ZMXA 3IKVA 2BAGA 4RAOA 5F23A 3ESZA 1AKWA 5FCDA 2H2GA 3VR6A 4BV3A 5JQWA 1NBHA 1BFDA 1JHVA 1AUQA 2EFDB 1QO9A 4TN1A 5JS7A 3W5BA 3S7TA 4K88A 4BS9A 2ANBA 1M83A 3A31A 2XZLA 1I0IA 1F12A 3NONA 2W6OA 1WBDA 4UEKA 1NPYA 1UC9A 3AK4A 5CLQA 3SIRA 1KARA 4RZ2A 1DWPA 4WAUA 1FMTA 4N5IX 2WUWE 2A9QA 3CGWA 3F90A 3IP5A 3O94A 2I2FA 2O4CA 2GMWA 3OECA 1A9SA 4ANFA 3T9CA 1KZ1A 2XTZA 3E5HA 3I30X 3M4JA 5J2TB 4G0WA 1VJ1A 5TX7A 2AIRA 2C3YA 4PO3X 5DMHA 4CV1A 4DDUA 3NYWA 4RKRA 3H5WA 3TPZA 1I01A 3NTOA 5JCZA 2H1RA 4UJ3A 3L4KA 1FYWA 2W4MA 5ISMA 1TUBB 5K6RA 2L69A 4HKTA 4KDFA 4EHIA 4CMEC 5H8WA 2VYQA 1ES9A 2XR1A 3ZV4A 5EE1A 2RGBA 3C1OA 1TO1E 1QKJA 3FYSA 3KD3A 4C6TB 2VQ3A 1XCJA 3B6KA 2GARA 1RS0A 1XTPA 1FFSA 4W9NA 5SZHB 1PNTA 3CLHA 3E2IA 3GEMA 4ZZ0A 2VPIA 1V6CA 3TSAA 4C3ZA 1TZKA 1R4MA 5GZ3A 3I9JA 3QSYA 1JQ5A 2PX4A 3N86A 1D9ZA 1KZ6A 4WVLA 2VJMA 3EYWA 1CW2B 2MCFA 3WS7A 1QSGA 4JJ8A 4UKDA 4M22A 821PA 3LC7O 1OLXB 1HUQA 5KTKA 2YOGA 1Q95A 2JLUA 1OOEA 3TTYA 5AHOA 4GR9A 3U6BA 2P75A 3K53A 4B85A 5FTMA 2IYPA 2R87A 3ZKWB 1AKYA 3W4IA 4GX5A 5EN4A 1VLQA 2I7VA 2QPTA 5TGDA 5UKDA 3REQB 2R5NA 2GASA 2QNRA 3TLKA 3W3AH 4V02A 4O4LB 2MSCB 3WKCA 4GLJA 4RY2A 5GZ1A 3FLEA 4C1NA 1UBLS 2VHEA 5CJJA 1KEEB 2P0AA 3JQPA 3R3WA 4DV4B 1PD1A 2FZWA 3EXG1 3NUZA 3K5HA 1SC6A 4MVJA 1POWA 4PSUA 4DBZA 3SQWA 3N2GA 4RSGA 4DTIA 4MVYA 2V65A 1QBKC 1FL9A 3Q4GA 5T64A 4TYYA 4LGCA 3N75A 5B58C 3ZDDA 2CL7X 1X9GA 1GPMA 2ID8A 3OEHD 1ISFA 4D4KA 4LPKA 1W7AA 3WK6A 1T8YA 1BXKA 3M6AA 4BX2A 1D4OA 2DCMA 4FMBB 1IBLB 3QKWA 1KK3A 2GM3A 1JHMA 3HLTA 5ICEA 1U0SY 4KQMA 2QNIA 3ZYCA 3C6YA 3GFRA 3C3EA 4YCCA 3EBOA 3COYA 1R00A 1E96A 4WQMA 4GM1A 2NT4A 1ZXLA 1TRHA 4NDZA 4QTUB 2XDQB 2C9BA 5AUQA 2BF7A 2VNHA 4ZT4A 2IYWA 2AFHE 1X70A 2ZB8A 7GPBA 1VA5A 2HK9A 5DNYB 2GAOA 4FPXA 3VH3A 3R5HA 3W2HA 4JFRA 3FD8A 4H6VA 1X7XB 2IY9A 3M89A 4PANA 4QUJA 2HYIC 1JJ7A 3COSA 3DW3X 4JOCA 4F2HA 2ZS7A 3KJFA 2JGDA 2W8BB 2PVSA 5AKJA 5ALNA 2O8EA 4BO6A 4F4JA 2DBQA 1W4LA 4Q4AB 2IYRA 3CZMA 1JGTA 4JT4A 3FVTA 3NJ4A 1YQWA 1G4AE 1DV2A 4K87A 4AC9A 3T7SA 3CPJB 2OG2A 1CJKC 3B9QA 4IUCS 3O91A 3UYLA 1DIAA 2PANA 2PYDA 1HYQA 3EARA 5JCJD 4QHSA 4F6RA 2OO5A 1QGYA 1G8HA 3WMGA 1XU9A 4NZNA 3SG0A 2NYVA 2CB0A 1TQ8A 1E2NA 5CEFA 1U0JA 2A9PA 3IDFA 1RRMA 3JQDA 4P31A 1AZSC 4KOAA 5I48A 3DS8A 1RJWA 2IE8A 1YDWA 5D51S 4QG7A 3JATB 3COJA 3HDQA 4HNHA 5FPSA 1QK4A 1UF9A 3VR2A 4W5NA 5KUTA 2C7OA 7REQA 1PYDA 1YDEA 3QHQA 2JFFA 4N47A 3HK2A 4IVPA 2IX9A 4FSHA 2O54A 1FCJA 1QO0D 3BL8A 1PZFA 1DS6A 1XZGA 2NVBA 4JL6A 5IAEA 4ZO4A 4KO3S 1R27A 4JROA 4NPAA 2R0QC 1QU2A 3KFVA 2C2ZA 1NSYA 2GN9A 2PM8A 5BNWA 2H4JA 2ZOSA 4EKGA 1QXSA 3HBLA 2AD5A 2FYTA 4WWHA 3U3ZA 4WBNF 3FYUB 2CMDA 3B1YA 1EVZA 2GCGA 1Q0TA 2GD6A 4I6GA 4CR7A 2XUZA 1BDJA 4O33A 1T8SA 3UKOA 1NW9B 4I55F 1P2VA 2D1FA 5CH3A 5EVCA 2W2MA 1LFAA 4BNDB 3TFOA 3BTOA 1AT1A 1LI5A 5ALXA 5LKAA 3LU1A 2HQSA 4GOXA 3L7OA 4I14A 3HA5A 2DULA 2QYHA 2Q45A 4H7JA 3W9BA 1SWVA 5KWEA 3FF1A 1NQOA 4CDMA 3ENQA 1DFGA 4YFYA 3L7MA 4OSPA 3A26A 2NUTA 3ZDXB 2Z3WA 4QBIA 4WCFC 4ZQCB 5TJHA 2G8LA 1ZM9A 2BMDA 4LI3X 2DGDA 2C9OA 1F1BA 2DPMA 5BWCA 4ECAA 1NZJA 2QRZA 3DTYA 5FA6A 5A5DA 2JCYA 3AZPA 3PX7A 2LCFA 2H0AA 5E1MA 1W29A 4F4HA 4R2IA 1SQGA 1UWVA 3FB1A 4I9UA 3W5JA 3KB8A 3O26A 4YUAA 1BVUA 3DMPA 2ZXUA 5IN4A 3FRJA 1L5VA 1Q3HA 3BL6A 2E4WA 3BX1A 3AJ9A 1OWOA 2LDXA 2PO5A 2HBYA 5A4AA 2DFPA 1B1AA 4D96A 3VPBA 2FFBA 1U2RA 3FAKA 1DRUA 1J0DA 3G2IA 3WP0A 1YL7A 1WMBA 1NRXA 4ALLA 2JBAB 4FVTA 1RPTA 3HCEA 2A5GA 1ENPA 2HAEA 4XUCA 1J7KA 5AUNB 3OCJA 3EEYA 4HZUB 1BEEA 2WJ6A 1IHDA 1VIVA 1FS4A 4YJ3B 4RJJA 4LBVA 1A9XA 2ZJ2A 5AI9A 2FWIA 2XEDA 1TT5A 1O0SA 4H1VA 4IMJB 1KI7A 4OYYA 1Y80A 2PMCA 1GTL1 3PI7A 3CJQA 1OW3B 4Y2UA 3UPTA 2ZP1A 4ZU6X 3WKBA 3H8JA 4G5RA 1EHYA 4XGKA 4XYMA 3RVBA 4KN8A 3VBEA 4S05A 4HDCA 1EXWA 1XI2A 2YZNA 1G3RA 1II8B 3ZS8A 4CIVA 5B1EA 5DTRA 1R6BX 3X2FA 1SRQA 3I5YA 1Z0ZA 2I6GA 2AC4A 4QT4A 3GLFA 1RJ9B 4EI7A 1GIAA 4UAJA 1OWLA 5FWNA 3FHTA 3L9XA 1LCIA 4PLVA 3V3TA 1PTJA 1PFQA 3KL4A 3JQFA 5AK5A 4L85A 4R9VA 4L4ZA 4C4RA 1ZMTA 2WKPA 3M6IA 3AG5A 3PQDA 3T5AA 3EAFA 2WY2D 3IBSA 2DX7A 4CEIB 1AZWA 1FTYA 3SC6A 2I54A 5JS8A 4CETA 3SBDA 1A9PA 2BBWA 2GXUA 1CUHA 1FS5A 4KBFA 2B8WA 1WUIS 4RQAA 2HV8A 3I2YX 2GCIA 2AV6A 2JC3A 1IBCA 1KI6A 1OILA 4PGGA 1D0SA 3ZUGA 3UK7A 2PUJA 1JZSA 3DMNA 3V97A 5I5EA 5K3SA 3IUJA 3LHSA 3KKLA 1K4KA 1Z7WA 1N1EA 3EDOA 1T9AA 4YMGA 3DLCA 1GUYA 2WFLB 2WHXA 3QG5A 3ECSA 2IUSA 4RF3A 3FCOA 2GJAA 3VZCA 3K09C 3O2NA 1K89A 4I5DA 4K81B 1VMIA 1VE9A 3QVMA 2KHZA 2Q4BA 3NYIA 3TK1A 5KOHB 1H3FA 1MO4A 2DECA 1IBMB 4BVBA 1DG9A 2D4HA 2V7EA 3LC0A 2Y76A 1N25A 5DN6D 1OAOC 4WY5A 1N3BA 3KQWA 3LV8A 3PC2A 4UHDA 3WLEA 2IZ5A 3F0TA 3V2GA 1KP2A 1PR6A 2E1PA 2QW1A 3ANNA 3FVRA 2IUYA 3K0FA 1ZNYA 1IY0A 3MBOA 4H9GA 4KE6A 3HI4A 4L2IA 1RPAA 2ZWPA 3LUGA 5JZOA 1VYUA 3OICA 1JEEA 1HDEA 2IYAA 2GN0A 1KYZA 2RMKA 3MPOA 4LNUB 4A8JC 4HDQB 3VDMA 1MJNA 2C0CA 2YJTD 4AP6A 2CMKA 1IQRA 3PPIA 2D06A 3VV3A 1XF1A 2BM0A 3LYAA 4OJKA 3FOFC 4UQPA 1B3BA 2P11A 1MB2A 3R8XA 2FG7C 4Y2HA 1AD2A 1HRDA 1IZZA 3G0CA