3NDPA

Crystal structure of human ak4(l171p)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
214
Chain Sequence
LLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase isoenzyme 4
publication title Crystal structure of human adenylate kinase 4 (L171P) suggests the role of hinge region in protein domain motion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 214
sequence length 227
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ndpA00
1DAHA 4A8JA 1T3HA 2W6IA 2QT0A 2OBNA 4TN1A 2FJUA 2AXNA 2Q3FA 3B5JA 1FOEB 3FKSA 1KMHB 2J3EA 1QG4A 1N5KA 2CLDX 2XNDD 1OFUX 5JEEA 2PEZA 4LV5B 521PA 3EX7C 1H8HA 1E2QA 4LBZA 2PLFA 3M0EA 3W6NA 4DLSA 3KJIA 3KUDA 4ASUD 4IW3B 1CXZA 2ZI9A 2QAGB 2PT7A 1CJTC 1M1YE 2D2EA 4C9BA 3FMFA 4NKRA 4TYWA 1RFLA 3FFBA 3ZS9A 3QF7A 4W9MC 1NI3A 1G7CA 1OYYA 2BEKA 2OUKA 1DEKA 4B48A 1UBCA 821PA 1Z5ZA 4C2UA 1X8KA 3PUXA 2BV3A 1BO6A 5EZ6B 5AJWA 4LOAA 2YWHA 2QY9A 1YU9A 1COWA 3ZJYA 2ZSBA 1QDEA 4BGDA 2OCPA 5KO2A 4YMWA 1EXMA 4RSGA 2E1RA 2DPXA 3Q5EA 4OJKA 1H8ED 3I61A 1KAGA 2DYKA 4KVGA 3SDZA 3T12A 2IYTA 1O87A 1TUIA 2ZRMA 4WZ6A 1E1QD 2ZAOA 1KZGB 5HTKA 1LVGA 2IWRA 4EFNA 1XTIA 4ERNA 1FW6A 2WJYA 2C95A 2BEJA 3HYTA 2VF7A 2ZAMA 5KYKA 2IYQA 2G9NA 1TNDA 2XXAB 1IAQA 1U81A 4Y0VA 2GXQA 1UF9A 3EASA 3NC1C 4OHVA 4A0GA 1ANKA 4Q4LA 3CR7A 3ZVRA 4DKXA 4ZV4A 2ZJAA 1KI6A 4Q5IA 4P32A 1HTWA 4EIWA 2CDNA 3RYTC 3I8SA 2J0VA 2GXSA 3MRSA 4DCNA 2O8CA 3E2IA 1CJVC 2J41A 2H92A 3Q72A 4U00A 1M2OB 2JDIA 4LYHA 3NEJA 4IVQA 2MSCB 4AYXA 4CDGA 3VKGA 5LBIA 4DC9A 3QKRB 4MGKR 3GP8A 121PA 2DB3A 1RZ3A 2YWEA 3AKDA 3CF6R 5CM8B 2ZRLA 1CU1A 4HDOB 4BFVA 4HAZA 2OCYC 1XTKA 2JJ2A 1NN5A 2ZYTX 4H1VA 1JXMA 2ZR0A 2ZRJA 1KK0A 4F7WA 4IEEA 3AVPA 1XTQA 3RANA 3HYRA 1VG0B 1LTQA 4EJSA 4POAA 1XPUA 2W2VA 1A1VA 4L15A 1RYFA 4Q21A 1PV4A 4Q9LA 5CJPA 1KSHA 1KY2A 4B3FX 1ZM2A 1U2RA 1CJMA 2ZYUX 4OI2A 2D7DA 1G3QA 4HATA 1AKYA 1MKYA 4JL6A 2ERXA 4KBGA 1FX0B 1G291 4TMWA 1P9WA 3MG9A 1LS6A 4LDJA 5L3SA 2GF0A 1OHHA 1OKKD 5EXSA 4FW9A 1QVRA 5EP4A 3PVSA 5DH9A 5FUXA 1P9NA 1D2MA 2AFIE 3W90A 5AK0A 3KTAA 4TT3D 1F5NA 1ZUNB 2OLJA 2IF0A 2QQ0A 1Q57A 2VHUA 3TW8B 1CTQA 1E32A 3U44A 2J7PD 2QRNA 1GRRA 3KFVA 3QKSA 1S1CA 1U90A 1GZSA 3HU2A 5DN6A 1DELA 2GJ8A 4YMUA 4P4SA 4NL4H 1ZD8A 1DO2A 1R0XA 2VSFA 1ZCAA 4OJQA 1E9CA 2R2AA 5BWMA 1GITA 1AZTA 1S3SA 4CIDA 3B9PA 2ZE5A 3DZ8A 4Q1FA 4TYPA 2GILA 2R44A 4KAXA 2QI9C 2KSQA 3N5CA 2JLZA 4HB0A 2IYUA 4NU0A 4E09A 2ZS7A 4YXWD 5EP3A 1VHTA 2BM1A 4TQAA 1QBKC 4HDCA 4B34A 1XP8A 4A15A 2NG1A 5K8LA 1CR2A 3FHTA 4MYTA 4ESHA 1KO7A 1AS0A 2EYQA 3VAAA 1QHXA 2JCSA 1K5GA 1P75A 5CIWA 1QHHA 1GL6A 3CZQA 4DZZA 3GCGA 3VR1A 5FPKA 5DNYB 3PUZA 3PENA 1T3LA 4XD7A 4OQNA 1MO3A 3SHFA 4KITB 1DAGA 2XX3A 4F93B 2NO9A 4FCWA 4M1WA 2CXXA 1NSFA 4B6EA 1X6VA 4NYMQ 4GPTA 4LBYA 3AP3A 3Q7QA 3IQWA 3D6TB 3SS8A 4MQBA 4W5HA 2CK3D 4BFUA 4MRVA 1XU4A 3RS0A 1E2PA 3BS4A 2HV8A 3ADCA 1OYWA 5EE0A 4JSTA 4DEYA 5TMPA 4HLDA 4V0ME 3HPRA 1PLJA 1G8HA 5IK2A 2PCLA 3DEFA 3X1WA 4JL8A 2B8TA 1NVWQ 2IEYA 3ZIAD 1E3MA 1JI0A 2ZRIA 4PQRA 2ATXA 1TPZA 3OFNA 4ZCLA 4AKIA 1TF7A 3WYGA 4DCSA 2O0JA 3L82B 3R7WB 1FQJA 5EE3A 4DUGA 2QSZA 2ZQ5A 4EPYA 4PHTA 4ZI2A 4RZUA 2O5VA 1KI7A 2BBTA 4L5BA 3IPYA 4AURA 3K0AA 2F3RA 1GRNA 2P3SA 4TMXA 5LDDC 3TR5A 3UIEA 3DO6A 4P4UA 1YR8A 1KOFA 4UNRA 1EFCA 2G3YA 5ANRB 3KX2A 3IILA 2HDNB 3T34A 4CEJA 2A5GA 3CLVA 5AUPB 4JLVA 4LYFA 4LY6A 1E0JA 4JKYA 1XXHA 2GEVA 1E9SA 5KSPA 4KVAA 3TAUA 4X8MA 3WNCA 4FD2A 2ZUDA 4UNPA 5G3YA 2ZRCA 3W9YA 3F3YA 1WRBA 5FOTA 3V4RA 1ELOA 3UK6A 1OB5A 1YZGA 1R8QA 1NP6A 4KFSA 4DWJA 1UKYA 4ASUA 4F4IA 1XJQA 2ZROA 4FIDA 5LD2C 5F9FA 1NJGA 1RIFA 4ZIRB 3AH8A 3L2OB 3Q85A 2HJGA 4LWZA 5FI0B 2FEMA 1GRQA 1KK3A 1NJFA 1G5RA 5DIFA 1NF3A 2Q0HA 3KKNA 1EWQA 5FFMA 4FMDF 3EC1A 4URUR 1S2MA 4HEJA 4RFVA 2GBLC 4RCZA 2VIIA 1TQ4A 3T35A 4XSGA 1OXXK 1TQDA 2R65A 3S1AB 3K70B 4B3GA 5KOYA 1NN1A 2HF8A 4BFWA 2VO1A 4HUQB 5FOVA 1F2TB 4WA7A 2WOOA 4X8LA 5C4GB 2BDTA 3EW9A 2HCBA 2WPDA 1AN0A 1X86B 4CT4B 4JIMA 4Q00A 3ZGXA 2ZUBA 3RWOA 2P65A 1I4DD 4OK6A 3NVAA 2XZPA 2YVUA 1NVXQ 3BE4A 2B7CA 3I4LA 1AGPA 5L3QB 5G40A 5KDDA 2BKEA 4GNKA 1HT1E 1P3JA 2OXRA 2R6DA 3X1XA 2V6JA 4A36A 4DT1A 2FGKA 3K0EA 3KXKA 4MYCA 2BOVA 3EXAA 4C0QC 3U6KA 4LYJA 2XITA 3ZQJA 1F60A 4KSCA 3A1UA 2J87A 1CR0A 1ZM9A 5FUVA 1S9DA 1N6PA 2QORA 1KI1A 4N3NA 1ZCBA 2FA9A 2QU8A 4M9QA 2WV9A 3NHAA 4LJ8A 1OFTA 4GMXA 5B30A 4U02A 2C9YA 2W2TA 3CPJB 5JRJA 2F55A 4M9XA 1T8UA 4D4KA 4OQXA 3OIUA 4TLCA 3ZYCA 2ZR9A 2R6AA 2PJZA 5DLQC 1FP7A 5LPNA 1IONA 3UPUA 3RS2A 5JJIA 1GDDA 4QG7A 4EFLA 1WF3A 4OK5A 2RHDA 2GTPA 5JI3E 1HV8A 1G18A 3U3JA 4PQYA 2WICA 4Q9KA 1R0YA 1RRFA 3UATA 3BFXA 2DFTA 4D82A 1DO0A 1I4LD 4TL8A 2P6UA 4WW0A 3GLGA 3IQXA 221PA 3H1TA 3SBEA 3SU8A 3SOPA 2GETA 3L0OA 3B2EA 3A1SA 3CX6A 1NL3A 1FZQA 4DLUA 2IW3A 3L8YA 2VPPA 1E79D 5JSZA 1SHKA 4E5UA 3CPEA 4QJ4A 2V55B 1D2EA 4HAYA 5AWFC 2BJWA 3UXMA 3VR4A 2BWJA 4HZIA 4JSYA 4URYR 5CDFA 3WHKA 4NTZA 1VECA 5UKDA 3VKWA 2BMJA 3KQKA 2XJ9A 4M1OA 4NCJA 2OESA 5FH9A 3QVUA 1JBKA 2QQEA 2KB0A 3L0SA 4M1TA 1Q1ZA 4HZUB 4MGZR 5EE1A 4ZDWA 2QRZA 4A0HA 1AGRA 1ONBA 1T0JB 4YQFA 3HPQA 3TE6A 2YKGA 4OQLA 4XVRA 3REGA 2J7PA 2W6ID 4HI0E 1P4SA 2QM8A 1GVNB 3R9WA 1N5IA 2GEDA 1DPFA 2QTFA 3CPHA 3FKSD 1SGWA 1S3GA 4DDVA 1KKLA 2IS1A 4Q01A 2OBMA 4FMBB 1H8HD 1KSJA 5BYJA 1GILA 3VMFA 3LBNA 1CKEA 5FBWB 2WMOB 5TXGA 3AF1A 3QG1A 4PPFA 4JT4A 5DO9A 4JLJA 4B71A 3I62A 3EIEA 3Q3JB 4I4LA 3IPXA 3B60A 3U7GA 4RFSA 3SJAA 4JT2A 1TL7C 1YZQA 2ZE8A 3CNOA 3L0PA 1IHUA 2VSXA 4M22A 5JHGB 1Z8FA 4FMDB 1NMZA 2GRJA 4DLYA 3MCAA 4BLTA 1E4YA 3TSZA 5JEDA 1IOZA 3ICQB 1SULA 3OEHA 4BLPA 5K8UA 4QHTA 3TW4A 1L7VC 2XB4A 3BB3A 2J45A 3AF2A 4D26A 4ZO4A 4RY2A 2DBYA 2VRWA 3I5XA 4LHWA 1UBFA 3EZ9A 2QTVB 1E0AA 5JS8A 1VYTA 2VP2A 1P9RA 4GT1A 5KSZA 2RGAA 5KHOC 1R8SA 4QBIA 2NZ8A 2WIAA 3GJ6A 2IX3A 3LXXA 2FNAA 1QHIA 2ZJ2A 1GL9B 3QVVA 2OBLA 3THYB 5ELXA 1II8A 4LJ5A 4TL6A 2OAQ1 4CYMA 2QN6A 2J0UA 1ZP6A 1MRNA 2H8KA 4D25A 3RLFA 1VPLA 3ZIAA 1J8MF 4IDOA 5SZIA 1Z28A 1K6MA 1JR6A 4RCYA 1QHYA 1VYVA 2W83A 1N6RA 4KJZA 1DAMA 4EUNA 1Z08A 2SHKA 4D0GA 2YHSA 3ZVMA 2B8WA 3KZ1E 4B75A 3QF4B 1ZUIA 2OSBA 2BVNA 4OBEA 5CM9C 2CCGA 1KI2A 1RC8A 3EARA 3PITA 2NO0A 2VL7A 2W6JA 4HLUA 1P2VA 2IL1A 4H1UA 3SQXA 1KK2A 1HURA 1PZNA 1XEFA 3OE7A 4L9WA 5FTKA 1ZW6A 4AIIA 3AB3A 2C99A 2JJ2D 2OAP1 4HB4A 4RD3A 4QBHA 1FNMA 2FFHA 4NONA 3OF5A 3QQ5A 1RYHA 3CBQA 3VR3A 4LJ4A 2RGNA 4CEHA 3B7GA 3CF0A 1L8QA 5EP2A 4BFXA 4AWXA 2ZE7A 4ESVA 1YZTA 2PZEA 2IT1A 4MUAA 3JZAA 5C18A 2IYZA 1IN4A 2GEUA 4CGZA 4KXFB 3FDIA 3W5IA 3GLFA 4KLZA 1SHZA 4Q4AA 4AYWA 1NVUQ 2VH5R 2WWFA 4TMTA 4TYQA 2JLUA 1JALA 3EG5A 4S2EA 4ARZA 5DI3A 1M7GA 1XCMA 3NG1A 2FSHA 2GZDA 4O25A 1JAHA 4KFUA 3VU9B 1KO4A 5B2ZA 3QJYA 2GK6A 2ODBA 4MH0R 5DN6D 4TMZA 4IKEA 2AWOA 4LPKA 4EKDA 5TV2A 1W0JD 2ZJOA 3U7HB 2QPTA 4PZLA 4QFMA 1CS4C 1UKVY 2G77B 2EYUA 4HB3A 2JATA 3CO5A 4P0TA 3MAAC 3GLHB 1S1MA 1P73A 1XCPA 1Z6AA 2VHJA 2ZSFA 1EK0A 5HPYB 2CCKA 3EC2A 3GJ0A 3ETLA 3L0IB 2BKUA 4PXAA 3AVUA 2QL6A 5EE5B 2ANCA 2O8EA 4LHYA 3ZVNA 2GDJA 1KO5A 4OHYA 2WJGA 3AQ4A 5A4JA 1AJEA 1CIPA 3QKUA 2J7KA 2WM9B 4JYBA 4UXHA 1GWNA 4C30A 1UAAA 4UQOA 4Q1DA 2O8FA 4US1R 2CCJA 4WIAA 1XTRA 5CJ2A 4YC7A 4QGAA 4XD7D 2DWPA 3MFYA 2CJWB 4HB2A 3H2YA 4YMVA 5G53C 2ZJZA 4QM6A 2QROA 2GZHA 2ZITA 3RRZA 3CR8A 5E3HA 2ZRDA 1SXJA 2VYFA 4LK2A 1X1SA 2YC2C 1KKMA 3DZDA 3E70C 4EPXA 1XMVA 4TYNA 1QF9A 2X2EA 4MYUA 5IK2D 1BKDR 3TKLA 1XPOA 1LW7A 2ZSEA 4CEIA 4JYCA 1IY2A 2ZI6A 4IVRA 3NKVA 5DHAA 2FV8A 3OFND 1W5SA 4AK9A 2QMUA 4GOXA 4DUGD 2Q9AA 2R8RA 3O8CA 2G88A 4NP6A 2ZTSA 1J99A 2GZAA 1FUUA 1E2MA 2A5DA 1W36D 1M74A 1U8YA 4M1YA 1D2NA 1D5CA 4IXMA 3G0HA 4IFBA 1TUEA 1BMFA 4WXPA 5K8IA 1NKSA 1N6NA 2NO6A 3AM1A 2ONKA 3AUYA 4DIEA 2V3CC 2P6RA 5BYKA 2ZSDA 4RD0A 1WXQA 3RVBA 5JCZA 5CITA 4II7A 2Z43A 1F48A 1G8GA 1NVVR 4IEIA 3EZFA 4A8JB 2HJVA 2RGGA 1JPNA 5JRZA 2AHOA 4M1MA 5D3MA 1LF5A 4PHGA 3VX3A 3D7MA 2XOKD 2H18A 2XGJA 1U99A 2KBEA 4G5GA 1DG3A 1E2DA 4IDPA 4V0KA 3NEYA 2WJVA 2HT1A 4C0AC 1R10A 3K0CC 5FPYA 2D4HA 2GHIA 3TNFA 2PMDA 2CNWA 2AFHE 4DSTA 2G0NA 3MMPA 1IN7A 4XVQA 4BLQA 1E2JA 4NPHA 4OK3A 3VNUA 3QPUA 1XDBA 1ZM3A 4J0QA 1YZLA 3DMNA 3SZRA 4B35A 1IBRA 1Z6GA 4D2IA 4PO9A 1CJKC 4JVSB 3MLEA 1ZD9A 4C0LA 4PHFA 2BJVA 1GUAA 2CEAA 2F1JA 2RGDA 3GMTA 4QGFA 5D3QA 4RZ3A 3LLUA 1VCNA 4B76A 1OE0A 3WRXC 1HT2E 4YMTA 1M8PA 2WSSA 4BRWA 2WPDD 2QAGA 4D0LB 1LY1A 3B1WA 1R4AA 2D3WA 2UZ3A 5CIQA 5CLLA 2QP4A 6Q21A 4PC6A 3KKPA 3CKLA 5C2JB 3TVDA 3IHLA 3RS5A 5TB5A 2C03A 2ORVA 4PQFA 5C4MA 1VG1A 4RKEA 5E7JA 4D4LA 5FPSA 1KI6B 1GFIA 5TVKA 1DS6A 1G7TA 1W49A 5AJZA 5SZHB 3HP1A 2HLDA 2J0SA 4TMKA 4KHZA 1ZMXA 3C5CA 4KCGA 4LHZA 4FWIB 3EWSA 4LPSA 2CHGA 4B44A 3TUJC 3PEYA 2RHMA 3I8XA 2YOHA 4JJKA 3CRW1 1EFRA 1BOFA 1OSNA 3GFTA 3ZS8A 1UDWA 2XJ4A 1JB1A 2QT1A 4DSOA 3M4YA 4MRNA 2R9VA 4ON9A 5AUOB 3EPLA 1XD8A 1OH6A 1EESA 1E0KA 2OZEA 2YYZA 3DOFA 1G64A 1G21E 1F2UA 4DDUA 5F98A 1T3SA 3TUIC 5TY0A 2AX4A 2YOGA 3GJ4A 1CR4A 1U9IC 1E98A 3AGPA 2Q3MA 4EQ6A 1SVMA 1VCMA 2YNMA 4GSYA 1BS1A 1MV5A 2JIZA 4MRSA 4Q1CA 1HE8B 3CH5A 4QGHA 4DJTA 2QEQA 4HAXA 4EJSB 1KGDA 1N6IA 2DR3A 2FE4A 3AVQA 5F2EA 1GNQA 4DLTA 1AQUA 1DVRA 2QP3A 4OKSA 2QZ4A 3ADKA 3RS4A 2EVWX 4OL0A 4ZPXA 2IUUA 4XJXA 2A5FA 2Z4SA 5GJBA 3SNHA 3QE0A 3PEWA 2BBSA 1VIYA 4XH9B 4BECA 1OFHA 1TF5A 1G5TA 2ZJBA 3KJHA 4OHZA 4A0FA 2OE2A 2IHYA 1W7AA 5L3SB 1I4TD 1Z6YA 2Z5FA 3C16C 4NBSA 2MSEB 2R62A 3CRMA 4LJ7A 4QGGA 2FFBA 1KO8A 1E9DA 3UG6A 1WQ1R 1UEJA 1A5TA 3KTAB 3PJRA 4MKGA 4DCVA 1EFTA 5JBQA 4TMVA 3LNCA 3U44B 1EGAA 3QEOA 4JVNA 1TX4B 3HR7A 4RD2A 4P4SB 1W0KD 3K53A 1UDXA 3REFA 1KZ7B 2DY1A 1XD9A 4PR0A 3SYKA 4LUCA 1TEVA 1DOAA 1W0JA 4OHWA 1ZUHA 1WMSA 3P1JA 4ITRC 1FUKA 2N1BA 5FBRB 2F1IA 4D4MA 3QXCA 1ZVQA 2W0SA 4QNRA 2DFNA 4RJLA 2VA8A 5FBQB 4PAOA 1RPZA 1XWIA 1M7BA 1YZNA 1U94A 3QXHA 1IN8A 1R5BA 2P2LA 5IRCD 2P6NA 4ACAA 2RGEA 2NIPA 5FTLA 5GVRA 2PT5A 3CRVA 2IYRA 5CK4A 4DLVA 1BYUA 5L3RA 3R8CA 1OXUA 1QHHB 4BFYA 3U60B 3B8HA 4EPVA 2RGBA 1GKIA 3MWKA 3OEHD 3SFVA 3TAHA 2FN4A 2AKAB 2IYYA 1LFDB 3TK1A 4PSKA 1C4OA 4F92B 1XXHE 2Z6VA 1MR3F 4GMDA 5SZKB 3Q7PA 1VG9B 5J5CA 1SKQA 2EWVA 4QOSA 4TLAA 3MJRA 1KYIA 1QRAA 2BIFA 3NH9A 3GJ8A 3T06B 2XB2A 4X8OA 3B85A 3P32A 4GOKA 4NYJR 3SYNA 1PJRA 4LYAA 4QM7A 3ECCA 4DB4A 2BCGY 5KNCA 2H16A 4MGIR 2LKCA 1NBMA 4HUTA 2FGJA 4OHXA 1IY0A 3MWLA 3EPJA 2FPKA 2NGRA 2IXGA 2JJ8A 3GLIA 3U2QA 3B78A 3TH5A 2QAJA 4JMPA 1I2MA 2QNRA 1T5LA 2D06A 3W8NA 3AF4A 1N3BA 1W36B 3K09A 1U0LA 4ILEA 4QXAA 4RD1A 3NXSA 2CE2X 3LBIA 1NG9A 2GJKA 4M4SA 4BUJA 3O8RA 3ZD6A 2H1LA 3K0AB 5C1BA 2ZM5A 2FSGA 4Q19A 3T5DA 2J0QA 3WMGA 4Z8XA 3RC8A 2JAQA 2XSZA 3I92A 1JR3A 4PX9A 5DISB 3PV0A 2W6JD 3UMRA 4M2LA 2CVHA 4CEJB 4F91B 1OXVA 3OE7D 1E9FA 1CP2A 3QY0A 3W6OA 3EZ7A 2IF2A 3PR1A 4JBYA 3B6EA 3WNBA 4CT5A 1TQ2A 1XXHB 2OG2A 1HUQA 4GBMA 3U4QA 4TZ6A 2XOKA 1OT3A 4DLWA 4US2R 4BPBA 2FEOA 4KFTA 5FPTA 2ZRNA 5HCIA 3X1ZA 1A2BA 5CB6A 5F3WB 2ZI7A 3GPLA 1IXSB 1U8AA 1VTKA 1G8YA 2FF7A 1MRSA 1QHGA 3KKMA 4KODA 1Q1QA 1X1RA 4NCNA 4KFRA 2EU8A 5CYPA 4JBXA 3ZVLA 4Z8YA 4A2PA 3HJNA 3FHCB 1U0JA 1YR7A 2BBOA 3C5HA 3KJEA 3NC0C 5E95A 4DCTA 4BFZA 1HA3A 3ASYA 3ASZA 1SVOA 3BIFA 4XVUA 3KXIA 4QHSA 4Z54A 2ODNA 2UVQA 4A8JC 1D9XA 5KPDA 1G5PA 4D80A 2W2XA 5JJKA 1NSTA 2GJ9A 4B2LA 3KKQA 2VEDA 2A9KA 2VTKA 1Z2CA 3G5UA 3PUYA 1ODFA 2ZJ8A 4O0MA 3GLGE 2BHRA 2HT6A 3IIMA 2IYVA 3LDAA 1OIWA 2BBWA 4CVNA 3BB1A 5J4VA 3ADDA 3MGCA 3DM9B 4ZIRA 3AUXA 3SBDA 2IUSA 3IBYA 5FUYA 5EXTA 1Z0JA 3TBKA 1G9XA 2C98A 1Z06A 3U5ZB 4PSAA 1P2UA 1D8TA 4DT1B 3WP0A 4DSNA 1HQCA 4D6PA 4RZXA 5CDFE 2ATVA 2YOFA 4HAWA 2IYWA 1XMJA 3CZPA 1Q12A 2I1VB 3PUWA 2KBFA 2LCFA 5P21A 2QE7A 2WMNB 3WY9A 4K81B 3WXMA 1OJLA 1T6NA 3SN6A 3ZDQA 2DWOA 3OIVA 3IGFA 3CWZA 3L8ZA 5EUMA 2QBYB 3N2IA 4BZPA 4RD6A 4U7DA 3A58B 2REOA 2G0TA 1T9HA 1M7HA 1S96A 2C9OA 2ZPTX 3MJHA 1WP9A 1WB9A 2ZJYA 1OXTA 3LW7A 4PAMA 3SR0A 2C96A 3LX8A 2REXB 1SXJD 4PC3A 1KY3A 1CBUA 4Q4JA 3RDPA 2MMGA 1D6JA 2Q3HA 1GKUB 5E4FA 1HYQA 1EWRA 1RW4A 3EPHA 4TQ9A 1R7RA 3MWJA 3GLGB 3R20A 5GJVC 1ZM7A 3NDPA 3E5HA 2XTNA 4R9UC 2GVDC 2YWFA 3F0TA 5FOWA 4TYYA 5JSZB 1VCOA 3RSLA 1XMSA 3QI2A 1FMLA 2JLYA 2GESA 2WAXA 1AS2A 2FFQA 3AEZA 4H9GA 1A2KC 1L4YA 1NY5A 2EW1A 5FL7A 1JAIA 1G6HA 1FTSA 5CLQA 2JASA 4BEBA 8OHMA 5J4HA 2ZU6A 1FQKA 1BMFD 2P67A 3THOA 3F8TA 3EWAA 4FXPA 3A6PC 3A1WA 2H7VA 3I73A 1KJZA 5G41A 3A4NA 1JNYA 3ND9A 3FKQA 4LI0A 2XTZA 1JEEA 3DKVA 1J7KA 4TLDA 1GNPA 2KE5A 1NIPA 1LS1A 2FZ4A 1Q3TA 3RRYA 4Y0AA 1HE1C 1R6BX 1IN6A 3RWMB 4EJSC 4OQFA 2FG5A 2MMCA 1E9AA 4G5QA 2IA5A 3CWQA 3FVQA 3A4LA 3EIHA 1S9HA 4RKFA 2X8AA 1W4CA 1CEEA 1W0KA 2H5EA 4LRWA 5DYGA 4NH0A 1YR6A 1RJ9A 4PO8A 1E1RA 4N0DA 4B47A 1UEIA 4N0EA 1V5WA 2B92A 2DWQA 2VBCA 2V1UA 2I3BA 1Q1EA 2CNWD 2DFKB 1J2JA 4QJ3A 5C46F 2KI5A 2JEOA 4RFSB 4TTRA 4JJZA 2JLXA 3FMPB 2ZU0C 4FCTA 1W44A 5FR1A 3UWOA 1PUJA 1IY1A 3U3RA 1KI4A 1Z47A 2EFEB 4V0NA 1IQPA 1JEDA 2WJJA 2C5LA 2WWHA 4OI1A 2V1XA 1RKBA 5HE8A 2KJQA 3BBPA 1V43A 1Z0AA 3BH0A 1VIAA 3V9PA 4TSFA 4FWTA 5J4YA 3A36A 4Z1MA 3OIWA 4NZYA 4WZAE 3O8DA 3RAPR 1SVWA 2WSSD 3ZZ0A 4TQUS 3AVYA 3K9HA 5DGXA 1GG2A 1KI8A 2WHXA 4PC1A 1G7SA 5EXXA 3TLXA 3T15A 4UJ3A 5F9HA 1N6LA 1G8PA 1UBGA 5FOUA 4C3ZA 1E2FA 4LCBA 4B33A 1II8B 2CHVA 1IM2A 4URZR 421PA 2BMFA 2PX0A 4YLGA 3GLFE 2J0UB 2OO7A 3CX7A 4MDEA 5BW8A 4MKIA 5H68A 2ZS9A 3KQHA 4QBGB 2HLDD 1DTSA 4V0LA 4UXJA 1HQYE 2F9LA 2WWYA 4C2TA 2ORIA 3C15C 5AR1A 3DKPA 3QPWA 1E99A 1YRBA 3WMFA 3F5FA 5EJEA 1M6NA 1EFRD 2QMHA 4G5OA 4A2WA 3HR8A 3LWNA 3LRPA 1R5NA 3TGPA 4RZ2A 2OM2A 1NMYA 3RS7A 4UNQA 3U7FB 4XIGS 3UMSA 4S35A 3DPUA 4MDFA 3RRNA 3WHLA 2FSFA 1US8A 2FZLA 4E22A 3M6AA 1NN3A 3FPAA 1MABA 4ZDKA 3FE2A 3O8BA 3H84A 5B58C 2CE7A 3THXA 2HCJB 4XTCS 2JIZD 4I1UA 2NPIA 4JLOA 1EX7A 4B73A 1G3MA 4A6PA 2J9RA 4DIDA 2ZREA 4L4UA 2GNOA 4CEHB 3BH7A 1G19A 5FTJA 1KJWA 4A9AA 1T4GA 1WDTA 3U7EB 5AUNB 1S4QA 5TARA 4DDTA 1W36C 4WXRA 1NVVQ 2NQ2C 2XTMA 3QF4A 3VHXA 1Z0KA 3GLFB 2WVJA 4ZKEA 3IUYA 5B57C 3W3AA 3Q5DA 4Q4AB 4KV9A 4LZZA 721PA 1C1YA 4FN5A 1W4AA 4JBWA 2C2HA 4KU4A 4O3MA 1SQ5A 3NBYC 4OQMA 4ARZB 5BQ5A 1SXJE 4IHQA 5DI3B 2J5XA 4C7OA 1W4RA 2FDCA 2GXAA 2YZ2A 3C14C 3KDSE 1EFUA 2ZI4A 3M1IA 1ZNWA 2IYXA 2VHTA 5M04A 4CRWB 1IXZA 4N1AA 5H1YA 1K8RA 4JLMA 4P31A 3VR6A 1CJUC 4NYIQ 2D2FA 3QPVA 1TAGA 3BWDD 5AUQA 3NHBA 3UG7A 1YZKA 4M0LA 1WBBA 2O8BA 1IJEA 4JVLA 3GEIA 1ZIPA 3SQWA 1TTTA 1XEXA 4AYTA 2JLVA 2ZYVX 2O8EB 1G16A 4AC9A 3RNLA 4Z51A 3BGWA 1UPTA 4Q7MB 3SJCA 3LLMA 4Q9IA 3BRWD 1C9KA 1U8ZA 3K0FA 4AD8A 4B74A 2J59A 2ANBA 3HWSA 4P4TA 5GJCA 3KQUA 3CNLA 2J1LA 3KXLA 2O8FB 1XF9A 1XX6A 4OI4A 5L3VA 1M34E 2OCAA 2JLRA 1ZYUA 3GFPA 4X8HA 4HAUA 5EZ5A 4WZBE 3THWA 2A3RA 1Z3IX 3HU1A 1EFHA 2IHBA 3QXXA 4LC1A 4ACBA 3GLHA 4IOMA 4JLNA 1E69A 1Q1BA 1SXJB 1XNJA 1JJVA 4R98A 4MRRA 1KIMA 3A1TA 3EZ2A 2AD5A 3ZZUA 5KUTA 3D3QA 1E2HA 5JLJA 4NDZA 4F38A 2CMKA 1OLOA 1XD2A 4UNSA 3UKDA 1NIJA 1VG8A 3DMDA 1NBMD 2WJIA 4PC7A 4CEIB 4GP6A 2QP9X 4GL2A 2WAYA 2CL0X 4TL9A 4DLXA 4C0HA 3RSOA 4ZDJA 1DE0A 1P62B 2ZRGA 3V00A 1GP2A 4GP7A 5IDVA 1B0UA 1E94E 3BC1A 1CF4A 4LC0A 4V0OA 3QXJA 3U3OA 4ZKDA 1MO4A 4AI6A 1TU4A 2FMXA 3P4YA 2PBRA 1X8LA 3QSYA 1JXOA 2G6BA 1KK1A 1ESMA 2F7SA 3K8YA 2ZRFA 1N5JA 2XSZD 1JR3D 1N6KA 3LFUA 4W5JA 4XOIA 5KNBA 3IIJA 1VYUA 3B1ZA 1H65A 1LB1B 3A4MA 3AV0B 1ZU5A 4I1VA 4Q48A 4U5XA 1E2NA 4MRPA 1EX6A 2PZGA 5D3MB 5SZJA 4C0KA 2VP9A 2GXUA 2OEPA 1W2HA 3OAAA 3CRRA 2QTHA 2QGNA 2FFAA 3NBFA 3ONWA 4QBFA 4GI7A 2JLSA 2HXSA 4Q4HA 2NPFA 1XRJA 1YE8A 1RRGA 3FFAA 1OXSC 4E07A 5KSYA 1KJYA 2F43A 4DRZA 1GL7A 5J40A 4NCKA 2YJTD 3NWJA 1WBDA 3QXSA 1HEIA 2P5TB 3AKYA 1IJFA 2GCOA 2V4ZA 1KAOA 1II9A 4JL5A 1NG1A 2O8DA 1AM4D 1DG1G 3DM5A 3QG5A 4PHHA 4AKEA 1R2QA 3FMOB 4NYIR 1HH4A 2C04A 2GBLA 1U0HC 5HCNA 1YRAA 2G1KA 2RMKA 4M8NE 3TUZC 1TADA 5J4KA 4MKHA 4FI3C 1KMHA 1VMAA 2OLKA 3HU3A 3SC3A 1RVDA 2R6GA 4WVFA 5EQTA 3QUSA 1SVLA 2FPMA 3A1VA 5FL3A 3P27A 3TSOA 3B1VA 4GDFA 1VKJA 4M9ZA 2N42A 3GJ5A 2CL6X 3QIAA 2L0XA 1Q21A 2AR7A 2I4IA 3PUVA 4IOJA 4ZCMA 4LHVA 2B6HA 2F3TA 1X3SA 3PCRB 2XEXA 2RCNA 3LQRA 3AP2A 4W7SA 3GEHA 1SZPA 1Z0IA 3RS3A 3MSXA 3AVXA 4M21A 4OI0A 2QGZA 3BJIC 1Q20A 3VR5A 1UKZA 3K70D 1BH2A 2GA8A 2OFWA 4EPWA 2O8CB 2YINC 3I3SR 3VFDA 3TRFA 2QE7D 5FTMA 3UANA 5FUWA 4NYJQ 3D8BA 4LJAA 5HZKA 4OYHA 4KSBA 4TTPA 3P20A 4A1FA 4JLAA 1KNQA 4O2LA 3WRYC 3C41J 2OT3B 5JS7A 4D4JA 1F2UB 3SEAA 2ZVPX 2OFOA 1E0SA 1E2GA 2FH5B 1KDOA 2XXAA 4EQ6B 3GEEA 2O0KA 1W2GA 2ZI3A 1XFAA 2GCPA 3LA6A 4G1UC 3ADBA 4LV6A 1AKEA 1G17A 3EIQA 3MUFA 3PQCA 3KQLA 1LF0A 3U3KA 5A0FA 2C9CA 3I32A 4HLQB 3GD7A 2RH5A 1W1WA 1UKEA 2GAAA 1MO6A 2WBLC 3B1YA 1E2EA 2ZR7A 4Q03A 1KSGA 3JVUA 2AK3A 1TU3A 3AP1A 5EP1A 4BASA 3LV8A 5FPHA 2JLQA 3BFVA 2IWHA 2GAOA 1W47A 2V6IA 1QVAA 4KYUA 1FTNA 3BH6A 5FL7D 3QKRA 2PH1A 3ND8A 2DCUA 1Z0DA 1NKTA 1S8FA 3JZMA 4URVR 2QMOA 3LH5A 5HZHA 1ZNYA 4FMCF 3DOEA 4HLUC 3NBXX 1YR9A 5DE3A 1O3YA 4MUBA 3KUCA 4NHOA 4EFMA 5GVSA 2E9SA 4I1OA 1L4UA 5EE9A 4IOKA 3B9QA 1Z22A 4JKIA 1BIFA 4L8GA 2QM7A 3CUEF 4KI0A 3QKSB 5FOXA 2BM0A 1PUIA 3K9NA 1G4AE 1NBME 3EZ6A 2RGNC 3OEEA 3K9LA 2AK2A 2ZRKA 3I72A 4JLKA 5HE9A 3IBGA 3I5YA 3FMIA 1T91A 3AGQA 2AN9A 1E1RD 5BXQC 1ZNZA 3GLIE 2RKOA 2FX3A 3TVTA 1FX0A 5JMTA 4LGMA 2OHFA 2GJAA 3TJZA 2EFCB 3OESA 2PMKA 3BK7A 1MOZA 3KB1A 4IDQA 3GJXC 1Z6XA 2CLCX 1Q0UA 4PANA 2GCNA 2OXCA 1WE2A 2GWHA 1JR3E 4IFEA 1KI3A 4ZI3A 4BWYA 2ZI5A 2ECKA 3ZLJA 1RRCA 2G83A 4XWKA 3LQQA 2JJ1A 1FFHA 2C78A 3W34A 1OH7A 2B21A 3A37A 2WWWA 1XEWY 2GVZC 2X2FA 3IIKA 5JHHB 4QNMA 4TSFD 1G41A 4EPRA 3EAQA 4Z1MD 3AF3A 2AL7A 1W48A 3CIOA 3BFKA 2ZE6A 2UZIR 4NCIA 2WKPA 2A5YB 1E96A 1FMJA 2FWRA 4G3XA 1Y3AA 2ORWA 3L43A 4LBWA 2WOJA 3LW8A 2ZRBA 3LY5A 2Q9BA 3T5GA 4DEXA 3VX4A 4LJ6A 2IS4A 4KLNA 2PZFA 1KO1A 2H17A 3R9XA 2NO1A 4YDSA 3AVTA 2IK8A 4RD4A 3GLIB 4BLRA 4BZXA 2QG6A 2QENA 2ZIAA 3IHWA 5DHFA 4GFDA 4C4PA 4B3XA 1P72A 3PFIA 3IEUA 3JVVA 1JQLB 4AG5A 2WIBA 4Q18A 1ETUA 2IEZA 2QPAA 4TWZA 4PPQA 3PEUA 1XJ0A 3BOSA 1JPJA 4PTLA 4B3BA 4BZQA 3IEVA 2ODEA 1GNRA 1SXJC 1Z2AA 2J46A 1ZRHA 4XTRA 5K8TA 1IXRC 1A7JA 4FINA 1R5OA 1LNZA 3WBJA 1DAFA 4UXIA 1KTVA 4M1SA 4Q47A 3VR2A 3GJ7A 4I81A 1F6BA 4QJ5A 3GQBA 3KFXA 4V02A 1A82A 4MITA 1IN5A 4L9SA 4PPNA 3WNDA 621PA 3B13B 1WCV1 3U4QB 3UWKA 1N0UA 2D7CA 2GF9A 3Q8XB 5IHPA 4EPTA 1DADA 1FP6A 3R7WA 1CR1A 5JCPA 1LV7A 1Z29A 2UKDA 4US0R 1N2CE 3OHMA 2WTUA 2P5SA 3X1DA 4CF7A 4A82A 1GIAA 2HYDA 1DAEA 3OZXA 3SYLA 5TDHA 4PFSA 3TR0A 2XZOA 3CM0A 3B82A 2V7QA 2R6FA 2QPOA 4B2PA 1OPXA 4FMCB 4Q9JA 2Q6TA 5CB8A 3GFOA 1QZXA 4DDWA 5L8VA 2PX3A 5FOSA 2PEYA 4Q66C 4MYHA 1XB2A 3E1SA 5JECA 1GM5A 3UMFA 1AIPA 2A2ZA 2IS6A 1SVKA 3TQFA 1E4VA 4JLDA 3R8FA 1DAIA 2AXPA 2XNDA 1YKSA 1ZD1A 4YDHB 5B64A 4JS0A 4R2HA 5AJVB 1JECA 1MO5A 2R6CA 3BERA 2P0EA 2NZJA 3LD9A 2VP0A 3LO5A 1MT0A 4B6FA 2NMVA 4V0MA 1ZJ6A 4R2IA 3NH6A 2IYSA 4URWR 2XZLA 4C0BA 3C7KA 1YJ5A 3WP1B 4AKHA 3K9GA 3SJBA 3CONA 1T0HB 3LBHA 1XJCA 1E9EA 4RVCA 1OH5A 4UKDA 5AJYA 1R0ZA 3FWYA 4DBLC 4V03A 4LBVA 4R7ZA 5E7IA 2D74A 2G1JA 1VDZA 3FYHA 4JVMA 5FTNA 2E87A 3W8RA 4G5SA 3P4XA 2BCJQ 1DAKA 4IJMA 5JJLA 1E2LA 3BXZA 3S1AA 2ZRAA 4DSUA 2QMEA 4FCVA 1H8EA 1NMXA 1PLKA 3QKTA 1F2TA 2RAPA 2ZS8A 4HUQA 4P3YA 3WYFA 3LX5A 1K5DA 3NBZC 2IC5A 3GJ3A 1W5TA 2QAGC 1E1QA 5EUQB 5G3ZA 2IXFA 3DVLA 3KKOA 1KSFX 1DARA 4M1KA 2C77A 4IVPA 4TLEA 1AA9A 2YV5A 4IOLA 4QL3A 2HYIC 4YONB 4A4DA 1WA5A 4Q4JB 5L3QA 2X1VA 1ESNA 4KYIB 1TF2A 3T1TA 3IO3A 4NYMR 3KL4A 3AKEA 1CLUA 4PZZA 1B23P 4GZMA 1II0A 2BMEA 1CRQA 4DCUA 1CRPA 3AF0A 1NY6A 4IDHA 3QNUA 1P2TA 4B3CA 2CL7X 2PL3A 4URXR 4LX0A 1D9ZA 3FGNA 4G0NA 2CBZA 1XCGB 3VNVA 3D31A 4IDNA 2ZYWX 1ZU4A 1CULC 4HAVA 1GOTA 1XPRA 2ODWA 1GSIA 2I1QA 2ZJ5A 2QBYA 1UM8A 4A2QA 4HSEA 1N6HA 1SKYE 4Q1BA 3MD0A 3K0SA 3N2EA 2EQBA 5KSOA 3DHWC 3MWYW 2VLIA 3K1JA 1N25A 3NTUA 4NE2A 1UFQA 2HUPA 2BC9A 1J70A 4M53A 3RC3A 4CW7A 3EA5A 3U6BA 3TQCA 4JZKA 5EXPA 1E9BA 2EFDB 2DHRA 2N46A 1ZNXA 3FHOA 4ABYA 1ZC4A 1Z07A 2ASEA 1QHSA 4Q7JB 1VCIA 2VP5A 5BN3A 5JZVA 1KHTA 2WWIA 4W5WA 2BMDA 3OAAD 3G82C 4HYYA 1S0UA 3IKJA 5DYIA 5FR2A 4I1SA 1GAJA 3WBKA 5IF9A 1AS3A 1N0WA 5HKKD 1RJ9B 1Y63A 3B1XA 2EWWA 3NDBB 1J8YF 3K0CA 3P26A 4TTQA 1VHLA 3SJZA 1KDRA 2B7BA 1G20E 2VQSA 3N70A 3BORA 1U98A 1XZQA 4BEJA 1OKKA 4XWOA 2JLWA 5DI9A 4G01B 2V54A 4QRHA 1ZAKA 1Z63A 2C8VA 2FU5C 1P6XA 3QENA 4TT3A 1YVDA 1EG7A 3O47A 5KPJA 1XTJA 1XBTA 2LWIA 4P33A 5JWRA 4B43A 4HZUA 1KDPA 1SKYB 3IDQA 2F1RA 4DLZA 4UNNA 5GADl 4BQSA 4TZ0A 1NN0A 4PSVA 2XNSA 1NNEA 3NIBA 4YMSA 2ZXUA 2NO7A 2CVFA 1G3RA 2IYLD 3U3MA 1N5LA 2VHCA 1OF1A 4PO1A 2HF9A 4GOJA 5FBLB 4A92A 2GK7A 4QC2A 3QEJA 2LKDA 1X8JA 3W6PA 3FTQA 4YXWA 3T1VA 1XTSA 4M9SA 1E9RA 1E6CA 1Z6TA 2FSIA 3H0KA 3FOZA 3TMKA 3ZH9B 4ZDIA 1NLFA 2Z0MA 2RGXA 4Q7LA 2GKSA 1E2IA 3T1QA 2IBMA 3W3ZB 5HR5A 1COWD 2F6RA 2ZVQX 2H57A 2IXEA 5DSZA 1KDTA 1QG2A 2CLSA 3J81k 5LB4A 4E03A 3RABA 1DBSA 1XMIA 1PVOA 3QBTA 1AQYA 2X19A 2CK3A 4KO8A 3CX8A 1OV4A 4DXAA 4AY2A 3I1FA 3CB4A 2F1HA 1N6OA 1G7RA 2IUTA 2VHQA 2VSOA 2ZANA 2A30A 2WZQA 1P7CA 1OIXA 4BE7B 2FPLA 3PEVA 1US8B 5AJXA 4Q9HA 1OB2A 3PG5A 4LJ9A 4XSHA 1MABB 3CW2A 1U9IA 5H70A 4QKQA 1RE0A 1Z0FA 2WJHA 5BN4A 3THYA 2ERYA 1JQJC 4C0SA 5IT5A 1Z83A 3THXB 4AKGA 4GZLA 4BLOA 3VQTA 1T5IA 1KI9A 2W0MA 4F4JA 2ZSAA 3BD9A 1ZINA 3C4JA 4PC2A 3T1OA 1HY3A 1ZC3A 5JFGA 2JDID 4I99A 4O2RA 1BYIA 2Z4RA 5JI2E 2PLRA 3K09C 1TMKA 1SVIA 1GKYA 3CNNA 2RB4A 2W58A 2D62A 1AK2A 2WKQA 2ZRHA 4MKFA 2A78A 2Z83A 4C0JA 4D0NA 4HLCA 3DDCA 1L2TA 2Q21A 2AWNA 3BB4A 4DB2A 1G1MA 2ZRPA 3A8TA 4DHEA 1RRPA 3Q9LA 1KMQA 1OW3B 1UADA 3GLHE 4WAUA 2DFLA 4QHYA 4K46A 1XEWX 5KTYA 4C7OB 3LAWA 4F4CA 5GJWC 2V8OA 4GRAA 4MA4A 2O0HA 4LJYA 2X77A 3AKCA 1J90A 2W00A 1NLZA 1P61B 2PCJA 3AVOA 3ZZTA 1FNNA 1GTVA 1YZUA 3CF2A 2WWXA 3CH4B 3LVRE 4IRUB 1YHNA 1OH8A 3OEED 1OFIA 2TMKA 4TLBA 4DLRA 1E2KA 1NLYA 1ZM4A 2ZETA 1G6OA 4NMMA 3SI7A 4TL7A 5LB2A 3ZQ6A 3QBVA 2O8BB 3VTKA 4D81A 1OHHD 3R9IA 1R0WA 1XEXB 3LVQE 2NTYC 2OCBA 3SE0A 4CZ2A 3ZD7A 3AVWA 2WKRA 4HDQB 4LSGA 1ZIOA 3K0FB 3VKHA 2VP4A 2JGNA 4B3DA 1TQ6A 3U61B 3LXRA 2K5UA 3VU9A 2HXYA 3EPKA 4Q02A 4UJ5A 2JJ1D 3KB2A 3QOFA 4BFSA 1XZPA 4JLPA 1Q22A 3THWB 2EFHB 2HEIA 2REBA 4A6XA 3PXGA 5E7MA 5JWOA 4Q1AA 1FL9A 2AKYA 3BAFA 3H86A 1A4RA 3IO5A 4B2IA 5KU1A 3C8UA 4MGYR 1NRJB 4JLBA 4XWAA 3WYAA 4AG6A 1Q3HA 1KNXA 2AD1A 4LV8B 4A0RA 5J4LA 1XD2B 4PAQA 3EA0A 5KDOA 3SFZA 2JA1A 3DL0A 3PIRA 4ZCIA 1UBEA 3OIYA 4K8OA 1OIVA 1FPMA 1PLLA 1T8TA 4Q7KA 4BFTA 4NCHA 2WSMA 2GJSA 2QA5A 3RHFA 3RRMA 3K70C 1MH1A 1G3IA 5CYOA 1F3OA 1TEXA 2ZEJA 5FI1B 4EDHA 1ZBDA 2VF8A 4DVGA 4BLSA 2YC4C 4G5RA 2CJWA 2Q9CA 4IXNA 3T61A 4R71A 1JJ7A 3CRQA 5J47A 1G3UA 5H8WA 1N0VC 4B32A 5JWHA 5A5GA 4KBFA 3VHLB 3X2SA 3ICEA 2CHQA 1G8FA 2WWGA 1Q44A 2QUZA 4WBSA 2V9PA 2XAUA 2EFGA 2OV2A 3SHWA 3X1YA 1W4BA 2ONJA 3KQNA 2O52A 1YQTA 3H4MA 2NOAA 4WOPA 2MSDB 2PJRA 2KWIA 3TIFA 3V4FA 1E79A 4Q1EA 1W46A 2A5JA 4EAQA 4Q4HB 1QHNA 4LHXA 5HKKA 2RGCA 5FBVB 2FOLA 1UJ2A 2OFXA 2Y8EA 4BRUA 2OILA 5CK5A 1P5ZB 2F43B 2ZUCA 2VP6A 5LD2B 2IS2A 3AVVA 2QSYA 2YWGA 3FB4A 4PPGA 4L16A 3TSWA 2GCOB 3HDTA 2V7QD 1G4UR 1SVSA 5BN5A 1P2SA 4PZYA 2O8DB 1AZSC 3W5JA 5KDLA 1P60A 5KNDA 1I2DA 2F9MA 2A7QA 3WMEA 3KJGA
chains in the Genus database with same CATH superfamily
2BGUA 4X6UA 1AF7A 2YN2A 4FHDA 1CJSA 2YZNA 4LVOA 3RVLA 4MRAA 2VF2A 2OBNA 1RP1A 2AXNA 4QELA 5ALRA 5TEVA 5A1JA 1FOEB 3IVGA 5BW5A 2MYPA 5HMMA 4B6QA 2OHGA 3A6GA 1E18A 1XTTA 2WK1A 4UBKA 521PA 3BF8A 4LBZA 2C5EA 5HVNA 1RXWA 1E1CA 16PKA 1JLMA 1QYRA 3HP4A 1BW9A 1RI3A 3KJIA 3KUDA 3OPVA 4ASUD 5A2QA 2O19A 1CXZA 1DAOA 2PRYA 1MH9A 4L95C 4HGYA 4P22A 1M1YE 3VC7A 4TYWA 2PDAA 2HWKA 3A1FA 3FFBA 3WOVA 1VLZA 2BEKA 1OYYA 3KEGA 3VH2A 3OT1B 2GTIA 1XRRA 5LMZA 1A9XA 1RPNA 4B48A 1KARA 2FW1A 1UBCA 821PA 4PG7A 2PVPA 1XXLA 1VHDA 1XDDA 2X0RA 2BV3A 3R7SA 1K98A 4LOAA 4NXNB 2IH4A 3CUVA 3CBGA 5AVJA 4BKMA 4II2A 4G0ZA 3VPHA 2Q9UA 5C3UA 2ZSBA 1QDEA 4J91A 4E7OA 2ZB2A 3CVOA 2HDHA 3L07A 4K26A 5A7FA 4YMWA 4RSGA 1DPGA 3NU1A 5KO2A 3MQ4A 4KG7A 5KOJA 4F6CA 1ZESA 2UVPA 3MCUA 5AW6A 1T2EA 1FXUA 1DWOA 3C45A 4O4LB 4OJKA 2VHXA 4KVGA 3RF7A 5EHNA 4EY3A 2O3QA 4BQOA 1PD1A 2B2XA 1R00A 1GG8A 2HMTA 2ZRMA 3EXFB 4PNPA 4QVKA 3AG6A 2ZAOA 3OCZA 3GL9A 4WECA 5EUBA 4EFNA 5ISMA 1XTIA 3E22B 4XCQA 1FW6A 2C95A 4BNTA 5BR4A 2P77A 2VF7A 3DDUA 1GSHA 1ST2A 2ZAMA 2Y1WA 5KYXA 4BY9E 1E62A 1IAQA 1XU9A 3P9ZA 4ID3A 2GXQA 1UF9A 3ITEA 3OM1A 4OHVA 4TUYA 5F1YA 2IQIA 3ZVRA 1VM6A 2H4FA 3M3HA 4DKXA 4NABA 5IG2A 2ZJAA 3RC2A 2Q5QA 4AZVA 2XWJI 1PRYA 4P32A 4EIWA 4R8MA 4V3CA 1P39A 3RYTC 4F2GA 4BNNA 4MIEA 3NM6B 1Z62A 3CQ9A 1KYQA 3D4BA 4HPXB 1JQ3A 4YO8A 4DCNA 4W5RA 3GPDG 4EMSA 2AG6A 2H92A 4U3JB 4NESA 4WV3A 3TLBA 2TMGA 1VGRA 1M2OB 1ZONA 2NQTA 3NEJA 3AFIA 1P44A 4JI0B 3KNZA 4WPGA 1WKBA 3KBBA 3UJDA 1BHO1 1RAHA 4DR6B 3Q8KA 4DC9A 3KKLA 4OY3A 3WHIA 1LSSA 3QYPA 3W78A 3ROQA 4E1AA 2Z2XA 1WDKA 1YK1A 121PA 3KC2A 3W4IA 3VU1A 4KX3A 3AKDA 5DHSA 4FPXA 5BP7A 1DC7A 1R15A 4AF7A 4DW8A 1XQYA 2OCYC 5BSHA 5HQTA 2JJ2A 1NN5A 1ZS9A 2ZYTX 3QU9A 4Y6PA 1LPBB 1EFAA 4GM0A 3EXG1 1BRMA 2H7XA 4IIFA 4LFCB 4L02A 5L95A 3MB5A 2I8AA 4U0JA 1XPUA 2AVDA 4G0XA 3LO8A 1YGYA 3ZJ4A 4L15A 1MT3A 1RYFA 4ER5A 3WLOA 2PQ2A 1FQOA 5FUBA 1TAQA 3QKWA 2A9VA 3WIOA 1BEEA 4QQFA 3QEMA 1JE1A 2WM3A 1AKYA 1MKYA 3NIFB 5D5PA 5LMUB 1G291 3BHNA 1K7XB 2VZLA 3U62A 5L3SA 5BXYA 4TVOA 4P0PB 4UM9B 2REQB 1PYOA 2QXTA 2V7XA 4X6XA 3TLEA 4HPWA 1QU3A 4CE6A 1OKKD 3WHPA 2HU5A 1QVRA 2AMYA 5DH9A 1PWHA 3ZE2B 4Y2SA 1P9NA 1D2MA 1RDFA 2EL7A 4PO3X 3KTAA 3RADC 1FJHA 4OHUA 1F5NA 3QLVC 4WJZA 1LGYA 2WJAA 1LPNA 2YY7A 3TM5A 2MIIA 3I5AA 3TW8B 4JOSA 3WLPA 1O96B 3KFVA 2IITA 3HRKA 3K31A 1X87A 4RE5A 3AX6A 3HNPA 1IDOA 2XNCA 1M0TA 1DELA 3HU2A 4RX1A 5DN6A 2ROQA 2R8XA 3TPCA 3G2HA 3QTBA 4NL4H 1ZD8A 2UV8A 2EERA 4F4UA 4K6GA 3WO0A 1NPDA 4D8UA 1E9CA 4RORA 1IHOA 4Y9UA 5H81A 4BTLA 1P7VA 1S3SA 5BWMA 2NSLA 3IDFA 3IV6A 3B9PA 4NJMA 3DZ8A 2I2XB 2OZPA 2R44A 1GDHA 5HRUA 3AF5A 3ZCTA 2KSQA 1H93A 4IJWA 2JLZA 2HI0A 1AXGA 1WCWA 1BE6A 2XB9A 1JG6A 1N9KA 5JS6A 1NW4A 2Y1LA 4XXHA 2XYRA 5CU7A 1QBKC 4UQLA 1JJFA 1CFZA 2JKYA 3MCVA 5K8LA 4MYTA 1LLUA 4L4YA 2WVHA 4A10A 1AS0A 4ESHA 5BOVA 1QE5A 4RWEA 3STWA 2I71A 3CXRA 4XLTA 1GPLA 1M0SA 4JC4A 1RRKA 3LPCA 4K03A 2Y0BA 3PENA 1ZA2A 3QFTA 4A1OA 1DAGA 1WZCA 4LNHA 5J2TF 4M1WA 1Y6FA 1NQWA 1K1EA 2FTKE 2XVMA 5I8ZA 4D9BA 1TDJA 4DMUB 3RWBA 4CIWA 2AFIB 1RWXA 2JGMA 2ZVDA 3F6SA 5E1DA 2EJWA 3IMGA 1MQ9A 1T43A 3KPUA 3QOWA 1MENA 3AY6A 4MRVA 1BCRB 1E2PA 2HV8A 3U7QA 1OYWA 2VC2B 4JSTA 1E20A 1ZJWA 2ECOA 4R2XA 3HPRA 1NXPA 4IMJB 4V0ME 1FX1A 1QQ7A 5IK2A 3SLGA 5I7VA 1HFKA 2PCLA 2OHOA 4YAWA 3X1WA 3BE5A 3IVMA 2CHEA 3L8GA 2B1RA 1I1OA 1L4BA 1E5VA 4IHJF 4QPPA 5L7YA 4RVSA 1QTQA 1CIVA 4LJSA 4MJLA 4C3VA 1LSUA 1QRSA 3H16A 3ZIAD 4OHMA 5AM0A 1E3MA 3OWOA 4B6JA 1TPZA 1U2DA 1TF7A 1X7WA 4Q1VA 1M67A 3A3OA 4EPYA 3W7BA 4QPCA 1DXYA 3QH4A 4QTTB 5HJ7A 2NADA 1RNLA 1SUEA 5JNUA 3VAZA 2CF5A 1C0KA 1KYYA 4RFLA 1FVOA 4AURA 3TEJA 4P81A 4HH4A 2F3RA 1C30A 1GRNA 1BJRE 4GMHA 1V6CA 3ODPA 5IXSA 1WXFA 1JLKA 3BL8A 1VLVA 4IRXA 4P4UA 4UNRA 1YR8A 1KOFA 2PUWA 1EFCA 4KN8A 4XSVA 4MW1A 3T34A 3V1KA 1YQGA 4E2ZA 3RUFA 2I7TA 1U2PA 2W2KB 5EFOA 5AHKA 1XXHA 3PQEA 1TCBA 5EJ5A 1SXPA 4MS1B 2PX6A 4FD2A 1WTAA 1X92A 4GPAA 3VR3D 5G3YA 5JS1A 4W6ZA 5IVKA 1HO3A 2X0KA 4ITUA 3DKRA 1ELOA 2FWPA 3QE3A 3BE8A 5FUQA 1RWPA 3BK2A 3E9NA 4U7HA 2IU0A 1WMEA 3PF8A 3B51X 3EFOB 4ASUA 3NYQA 2O7QA 4NFSA 4YLEA 4ZO6A 1AVTA 3AH8A 5DNDA 1MX3A 1FS4A 2YZ7A 3L2OB 3QPDA 4MS3A 1TA9A 2O3SA 4IFIA 2VXYA 4LWZA 4PLFA 5IH3A 1HLFA 5A5VA 1G5RA 1GAQA 3D3NA 3P71T 5A71A 1DBWA 3MMSA 2UYCA 2ILVA 1QC5A 2Q0HA 4X61A 1EWQA 1U65A 1XZMA 1KEPA 1HZZC 1RXCA 2F8MA 3EC1A 4HWPA 1PW7A 4OAOA 2G8LA 4RCZA 3UV3A 2NNLD 3ISJA 4PZEA 3SQNA 1OXMA 1OWPA 4LTMA 1N2CB 3OA0A 1KDYA 2CSXA 4B3GA 4YCDA 4TMYA 4ISBA 3TRIA 3TOXA 1B8UA 2BZ0A 2HF8A 2JF0A 2PSHA 1H2RS 3GDHA 3GZ4A 4BFWA 5B1EA 1HLGA 2TECE 4X85A 4D9FA 3AM3A 1GKLA 5C4GB 2BDTA 1PU2A 3RJTA 1X86B 4JIMA 4ZYWA 3HKBB 1A96A 2IVFA 3ZGXA 2XIJA 2ONCA 2ZUBA 5D51S 5TGDA 2F48A 4NLLA 5JSUA 3VH1A 4XX0A 2ZT5A 4OAQA 1Y5LA 1Y9AA 4HX9A 2YVUA 3FZYA 1NVXQ 4NPAA 4BV2A 2WQ7A 2PZ8A 1J5XA 1AGPA 2GF2A 1Y8RB 3I4LA 1NDUA 3FYUA 5L3QB 2BKEA 1IOLA 1LX7A 3JYOA 1P3JA 2OXRA 3PHCA 5M2QA 4QPNA 4EI8A 1EX1A 4A36A 1V8PA 2MDTA 1H2EA 5FQOA 3U1TA 2NYRA 1DLIA 1GGKA 2AQKA 3AR7A 3O6VA 2R11A 4CDMA 2QKYA 4BP1A 2PD3A 1V4NA 2EKPA 5HX7A 5LQCA 3A1UA 4NENB 3UK2A 2RBEA 5CXXA 2RAUA 2DERA 1VRWA 1L9KA 2QORA 3DT8A 4L4RA 4ZJZA 3HSYA 3G9TA 2X9NA 1W35A 5D8DA 1PBNA 4FNOA 1U0BB 1OFTA 1GQQA 3F3SA 4IUCS 3C3AA 4N47A 2HCFA 2W2TA 4IO1A 4NJOA 1Z5VA 2F55A 1SCUA 2P2ZA 1Y5RA 3IMEA 3WQSB 1JHUA 1RYDA 1F51E 1L1RA 2ZBUA 3K1YA 3OIUA 4K28A 2VUIB 4OSOA 3QRWA 3BDIA 3TFQA 3ZYCA 1DBIA 2ZR9A 3KQYA 1SUCA 1YVRA 3UPUA 3M5CA 1GTMA 1JU3A 1GDDA 3F3KA 3GUZA 3JZIA 3MYRA 2RHDA 2GTPA 4U0KA 1HV8A 2FF5A 1H85A 1ZGGA 2C42A 3BAZA 2ENWA 2H59A 4TROA 4E08A 4Q9KA 3ZCXA 1NRXA 4I9UA 5AM3A 4LS3A 1AGNA 2DFTA 4WESA 3WLJA 4WBNB 4CR8A 1DO0A 1K5PA 1BOOA 3I0NA 3CLKA 3PUJA 4TL8A 1XLWA 4WW0A 1CQWA 2VJMB 5TQ0B 1CQIA 3DO8A 3H1TA 3ORYA 3R44A 3SU8A 4E13A 2GETA 3B2EA 3A1SA 2WJ4A 3CX6A 3ISVA 1NL3A 1I24A 2PBZA 5HFAA 4DZTA 1LQ2A 1KR2A 5COAA 2PX8A 3O03A 1R64A 2HTFA 3PGVA 4J49A 4HMOA 4G1BA 2V55B 1UDBA 1B6RA 1BG6A 3FCUB 2BJWA 3UXMA 3ONDA 5AVZA 1NYTA 1KVQA 4LECA 1R4MB 4BUCA 5I7EA 5IUNC 4FEEA 3ND7A 1U8XX 4GM1A 4URYR 5KJ6A 4OQQA 3EG9A 4KE9A 3T94A 2W70A 1NQOA 3SZOA 3KQKA 5B1HA 3ZWPA 1KU6A 4CCYB 4FOOA 2FDXA 3JY6A 4M1OA 3F97A 1UAYA 2YH2A 4J0IA 5EKUA 3IQZA 3WWYA 2QQEA 4M1TA 3L0SA 5DN9A 1Q1ZA 3UMJA 3JASB 3WDSA 4CKZA 2QRZA 1AGRA 3M9XA 3GGJA 5EA2A 3TE6A 1T3GA 4K6CA 4PIVA 4HI0E 5TE9A 1ZO8A 3IP6A 4RKQA 3DFUA 3G1TA 5K20A 3CX4A 3LNTA 2G5PA 2Y1KA 3DDWA 3L02A 4DDVA 3KQVA 5FWAA 7YASA 1QAQA 2NZWA 4CM4B 3FDFA 1Y37A 4FMBB 1X9GA 5TPWB 4B8YA 1GILA 3N6VA 4JX9A 2WMOB 3AXTA 1I6LA 1G1AA 3AF1A 3VH3A 1BN6A 4EX6A 3B5EA 3J81A 5DO9A 4JLJA 3A05A 2HPVA 1U9ZA 4JB2A 1ODLA 1X38A 5DB4A 9LDTA 3VC1A 4I2NA 5H80A 1I01A 2Q1UA 2IYPA 2RHCA 4JT2A 4WJLA 4Q16A 4ZALA 5CAEA 1L1QA 1LPAB 1JWAB 2IUEA 3DEZA 4Y2RA 2VSXA 5H9VA 4GR4A 5JHGB 5ARDA 3VU3A 4I50A 2GRJA 5EPUA 1U6KA 1QO9A 3MCAA 4RMJA 2W8BA 3TSZA 5JEDA 3GLRA 3HG7A 3GRCA 4JI3B 1NPTO 3OEHA 3BD7A 3E3OA 4AUNA 4RY0A 4QHTA 4MEAA 3N1UA 3ENQA 1HDGO 1JT2A 5CT9A 4D26A 4X7MA 3GZJA 2PZLA 3CLRC 5ALOA 1A7AA 2DBYA 4C4RA 1XE3A 5KTTA 1UBFA 3EZ9A 2RC6A 2WMYA 1WX1A 5BUSA 2P78A 2PGIA 4H59A 2LPMA 3FVWA 2JD1A 2EX0A 2MWMA 3NTXA 4Y7DA 1AKMA 5I7RA 2CVPA 1P9RA 2IELA 5AT1A 3AHIA 1THTA 1L5QA 1DOZA 1GY8A 1D2CA 3WNVA 3O94A 5KVAA 3G6KA 3S28A 2V0NA 5K4HA 4BN0A 1GL9B 2P2CA 5BWBA 2PUAA 1FDOA 1EVQA 1Y9ZA 4XJSA 1DJQA 5JNSA 4CI9A 4QGSA 2VJYA 3ABIA 4TL6A 4WXEA 4YFVA 5LA6A 5IWCA 5TT1A 3PX2A 3HEBA 4F3CA 2FPPA 1MRNA 2XUAA 2O2ZA 3ZIAA 3VPDA 1P1HA 2OUIA 3M33A 5JBNA 2IBTA 1OZGA 4RCYA 4XYLA 4JDPA 1EQ2A 4F1KA 1VYVA 3QEBZ 1N6RA 4RCVA 1Z08A 2HSGA 1VCHA 3VJMA 1GT6A 4LJKA 4Z0NA 4YT5A 2C2OA 2I9KA 3TRJA 1H1LB 1BDJA 4H2DA 1UMKA 1CUIA 1SG0A 3D0RA 2CCGA 4O29A 5CM9C 3V4ZA 4HOYA 3UNXA 2NO0A 3HFSA 2V5UA 3SHOA 4C6HA 1ZLXA 3CNBA 3OSUA 1HURA 1Z4QA 1ZEJA 2O7VA 3OE7A 3CZ5A 1ZW6A 1O58A 2I9PA 3D6UA 3DLTA 3O73A 1WMBA 4ZO7A 1B0AA 3BILA 5EQFA 4YPFA 4M83A 4RD3A 3C5VA 3QOYA 9ABPA 5AM4A 3FUWA 3C3BA 2CKDA 2I6GA 3RVMA 4RF4A 5E4TA 1Y6RA 3IQGX 3T7KA 3CBQA 3F98A 4GQIA 2F8LA 4DR1B 4UCQA 3VR3A 1TEHA 2VXCA 3CF0A 5TVGA 3O92A 4RZIA 4AWXA 2PZEA 5BVHB 3JZAA 4EJ6A 4BC0A 3FFTA 2WIJA 1IN4A 1Q0QA 1QHFA 2G06A 2GEUA 4BC1A 1XKTA 3RU2A 2ZIWB 3GP5A 2CJFA 2YW2A 4WERA 4FDMA 1MJFA 3O3MB 1GL3A 4LJLA 2WAMA 3X3HA 3O82A 4HY3A 4KQXA 1E3IA 3ROTA 2JLUA 2GKOA 4U4AA 3RFUA 1V1MA 3ZY2A 2ZYGA 2NTVA 1BXGA 2PGXA 3C7DB 3F46A 5DI3A 1I9CA 2Y93A 1OAOA 1RXYA 3G9ZA 1JAHA 3VU9B 1KO4A 3TAXA 3GHHA 3N0VA 5KC9A 5I3ZA 3G8DA 5DLDA 1U2GA 2ODBA 3KWLA 3QHPA 4MH0R 4ZV7A 3GAFA 2OVBA 4IKEA 2AWOA 2Q1WA 1PQUA 1T9AA 4LRTB 5AI0A 1ODJA 3UGTA 3FOCA 2QPTA 4WCVA 3V6LA 4J0HA 2R8BA 2G77B 3OWXA 5GV8A 2JATA 1GSAA 3IP7A 3FLBA 1IBSA 4R01A 1VI5A 3QY9A 1XCPA 1Z6AA 5HPYB 2ZSFA 2CCKA 2QYHA 1VJ5A 1UJNA 3ETLA 4DFDA 3A25A 3DTVD 5DCWA 5EE5B 3IUBA 1EA5A 2ANCA 2JRLA 3B70A 4WH0A 5DP2A 5BUCA 4OEHA 2GGSA 7ABPA 4OHYA 3FSGA 2AT1A 3L84A 3MM4A 3FBWA 2J7KA 3KB6A 4L9AA 3HBFA 3T5BA 4PLVA 2O8FA 3AEYA 5CX1B 3EVFA 2CCJA 1RZVA 4Z1OA 3NYWA 7GPBA 1GUFA 1XTRA 2FZEA 4YC7A 3FNRA 3L8FA 4PLZA 3AR8A 5IAEA 4HB2A 5IHXA 2FQXA 4K9MA 1TXGA 2NV6A 2Y9PB 4GVPA 1E1NA 3W4JA 1LDEA 4JKOA 4K0RA 1G9TA 2QROA 4W8HA 3RBZA 2H9IA 3UO8B 1HBJA 4LK2A 1I1HA 3HN2A 1PNQA 3ZLVA 3FJYA 3OBBA 1QH1B 1KKMA 4EPXA 3O3NB 2AUMA 4XLZA 3IXLA 3WIEA 2FPUA 4YAUA 3BRQA 1OQAA 4MVJP 4MYUA 1ZMBA 2J32A 3NQ41 1UK6A 2H08A 3G2KA 4G84A 1LW7A 2ZSEA 5H83A 4U2GA 3BCUA 1JN0A 3AETB 4QT4A 2ZI6A 3V97A 2EV9A 4IIYA 4RO0A 5TQ2A 1GCUA 4ZHQF 2FV8A 1FLDA 1W5SA 2Z95A 4NI5A 5T4HA 1ZOIA 2O7NA 2FWIA 4DUGD 1LPOA 5EIEA 3S2ZA 2FFJA 2ID7A 4NP6A 1AB6A 3F7MA 1W36D 3DH0A 1QB8A 2J9FB 3UVEA 1SOUA 3O1IC 4W63A 5L3ZA 1BMFA 1OLSB 1NKSA 1N6NA 3PRHA 1ORIA 2ONKA 3DW1X 4BMPB 3A6FA 4EGQA 4W5OA 2NP7A 4KQHA 3RVBA 2Q5CA 5JCZA 4L8LA 4QDZA 4J3JA 4C03A 5CITA 1ID8A 3C6QA 1I5OA 1OLXB 2BTOA 3EZFA 2EFJA 4EUEA 1DT3A 4G07A 3PC8A 5LIRA 1IU9A 5GPBA 2AHOA 4M1MA 1LF5A 3VX3A 5DBOA 2B30A 3WKDA 4BP3A 4R1PA 5KWVA 2Y0DA 2WJVA 5F21A 3OPXA 5AHOA 3TJMA 4C0AC 3C3DA 2GHIA 5KU7A 4BKOA 2AC7A 3TNFA 3OI7A 2AFHE 3ZNQA 2Z2ZA 4GZ3A 4KFCA 3I5MA 4ZJYA 1L6IA 3F47A 2XMSA 3FR8A 4OK3A 3S70A 4DA9A 2DR2A 4J0QA 3SZRA 1JW9B 3DMNA 4YRRA 4N3AA 4UBMA 4MUNA 4Q39A 1Q0RA 1JIQA 4QDTA 4MWGA 4H7EA 4ZA2A 4JC8A 1ZD9A 1JHOA 1LTKA 1Y3FE 2D5LA 4PHFA 5DWQA 1GUAA 4HNAA 5DULA 3DP7A 1YBHA 1KJQA 3PPIA 3DGEC 3JZFA 1B93A 3LLUA 4M55A 3ZX5A 1XO1A 1ZH2A 3HB0A 3T6KA 3TNJA 4TKVA 4BXOB 1W88A 2C0PA 2ZULA 4QAQA 4ALJA 1U5CA 2FWAA 2GUWA 1SCNE 1HT2E 3CUWA 4CPDA 2B5OA 5TS2A 4WLUA 4X1YB 1REQB 3AU8A 5HJEA 1EJ2A 2H0RA 3LVBA 4JQOA 4AZ3B 5CDYA 1LY1A 2DTEA 4WOJA 2PT6A 3K20A 5DMXA 7AT1A 5JZBA 1Z2OX 3G6WA 3EVZA 2K4MA 3OZVA 3ZXUB 2WB2A 2GBPA 4K9OA 3RS5A 5AI9A 3BXEA 5GAJA 4CNQA 2J67A 3PJGA 1VG1A 4E46A 5EHXA 4HNGA 4HN2A 5E7JA 3FGPA 5FTKA 1YA8A 1KI6B 3G0GA 5TVKA 4ZT4A 3WIVA 3KV3O 5KOHB 1W49A 1G7TA 1TD9A 2K6GA 5AJZA 1O4VA 5EMHA 2HLHA 4JVOA 3PTAA 2J0SA 1SB9A 3UJAA 1EHYA 1FTQA 2Q5FA 4O2BF 4B17A 4FWIB 1XKLA 4LPSA 2CHGA 5D86A 4NAHA 4ZU3A 2C7QA 2QLTA 4Y30A 3I8XA 4BNXA 1EFRA 1OSNA 3GFTA 4NRDA 3ZS8A 5HJ5A 1FFXB 5CH5A 4UZFA 1YQXA 4D6YA 4R0NA 3Q8LA 1YNSA 1WW3A 4U1RA 3EPLA 2VYQA 2AMLA 3HUFA 2O54A 5EJIA 3UJ9A 2VRNA 3EQ9A 4ZT6A 1CR4A 1U9IC 1IB0A 2BFDA 3AGPA 4FKBA 1PNOA 1SVMA 3Q3CA 2ZBFA 1JKIA 1ZSYA 1BS1A 3BA1A 4GSYA 2JIZA 4B3IA 3BMOA 1RQNA 2HZ7A 1Z4MA 4U9IS 3CTMA 3H3JA 4IG9A 5BNTA 1GNQA 1AQUA 4UHKA 2QZ4A 3ADKA 1PQWA 4RA9B 4BJHB 4OL0A 4Y2TA 4J0KA 1YFJA 5GJBA 1C1XA 2XMDA 2XOEA 4JOCA 2OFFA 2FWNA 1XU7A 2PANA 3HGQA 3QE0A 4J76A 3SHQA 4BECA 3CVUA 4NMWA 1G5TA 1P45A 3KJHA 3N6XA 1TO6A 4XASA 2HQRA 3FUVA 5DEOA 4GPEA 5FNZA 4O1IA 5LOVB 1CIJA 3EY9A 1UKCA 1XZFA 1I2CA 4FT4A 3CRMA 2Q6OA 2H63A 2Z4TA 4LJ7A 4XUEA 3SR4A 5ITZB 3MCZA 2IHKA 3W2EA 4CCSA 1LUAA 1UEJA 1A5TA 4X97A 4KACA 4HGPA 4OOFA 4JHLA 4EHBA 4WLNA 1T4MA 5IXYA 1GN9A 1N2IA 3HDYA 5JAQA 4TMVA 1WABA 1R18A 3A6HA 4LQCA 3LNCA 4Q15A 1GG5A 3QEOA 3CKYA 4CKCA 3S8EA 3R0QA 1PS8A 2C5SA 2C4VA 3HR7A 4EUKA 4AF6A 4J6EA 4RIGA 5ER9A 1R8YA 1W0KD 3D0OA 3T5AA 1UDXA 3KZKA 3IBSA 2DY1A 4Y2GA 1V5IA 3IOMA 3LKBA 3NR2A 3I2FA 3AR6A 4YJFA 1DOAA 4OHWA 1ZUHA 2PS9A 1WMSA 3LECA 1FUKA 5FBRB 3TB6A 4QNRA 1WY5A 2HJWA 4LOKA 4CG2A 1V6SA 3VC3A 1FMFA 1E4EB 2H4WA 5CVCA 3ILHA 1N7HA 3PZRA 3VTAA 4C6TB 4NU5A 4PFQA 4JT8A 2H4XA 3LX6A 4OJNA 5F77A 1BQEA 2MINB 3BRWA 2P2LA 3M1AA 4X1OA 4KPUB 3TD6A 3S27A 3LHKA 5IRCD 2RGEA 5FTLA 4HPJB 2PT5A 5CK4A 3ZHRA 1JGTA 1BYUA 3N2GB 1OXUA 5B7PA 2XMGA 4MVCA 1ZJ5A 2J5BA 2I2FA 5AFSA 3J7AC 1QP4A 1RU3A 3RRXA 3OLCX 4F92B 1CD5A 2XDQB 3RT1A 1UPBA 1E3DA 2H4JA 4GLLA 4DYDA 5SZKB 4XRGA 5CR9A 1VG9B 1H2XA 3AMVA 5ECYA 2Z2IA 4YP0A 1VC2A 4TLAA 3RG2A 4QQRA 1KYIA 3JWPA 3NH9A 4OG2A 3T06B 3VUEA 3GRPA 3O9ZA 4DLNA 4X8OA 3FRIA 4NYJR 5ALMA 3DE6X 4K9KA 3V4LA 1P7WA 3OQHA 4LYAA 3ECCA 4MV3A 2HFKA 2JAWA 5KCMA 3A4VA 2H16A 3UMBA 1Z8NA 1NBMA 3BDAA 1PP4A 4HMQA 1HOTA 1SC6A 4LDRA 4OHXA 2Y0PA 4FYHA 3UPDA 1QONA 1XLTA 1G8JA 2IXGA 4XQ9A 1P4GA 5FPQA 1HORA 2JJ8A 3INGA 3LDGA 3MT0A 4MUGA 4QFBA 1C29B 5BW4A 4RH1A 3U2QA 2HOQA 3IJ5A 3S55A 3OUUA 3GJZA 1F5SA 1Y8QA 2QAJA 1U3GA 4GBED 1I2MA 5EVCA 4X94A 3ZE7A 5JH7B 3IP1A 5CXSA 4BAUA 4WNAB 2VTVA 3L6CA 2HV9A 1ZOLA 3LBIA 3GDWA 1RBZA 4RHXA 1DIBA 2H1LA 3K0AB 4GP9A 4PYNA 2H31A 4Q19A 3T5DA 1Y5NA 4DMKA 4RVOA 1T8PA 4Z8XA 3V2HA 2RGRA 3RC8A 2EX1A 1E7SA 4HH1A 4KV7A 3WK8A 3PV0A 2W6JD 1OMOA 4DVJA 4M2LA 1X7YB 1Z5UA 4J2TA 2NWQA 4CEJB 3ZUPA 4P80A 5TGTA 1E9FA 1CP2A 3W6OA 3EZ7A 3WMWA 3WBBA 3PR1A 1HOXA 4PS1A 2OG2A 4U7GA 5DNWA 5CFMA 3IBFA 1Q7BA 2P3OA 4RKWA 4TZ6A 1G98A 3G8BA 2RIRA 1VE3A 3ASUA 3LHDA 4IIJA 4E2XA 1XDWA 3RFFA 1GU7A 4IYRA 3R3SA 3RTAA 1U3DA 1E3QA 1AUXA 2DX7A 2Q7XA 2ZRNA 2E37A 1P2BA 3CSSA 2ZI7A 3ZU3A 2D7JA 3BGDA 1JXAA 1VTKA 3C85A 4DNXA 1G8YA 1MRSA 1T24A 2FF7A 2NUPB 1Q1QA 4OB6A 3KOUA 3L93A 2UZAA 1NW6A 3UHPA 4GKVA 1I2ZA 3W3AD 2GPSA 4FP9A 4IDCA 1HM5A 1P9OA 1OI7A 4Z8YA 5EHIA 4UVDA 2DQKA 1ZOPA 2B0CA 3X1KA 3FHCB 1YR7A 2Y2VA 2BR3A 3C5HA 4KRYA 4YRMA 4N6OA 3WK5A 1Z8HA 1QIMA 2DBQA 2NVWA 1HA3A 2C5GA 3AW9A 3I2JA 1SVOA 4J2OA 3WG9A 3HO8A 4D5GA 4CM9D 4D3XA 2QQGA 4TVBA 4YDRA 4LE0A 4D80A 1NSTA 4LOLA 1L4EA 1H0KA 4GLFA 4L5JA 5CNIA 3BTVA 3DBLB 5PGMA 4B2LA 3GT7A 2A9KA 1L1FA 2RD2A 1K68A 1ODFA 2X13A 1OC2A 4KDFA 1NVDA 4D5EA 5BPHA 1S02A 1VL6A 1TW2A 5FLXA 3EGWA 3R1IA 3ZLBA 3ZBTA 1QBGA 1PX2A 2C94A 4R54A 5F7JA 3I2HA 3RC7A 5KWIA 3X43A 2H52A 5FUYA 2YXBA 5EXTA 3NTVA 3NGXA 1KEEB 1TCAA 1G9XA 1XK6A 1NDQA 5DYYA 4EG4A 5BNIA 1UFOA 1EFDN 5ICMA 1R8XA 2QW8A 1TKAA 2XXAA 4DSNA 1ZRMA 4MVJG 1HQCA 1DEAA 4YJDA 4YQYA 4RZXA 2ATVA 2VNAA 3MQ2A 2IYWA 4F8EA 5BV1A 3MTDA 1RC1A 5MFPA 3IMFA 3M9LA 4PTYA 1Q12A 2JHAA 1KVRA 4M7RA 5ERYA 2QE7A 2QX7A 3H6GA 1NXSA 4K81B 1F7UA 1OJLA 1YBAA 3SN6A 2D2IA 3OIVA 2GYWA 4NZPA 4QAJA 2G72A 2QBYB 1ATZA 4BZPA 2VFAA 4I9HA 1LW6E 4M0DA 4RD6A 5C34B 3A58B 3N6RA 1FDTA 2E4AA 2G0TA 1S96A 1T1IA 3MJHA 1UKAA 3PLAE 4G0WA 1P1CA 5U4XA 4BATA 2PH5A 3LXUX 3DLBA 3D2LA 3LP8A 3LX8A 2R97A 1SXJD 5ALZA 2DUWA 2AG8A 4YV0A 2PO7A 3PFGA 3U7IA 5JCXA 2F8SA 3QHAA 1HYQA 4N82A 5HIIA 4G1MB 4TQ9A 2KX7A 2F9FA 4OXIA 2VJCA 2PWZA 4ER0A 4F11A 2PSFA 2YS7A 5GJVC 4MKXA 1ZM7A 4B4OA 3HL4A 3E5HA 4KI7A 4YGXB 4Q37A 3KETA 3RKUA 2C3OA 5FOWA 5TT0A 1FK8A 3A0UA 2AXEA 3TR6A 3IQHX 3RSLA 4H7DA 3E2PA 1FMLA 4O02B 2WAXA 2WW8A 3AEZA 3MSCA 1UFRA 3FDZA 5CHEA 3DDHA 1A2KC 3OUZA 2EW1A 1KDVA 4CMIA 4N41A 1I80A 5TRTA 4X71A 1FTSA 5CLQA 1EFPA 2P4SA 4BEBA 4JXXA 4RPGA 4UDOA 1YNOA 2ZU6A 4PV7A 3F78A 2HHAA 1BNCA 4MVJD 3F8TA 2HA6A 1UBSB 3THOA 1INLA 1SOVA 4FXPA 3T41A 5G41A 3ELUA 4CLRA 1KJZA 3LUJA 3A4NA 1NVKA 1CZRA 1S5PA 3H2JA 2XTZA 1JEEA 3DKVA 2DLDA 5EVJA 1J7KA 2ZUVA 1W581 2KE5A 4YHHB 1DT5A 4JBNA 1PTJA 3A2LA 1T9CA 3GO4A 4CBVA 3ZEIA 3IV7A 3JRNA 3QMPA 2FG5A 3DZHA 5HXAA 1VMIA 2VCYA 3CWQA 3KXPA 3SM3A 2NSHA 1QFSA 2JHCA 3BCRA 4M8KA 1VPTA 2YZGA 3A4LA 5CUQA 2E5LB 5SYNA 1QX4A 4IXTA 1W4CA 1CEEA 4XQ0A 1W0KA 3KUXA 2R5FA 4LRWA 4CNBA 1RJ9A 3G49A 1FSSA 2R85A 4YRPA 3W2GA 1E1RA 2ACEA 1OFVA 1P4HA 3V1UA 1R27A 2M6RA 4GPZA 1YQWA 2V1UA 4N48A 2F67A 2CNWD 1KAMA 5FNVF 4PN7A 4WKCA 4WN3A 4DA6A 2OKGA 2PYIA 3M1LA 3FMPB 1ADFA 2ILTA 1PL0A 2SCUA 2XGOA 5H3HA 2GFIA 3U3RA 2HIMA 3HO1A 3CW8X 1QLJA 4F86A 4V0NA 3RJ9A 1SVUA 4ALKA 1A77A 3HM9A 3D3EA 2QRVA 5FIUA 4OI1A 2R47A 4BQNA 5EIXA 3ID6C 1XMQB 2UYQA 4NG5A 1RKBA 3WGOA 1EUCA 4UOZA 1CUEA 1Z16A 1X7HA 3FFWA 3DQPA 3BBPA 4CQMB 1NVEA 4DSAA 3DE4X 2Z8YA 5JXIA 5BR8B 2NXJA 4FWTA 4TSFA 2AZMA 5J4YA 3ZK8A 4WFKA 2QIOA 3QA9A 4J1NA 2HF7A 2P90A 2CUZA 1HG1A 2JGKA 1QYVA 1J25A 3IELA 3KWFA 3BEDA 3S4YA 5CBPB 2WSSD 4F5WA 1Q17A 4GPIB 1EAYA 1YB6A 4D9CA 1M8FA 1KI8A 2QLNA 5HF9A 4FWBA 4EHNA 5E0KB 4RZQA 4WNIA 5EXXA 4FE3A 3FPBA 2B34A 1QJCA 4D9GA 4HVTA 5IM4F 1AQNA 1FDSA 4KK4A 4LCBA 1YFLA 1II8B 5JQGB 1GZDA 1IM2A 5LXTF 1B42A 1FDVA 2BMFA 1VKRA 1QQBA 2P8SA 3PICA 1ECBA 1Y1LA 3AHCA 3ONEA 5DEIA 3CX7A 4XYEA 4AM8A 3AIOA 1WVGA 4RTNA 3VR5D 1B16A 1TCVA 3INNA 3JWHA 4LEIA 4QBGB 4Z0TA 2XOXA 3DAOA 4V0LA 2WWYA 3D3KA 4AJEA 3LSYA 3BD6A 5D85A 4RK6A 1K6IA 4R51A 3NRJA 3WMFA 1BFDA 1PDWA 5EJEA 5JAUA 5DRTA 4V2UA 4G5OA 2NQ8A 4A2WA 1EBBA 3LWNA 1EXWA 1ZRNA 3EN0A 1MJNA 1R5NA 2D1QA 4RZ2A 1NMYA 1RKVA 1VBFA 4KIWA 3UMSA 4MV0A 3HGMA 3IDSA 2QR5A 3E35A 4MDFA 4M8LA 4OGWA 4XM0A 2SBTA 3FROA 3M6AA 1NN3A 1U7DA 3A1DA 4KDRA 1Y6GA 4E7PA 3LUGA 4PE5B 2X5KO 3O8BA 1WL8A 3U7FB 3KR2A 1P5HA 3H84A 5AOBA 5HGJA 2HCJB 4XTCS 4N7RA 2IGTA 4HQOA 2NPIA 1OZ0A 4WZAB 5BSUA 1A3CA 1G3MA 2VR1A 1GZ7A 3KHKA 4NU6A 4A6PA 6REQA 4MQFB 3V9PA 3QWAA 2EF0A 3CN9A 2O48X 4RVUA 3V4OA 3WGYA 4YGYA 5TQVA 1T0PA 4ENVA 3NBAA 1TAUA 3QWFA 5IC5A 4A9AA 1WDTA 3FOWA 4DDTA 5K0EA 4YVFA 3GZNB 5BY2A 1BHJA 3QF4A 3ABOB 4OP2A 2FY8A 2I2WA 2Q4BA 5BMVB 2IHNA 3OC0A 3I6MA 3VHXA 3VHQA 1P81A 3VO9A 1Z0KA 1WCIB 3MB8A 2NXWA 3P9SA 3WFIA 3W3AA 4BO3A 4Q4AB 2XY4A 4F2WA 2Z9BA 2JH9A 5AJUA 3GYBA 3O8LA 4FN5A 5AICA 2Y2UA 2CT8A 4OQMA 1PNTA 1OWOA 2JFUA 2QL9A 5BQ5A 4JI1B 3QLVA 4C7OA 1YR2A 1KR5A 1J9GA 2Z08A 4P08A 5C31A 2GXAA 3I9JA 2FDCA 1CHNA 2RBKA 5EJ4A 4BL5A 1E5QA 1EFUA 1JG7A 1KFCB <