3NDPA

Crystal structure of human ak4(l171p)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
214
Chain Sequence
b'LLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase isoenzyme 4
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human adenylate kinase 4 (L171P) suggests the role of hinge region in protein domain motion
pubmed doi rcsb
total genus 63
structure length 214
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ndpA00
3PUXA 3NIBA 3E70C 5K8IA 2JCSA 3CX7A 5HZKA 2EFEB 4GZMA 4J0QA 1BKDR 1EFUA 4BEJA 4PX9A 1TEXA 5KNBA 2AN9A 3Q72A 1FUKA 2J0UB 4U02A 3GEEA 2AK2A 1IXRC 2BC9A 4NBSA 3EPJA 3WYGA 2J0UA 4L8GA 4MYTA 2BV3A 3QKTA 4P4SB 4YC7A 1VYTA 1UAAA 3PCRB 3VHLB 3AVXA 2YOFA 3L82B 1KI8A 4YMVA 4P4SA 3U7HB 4YONB 3ZVMA 2DFNA 2WKPA 5JSZB 4RD2A 2KB0A 3PUYA 5D3MA 5P21A 3UIEA 4QBGB 5FPHA 1P3JA 2PEZA 3SFZA 3CNNA 5LD2B 5BN4A 1HUQA 1ZCAA 1ZU5A 2PCJA 2RGAA 3UK6A 4M21A 5H8WA 5JJLA 2RKOA 1G18A 3ZYCA 5E7IA 1NBMD 3G5UA 2R6FA 2CLDX 3OFND 3O8DA 2FZLA 4M9SA 2LWIA 5J4LA 3NEJA 1BO6A 3A1UA 4GI7A 4BWYA 1XWIA 4JKIA 2NOAA 3BWDD 4JS0A 1GL9B 1YZUA 2F43A 2ODBA 3ASYA 4AG5A 1YVDA 3EZ7A 4K81B 3FDIA 4IDQA 1NIPA 5KNDA 3KL4A 2IC5A 3A6PC 2FFAA 2HF8A 3FKQA 2QMUA 5IT5A 1MR3F 3BRWD 4XSGA 1F2UB 2BDTA 3OF5A 1JEDA 2OE2A 3QBVA 4PQRA 3BBPA 2GCOB 1KJWA 4XSHA 1KJYA 3GJ4A 5CB6A 2WVJA 3B60A 3CB4A 3TAUA 2BKEA 4LWZA 3NXSA 1OXUA 1QDEA 3NH6A 1VKJA 1SXJE 5AWFC 2JLVA 2BM0A 2XEXA 4M1WA 4DT1A 4XWOA 4LJ9A 2ZRDA 2QG6A 2O8FB 2CCKA 3RHFA 2F1IA 2MMCA 4EUNA 3THXA 4ZDIA 3NBFA 1YZNA 5KNCA 2GESA 4EFMA 3R20A 4HI0E 1E9CA 4B43A 1W2GA 1VG0B 4QJ5A 3CX8A 1R6BX 1Z83A 1JAHA 1G7CA 2WSSD 2EFGA 2VEDA 2W0SA 5DI3A 1GIAA 1KI3A 2KJQA 4IFBA 4BECA 1CJKC 1XEXA 3DOEA 5J5CA 3U61B 1RRCA 1GSIA 3CPHA 2A7QA 2JIZA 3FKSD 4P3YA 4QHYA 1W49A 3MD0A 1ZP6A 2V54A 4X8HA 1M8PA 5DH9A 5EP4A 4M1MA 5DE3A 2XTMA 3K0FB 1E2DA 5TARA 1JECA 1GUAA 2CL6X 4IOJA 3QIAA 3ND8A 3A4NA 3C5HA 2G1JA 2NO6A 4TMKA 1E3MA 2CCGA 3ZD7A 4WW0A 1G1MA 1UM8A 3U6KA 5CJPA 2DFTA 4UNNA 2OESA 3TAHA 3W34A 5TDHA 2ZYTX 2ZYWX 5G41A 1E2EA 2CK3A 1K5GA 2ZRMA 1Z0JA 3AF4A 4A6XA 2ZQ5A 4BZQA 2PZGA 2NPIA 3VR5A 1GKIA 2ZRAA 1XTIA 1FL9A 3CZQA 4FCTA 2ZAMA 4EPXA 4Z51A 4PPFA 4BFTA 1E0JA 4A4DA 3ADKA 1U98A 3VR1A 4JLNA 1NVVR 5FBQB 5EP3A 4LHWA 1WF3A 2QSYA 3A1TA 2J41A 4I99A 4KVGA 3FMIA 1DG1G 3B1VA 1KK1A 4N0EA 2BEKA 4FD2A 2W2VA 2FA9A 4FWIB 2R8RA 1GKUB 4FW9A 5A5GA 3K70C 2R9VA 4HB4A 1ZIOA 4KLNA 3KXLA 4XTCS 4I81A 2YNMA 5CK4A 3UMSA 2CHVA 2IYVA 2D7CA 1ZM2A 2JLUA 1NF3A 1W36C 1FZQA 3CIOA 4XJXA 3LWNA 2CVHA 4FMCF 3DMNA 1DADA 3CZPA 3E1SA 2QAGC 4EJSA 1TTTA 4LRWA 2IBMA 2GILA 3FHCB 1T6NA 4QBIA 5HCIA 4BFYA 1OIWA 1J8MF 2AXPA 5DHAA 2O52A 4OI4A 4WAUA 3VR6A 3X1WA 2G77B 4EJSB 1NN0A 2FZ4A 1VCIA 4FCWA 3BC1A 1OPXA 2IWHA 3AVVA 4AK9A 1W48A 4AC9A 4BLOA 3RSLA 4B75A 2O0JA 2QQEA 2IYLD 3RLFA 1XD9A 4GL2A 1KAGA 1VYVA 2IYWA 5J4KA 2V7QA 3DKPA 2X2FA 3EWAA 1XRJA 2OLJA 3GLHB 3QVVA 2D06A 4JKYA 4JVLA 1N6HA 2IX3A 4ACBA 2QBYB 4ACAA 4AKGA 1KNXA 2LKCA 1T0HB 3O8CA 4A8JA 1IY0A 1L7VC 3MRSA 3VR3A 1Z47A 2ZYUX 3W8RA 3QSYA 2ZRNA 3CKLA 3PXGA 2HJVA 3WMGA 2AFHE 4HLUC 1AGRA 1U0LA 3R7WB 3A4MA 1KZGB 1JXMA 1XJCA 4GOKA 1FP7A 1K5DA 1NSFA 4RZ3A 4AG6A 3TW8B 2W2XA 2IHBA 4CEJB 4FMDB 4MDEA 4QC2A 1R0YA 1IAQA 5IRCD 3K70B 1QHHA 4HB3A 2XNSA 3DO6A 4Q9HA 2ZS8A 1Q0UA 3DL0A 4FINA 1CKEA 2AKAB 3PG5A 2UZIR 3QNUA 1M2OB 4KO8A 4PHGA 4C0AC 4URXR 1S2MA 3UMFA 5FTLA 2GRJA 3T34A 5JMTA 2GK7A 5FPYA 4QM7A 1E1RA 2AKYA 1X1RA 2R2AA 1BYIA 2CK3D 2VH5R 5CM9C 2PLRA 3QEJA 5IF9A 1OF1A 2ZROA 2JDID 1W4AA 1QF9A 1FPMA 3AV0B 3DEFA 1RPZA 1Z0DA 2ASEA 1CR2A 3LX5A 4DKXA 1M74A 2VSFA 1Y63A 3G82C 5FH9A 2ZXUA 3OEED 5K8TA 2ATXA 3B7GA 4LBWA 4C2UA 3V00A 2IS6A 4QRHA 4IVQA 4W5WA 4URZR 1AGPA 3P27A 3C14C 4XD7A 1OV4A 5HKKD 2NO7A 2OXRA 1J70A 4DSTA 1HA3A 1AZSC 1KIMA 1I2MA 1OFHA 1AQUA 3PR1A 4KYIB 1CJUC 2IYRA 3HP1A 3IIKA 4TLEA 2GF0A 3RNLA 3OZXA 1K8RA 4I4LA 5K8UA 4RCYA 1N0VC 2E1RA 2REBA 4BFZA 3OIUA 4FMCB 3RC3A 2OUKA 2QSZA 3JVUA 4I1SA 4HZUB 3L0SA 3AVTA 2IEZA 1P9RA 4HLUA 4ASUA 3RWOA 3CNOA 2QTHA 3TQCA 2O8EB 1TX4B 1E2IA 2VP5A 4JLJA 1CS4C 2X2EA 4GRAA 1QZXA 1KI1A 4II7A 4R9UC 3IUYA 2FG5A 4OHVA 4RD1A 3NBZC 4B3CA 4UQOA 5FOUA 1E2HA 2GEUA 1XTJA 1YR6A 5L3SA 3UATA 2ZAOA 3I32A 2D2EA 3IQXA 4JLMA 2ZR0A 2BJWA 2FSHA 4RD0A 2CEAA 3F5FA 2PX3A 1E2PA 2WJJA 1NSTA 1G4AE 3W90A 3LO5A 3KFVA 3H2YA 4QKQA 4B48A 4JLPA 5HZHA 4PC7A 3FFBA 2NG1A 3PENA 3EARA 3T5DA 5J4VA 5AJYA 5JCPA 2C9OA 4PHHA 2YJTD 1E2NA 3ND9A 4MRVA 1K6MA 5TV2A 5EXTA 5HPYB 1FX0A 4M0LA 2GXAA 4M4SA 3TVDA 2GEVA 1OIVA 4LJ4A 3RS0A 3ZLJA 3L8YA 2J45A 1IJEA 1ZU4A 2IYQA 2WAYA 2GBLC 3D3QA 3TE6A 4PO1A 5JHGB 3TNFA 4TL6A 2V3CC 4DCUA 1VHTA 1W4CA 2C95A 2CLCX 3KJIA 5F98A 4U00A 4V0LA 1EGAA 2IYZA 3VNVA 1A5TA 3O47A 1T8TA 4KLZA 1D2MA 3B78A 1QVAA 5KPDA 4QJ4A 4F4CA 3X1YA 1IJFA 5TXGA 1KYIA 2QGZA 1E0KA 4NCKA 3FTQA 2PJZA 4NYMR 2IS1A 2QE7A 3QY0A 3ONWA 5KPJA 2QM7A 2FEOA 1DO2A 4Q4AB 3T15A 5JRZA 1SVMA 4IDNA 3BIFA 1UBFA 1E0SA 2NO1A 3BH7A 2HT6A 3UG7A 4URYR 5EE9A 1OH8A 1G19A 3ADBA 2BJVA 1II9A 2PZEA 4D26A 2YC4C 2HV8A 4LYHA 1G5RA 3TW4A 3NBYC 2GXSA 5FBRB 1CF4A 3CBQA 1XXHB 3GEHA 4M1KA 4OYHA 2FX3A 1UDXA 1OH7A 4MGZR 2GWHA 1P6XA 3L2OB 4ASUD 1EFHA 3SOPA 4PO8A 2HCJB 3IIMA 4DLRA 2C78A 2W00A 2ZRPA 3QKSB 4GMDA 2ZJYA 3SR0A 1D8TA 1SXJB 2OBNA 3Q8XB 4PSAA 4Q02A 2QU8A 5LDDC 2B8TA 1Q12A 5EUQB 2ZR9A 2VHCA 1V43A 4HUQA 1KO7A 2GDJA 4KFSA 2J87A 2Z0MA 4KFUA 2ZSBA 4MKGA 2GBLA 4AWXA 4M9XA 2R62A 2FOLA 2RGDA 3VX4A 4P0TA 4AKEA 1H8HD 1D9ZA 3AQ4A 2G83A 1L2TA 1Y3AA 1YZLA 2IF2A 4L9WA 4AY2A 2ZRCA 2V4ZA 3RRMA 2RGCA 2YC2C 3EZ2A 2QN6A 1P75A 5FI1B 1PV4A 3LQRA 4X8LA 3VQTA 2WIBA 5JLJA 1Z6AA 2KWIA 1MABB 1N3BA 4MRPA 1IBRA 4UNPA 4MQBA 2PT5A 1N6NA 4P33A 4EFLA 1S9HA 2C2HA 3WHKA 4D25A 4AI6A 3CR7A 3B1XA 3X1DA 1TNDA 4C30A 5KO2A 2HDNB 2WWXA 2ZSFA 2ZJAA 5SZJA 5JI3E 3CPJB 3P1JA 3CW2A 3ZZUA 3KXKA 1NBME 4D0NA 3HDTA 2ZE8A 4PPQA 2QEQA 4CEIB 1AJEA 3AH8A 4Q1DA 1KO5A 2A5JA 3I73A 2XNDA 1SKYB 5HKKA 1E6CA 4A1FA 2GVZC 1G6OA 1MRSA 4ON9A 4TTQA 4XWAA 1B0UA 4URUR 1RJ9B 4TL9A 4YMSA 1P4SA 4O0MA 2XB2A 4ITRC 1II0A 3MWKA 4AIIA 4TSFA 2ZIAA 5AR1A 1KSGA 5FUVA 3WNBA 3NTUA 3AVOA 4DCSA 1GG2A 3QXCA 1FX0B 2PMDA 4TMVA 3KKOA 2P6RA 1OKKD 2NGRA 1UBCA 4TLAA 1N6KA 1YZKA 1Z22A 4MYUA 3OHMA 2F9MA 1WRBA 1GNRA 3EPHA 1E1RD 1U9IA 4ARZA 1NRJB 2VHTA 4DSUA 1RRPA 4XTRA 1O3YA 4D82A 4ARZB 1P2UA 1SVIA 3JZAA 3LAWA 4JT2A 3RRZA 3U3OA 4MYCA 1SZPA 4QGFA 1Z0KA 1XBTA 2D74A 3OAAD 2RHMA 1XPRA 3R8FA 1GRQA 1A1VA 2B21A 2CJWA 2G0TA 4OJKA 4D0GA 2F6RA 3SU8A 1AKEA 4H9GA 4TL7A 4E07A 3IEVA 4IKEA 1IN5A 2VF7A 3EW9A 4BFWA 4PQYA 2QP9X 4C7OB 4GZLA 1NKSA 4UNRA 3HYRA 2ATVA 3H4MA 3AP3A 4PZYA 4CZ2A 1J90A 2B7CA 4WZ6A 4JLAA 4BGDA 4EDHA 2EYUA 1YR9A 1G8YA 2C98A 4MYHA 1QHIA 2VTKA 2ZJOA 2GHIA 2ANBA 4FWTA 4UXIA 2VF8A 4JVMA 4P4UA 3DM9B 2EW1A 3GEIA 1U0HC 5JFGA 1JJ7A 5EE5B 2ZUDA 4Q19A 5JSZA 2ORWA 5GVRA 4WVFA 1NNEA 3GLHA 3S1AB 1UFQA 2GNOA 4LJ5A 4MGIR 4A92A 2IK8A 4YMUA 5C1BA 1ZD9A 3IPXA 4KODA 2ZVQX 1E4VA 1XDBA 4KJZA 2GF9A 4PR0A 4LK2A 1VYUA 4QHTA 1HE1C 1E32A 1XEFA 1ZCBA 2BCJQ 3A37A 3CONA 4JSYA 3T1QA 4DUGA 1N6PA 1C1YA 1I4TD 3Q9LA 4LGMA 1ZAKA 1LV7A 1P2VA 1SVWA 1NVWQ 1P62B 1UADA 2ZR7A 4WXRA 5EZ5A 1ELOA 1ZUIA 4R7ZA 4DLTA 4WZAE 1RRFA 2YOHA 2VHUA 1W5SA 1GITA 1DG3A 1XMSA 1QRAA 2XJ4A 2W6ID 5CYPA 1M1YE 3TVTA 1RW4A 4LI0A 4TQ9A 4CEJA 3GJXC 3LQQA 3AM1A 3GLHE 1ZMXA 1G3QA 4R2IA 4ILEA 3EPLA 3QPVA 3KQLA 3QF4A 2ZI7A 4JVSB 2ZE7A 3HJNA 4EPTA 4F93B 3CNLA 2I1VB 5SZIA 4FXPA 1EK0A 3T5GA 3QKSA 1FW6A 3LD9A 4JZKA 3LDAA 1G3UA 3AVQA 3GJ6A 1H8ED 3QPUA 1P9WA 3KKMA 2XZOA 3QKUA 2JLRA 3P4YA 3EA5A 1N6LA 2OFOA 4GFDA 4TMTA 5KOYA 4NCJA 1KDTA 3WBKA 3DZDA 2F43B 4ABYA 2ZI4A 2Z5FA 4LJYA 2O8FA 1D6JA 2FNAA 3WMFA 4DHEA 4OQMA 4M2LA 4KBFA 1HH4A 2QQ0A 5JS8A 1ZIPA 1VIAA 1P73A 2QP4A 1EG7A 1MOZA 2KE5A 2A3RA 2QTVB 1N5KA 2GK6A 1UPTA 3PUZA 1A2BA 4CIDA 1Z5ZA 4B47A 2DR3A 5FFMA 3MCAA 1EWRA 1KJZA 2VSOA 1NG9A 4A36A 3BGWA 4CT5A 4OQFA 1GNPA 3LH5A 3ZQ6A 3TSZA 3U5ZB 5IDVA 1HY3A 4M1SA 4TYPA 4G1UC 4O3MA 1XCMA 2ODEA 3EZ6A 1ONBA 2DWPA 421PA 3T12A 1U8YA 3REFA 3SNHA 2AXNA 2D3WA 4G3XA 5AJWA 4Q5IA 2IF0A 5L3SB 1S3GA 5H1YA 3SHFA 1DAFA 2WOOA 3BB4A 3N2EA 3AP1A 5EXSA 2C96A 4BZPA 4JL6A 3REGA 3ZS8A 3PV0A 1CRQA 3U44A 4JLVA 4ZDWA 4L16A 3D8BA 5LD2C 1CULC 2YKGA 3BFVA 4M9QA 4MGKR 1E9SA 3LBHA 4HATA 2UKDA 3SJZA 4FMDF 4RY2A 5BW8A 4YDSA 2HYDA 5DYIA 1F5NA 2O8DB 5KU1A 1HQCA 2O0HA 4QM6A 1FQJA 3CRW1 3KXIA 2BMEA 3N5CA 2QAJA 2WMNB 3IKJA 1J2JA 2OLKA 4ZCLA 3NEYA 2NIPA 4V0OA 1DO0A 5UKDA 3W9YA 1CXZA 1T91A 2QORA 2WJIA 2P0EA 3THYA 1JR6A 1COWA 1QHNA 4FI3C 5EJEA 1NP6A 3ECCA 3I1FA 1GFIA 2WWYA 1S3SA 1E99A 4PANA 2JJ1D 2QENA 3AKYA 5F3WB 3OFNA 2REXB 3GLIB 4NH0A 5AK0A 4LBZA 1KOFA 4POAA 3I62A 3TJZA 4N0DA 4TMXA 3BAFA 4MRNA 4B2PA 3CRQA 4TQUS 4QJ3A 3IPYA 2IXEA 5H68A 2VP4A 1TQ2A 2BMFA 3RAPR 3ZIAD 4PC6A 2VLIA 1ANKA 5EXPA 3A1VA 5CIWA 5DN6A 3TQFA 1QG4A 1UBGA 3TUZC 4BLPA 4M1TA 4B6EA 4TLCA 4D4LA 2JATA 5GJBA 2PJRA 3RS5A 1NY6A 1Q57A 1KK2A 1E9DA 1G9XA 1ESNA 4LHZA 4RD6A 1J7KA 2NMVA 1MO6A 3SI7A 5D3QA 2CNWD 3U60B 2J9RA 5CDFE 2N42A 3KJHA 1B23P 4RJLA 3TK1A 2QP3A 1F60A 1XB2A 4IVPA 4NZYA 1F3OA 2P3SA 4O25A 4JSTA 5JCZA 3GPLA 1JPJA 1DAMA 4NCNA 1E2FA 1J99A 2DWOA 4TZ6A 4FIDA 2IYTA 2VRWA 5AUPB 1Z29A 2B8WA 4HB2A 4DLYA 3Q7QA 2HJGA 2EU8A 1KY3A 3DKVA 3BORA 5G3YA 1IN4A 4KAXA 2FU5C 4CT4B 3KKPA 4JT4A 2VL7A 4GDFA 2FEMA 1SXJA 1GP2A 1LY1A 2RCNA 2R65A 4IOKA 4Q7LA 4V0NA 5GJVC 3SEAA 3WRXC 1W0JA 1U0JA 3CF0A 5CJ2A 2GKSA 2QE7D 2WAXA 1DAEA 1R10A 3AF0A 4KI0A 4D4KA 5KDOA 1SVSA 3AF3A 3GJ3A 1UKYA 3UG6A 3HWSA 2OHFA 4EJSC 5JS7A 1Q1ZA 1I4LD 4GMXA 4Z8XA 4A82A 2Z6VA 3PUWA 1JPNA 1Q3TA 1RVDA 1OYYA 2WSMA 4DB4A 1NJFA 2Q0HA 1TU4A 3JZMA 4XD7D 1E1QD 4K8OA 1T9HA 1JAIA 1Q1EA 3K1JA 4PXAA 3TBKA 4A9AA 4QHSA 2CBZA 4HLDA 3RWMB 1GL6A 3QJYA 3H86A 5KSYA 3ADDA 4ZI2A 4QBFA 2ZRLA 1XXHA 3ZDQA 3Q7PA 1YE8A 5B64A 1JI0A 3I72A 1AS0A 1UKEA 4F4IA 3G0HA 3SQWA 2FFHA 3B1YA 2WWGA 2GXQA 4B35A 1CLUA 3U6BA 5BQ5A 3SYKA 3VU9B 1NG1A 2P6NA 2PL3A 2A5YB 5DI3B 4UKDA 2XXAA 4MKIA 1PLJA 2RGXA 1L4UA 1D5CA 1E9EA 4Q21A 4B73A 3R7WA 3ZQJA 1WCV1 3L8ZA 3LRPA 4JBWA 2NQ2C 2RB4A 2H92A 1JNYA 2FWRA 1E2GA 2W6JA 3KUDA 3PITA 1U94A 2ZSDA 1KKMA 5CDFA 4ZI3A 3TR0A 3UXMA 3F0TA 4HUTA 3U7FB 1EX6A 3K9LA 3LVQE 4M53A 1RKBA 2QMEA 2HXSA 1SVOA 1XD8A 3BS4A 1R8SA 3QUSA 4U7DA 4HLQB 1JALA 5FL7D 1T3HA 4PAQA 1NKTA 1XMJA 2J7KA 4D2IA 4EFNA 3ASZA 4E22A 2JLXA 1F6BA 3EC1A 2ORVA 1E9FA 2ZS9A 2CHQA 4NCIA 3LY5A 1W0KA 1N6IA 1D9XA 1E2LA 1S0UA 3FPAA 3NC1C 4C0QC 3DHWC 3KQUA 1DELA 2Z4RA 2JASA 2ZTSA 2YWGA 3IO3A 1I4DD 2ZU0C 1JB1A 3OIYA 2IS2A 1CRPA 4BLQA 1Z6TA 5L8VA 1G21E 2VHQA 1GKYA 1ZD1A 2A9KA 2ZRIA 3V4RA 2QY9A 2Q3FA 1ZNXA 2CL7X 1IQPA 2X1VA 2CJWB 1CU1A 4IRUB 1VCOA 2ZUCA 1HYQA 4HAZA 3VKHA 1XU4A 2JA1A 3NBXX 1OLOA 4QGHA 3F8TA 1KI9A 3LLMA 4NMMA 1G8FA 3CLVA 3K09A 1VECA 4G01B 3TRFA 4ERNA 2F7SA 3N70A 1TU3A 5DO9A 2FSFA 2ONJA 2X19A 1DAIA 1G8HA 1NMZA 1N5IA 2ZRKA 4LV6A 3SYNA 1E94E 5ANRB 4Q4LA 3K0EA 1D2EA 5HR5A 3L43A 2MMGA 3LNCA 2I4IA 1XTQA 5JZVA 1VMAA 2A2ZA 3AKEA 4I1VA 1GAJA 2Q21A 1TUIA 2QMHA 1PUIA 1ZNZA 2XOKA 1IONA 3DM5A 2FFBA 1XTRA 2AD1A 2N46A 5TVKA 4B44A 2XGJA 3GMTA 3W3AA 3WBJA 1TAGA 2IYXA 3L0OA 4WXPA 2XB4A 3KJGA 4RFVA 2QGNA 5FTKA 5B57C 2WJYA 3I8XA 4F4JA 1E2QA 2Q9BA 3FWYA 5EZ6B 2PMKA 2HCBA 5IHPA 3PFIA 1E4YA 2F55A 1GOTA 2L0XA 2GZAA 2BM1A 2GCOA 1R4AA 3MAAC 1R5OA 4M1YA 3AVYA 3BERA 1CR1A 4D0LB 1R7RA 1EFCA 1OB5A 1KY2A 2GEDA 1OHHA 4LJ7A 2MSCB 2A78A 5BN5A 1GRRA 3V4FA 3NG1A 3ZVRA 2ZU6A 3EASA 2ZI3A 3PVSA 4NPHA 2VP9A 4OHXA 2FF7A 2EQBA 1G3MA 2PX0A 4LZZA 4NCHA 5F2EA 4HZUA 1MO3A 3LXXA 3NC0C 4IEIA 2OCYC 2QPAA 3BK7A 3EZ9A 2FV8A 4JIMA 4ZIRB 3KQHA 1KSFX 4C7OA 3KTAB 1DE0A 2ZRFA 2QROA 3PJRA 3KKNA 5IK2A 1G41A 1M7GA 3LA6A 3QKRA 4TWZA 1ZM7A 1I2DA 3KJEA 3FMFA 2BHRA 4EKDA 3NDBB 3T35A 2WICA 4AURA 4W5HA 4XVQA 2VP6A 4M8NE 2PH1A 4IDOA 3WHLA 3OIVA 5DIFA 5C4MA 5E7JA 4EPWA 1JR3E 3IQWA 2VYFA 1YRBA 1SGWA 1FUUA 2KSQA 1XF9A 3OESA 3VR4A 4QG7A 2CVFA 1FP6A 3QXSA 3I92A 1JR3A 4I1UA 3MLEA 5AJXA 4AKIA 4LHXA 4LC1A 2REOA 4K46A 5LB4A 5C2JB 1ZINA 1P2TA 2W6JD 3M4YA 5DISB 3I8SA 4L4UA 5FL7A 2J7PD 2F3RA 2N1BA 3OE7D 2DCUA 4HYYA 1ZUHA 4HAYA 2WKRA 4H1UA 1Q44A 3NHBA 4D80A 1OXTA 1PLKA 2O8CB 4DIDA 4NTZA 1W5TA 4EPVA 3B85A 1JXOA 1WXQA 4LYAA 1SULA 4DCTA 1G20E 3BH6A 2VHJA 4F7WA 4CEIA 2J7PA 1GILA 1E2JA 3X1ZA 2G88A 4LPKA 1F48A 4B33A 2FPLA 3CPEA 5BXQC 2ERXA 4XH9B 2W83A 4WZBE 1N0WA 2PLFA 3BE4A 4TMZA 2AL7A 4RSGA 3U4QB 3LW8A 3EPKA 2XX3A 2VP2A 1NLZA 2BOVA 3C8UA 3QQ5A 3U3KA 2WMOB 3U7GA 1E98A 1SVLA 5GVSA 1IXZA 2EYQA 3RS4A 1A7JA 2XSZD 2R44A 3T1TA 4GBMA 2QNRA 3ZIAA 3R9XA 5BYJA 1SQ5A 4LX0A 2GTPA 4B2IA 4FCVA 1XMVA 1ZM9A 1DS6A 1FNNA 2DPXA 1NMYA 2J0VA 2AX4A 5K8LA 1NBMA 1YZTA 2H16A 2J0QA 2ZE6A 1TMKA 3K0CC 3GJ0A 1NL3A 1KMHB 2FDCA 4RKFA 2RMKA 1DBSA 3GJ7A 1HEIA 5LBIA 1TQ4A 3CR8A 4OHZA 2QT0A 4Q1AA 4URWR 2OCPA 1XJQA 3U7EB 3CF6R 5CLQA 4R2HA 3R9IA 2HXYA 4B3XA 2AR7A 1G7SA 1G5TA 3CM0A 5LB2A 1U8AA 3GLGA 4TYYA 4Q4AA 1OFIA 1N6OA 1UBEA 2JJ2A 2QZ4A 3TSWA 1XMIA 4TYWA 1M7HA 4IXMA 2EFCB 2IW3A 3D6TB 2GAAA 1XNJA 1VHLA 3L0PA 5FPKA 1QHSA 1XCGB 1NVXQ 4KSBA 3FB4A 1P5ZB 1TPZA 2YV5A 4GP6A 3BD9A 3RVBA 3H0KA 1G64A 3P32A 1CR0A 4OL0A 3BB3A 5L3QB 4IXNA 2IYSA 3AKDA 2OFWA 4HDQB 3THOA 2FE4A 2ZETA 1E9RA 2C03A 2DB3A 4UNQA 2RGBA 1X6VA 1YR8A 2V8OA 2V1UA 1KZ7B 4A15A 4TZ0A 4R98A 3K70D 3KB2A 1CR4A 5ELXA 1NJGA 3AUYA 5CITA 4OI1A 5J4YA 1IHUA 1LFDB 5AJZA 1X1SA 4PZZA 2EWVA 2AK3A 3MWLA 3QXXA 2JLQA 4HUQB 4DDWA 1TF7A 2O8CA 1GVNB 2C9CA 1WB9A 2Z43A 3K0FA 4GNKA 2IUTA 1WP9A 1KO1A 3W5IA 4GT1A 3NKVA 2ZSAA 1IXSB 1R5BA 1BMFA 1XZQA 1HT1E 5FBWB 2ZPTX 1HURA 1G3IA 3PEWA 3QENA 3EIEA 4KXFB 1ZM4A 4Z1MD 1KSJA 4YLGA 4JL5A 5EP1A 1YZGA 3LBNA 2X77A 1COWD 1KDOA 1KDRA 1FTSA 2F1HA 1BH2A 4ZCIA 5BN3A 5JJKA 2IT1A 4DEXA 1GZSA 1RRGA 1NLFA 3RS2A 3U3RA 5AUNB 1MABA 4NYJR 3RYTC 2XSZA 1OXVA 3WRYC 1KO4A 2Q6TA 3PEYA 3FYHA 1W46A 2WIAA 3SE0A 4YXWA 4NKRA 1KDPA 1NMXA 2YINC 4CGZA 3RSOA 4D4JA 1XP8A 3B5JA 4NDZA 4PO9A 3Q5DA 2RH5A 2NO0A 3A1WA 3RABA 2OXCA 2RAPA 1R8QA 1E69A 1W44A 2WHXA 3LLUA 3TKLA 3NVAA 1TEVA 3K9NA 1S4QA 2PT7A 4US1R 3GLFB 1N6RA 1XFAA 4E09A 5GADl 1OXSC 3U4QA 3VHXA 3T61A 4DLZA 121PA 3FOZA 2VQSA 1W0JD 4MA4A 2BBSA 5KDLA 4Q01A 4DDTA 3QF4B 5KSZA 2XAUA 1YRAA 1E9BA 4WOPA 3VTKA 2V7QD 3MMPA 2J0SA 3H1TA 3KZ1E 2IXGA 3QG1A 5JEEA 3CUEF 2QAGB 2O8EA 4PFSA 1MRNA 1IOZA 2V6IA 4S2EA 1G4UR 4BEBA 4B76A 1W36D 3K0AA 1XJ0A 4Q48A 4TT3A 4F92B 5TMPA 1VIYA 2QAGA 3GLGE 1C9KA 4Q4JA 2ERYA 3UWKA 2R6CA 2JDIA 4KVAA 3W6OA 4HEJA 1PUJA 2ZITA 4B3FX 1LS1A 4LC0A 3PUVA 2W2TA 2QT1A 2ZREA 2XITA 4GP7A 1WBBA 4RCZA 3IBYA 4G0NA 4BE7B 2AWNA 5SZKB 1EFRD 4GOXA 4A0FA 3EX7C 3LBIA 3AP2A 4Q1FA 4M9ZA 3GD7A 4OHYA 3O8BA 5BWMA 3HR8A 2B7BA 4LV5B 1Z0FA 2JGNA 5FUWA 1T5LA 1ZC4A 4LUCA 5DI9A 5A0FA 3F3YA 4NYIR 3VNUA 3THWB 4V0KA 1L8QA 2C99A 3U2QA 2D4HA 3WYFA 3GLGB 1P2SA 5CLLA 4LYFA 4QNRA 3I5YA 1XEWY 3W3ZB 2ONKA 3CWZA 2FSGA 2MSEB 5C18A 2Q3HA 4BFVA 1W7AA 3BOSA 3QVUA 4C0SA 4Q7JB 1ZW6A 4G5GA 1JR3D 3DVLA 2XTNA 2GA8A 2UVQA 3MWJA 5J47A 3BXZA 1A4RA 3EIHA 3OEHA 2PBRA 5DGXA 4HDOB 4ZO4A 1AA9A 1PZNA 2PZFA 1KNQA 2FPMA 5J4HA 4TYNA 1JQLB 4NP6A 2V55B 4S35A 2CE7A 1IN8A 2HYIC 1EFTA 1U9IC 3OEEA 2YWEA 2I3BA 4EPYA 2V9PA 3C5CA 2IUUA 1E0AA 1LF5A 1WA5A 5G40A 2J1LA 4IDHA 2KI5A 3ZZ0A 1YJ5A 2DWQA 2AFIE 2DFKB 1LVGA 5J40A 1LB1B 1X3SA 5JBQA 1FQKA 5EQTA 4IW3B 2E9SA 4TTRA 3MWYW 5JHHB 4Q66C 2Z83A 2XZPA 1EWQA 4V03A 2GCNA 2XXAB 4A2WA 5CM8B 1BOFA 2VSXA 1RE0A 3BFXA 3T1VA 2IS4A 1U99A 4NYIQ 3HU3A 2Q3MA 2Z4SA 1EESA 4UXJA 1QBKC 3E2IA 4JMPA 3K8YA 4GSYA 4LHYA 4LY6A 4NYJQ 3FMPB 2OT3B 5F9FA 2YVUA 3QXHA 5TB5A 1L4YA 1XD2A 1DAGA 2OM2A 2IHYA 2ZSEA 1RZ3A 1X8LA 5M04A 2OBMA 1W4RA 2BWJA 4Q4HB 3TIFA 4PHTA 2J46A 1DPFA 5G53C 3D31A 4ZPXA 2FMXA 3ETLA 4MH0R 4B71A 3OAAA 3AGPA 4UXHA 4KFTA 2J3EA 5HE8A 2O5VA 3SJBA 2CCJA 4A2QA 4EQ6A 4PPGA 1Z6YA 1AN0A 5KUTA 1CBUA 1YHNA 1RIFA 2WWIA 5DHFA 1FTNA 3CRVA 4JLOA 3OIWA 3RANA 5LPNA 2NTYC 3MUFA 1WMSA 4P4TA 3WNCA 1OHHD 2ZI6A 3HU1A 4Q1EA 4B3BA 4CRWB 4LPSA 3IDQA 4KYUA 3X2SA 4DEYA 4B2LA 2EFDB 2XZLA 1PVOA 1FMJA 4AYXA 2JIZD 4TL8A 521PA 3A4LA 1R5NA 1YQTA 3QKRB 4BRWA 2JLSA 3ZJYA 1N0UA 2FPKA 2QI9C 4QXAA 4YMWA 4LJ8A 1E96A 2GAOA 5FI0B 2SHKA 2D7DA 2XNDD 4Q7MB 4RD3A 2ZVPX 4A2PA 3ZS9A 4LJAA 4PSKA 1Z63A 4Q47A 4O2RA 2JLYA 2DY1A 3B1ZA 4D4MA 2Q9AA 3U3JA 1S96A 2C8VA 4Y0AA 4BASA 4OI0A 3CRMA 4DSNA 4OQLA 1G7RA 3EZFA 4DLWA 3KX2A 1XX6A 4G5QA 3D7MA 4NONA 4QNMA 3SBEA 1R0WA 4TQAA 2ZS7A 2C04A 3AKCA 4TLDA 5EUMA 3QPWA 3UKDA 3IGFA 4Q00A 1XXHE 4RKEA 1G291 1ZNWA 2BVNA 2HEIA 5GJWC 221PA 2ZANA 3GQBA 3R8CA 3I4LA 3GLIE 1LTQA 1TL7C 1W4BA 4DWJA 1FFHA 1Q20A 3SFVA 3WP1B 1ZRHA 1OFUX 1KI2A 3UWOA 4DJTA 4ZKDA 3FMOB 2WV9A 3AVPA 2WOJA 1SHZA 2P65A 1CJMA 4OK3A 4CW7A 4MGYR 1N25A 2CL0X 2DHRA 3PIRA 4NU0A 4DLVA 2XJ9A 1KSHA 2WWHA 2A5GA 2WKQA 4OHWA 3C41J 3VU9A 3DZ8A 4I1OA 1MV5A 4HLCA 1XEWX 1M6NA 5FOWA 1KI6B 1MO4A 2A5FA 3M6AA 3SC3A 5IK2D 4OK6A 4DBLC 1E2KA 4UJ5A 4IOLA 2ZI9A 3CH4B 1AK2A 4RVCA 3A8TA 3OEHD 5FOSA 3QI2A 3C16C 5DN6D 3ZZTA 5KSPA 2GJKA 1HTWA 4PC3A 1P61B 4DDUA 4G5RA 2C9YA 1O87A 2ZJBA 4XVUA 1QG2A 5FOTA 3FFAA 1XCPA 2HLDD 3THYB 2RGNA 2VA8A 4Q4HA 3GP8A 4ZDJA 3KQNA 4BUJA 2H17A 3VMFA 1N5JA 4Q9LA 4B34A 1Q3HA 4Z1MA 1Q1BA 2WWWA 1GWNA 4NE2A 1ZBDA 5CK5A 1U90A 5L3QA 1T3LA 1AM4D 1ETUA 1RJ9A 3B9QA 1AS3A 1UKVY 1HE8B 2ZJ8A 4Q1CA 1J8YF 1BIFA 4MITA 1W1WA 4C0JA 5JRJA 4X8MA 2ZJZA 1OFTA 1PLLA 4LDJA 4JVNA 1E79A 1LW7A 3SS8A 4Z8YA 2CHGA 5B58C 4ZDKA 4TSFD 2HF9A 1R0XA 4UNSA 2OG2A 2KBEA 3IO5A 1OSNA 1H8HA 3RS7A 4N1AA 4Z54A 1GNQA 4JL8A 1T3SA 3N2IA 5L3RA 3RS3A 2QMOA 2H8KA 4IJMA 4A0HA 3TLXA 5FBVB 4IFEA 1UEJA 1XTKA 3EIQA 2ORIA 2GJAA 2HT1A 4DRZA 1M34E 4D6PA 2E87A 3CX6A 5B30A 4U5XA 721PA 1G8PA 2ZUBA 4L15A 4YXWD 1W47A 2WPDD 3ICEA 4KV9A 1QVRA 1WQ1R 4HAUA 4Q1BA 2YWFA 3Q3JB 3W6NA 3KDSE 1P72A 2ZE5A 2JJ1A 2ANCA 3AB3A 2O0KA 1GL7A 2W58A 3QXJA 3QEOA 3MJRA 4LCBA 4PHFA 4OKSA 5CIQA 4AYTA 4L5BA 4DCVA 2ECKA 2R6GA 2Y8EA 4C2TA 2D2FA 3Q5EA 3TSOA 1OH5A 3IHWA 2HLDA 1KK0A 1JQJC 1GRNA 1KMQA 4A8JB 2OSBA 5JI2E 2RGEA 3R9WA 2QBYA 5JWRA 1YKSA 4MRRA 3B9PA 3WY9A 3LVRE 2ZRGA 5HTKA 4EIWA 2BKUA 3S1AA 4OQNA 3QF7A 2R6AA 2QRNA 1W0KD 2ZJ5A 2IUSA 5FTMA 4ESVA 1ODFA 3I3SR 4WA7A 5BYKA 1W36B 4IEEA 2OZEA 2FSIA 1LS6A 5SZHB 1OT3A 1OKKA 4PTLA 2WZQA 3FE2A 1S1CA 3B13B 3U3MA 1A2KC 4HAVA 2JLZA 2CLSA 1ZJ6A 4IDPA 1QHHB 1RYFA 3ZD6A 4HSEA 2R6DA 2ODNA 2PCLA 4HDCA 1S9DA 2G3YA 4XIGS 5GJCA 1Z6XA 1TUEA 4B32A 3VKGA 1H8EA 2NZJA 2P5SA 4OQXA 1IM2A 3SN6A 4EAQA 3B8HA 4RFSA 2BEJA 3FVQA 3P26A 2W0MA 4A0GA 3A1SA 3NWJA 5E95A 4UJ3A 4BLSA 4BLTA 1UEIA 1MH1A 4URVR 3B2EA 2YOGA 3TMKA 4FN5A 2ZJ2A 5H70A 1U8ZA 2QL6A 3DPUA 4IOMA 5D3MB 1AZTA 1KAOA 2P5TB 2HUPA 5EE1A 3FHOA 2JJ2D 1E9AA 2QA5A 2FGKA 1KI6A 2IA5A 2FH5B 2ZRJA 4JLDA 4LHVA 3TUJC 5C46F 1TQ6A 3QOFA 2FJUA 4MUBA 2IEYA 2BBWA 2A30A 1NVVQ 4Q7KA 5FPSA 4BFSA 3CH5A 5FUXA 4KBGA 1HV8A 4JJKA 2EFHB 2YWHA 2ZI5A 4DVGA 2X8AA 5FR1A 1Z06A 4P32A 1VCMA 1VCNA 1Z0AA 2F9LA 2CE2X 2OCBA 3ZGXA 2BMJA 1ZYUA 2VBCA 4JBYA 1OJLA 1TF5A 1KGDA 2WBLC 4W5JA 5CB8A 1MO5A 4R71A 5EE0A 2C77A 1KI7A 3AF2A 3E5HA 4XVRA 3WNDA 5KDDA 4DB2A 2DYKA 4PC1A 3VX3A 3H84A 3AEZA 4DSOA 2JJ8A 2GJ8A 4AKHA 1MT0A 1NVUQ 4IVRA 3X1XA 2GZDA 2QTFA 2G0NA 5FR2A 4Q9IA 4YQFA 2QM8A 4C0BA 3GFPA 3JVVA 5EXXA 3W6PA 4Q18A 3L0IB 1UDWA 2WJHA 3GFOA 1IY2A 2IWRA 1TQDA 3B1WA 2GJ9A 3T06B 1SKYE 1T5IA 4MDFA 1BYUA 2OO7A 3NHAA 4A0RA 3K0SA 4C0KA 4TTPA 2F3TA 4X8OA 4B3GA 2QRZA 4DLUA 1VG1A 1Q22A 5FL3A 1XZPA 3VKWA 3SZRA 1JJVA 2YHSA 2J5XA 1CJVC 4P31A 3BJIC 2H57A 1GDDA 5JWOA 4RZXA 5KSOA 1ZNYA 3T1OA 2BBOA 4ESHA 2GETA 4M1OA 3I61A 5HCNA 3KTAA 1G7TA 2ZYVX 4BFXA 2LKDA 2QUZA 4DUGD 1D2NA 1DAHA 2JAQA 4WIAA 1VDZA 3K9GA 4V0MA 3KB1A 3DMDA 3ICQB 4L9SA 5KHOC 3RC8A 3WYAA 2MSDB 3C7KA 4G5OA 4RZ2A 3O8RA 3M0EA 2V6JA 1NI3A 2H5EA 4C3ZA 4B6FA 1VPLA 3MGCA 4V0ME 1DAKA 2CNWA 2IL1A 2ZRHA 3KFXA 2LCFA 3NH9A 1QHYA 3NDPA 4OBEA 2AWOA 2WM9B 5FTJA 4LV8B 1CP2A 4PAOA 3BFKA 4OK5A 1CEEA 2EVWX 3CF2A 4Q9KA 5HE9A 3SJCA 2QPTA 1RC8A 1VTKA 1W2HA 2CMKA 2QPOA 1S1MA 1E79D 2XOKD 4C0LA 3SYLA 2UZ3A 1N5LA 1LNZA 2WJVA 3P20A 4NYMQ 5JECA 2O8BB 5AUQA 5KTYA 3MSXA 3SHWA 4DZZA 3ZVNA 4LOAA 2WJGA 2KBFA 1AS2A 4MKHA 3UANA 1ZD8A 2NZ8A 5L3VA 2IYUA 5E3HA 1KMHA 3VAAA 1IN7A 4QOSA 4MRSA 5FTNA 1UJ2A 2G9NA 1M7BA 1GTVA 4NHOA 5DSZA 2RGNC 5B2ZA 2GCPA 4OJQA 4CF7A 4LYJA 4BFUA 3ADCA 2G1KA 1H65A 4PQFA 1WBDA 3B6EA 1A82A 3PEVA 8OHMA 4PAMA 4NL4H 5JJIA 2JLWA 3UMRA 1XPUA 1CJTC 1ZM3A 4JBXA 4D81A 1UF9A 2C5LA 2CXXA 4US2R 1Z28A 2OBLA 3RDPA 3K9HA 3EC2A 2BMDA 4W9MC 2ZM5A 4CEHA 1E2MA 1G6HA 1OIXA 1G5PA 4B74A 4F91B 3WP0A 4WBSA 1US8B 4KHZA 1OW3B 3WXMA 3MJHA 1T4GA 4F38A 3EAQA 1TADA 3SBDA 4PSVA 2Q9CA 1P60A 4C4PA 1ZVQA 2H1LA 4QBHA 4H1VA 4DC9A 2WSSA 1SKQA 1VG9B 4KCGA 3EG5A 3GFTA 3KUCA 3LV8A 4QFMA 5C4GB 4DLXA 2F1RA 2RHDA 2ZRBA 4JLKA 2OILA 1T8UA 1CTQA 2BCGY 2O8DA 1MKYA 1N2CE 1Z0IA 1AKYA 1RYHA 3CWQA 4A6PA 3K0AB 1PJRA 4TN1A 3LX8A 3C4JA 5JEDA 4YDHB 2PEYA 3TGPA 1II8A 4KU4A 1Q21A 4V02A 1NN1A 4KSCA 3TH5A 1LF0A 1XTSA 4BPBA 1SXJC 3V9PA 1JBKA 4OI2A 1WDTA 4LBYA 1U2RA 1G17A 5DLQC 4TYQA 3DDCA 4KITB 1SVKA 4LBVA 4N3NA 1HQYE 4Q03A 1G16A 3OE7A 4W7SA 4CVNA 3K0CA 1Z07A 1VG8A 1KTVA 2IXFA 3RRNA 4EQ6B 1EX7A 1T0JB 2JEOA 1OB2A 2TMKA 1KI4A 4DDVA 2ODWA 3UPUA 1XPOA 2P67A 2ZEJA 3GJ8A 2A5DA 4GOJA 4ZCMA 1X86B 2D62A 4QGGA 3I5XA 3P4XA 4DXAA 3TR5A 3GCGA 3HU2A 1JEEA 4ZIRA 5AJVB 1XD2B 4LSGA 4BZXA 1SHKA 4HB0A 1KO8A 2AHOA 5JWHA 3LW7A 1E1QA 1P9NA 3LXRA 1NY5A 2O8BA 4IHQA 821PA 1S8FA 3HPRA 4A8JC 1Z2CA 4G5SA 1R0ZA 1C4OA 3EWSA 4CEHB 1DTSA 3AVUA 3GLFA 4QGAA 3GLIA 1AQYA 3A36A 4Q9JA 1F2TA 2OEPA 3TUIC 3HR7A 1IY1A 1KKLA 2WTUA 2J59A 3LFUA 3GLFE 1OH6A 3KQKA 1F2TB 2VPPA 4RFSB 4Y0VA 1RFLA 2GJSA 3PEUA 2RGGA 3EA0A 3IBGA 2NPFA 1FOEB 3ZVLA 5KYKA 2NO9A 3ZH9B 3BH0A 1X8KA 4CDGA 2P2LA 1QHXA 1SXJD 2GXUA 3QG5A 4FMBB 4AD8A 6Q21A 1TF2A 4PPNA 5FBLB 1OYWA 1KHTA 2OAP1 2FGJA 2AD5A 2DFLA 2I1QA 4TT3D 1ZUNB 3IEUA 1CIPA 1V5WA 4HAXA 4DT1B 1Z3IX 5DNYB 4BLRA 1YZQA 4M22A 2WPDA 5FUYA 4YMTA 1FMLA 3AGQA 4E5UA 3VFDA 4KFRA 4XOIA 5E7MA 3C15C 4PC2A 2OAQ1 4HZIA 1DARA 3IIJA 1EFRA 3W5JA 3M1IA 1R2QA 4TMWA 4B3DA 1ZC3A 3QBTA 1Z08A 1KK3A 4QL3A 1AIPA 2VIIA 4AYWA 2IYYA 4ZV4A 4HAWA 4BQSA 5FOVA 3THWA 3J81k 2B6HA 3IILA 3AF1A 4JJZA 1DEKA 1NN5A 1Z6GA 2GVDC 3EXAA 1X8JA 4JYCA 3BB1A 2WWFA 4C0HA 1EXMA 1II8B 4Q4JB 5CYOA 1BS1A 2V1XA 1US8A 1WE2A 2OFXA 1HT2E 4XWKA 2YZ2A 2CDNA 1QHGA 3RRYA 3QE0A 3PQCA 4C9BA 3SJAA 3THXB 3GJ5A 1U81A 3FGNA 4CYMA 5E4FA 3U44B 1IN6A 1NLYA 2K5UA 5G3ZA 3K53A 4GPTA 3SQXA 2DBYA 1F2UA 2YYZA 4JLBA 5FPTA 4BRUA 3B82A 4MKFA 1GM5A 5A4JA 1NIJA 2OV2A 3CO5A 4US0R 5FOXA 1BMFD 1NN3A 4RD4A 1G8GA 1XEXB 1YR7A 2F1JA 1G3RA 2FN4A 1ESMA 3FKSA 4LJ6A 3AUXA 2OCAA 2VP0A 4E03A 3CRRA 2G6BA 4DCNA 5F9HA 3MG9A 4O2LA 3HYTA 1DVRA 4PZLA 4DLSA 2P6UA 2B92A 2BIFA 2XTZA 3SDZA 1OXXK 3DOFA 2H7VA 3MFYA 4RZUA 5EP2A 4EPRA 2FFQA 2BBTA 2GZHA 3HPQA 5TY0A 3WMEA 4TLBA 4MUAA 5AUOB 1DOAA 1FNMA 1P7CA 1OE0A 3A58B 1UKZA 2EWWA 1Q1QA 2VO1A 3IHLA 5DYGA 3VR2A 5EE3A 4DIEA 1YU9A 621PA 2W6IA 3KKQA 4ZKEA 4JYBA 3AVWA 1Z8FA 3W8NA 2H18A 3FHTA 3Q85A 3K09C 1Z2AA
chains in the Genus database with same CATH superfamily
1GNTA 3EEQA 2XOXA 2LDXA 3PI7A 3NIBA 3IPLA 1JPUA 3ZV6A 5K8IA 3CX7A 2VJKA 4I2VA 5JSFA 3UMYA 4GZMA 5L4SA 4J0QA 4D9CA 2I3DA 4YYEA 5KNBA 4WLEA 1AQIA 1CB7A 3HBJA 2J0UB 3F9IA 2HDWA 4JBGA 1SURA 2B6NA 2BC9A 4FONA 2WJWA 3MTDA 5KVQA 5KOIA 4DCGA 4EATA 3KZVA 4MYTA 5MFPA 2BV3A 4OB8A 5ALUA 2QX4A 1V7ZA 3L82B 4K2HA 3ZWPA 4ZGWA 4JEUA 4YMVA 2CGEA 4TM8A 5KQGA 4KEAA 2YXNA 3PWKA 4JAVC 3R7SA 2DFNA 2WKPA 4EYOA 2DKFA 3DWIA 5JSZB 1GQYA 2KB0A 1EDZA 3PUYA 4P1ZA 1E3EA 1ZI8A 3UIEA 2PEZA 3ZK7A 3GXOA 5LMNB 1V5FA 5IKOA 1H3NA 3VDXA 3UK6A 5JJLA 3BRQA 4M21A 5H8WA 1GA4A 2W9XA 1GGNA 3K6RA 4B6SA 1U2DC 5HUHA 5HZMA 2DERA 3T7DA 3ORFA 3G5UA 3TW0A 3GQVA 3WGIA 3AW8A 2F3PA 3KHKA 4EKNB 4CETA 1MEEA 3GJZA 3NEJA 4LJSA 1BO6A 4GI7A 2DKNA 1R4MA 1HFEL 1YB6A 5CB4F 2XNKA 2JL1A 2XKKA 2VUUA 4KO1S 4BKOA 2B9EA 3JTMA 2BDUA 3NAZA 1E8MA 2F43A 2ODBA 1NI4B 4PBSA 4YQYA 2XUIA 3ASYA 3D5TA 2JCXA 3KLPX 4LNHA 3OLZA 4LRXA 1H69A 2VJAA 2CV1A 3A6PC 1HQDA 2HF8A 3FKQA 4GM1A 2QT9A 3F6YA 2WTXA 3OC6A 1S02A 3BRWD 3DBOB 4OJMX 5EJ6A 3V8BA 1WETA 1XDZA 1JEDA 1UZUA 3BBPA 3EXHA 3HVIA 1SBZA 2GCOB 1IZ9A 2I99A 5KNCH 3UFBA 1KJYA 1RQ7A 2YYSA 1Z56C 2WVJA 4YUAA 4K8RB 4OSOA 4Y18A 4CI9A 3ZQUA 1E5LA 3GRRA 3GDOA 1FLDA 2RI6A 1ACMA 2HPHA 1Y9EA 1JQAA 2JLCA 2VLBA 3SZMA 3NXSA 3TAUA 3JAMA 3GT7A 2VXYA 1IY9A 3H9BA 2G28A 1TO1E 2GZ1A 4YPOA 1RWVA 4XWOA 1JG6A 3ISVA 2Q99A 4UASA 3W8FA 4RPLA 1GPJA 2WM3A 1GA1A 4WCFC 3VYVA 3DWGA 4WY8A 1BEUB 2PWAA 2X42A 1V3TA 2ZUVA 2WQ6A 4ZDIA 3NBFA 1YZNA 1QYIA 3TQHA 4AP9A 5KNCA 3R20A 4I5DA 3M6LA 4HI0E 4Z4QA 3HB5X 4LTNA 4B43A 1PI3A 1W2GA 4QJ5A 5BSKA 1M5TA 2QMQA 2GCGA 3CX8A 1REQA 2WHRA 2VEDA 4MI9A 4QAQA 5DI3A 3I04A 4Z0TA 3H7IA 3FF4A 4JK3A 4UTVA 1VMIA 1CJKC 1EXWA 3QELB 3OQBA 6REQB 1FMTA 2FUG6 1NQ5A 4GXTA 3MCVA 5J5CA 3GC6A 5FJJA 3W9BA 1AUPA 3CPHA 2JIZA 3WJ7A 3O9ZA 3FI9A 1QGDA 2R96A 2Q5HA 1DLIA 2V5UA 4U0KA 3IDOA 4F71A 4O2BF 4X8HA 2JNWA 2A84A 5EWJA 5TARA 1PL0A 3AY0A 4INPA 4IOJA 1KVUA 3ND8A 1O1YA 3C5HA 2OGUA 3D8RA 4JJ6A 2CCGA 1X0XA 2XDWA 2PJDA 2XT6A 1RHMA 3SKYA 5ILGA 3OWOA 3P2EA 1C0EA 3RLIA 4UNNA 2R8EA 3FN4A 3PEFA 1M5UA 3CLUC 2NVUB 2ZYTX 1NAHA 1ADYA 4PSDA 1R37A 2F8LA 2ZB2A 1Z0JA 4A6XA 2ZQ5A 2YJGA 4RQTA 2LCQA 2FK8A 4BZQA 4GI1A 1XTIA 1FL9A 5JSYA 2PDAA 3QOWA 5CH3A 3VU8A 1RJGA 2CFTA 4XGIA 5TNXA 4CMHA 4JT8A 4MHOA 3VR1A 2DVMA 3ZCXA 4U39A 3W9SA 3RVSA 5EP3A 3HN6A 1CIVA 4DARA 1WF3A 3ZHBA 2A0XA 1S2IA 2J41A 3UHJA 5KTSA 3QEAZ 3VPAA 3B1VA 4EHFA 3L49A 3TBFA 4P35A 4C6TA 4EX7A 3UK0A 1QVWA 4N0EA 2BEKA 3P0FA 1TXGA 1XO1A 2FA9A 2OBYA 4ZHQB 3O0TA 5AM3A 2GZ3A 3W7BA 5KNBH 4KLNA 1ZIOA 2A4MA 1SUDA 2QHXA 3HYNA 1OFVA 3PPVA 4JYPA 4XTCS 4I81A 2F1OA 4KK4A 4XCVA 1BDJA 4G5FA 5CK4A 5HUQA 3UMSA 2CHVA 1KWKA 1LEHA 4DA9A 1NF3A 5KYXA 1FZQA 3WAKA 3LWNA 2BE7A 2CVHA 3B6JA 5H59A 2WTAA 3UJ9A 1MQ9A 1LUAA 2PMWB 5CB4A 1PJAA 1BCSA 2BZSA 4UMEA 2AOUA 4GX0A 3ND7A 4BB5A 1GFSA 4HY3A 5DHAA 2O52A 4YRGA 4YXFA 2BE9A 3LC1O 2G77B 3FI0A 1VOTA 4KQ2A 3KQWA 3X1WA 4BMSA 2FZ4A 3SZ3A 3KVVA 3N8KA 3AEUB 2AOUB 2IWHA 3ZWAA 4RNDB 3AVVA 3GT3A 4H7KA 5CXXA 4BLOA 2F8TA 1I3OA 3I12A 2IP1A 2DLNA 1J1ZA 4R5HA 3CT4A 4G89A 3DBLA 1Q6YA 4D8WA 2V7QA 3NOQA 1L7PA 1XTZA 2R1VA 3R6LA 1SBNE 2IITA 1MW8X 3RYFA 4GW3A 2D06A 2PMEA 3ZV3A 2IX3A 2Y71A 4E88A 5KCMA 3KYCA 5HM6A 1NT4A 1OTHA 1BC5A 1TCVA 2LKCA 1T0HB 4AROA 1G5IA 1NX6A 2BD0A 2VSQA 1QYWA 3TNJA 1TM2A 4A8JA 1LSUA 4BGIA 1Z47A 1U3TA 1JEOA 1WZUA 2D1QA 2A1TR 1C80A 3PPWA 1XLTC 3CR3C 1LPSA 1NA5A 4HJXA 5AKJA 5TGDA 4BRZA 3M6VA 3O8QA 3I5MA 1B14A 4NBWA 1Y37A 4HCJA 2OCGA 4ONEA 2AFHE 5JATA 1E92A 3FHLA 1JH8A 1D2GA 2V7EA 4PFQA 2W8BB 5EKXA 3R77A 2OHJA 2EX1A 2Y4OA 1GTZA 4L22A 4OHFA 2HA5A 1NSFA 1EJ2A 4JB0A 4OYYA 4DOMA 4E2FA 4Z3DA 2J3LA 3ONFA 4MDEA 1R0YA 2C5HA 3DO6A 1GPBA 4QPDA 3Q6MA 3Q3EA 8ATCA 1N5DA 3HCWA 3OE5A 2NUTB 3DXXA 2SNIE 2CNOA 2VG8A 4FINA 3O1HB 3Q7RA 1PHPA 2UZIR 4KTTE 4NAUA 2WW8A 5E1DA 3WE7A 4RDHA 1S2MA 4E33A 2B4KA 4G56A 4L6CA 1HYEA 3VJMA 2L19A 3VPCA 3LYHA 1MAAA 3CVWA 2AKYA 1RM3A 1X1RA 1S5PA 2CK3D 1N3LA 2FRDA 1UBMS 3DZKA 3IAXA 2PLRA 3LC0A 4RKYA 5IS2A 3ED5A 3PE6A 4HS4A 1S2LA 3BQ9A 1E1LA 3D3KA 3CEPB 4KGXA 3UJ8A 2FCAA 3ZLUA 4CCAA 3K1ZA 4CKBB 4LXGA 1RPZA 5TQVA 3LX5A 4DKXA 2ZXUA 1SG9A 1K8ZB 5THKA 4F72A 1Z7BA 4C2UA 2ATXA 2QVBA 1GR1A 4H17A 2HN9A 4QRHA 1HL7A 1SB9A 4W5WA 1T15A 2XUKA 2BGJA 1Q83A 4PCAA 3K8OE 2WYVA 2Y0BA 1ILEA 1SCAA 2NO7A 1LSOA 1J70A 4LRUA 4JMLA 1HA3A 1OFHA 1YJAA 3FR7A 3O3NB 4IV0A 4U2EA 2RAVA 3EVDA 3PR1A 5EEHA 1CJUC 1NJ6A 2IYRA 1CP3A 3RRBA 1XEAA 1K8RA 1VQ1A 2G71A 5K8UA 3THRA 2REBA 3FPKA 2YWDA 2ZFUA 4H6XA 3T7CA 1HG0A 2QSZA 3JVUA 2LDBA 2ID4A 4D41A 3ZNPA 4C76A 1SD1A 1XDDA 3NV7A 4HAOA 2C3OA 4DA4A 3E23A 4IS3A 2IEZA 4MCHA 3ROPA 1LTKA 1HYGA 1R9NA 3OTWA 2AG8A 3R0XA 1TX4B 3TCXB 2O8EB 5M5BA 3EVEA 3JQ8A 5L51A 2YMQA 1KI1A 4MULA 3INTA 3QPCA 4IZIA 1XRQA 4KQGA 1Y7HA 1NQAO 4M8LA 3NBZC 1F17A 1Y5IA 4PYQA 1USWA 1XTJA 2GAIA 3F3MA 3BZUA 2Q3LA 2H1IA 4II3A 4BNNA 3AHIA 4DQXA 4RD0A 3PJDA 4PWZA 5HCUA 1UPBA 5AHKA 4W5RA 2X7XA 3KTOA 3LYAA 1RBYA 3W90A 5IANA 1NZDA 2O5EA 3KFVA 2B5OA 4QKQA 1DXYA 4I3GA 1IU9A 3FJ1A 4B48A 4BEWA 1SXIA 4U5QA 1R64A 3HABA 4BP9A 3FFBA 3PENA 2FQQA 3EARA 4UW9A 3T5DA 1QPZA 3LZ6A 5E6SA 1E62A 2YIVX 5JCPA 1GQFA 1IEQA 1GSHA 5DTIA 2REQB 5M3BA 1AH2A 1ODIA 2WJ6A 5LZ2A 3SXUB 2NYVA 1H5QA 3BREA 3B3JA 5EXTA 5HPYB 4CLEA 4N41A 4KREA 4ZEMA 1MC5A 3KO8A 1E3IA 3SVLA 4MO9A 3OSUA 3L8YA 4CV0A 1ZU4A 4RLQA 3TE6A 1RI4A 2R8XA 3K2BA 3KAKA 3ZD8A 2F9FA 1VHWA 1A04A 3I5AA 5IKXA 3GZTB 5FV7A 1NXVA 4NAHA 3TNYA 1YH3A 5F2OA 4AAYA 1I6WA 1VHTA 1RAIA 2CLCX 3H83A 4ER5A 4UU7A 1B8VA 5ES3A 4Z7NB 4MZXA 4U00A 4V0LA 3L0YA 4CV1A 1EGAA 1YR1A 2HA4A 3AINA 4QPCA 1K3FA 3O47A 1U04A 1UOPA 1YMUA 2W2KB 1D2MA 4KLZA 4MWCA 2ILVA 2CB0A 4FYWA 4KQEA 4R2LA 5TPZD 4M36A 1RWXA 1XLTA 1U2EA 1Y89A 4UBKA 5TXGA 4YB8A 5I9LA 4YRZA 5JSUA 1B16A 5JAPA 4NYMR 4I8IA 2AE2A 2H1VA 3QY0A 3RJTA 1G63A 2FEOA 4BBJA 4H7JA 4HWSA 2XDQB 2Q5LA 3BIFA 4PIVA 1UBFA 3H5RA 4LFBB 1TCCA 4X1YA 2NO1A 3VO2A 3BGSA 1MLDA 2H00A 5EJ4A 3RWBA 4UCXA 3GT0A 2I29A 1O94A 1VLVA 1PK8A 2PBFA 3IAM6 1AQ6A 2BJVA 3JW8A 5KMGB 1D3AA 2PZEA 3CNBA 2JAOA 1M75A 2YFKA 1JMYA 2WAMA 4CR7A 1U4SA 1Y1PA 4NDNE 3DMFA 5IKMA 1WCIB 4F2PA 5B3AA 1WEHA 2WA1A 3OMLA 3RVDA 3UHPA 1CF4A 4ESEA 3GEHA 5JXWA 2HU2A 1EFVA 3I6BA 5SY6A 4CHTA 2IXDA 1EEXB 3LOUA 4M89A 1U1DA 2GWHA 2ISQA 5F1YA 4D9MA 2O48X 4N18A 3K15A 5ALFA 2HCJB 1J9EA 4DLRA 3ZE8A 2HMTA 2D2IA 1MNAA 1BFKA 4GMDA 3RUIA 4FGKA 5JW6A 3SR0A 1KAMA 4KI7A 1KEEA 2HNKA 2YXBA 1D8TA 2WJZB 3K6SB 3T3GA 4O2AF 1ISFA 4EEXA 1YJCA 2ODPA 1NPDA 2B8TA 2D7JA 1BGWA 4H6PA 2XHEA 1U1IA 2ZR9A 3LXUX 3BRSA 3O9MA 3QU2A 3G0DA 4HUQA 4M7WA 3CLHA 2R1VB 2ZSBA 3HM2A 1AV6A 2O5RA 2NZWA 1AZLA 2FSUA 2J3MA 4OHRA 3OQ1A 4HVAA 2X0EA 4AKEA 3E84A 4M49A 1JDTA 3A3PA 2B98A 1Y3AA 1E6LA 2IF2A 4QUIA 4FX2A 4KQHA 1NAIA 3DQPA 7MHTA 4HRAA 3ETDA 4EKIA 1I01A 2V4ZA 2F3UA 2GJ4A 1T2VA 3RRMA 5BN3B 3VJRA 3EZ2A 4D92A 1SJ9A 2QN6A 5CURA 5FI1B 1DO8A 2DPHA 3LQRA 4LYYA 1E1DA 1Z6AA 2KWIA 5T7BA 1MABB 4GO1A 3EXHB 2SKCA 4L73A 5HFNA 4MUFA 1XA4A 1LRLA 4CQMA 4JUBA 3F6RA 4EFLA 3W5HA 2CWWA 1T3TA 4KN6A 4M9CA 4RXMA 2WT4A 4NEHB 5P8WA 4HO1X 5CW1A 1YRWA 1VL5A 3B1XA 4HWTA 1MCZA 3IPAA 4I50B 3Q0EA 2ICAA 3X1DA 5CCBA 3L0DA 4MUJA 5KO2A 1ESZA 2WWXA 2ZSFA 3INGA 2DPYA 1GG5A 2J31A 3D1VA 2HBZA 4JP3A 3PLRA 3LG2A 4NZNA 3R7NA 4F3TA 2EGUA 4XM1A 1JTFA 3P1JA 3D4IA 3LKDA 3G1WA 3MPOA 1NBME 4IGFA 2VDKB 3HDTA 2PSEA 2ZE8A 4PPQA 4UPVA 3TSYA 5BV2P 1AK1A 1U7HA 3KPJA 4RYDA 5AK5A 2A5JA 1YQQA 4LIPD 4K9KA 2D1YA 5EGSA 5HKKA 2BEVA 4RDCA 3AR5A 4XWAA 3OJ0A 4WJZA 3HMQA 4JLUA 2VJNA 1HEYA 1ADBA 3MCUA 4RGQA 3A1FA 4URUR 4YFVA 3RUCA 2GEFA 5ILQA 4TL9A 4G23A 1II0A 3MWKA 4UUQA 1LPOA 3V8MA 4UUBA 1H85A 2YFHA 5C9ZA 3GRFA 4M98A 4WN9B 4BN5A 2HWUA 1TVCA 2OO5C 1GGVA 3A70A 4TLAA 2WF5A 4ZJYA 4BKRA 4G4SO 4IUCS 4BS9A 2GAJA 5BPFA 1EK1A 2F9MA 4FFNA 4GGMX 1V1MA 3IT0A 2OENG 1E1RD 3CLTD 4UM7A 1X1CA 3VI3B 1DP4A 1FE8A 2XUGA 4OAPA 3Q15C 4OLFA 3RAGA 1OREA 2C1ZA 2O2XA 1P2UA 3JZAA 1PNRA 1H5UA 4RU1A 1Z8NA 2O20A 3LM8A 4FBMA 1I33A 2D74A 4X61A 2K7FA 3RJ9A 2E5WA 1A8QA 3DB2A 2Q45A 4N3CA 2B21A 5A05A 1OWOA 3E82A 4UBJA 2CJWA 4U7FA 1CG6A 2FLVA 2G0TA 2W71A 3OPVA 4IH1A 3UAZA 5EHZA 1CUUA 4H9GA 4TL7A 4K9OA 4BX8A 5JALA 2HQ1A 4IIDA 4C89A 5ALDA 1JIKA 3JYQA 4HOYA 4FKZA 5AO9A 4PQYA 2XE8A 1NHWA 4C7OB 3V1LA 1E59A 1A5SB 1XIVA 2ZIWB 4BJ6A 1Q84A 4BNKA 2ADOA 1ENZA 2BSQA 2CB9A 5A62A 4NNOA 1RQRA 2B7CA 4CZ2A 4LF5B 5KTYA 1YACA 5EZSA 4KJXA 3ZQKA 2V0GA 3UENA 1FFYA 2EYUA 1YR9A 1LQ2A 4MYHA 5EFOA 2Q5EA 1QHIA 2VTKA 1TM4E 3BX1A 4D8TA 3E81A 1RFGE 3EGDB 1KBZA 2ANBA 1K3TA 2Z3ZA 3DGFC 4PYKA 4O8ZA 4FWTA 3QJGA 2IKQA 1J07A 1FFCA 1U0HC 5HK8A 5CCDA 3T7JA 1NW3A 4EA6A 5JFGA 5JSZA 4BEVA 4Q19A 5IVKA 1X3LA 1JG3A 1MA3A 2P68A 3GN1A 5FO1A 1CDOA 1Z4OA 1RWBA 2OCXA 1T1JA 1UFQA 3DZCA 4LJ5A 5JMWA 1LQTA 3H16A 1YD7A 3M3HA 3L7IA 4KODA 5DT9A 1DQNA 1U0RA 3KC2A 1H2FA 4PR0A 2FDXA 3H1GA 4LK2A 3D5EA 4UEKA 4EHAA 3T1QA 1N6PA 1ZIDA 2DTDA 4HPWA 4HXFB 3Q9LA 4CFSA 1QH0A 1LV7A 1ZAKA 1UADA 2ZR7A 1J00A 2R7LA 4NNPA 4OUDB 4ANFA 1XSEA 3BMNA 4DLTA 3FYTA 3AIIA 4NATA 5JCJA 3RU3A 2PVPA 3USES 5KYNA 3SIPA 2UU9B 1I0IA 5IAGA 3FBGA 3AR4A 2AYXA 2Y2UA 1QRAA 1WPQA 3MUNA 3WK5A 4XYLA 4IH9A 5A9RA 3BMNB 1RW4A 3ORSA 3KJXA 2KHZA 1N9GA 2PRZA 3KNZA 3GJXC 4K6KA 4IWNA 4RF2A 5D5QA 2XLBA 5JCOA 3L6OO 5EXDA 4EA7A 1G3QA 2AEEA 4LXUA 3S2UA 1D07A 3KQLA 4B5LA 2Q5CA 4ITVA 3QF4A 2ZI7A 1U3GA 4OU4A 1QQ5A 1MOSA 2ZE7A 3HJNA 3G02A 2AV6A 2Y1XA 3D8TA 1VJ5A 1CEQA 4F04A 2O2IA 4YH1A 2ZJ7A 3HYSA 1DQZA 4PBRA 3T54A 3AVQA 1MQSA 2EJCA 3GJ6A 3KKMA 1EUCB 1EP3B 1CYEA 1A50B 5D00A 1UZAA 3BHMA 5IZCC 4AMVA 3S40A 1P5HA 3ZJUA 4O29A 3GHHA 2G72A 4FHFA 3ESXA 3ESYA 5E6RA 3CY6A 5ICEA 2O8FA 4FYIA 1GPH1 1V1MB 2FNAA 2GEBA 3WMFA 2FW6A 4M2LA 1HH4A 4FEYA 3U4MA 3MAGA 4GX1A 5AW6A 4DMRA 1PBNA 1L5OA 5JS8A 3ROQA 1B3BA 3IP3A 2CUNA 1IWOA 1AQLA 1GQRA 2LE0A 4HNUA 1H0KA 3FM9A 3G2IA 4MTLA 1XYGA 1N5KA 2DOKA 1UPTA 3A6KA 1XQYA 4LWOA 4CIDA 2DR3A 3I1YA 3HH8A 1Q74A 4NZPA 3I8OA 3O4JA 3AESA 1NG9A 1QE0A 1SG6A 2NZVG 2IBTA 1QAOA 4ZZ0A 1GNPA 2H2IA 5AW1A 3DVAB 2NU6B 2XD9A 3PCXA 2R85A 2RBGA 3DP7A 4GPIB 5EY5B 1XCMA 3W5AA 1ONBA 2IRWA 5KJEA 1ATZA 3GGJA 2OOKA 1U7TA 1ZFNA 2G70A 2H31A 3MJSA 4OMDA 3UPDA 5AW7A 3OX4A 1F4VA 3UEOA 3ORYA 1PGOA 1ODSA 1S3GA 5H1YA 2WOOA 3AP1A 1LLQA 2C96A 4UEQA 4DMGA 4BZPA 5F73A 4UE6A 1NI4A 3FFTA 3A9TA 1BZYA 5ESWA 5LJIA 3U44A 4Q3DA 2ID8A 1QFJA 6GPBA 1PHRA 2YKGA 3RTEA 3BFVA 4UM8B 2QR5A 1E9SA 2EJUA 3K31A 4HATA 2PRYA 2UKDA 4L72A 4IIEA 2QTAA 3T7IA 2B78A 2CXQA 2OV4A 4K9PA 4PG5A 3TIGA 2REQA 1EVYA 2X0IA 1QMGA 1V2GA 4QM6A 2CJFA 1RAGA 4G81A 1W19A 3H2JA 4FFSA 1MHPA 1YUNA 3AZOA 3CYFA 2QAJA 3VKVA 1NGSA 3IKJA 5A7FA 4YRBA 4CQNA 4DWOA 2OLKA 3QE4A 3NEYA 1FYEA 2NIPA 1XCOA 2XWBF 3OBIA 3Q10A 5B6IA 1DO0A 4DIFA 2V5AA 4QZVA 2YYAA 3A04A 2CY0A 2LRHA 3EQ8A 2RBKA 2W8ZA 2A33A 3VR5D 1PD1A 1DJMA 2Q41A 4EGCB 2PGNA 1COWA 1O0CA 4AZVA 2EKPA 1W87A 1NP6A 2O06A 2ZBFA 3D3NA 2HA6A 3J7AC 3QMWA 2OWEA 1EWVA 1WXXA 1K27A 1YCHA 3I1FA 4E11A 4NZOA 2OB1A 2JJ1D 2E4AA 2QENA 1Y5MA 4P84A 4QOFA 4HDRB 5DP1A 2UXCB 1OWPA 1X1AA 4NH0A 4EHIA 3DG9A 1CNMA 4GBJA 1EYZA 5GZ6A 1NWCA 4TMXA 3S5UA 2ZRQA 4MRNA 3DBRA 4TQUS 5E1BA 1SA0A 1CZOA 3FOCA 4H4EA 4I50F 2GZ2A 2PFGA 4W6ZA 1PQWA 1DNPA 4BLWA 5CIWA 3G8CA 1PGPA 5DKFA 1Q7GA 5JNRA 5J2TB 4PGAA 4Z9AA 4M1TA 2CXRA 4TLCA 1ZK4A 4D4LA 5GJBA 3DW3X 4OXYA 1XVTA 1G9XA 1KK2A 4IIYA 2NMVA 4LXTA 3H4TA 4WOJA 4HQLA 4M86A 3WGMA 3OVMA 4AQDA 5CDFE 3KJHA 1B6TA 1X9IA 2D1TA 4P5DA 2A67A 3TK1A 5CHEA 1C7JA 1LLDA 4L51A 2WHPB 4IVPA 4KKXB 5GIOE 3PU6A 4JSTA 3DXZA 3H04A 3HJAA 1JPJA 4IIJA 4NCNA 1RLIA 1J99A 3F6PA 1J06A 2OKCA 4R16A 3E15A 2YW9A 5AUPB 2QNBA 2PUGA 3RTBA 5HSGA 1KFBB 3HJHA 1QGZA 4CF4A 4AF6A 1VHJA 1STOA 4KAXA 1BG6A 1PV2A 2V5VA 4J1TA 4OJNA 4JT4A 2VL7A 5JSQA 3D1LA 4DFDA 1GP2A 1GV1A 1LY1A 2R65A 1DUSA 3GOHA 4OFBA 4QQKA 5IPFA 2CEKA 3LY9A 1XV5A 3HVJA 1NKVA 4HD8A 4W1SA 1W0JA 1GEGA 1TO2E 3U7QA 1EZ1A 2GKSA 2QN2A 3FNFA 4BGEA 4OQ4A 1DAEA 4FDTA 1Y1KE 4UVHA 3H4IA 5DM1A 1PW5A 4BX0A 1BW9A 1QP8A 3GJ3A 4HTFB 1NXQA 3LF2A 4QTTB 2OHFA 3O3MB 4EJSC 5JS7A 3N0VA 3WL6A 3V4PB 4Z8XA 2I76A 3IFSA 4A82A 4E2WA 3VTZA 1MZPA 5ALQA 1TVKA 2IPNA 4NJEB 4XUCA 1OYYA 1U7UA 3LC7O 3RQIA 5JPDA 3AHHA 3Q6IA 1ESDA 2AMVA 3QU7A 1FDRA 2C2XA 2MYTA 5T67A 3BJMA 3KDPA 4HGRA 2ZBUA 1JAIA 3KUXA 1Q1EA 3E7DA 4I4TF 4RIHA 5TGTA 4KPEC 3V8QA 1NQWA 1JEYB 2RD2A 3TBKA 3DE3X 5ALPA 5FADA 4JLSA 1U5CA 3HI6A 3M3DA 1I3LA 1KZYC 3GEMA 3G68A 3INNA 4ZAYA 4ZI2A 3IB3A 3ZDQA 5EKSA 4X1IB 1YE8A 3R7LA 5CUQA 5DGDA 4Y2GA 4Y2SA 4ZT5A 3JQ6A 4R68A 4BQPA 1HE4A 1TJ3A 1YKFA 1ZBQA 4BMZA 1JNXX 5H3HA 4DQLA 2FFHA 4XZ3A 1MH9A 4Q7EA 3B1YA 1KRXA 4LGCA 4UMDA 4Z99A 4B35A 2A1UB 3GUCA 2P6NA 3B89A 8GPBA 4OB6A 4XA8A 4UKDA 4JHLA 4AMBA 1QIDA 1CZKA 4UTOA 5EJIA 3ZW9A 3H9UA 1VGVA 3EBPA 1EA7A 5DB4A 4C07A 4EENA 4BNDB 2H85A 1CZHA 1L4KA 4UDYX 5EIBC 1IPEA 3GF4A 4Q21A 4HQ0A 3R7WA 1PL7A 2UVPB 2NZUG 3Q41A 1YS1X 5AHXA 3HI4A 2V7XA 3N07A 2ZIXA 1UCFA 4JITA 5DNWA 3ZKAA 3OQMA 3WLSA 1JQEA 1DMSA 1HFJA 3B5IA 3KR1A 4RVUA 3VR4H 3KUDA 4YAJA 3AWIA 4ZT6A 5J2UF 3EEIA 4R7TA 4ZI3A 1QH1A 1MBZA 3F0TA 3EXEB 2JIBA 3HEAA 4OSEA 5JZOA 3LVQE 2Y77A 4ML3A 1RKBA 2FWJA 3OJLA 5DZSA 5JAQA 3A32A 5IUNC 2I9KA 4DQUA 1QTQA 3NTQA 3ZCTA 3T9CA 1C3EA 5FL7D 1T3HA 1JP7A 4PAQA 3K94A 1F12A 1NKTA 1XMJA 2ERCA 1GFWA 3LC2O 3O26A 3DEJA 1AVTA 2JZCA 3AIKA 5E1MA 4J3FA 1F6BA 3UH1A 2VSNA 3F4KA 3A6EA 3QVJA 1J2YA 4H7FA 4L5IA 5CA0F 4NXMB 2VWHA 2B2CA 1P39A 1JLSA 3UQZA 3FPAA 3HVKA 5H83A 4YUZA 5KMGA 4ZALA 1XVVA 1KOLA 2ZTSA 5A04A 2F8MA 3OCUA 1PFKA 2BEUA 5CLGA 4H1HA 1YS2X 3CNEA 3UWDA 2ILTA 1A8PA 2FYTA 3L02A 2NTVA 4CN8A 4G0UA 3BWVA 2HFKA 2YWRA 2I2XB 3O4HA 5J5AA 5ALKA 5F5LA 4HRXA 2WB2A 1D4AA 3IAEA 2QY9A 1LLUA 2PV7A 1F0KA 2Q3FA 4M6WB 3VKFA 1XKTA 2CXOA 2JCVA 2PVCA 3MMZA 4R2WA 1IQPA 4RL4A 3B6KA 1KQOA 3RSGA 1X80B 5AI9A 1U9CA 1UFVA 3VKHA 2EOAA 3W5BA 1XU4A 1XTPA 3KU1A 3MMXA 1KI9A 4FS8A 4MROA 1IDOA 5B1SA 4YR9A 4G01B 3TRFA 4GDMA 5DMHA 1B76A 3G9QA 3GP5A 4EVRA 2HTEA 3KQSA 5DO9A 2FSFA 3ECSA 1WO8A 1DAIA 4HDAA 1X1DA 2V65A 2X7JA 3NYIA 1WULS 3KT0A 1E94E 5ANRB 5FBKA 3IUEA 3K0EA 4EB3A 1FDTA 5HRUA 5HR5A 4FK8A 3HUEA 2FUG1 2MMGA 2I4IA 1GQQA 2PSFA 3L93A 4ALIA 3IXMA 4E3WA 1CB0A 2I62A 3BL6A 2QMHA 3R4VA 3MWEA 3ZE0B 2F90A 2EQAA 1N32B 4HGZA 4BDTA 3AJAA 3NTLA 1ID8A 3DM5A 1XTRA 1GZHB 3HCBA 2CWDA 3NHRA 1H2ZA 5I4IA 6PFKA 2Y0PA 4MQ5A 2G80A 2P9TA 4B82A 2Z6AA 3UT0A 2NXNA 1DWOA 2IYXA 5ALMA 2C57A 3KPYA 4ZCRA 3VR0A 4G1MB 5LOVF 2PHZA 3ZU3A 4ZICA 4C6RA 2WJYA 3NIFB 3RR2A 5DM4A 1E2QA 4B80A 5EZ6B 4E5DA 4EG1A 1KXZA 5BQ3A 1B6SA 1E2UA 2IIVA 1G21B 2MIIA 1M54A 3CSSA 4NMWA 5FPQA 5IHPA 3WICA 1U8EA 1UDCA 1EBFA 4I7EA 4NEQA 4X6UA 4H08A 3H9JA 3OP1A 2PRKA 2FW9A 1X70A 1HZZC 3MB5A 4KWTA 4M1YA 2EKDA 3UW3A 5JROA 1EBBA 3HXPA 2VSYA 1PGNA 1THTA 1YKGA 4NV3A 1J1UA 3RVMA 1SAYA 1KY2A 4I08A 4U7WA 1FYVA 1OHHA 2XIJA 2WYHA 3IVAA 5GV8A 2GYYA 1V0JA 4IEFB 2PK3A 3CW9A 3V32A 4OQZA 3K3PA 1RI3A 3LECA 3TGWA 4Y9SA 3MWEB 4EUHA 1A9OA 4NPHA 4YAKA 2VP9A 5AKKA 5A7HA 4BVFA 1Y1SA 3NBMA 2WFLA 3JVEA 4CLRB 1KJQA 1WW3A 3G2QA 4IEIA 3D64A 2JK0A 1DIOB 3UK2A 3N8GA 1KSFX 3B12A 2W98A 3DMRA 3KTAB 3UUFA 1V3QE 3LP8A 2ZWMA 1VLQA 3H5LA 3MRTA 3NX4A 2O3JA 4MQFA 5IK2A 1I2DA 4UHKA 4RANA 2PFSA 3WQBA 2JW5A 2WICA 3F71A 3JAKA 3Q7TA 4LA4A 4QPJC 5EAIA 3UK1A 2Q8PA 4WI1A 5HYVA 4EMUA 4XVQA 3WIUA 4UD2A 2VP6A 2WM8A 3NHWA 4F6RB 3ZNNA 3EOAI 5DIFA 1Y81A 3GPDG 4FQ7A 2GM4A 3K8QA 1Z36A 2GZSA 4BC0A 1DQYA 2CLEB 3JD3A 4J2TA 3RC9A 4B85A 1SUAA 1TIKA 1FUUA 4HQNA 3ZCSA 5K6AA 4NABA 3VR4A 5ITSA 1ZCZA 1NUSA 4E70A 2K2WA 5CEEA 3PP8A 4HC4A 3MLEA 5AJXA 3LCMA 3STVA 2C4UA 4K46A 1ZVKA 4KH0A 4P3NA 2QG4A 3MQ2A 1AE1A 1P2TA 2W6JD 2XCIA 5DISB 1PKEA 4L4UA 5FL7A 2H1OA 3OE7D 2DCUA 3OJWA 4HYYA 4H1UA 5DNVA 1UWCA 3E7WA 3NUGA 1UPUA 5FLYA 1K98A 2Y68A 4NTZA 5BN4B 1W5TA 1CNFA 3QLTA 5D5HA 2PZ8A 5EMKA 3V1TC 3R24A 5KI6A 1A8SA 3NW9A 2AW3A 2CFIA 4QASA 1JLKA 3C4VA 5B7QA 2VNSA 4YV7A 2G8LA 2VHJA 5G1PA 5K3EA 3PGA1 4X71A 2WNSA 3X1ZA 3WLMA 1YQGA 2G88A 5KS2A 1F48A 2BGKA 4B33A 3AM3A 3PIDA 4N54A 4RDXA 4B3GA 2XRFA 3R5SA 4BX2A 2OXIA 1HDRA 3ZHSA 1WU7A 5LU8A 2C7RA 1ES9A 2AL7A 1ZZGA 3U4QB 1D03A 1W76A 1BDHA 3IDFA 2QYSA 2R8YA 3QHPA 3R3SA 3C8UA 4G4GA 2PM8A 3MT0A 1E98A 4U7PB 3C39A 4OQDA 1W88B 3R1IA 2EYQA 4MW4A 2E21A 2IUFA 3RHTA 4I5GA 2HHHB 2XSZD 3B6IA 2R44A 2QXTA 4LX8A 3IODA 4NI5A 2J3HA 2X86A 3R9XA 1N1DA 3FVWA 1SQ5A 4LX0A 2GTPA 3W6UA 3RUHA 4MUYA 1XMVA 1ZM9A 5E0OA 3FOBA 1DS6A 1FNNA 1K08A 2DPXA 3EDQA 2NU8A 5LZ9A 2AX4A 3TS1A 1NBMA 5KYYB 2I1WA 3SR4A 4DMMA 2H16A 2GASA 3BTUA 4K6MA 3TLMA 1UJMA 2J0QA 4DGSA 3GJ0A 2OGTA 1WXDA 2H3HA 3TCKA 3DHYA 4TS9A 1GYQA 4KXYA 4RKFA 2JKYA 5LNK6 5HF9A 1T1GA 2P9YA 5LBIA 1KH1A 4EB8A 3OTHA 3GWZA 3II6X 3PDIB 4RS4A 3THWA 4MWBA 2VHEA 1Z4JA 2D2XA 4OHZA 2OQRA 3IBCA 4GE3A 1PD0A 1S7CA 4HN2A 1OI3A 5DBHX 5I51A 4MV0A 1JSLA 4XLTA 4EG5A 4BJ3A 3EXIB 2Q3EA 1XNQB 4ZAWA 2HXYA 2O19A 2AR7A 4D8VA 3C70A 2C83A 2JGDB 5LB2A 3ASVA 1FBNA 3OD1A 4Q4AA 3S7TA 4HDKA 1F8FA 4XRGA 2G4LA 2QU7A 2QZ4A 5LXTA 3E8XA 1XMIA 1EP2B 4P7BA 3T5MA 1E3QA 1GPKA 2XI4A 1M7HA 4YO8A 4TYWA 1TGYA 2IW3A 1TE2A 4OTZA 3TLYA 2GAAA 2HU8A 1GRVA 5FPKA 1QHSA 4N3GA 1NVXQ 4MW0A 3FB4A 4Y2JA 3NWOA 3EFOB 3JALA 1M2NA 3K4HA 2QYOA 2ZBRA 4TX1A 3UK7A 5LYJF 2Q50A 1CR0A 2K7ZA 3S8YA 3BB3A 5JC1A 4H7DA 3THOA 2OFWA 4D46A 1VLMA 4WBNB 1FXWF 1M2OA 1MVNA 2ZETA 4ZV7A 3ZE9A 2XTJA 2XXJA 2C03A 4IJWA 1U02A 1D4OA 1X6VA 3HJUA 3TYXA 1Q1GA 1ZMBA 1ZO8A 2GPAA 1BKYA 4R2KA 1KVRA 1UANA 3K6JA 4ARCA 1BOOA 4UEWA 2EGGA 3R0JA 5HIMA 3KB2A 1YQDA 1UK7A 3H2ZA 5ELXA 4Q05A 5LUBA 3D4NA 1G8MA 4DV7B 2RFLA 3QM1A 4DCOA 4KH1A 5COBA 1QIJA 4ISBA 3PD1A 1X1SA 2AI2A 3JSXA 4M83A 5AJZA 3VO9A 1IM8A 2PWPA 2JLQA 1O8BA 3CLKA 4RF4A 3CXUA 4ZI7A 2Z43A 3RF6A 1CFJA 2DQYA 1RT9A 3AB8A 3LDUA 5DN9A 1EK6A 5K05A 2Z4TA 2PX4A 1IXSB 2Y1WA 2OCDA 1XZQA 4YT8A 3DCIA 3PEWA 1GVHA 1SIOA 3EIEA 2GNAA 1EUYA 2P1ZA 3KRTA 1KSJA 4YLGA 1ONNA 2I4OA 3BIOA 3LBNA 1COWD 1BH2A 3EG9A 5CBKA 2IT1A 1R66A 2YX1A 4DEXA 5K3OA 3K9WA 3FSGD 1IBMB 4OBXA 1BDBA</