3NDSA

Crystal structure of engineered naja nigricollis toxin alpha
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQPPTTKTCSPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational exchange is critical for the productivity of an oxidative folding intermediate with buried free cysteines.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Short neurotoxin 1
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3ndsA00
1CDRA 3LAQU 1ABTA 2GOOC 1CDQA 2CRSA 1NTXA 4AEAA 2H62C 1HAAA 2UWRA 1IDLA 1KFHA 1FF4A 2L03A 1NEAA 1ERGA 2HLRA 4BIKB 1W6BA 1FSSB 1ONJA 1G6MA 1BTEA 2X8BB 4XJJA 2MJ0A 2H5FA 3QB4B 2JQPA 1CTXA 1IK8A 2CDXA 3NEQA 4UY2C 1IKCA 1ZADA 2H62D 1KC4A 6EBXA 1F8UB 2MUOA 1CRFA 2MFAA 1V6PA 2FD6U 2BHIA 2PJYB 1KL8A 5IMYC 2ABXA 1JE9A 1CVOA 1TFSA 1TXBA 1HC9B 2OFSA 1YWHA 3NH7A 1CXOA 5DO6A 1CCQA 1LXGA 2CRTA 2LCRA 1FFJA 1DRSA 1IDHA 4QTIU 4FAOC 1QKDA 3VTSA 1FSCA 1LX5B 2I9BE 1IQ9A 1H0JA 2BTXA 3PLCA 2CTXA 1KBTA 4OM4A 2K3GA 2QJBC 2HLQA 3FEVA 1COEA 2QJAC 5DU1A 1BXPA 1JGKA 1KXIA 1CB9A 1LXHA 2J8BA 2UX2A 2H64C 4IYEA 2GOOB 4HQPF 4DO8A 2H7ZA 1IDGA 4LFTA 1IDIA 1FRAA 1CDTA 1MR6A 1TGXA 1UG4A 2ERAA 1F94A 1QKEA 1RGJA 2MUPA 2PJYC 3KFDI 5DZ5A 3BT1U 2CCXA 3U74U 2JVEA 2NBTA 2L5SA 4FAOE 1KBAA 3EVSC 1REWC 3BT2U 3NDSA 1S4YA 1CHVS 1I02A 2MJ4A 4BDTB 1TXAA 4OM5A 1NORA 1NYSA 1VB0A 1CDSA 1XT3A 1LJZA 1KTZB 1PLOA 2H64B 1CXNA 1KBSA 1HC9A 2MJYA 2QC1A 1ES7B 4ZQYA 1MAHF 1NXBA 3EBXA 1M9ZA 2N99A 2H8UA 1HAJA 1RL5A 5IMTD 3ERAA 4RUDA 2QJ9C 3KFDE 4P7UA 2VLWA 1L4WA 1NTNA 2LA1A 1CODA 1CREA 1JBDA 3HH7A 5EBXA 1HOYA 2MHYA 1FASA 4EY8B 1QM7A 3U73U 1NYUA 1IJCA 2H7ZB 1LSIA 1KS6A 1ERAA 1B41B 1KU6B
chains in the Genus database with same CATH superfamily
1CDRA 3LAQU 1ABTA 2GOOC 1CDQA 2CRSA 1NTXA 4AEAA 2H62C 1HAAA 2UWRA 1IDLA 1KFHA 1FF4A 2L03A 1NEAA 1ERGA 2HLRA 4BIKB 1W6BA 1FSSB 1ONJA 1G6MA 1BTEA 2X8BB 4XJJA 2MJ0A 2H5FA 3QB4B 2JQPA 1CTXA 1IK8A 2CDXA 3NEQA 4UY2C 1IKCA 1ZADA 2H62D 1KC4A 6EBXA 1F8UB 2MUOA 1CRFA 2MFAA 1V6PA 2FD6U 2BHIA 2PJYB 1KL8A 5IMYC 2ABXA 1JE9A 1CVOA 1TFSA 1TXBA 1HC9B 2OFSA 1YWHA 3NH7A 1CXOA 5DO6A 1CCQA 1LXGA 2CRTA 2LCRA 1FFJA 1DRSA 1IDHA 4QTIU 4FAOC 1QKDA 3VTSA 1FSCA 1LX5B 2I9BE 1IQ9A 1H0JA 2BTXA 3PLCA 2CTXA 1KBTA 4OM4A 2K3GA 2QJBC 2HLQA 3FEVA 1COEA 2QJAC 5DU1A 1BXPA 1JGKA 1KXIA 1CB9A 1LXHA 2J8BA 2UX2A 2H64C 4IYEA 2GOOB 4HQPF 4DO8A 2H7ZA 1IDGA 4LFTA 1IDIA 1FRAA 1CDTA 1MR6A 1TGXA 1UG4A 2ERAA 1F94A 1QKEA 1RGJA 2MUPA 2PJYC 3KFDI 5DZ5A 3BT1U 2CCXA 3U74U 2JVEA 2NBTA 2L5SA 4FAOE 1KBAA 4KSNA 3EVSC 1REWC 3BT2U 3NDSA 1S4YA 1CHVS 1I02A 2MJ4A 4BDTB 1TXAA 4OM5A 1NORA 1NYSA 1VB0A 1CDSA 1XT3A 1LJZA 1KTZB 1PLOA 2H64B 1CXNA 1KBSA 1HC9A 2MJYA 2QC1A 1ES7B 4ZQYA 1MAHF 1NXBA 3EBXA 1M9ZA 2N99A 2H8UA 1HAJA 1RL5A 5IMTD 3ERAA 4RUDA 2QJ9C 3KFDE 4P7UA 2VLWA 1L4WA 1NTNA 2LA1A 1CODA 1CREA 1JBDA 3HH7A 5EBXA 1HOYA 2MHYA 1FASA 4EY8B 1QM7A 3U73U 1NYUA 1IJCA 2H7ZB 1LSIA 1KS6A 1ERAA 1B41B 1KU6B
chains in the Genus database with same CATH topology
1CDRA 3LAQU 1ABTA 2GOOC 1CDQA 2CRSA 1NTXA 4AEAA 2H62C 1HAAA 2UWRA 1IDLA 1KFHA 1FF4A 2L03A 1NEAA 1ERGA 2HLRA 4BIKB 1W6BA 1FSSB 1ONJA 1G6MA 1BTEA 2X8BB 4XJJA 2MJ0A 2H5FA 3QB4B 2JQPA 1CTXA 1IK8A 2CDXA 3NEQA 4UY2C 1IKCA 1ZADA 2H62D 1KC4A 6EBXA 1F8UB 2MUOA 1CRFA 2MFAA 1V6PA 2FD6U 2BHIA 2PJYB 1KL8A 5IMYC 2ABXA 1JE9A 1CVOA 1TFSA 1TXBA 1HC9B 2OFSA 1YWHA 3NH7A 1CXOA 5DO6A 1CCQA 1LXGA 2CRTA 2LCRA 1FFJA 1DRSA 1IDHA 4QTIU 4FAOC 1QKDA 3VTSA 1FSCA 1LX5B 2I9BE 1IQ9A 1H0JA 2BTXA 3PLCA 2CTXA 1KBTA 4OM4A 2K3GA 2QJBC 2HLQA 3FEVA 1COEA 2QJAC 5DU1A 1BXPA 1JGKA 1KXIA 1CB9A 1LXHA 2J8BA 2UX2A 2H64C 4IYEA 2GOOB 4HQPF 4DO8A 2H7ZA 1IDGA 4LFTA 1IDIA 1FRAA 1CDTA 1MR6A 1TGXA 1UG4A 2ERAA 1F94A 1QKEA 1RGJA 2MUPA 2PJYC 3KFDI 5DZ5A 3BT1U 2CCXA 3U74U 2JVEA 2NBTA 2L5SA 4FAOE 1KBAA 4KSNA 3EVSC 1REWC 3BT2U 3NDSA 1S4YA 1CHVS 1I02A 2MJ4A 4BDTB 1TXAA 4OM5A 1NORA 1NYSA 1VB0A 1CDSA 1XT3A 1LJZA 1KTZB 1PLOA 2H64B 1CXNA 1KBSA 1HC9A 2MJYA 2QC1A 1ES7B 4ZQYA 1MAHF 1NXBA 3EBXA 1M9ZA 2N99A 2H8UA 1HAJA 1RL5A 5IMTD 3ERAA 4RUDA 2QJ9C 3KFDE 4P7UA 2VLWA 1L4WA 1NTNA 2LA1A 1CODA 1CREA 1JBDA 3HH7A 5EBXA 1HOYA 2MHYA 1FASA 4EY8B 1QM7A 3U73U 1NYUA 1IJCA 2H7ZB 1LSIA 1KS6A 1ERAA 1B41B 1KU6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDR A;  3LAQ U;  1ABT A;  2GOO C;  1CDQ A;  2CRS A;  1NTX A;  4AEA A;  2H62 C;  1HAA A;  2UWR A;  1IDL A;  1KFH A;  1FF4 A;  2L03 A;  1NEA A;  1ERG A;  2HLR A;  4BIK B;  1W6B A;  1FSS B;  1ONJ A;  1G6M A;  1BTE A;  2X8B B;  4XJJ A;  2MJ0 A;  2H5F A;  3QB4 B;  2JQP A;  1CTX A;  1IK8 A;  2CDX A;  3NEQ A;  4UY2 C;  1IKC A;  1ZAD A;  2H62 D;  1KC4 A;  6EBX A;  1F8U B;  2MUO A;  1CRF A;  2MFA A;  1V6P A;  2FD6 U;  2BHI A;  2PJY B;  1KL8 A;  5IMY C;  2ABX A;  1JE9 A;  1CVO A;  1TFS A;  1TXB A;  1HC9 B;  2OFS A;  1YWH A;  3NH7 A;  1CXO A;  5DO6 A;  1CCQ A;  1LXG A;  2CRT A;  2LCR A;  1FFJ A;  1DRS A;  1IDH A;  4QTI U;  4FAO C;  1QKD A;  3VTS A;  1FSC A;  1LX5 B;  2I9B E;  1IQ9 A;  1H0J A;  2BTX A;  3PLC A;  2CTX A;  1KBT A;  4OM4 A;  2K3G A;  2QJB C;  2HLQ A;  3FEV A;  1COE A;  2QJA C;  5DU1 A;  1BXP A;  1JGK A;  1KXI A;  1CB9 A;  1LXH A;  2J8B A;  2UX2 A;  2H64 C;  4IYE A;  2GOO B;  4HQP F;  4DO8 A;  2H7Z A;  1IDG A;  4LFT A;  1IDI A;  1FRA A;  1CDT A;  1MR6 A;  1TGX A;  1UG4 A;  2ERA A;  1F94 A;  1QKE A;  1RGJ A;  2MUP A;  2PJY C;  3KFD I;  5DZ5 A;  3BT1 U;  2CCX A;  3U74 U;  2JVE A;  2NBT A;  2L5S A;  4FAO E;  1KBA A;  3EVS C;  1REW C;  3BT2 U;  3NDS A;  1S4Y A;  1CHV S;  1I02 A;  2MJ4 A;  4BDT B;  1TXA A;  4OM5 A;  1NOR A;  1NYS A;  1VB0 A;  1CDS A;  1XT3 A;  1LJZ A;  1KTZ B;  1PLO A;  2H64 B;  1CXN A;  1KBS A;  1HC9 A;  2MJY A;  2QC1 A;  1ES7 B;  4ZQY A;  1MAH F;  1NXB A;  3EBX A;  1M9Z A;  2N99 A;  2H8U A;  1HAJ A;  1RL5 A;  5IMT D;  3ERA A;  4RUD A;  2QJ9 C;  3KFD E;  4P7U A;  2VLW A;  1L4W A;  1NTN A;  2LA1 A;  1COD A;  1CRE A;  1JBD A;  3HH7 A;  5EBX A;  1HOY A;  2MHY A;  1FAS A;  4EY8 B;  1QM7 A;  3U73 U;  1NYU A;  1IJC A;  2H7Z B;  1LSI A;  1KS6 A;  1ERA A;  1B41 B;  1KU6 B; 
#chains in the Genus database with same CATH topology
 1CDR A;  3LAQ U;  1ABT A;  2GOO C;  1CDQ A;  2CRS A;  1NTX A;  4AEA A;  2H62 C;  1HAA A;  2UWR A;  1IDL A;  1KFH A;  1FF4 A;  2L03 A;  1NEA A;  1ERG A;  2HLR A;  4BIK B;  1W6B A;  1FSS B;  1ONJ A;  1G6M A;  1BTE A;  2X8B B;  4XJJ A;  2MJ0 A;  2H5F A;  3QB4 B;  2JQP A;  1CTX A;  1IK8 A;  2CDX A;  3NEQ A;  4UY2 C;  1IKC A;  1ZAD A;  2H62 D;  1KC4 A;  6EBX A;  1F8U B;  2MUO A;  1CRF A;  2MFA A;  1V6P A;  2FD6 U;  2BHI A;  2PJY B;  1KL8 A;  5IMY C;  2ABX A;  1JE9 A;  1CVO A;  1TFS A;  1TXB A;  1HC9 B;  2OFS A;  1YWH A;  3NH7 A;  1CXO A;  5DO6 A;  1CCQ A;  1LXG A;  2CRT A;  2LCR A;  1FFJ A;  1DRS A;  1IDH A;  4QTI U;  4FAO C;  1QKD A;  3VTS A;  1FSC A;  1LX5 B;  2I9B E;  1IQ9 A;  1H0J A;  2BTX A;  3PLC A;  2CTX A;  1KBT A;  4OM4 A;  2K3G A;  2QJB C;  2HLQ A;  3FEV A;  1COE A;  2QJA C;  5DU1 A;  1BXP A;  1JGK A;  1KXI A;  1CB9 A;  1LXH A;  2J8B A;  2UX2 A;  2H64 C;  4IYE A;  2GOO B;  4HQP F;  4DO8 A;  2H7Z A;  1IDG A;  4LFT A;  1IDI A;  1FRA A;  1CDT A;  1MR6 A;  1TGX A;  1UG4 A;  2ERA A;  1F94 A;  1QKE A;  1RGJ A;  2MUP A;  2PJY C;  3KFD I;  5DZ5 A;  3BT1 U;  2CCX A;  3U74 U;  2JVE A;  2NBT A;  2L5S A;  4FAO E;  1KBA A;  4KSN A;  3EVS C;  1REW C;  3BT2 U;  3NDS A;  1S4Y A;  1CHV S;  1I02 A;  2MJ4 A;  4BDT B;  1TXA A;  4OM5 A;  1NOR A;  1NYS A;  1VB0 A;  1CDS A;  1XT3 A;  1LJZ A;  1KTZ B;  1PLO A;  2H64 B;  1CXN A;  1KBS A;  1HC9 A;  2MJY A;  2QC1 A;  1ES7 B;  4ZQY A;  1MAH F;  1NXB A;  3EBX A;  1M9Z A;  2N99 A;  2H8U A;  1HAJ A;  1RL5 A;  5IMT D;  3ERA A;  4RUD A;  2QJ9 C;  3KFD E;  4P7U A;  2VLW A;  1L4W A;  1NTN A;  2LA1 A;  1COD A;  1CRE A;  1JBD A;  3HH7 A;  5EBX A;  1HOY A;  2MHY A;  1FAS A;  4EY8 B;  1QM7 A;  3U73 U;  1NYU A;  1IJC A;  2H7Z B;  1LSI A;  1KS6 A;  1ERA A;  1B41 B;  1KU6 B; 
#chains in the Genus database with same CATH homology
 1CDR A;  3LAQ U;  1ABT A;  2GOO C;  1CDQ A;  2CRS A;  1NTX A;  4AEA A;  2H62 C;  1HAA A;  2UWR A;  1IDL A;  1KFH A;  1FF4 A;  2L03 A;  1NEA A;  1ERG A;  2HLR A;  4BIK B;  1W6B A;  1FSS B;  1ONJ A;  1G6M A;  1BTE A;  2X8B B;  4XJJ A;  2MJ0 A;  2H5F A;  3QB4 B;  2JQP A;  1CTX A;  1IK8 A;  2CDX A;  3NEQ A;  4UY2 C;  1IKC A;  1ZAD A;  2H62 D;  1KC4 A;  6EBX A;  1F8U B;  2MUO A;  1CRF A;  2MFA A;  1V6P A;  2FD6 U;  2BHI A;  2PJY B;  1KL8 A;  5IMY C;  2ABX A;  1JE9 A;  1CVO A;  1TFS A;  1TXB A;  1HC9 B;  2OFS A;  1YWH A;  3NH7 A;  1CXO A;  5DO6 A;  1CCQ A;  1LXG A;  2CRT A;  2LCR A;  1FFJ A;  1DRS A;  1IDH A;  4QTI U;  4FAO C;  1QKD A;  3VTS A;  1FSC A;  1LX5 B;  2I9B E;  1IQ9 A;  1H0J A;  2BTX A;  3PLC A;  2CTX A;  1KBT A;  4OM4 A;  2K3G A;  2QJB C;  2HLQ A;  3FEV A;  1COE A;  2QJA C;  5DU1 A;  1BXP A;  1JGK A;  1KXI A;  1CB9 A;  1LXH A;  2J8B A;  2UX2 A;  2H64 C;  4IYE A;  2GOO B;  4HQP F;  4DO8 A;  2H7Z A;  1IDG A;  4LFT A;  1IDI A;  1FRA A;  1CDT A;  1MR6 A;  1TGX A;  1UG4 A;  2ERA A;  1F94 A;  1QKE A;  1RGJ A;  2MUP A;  2PJY C;  3KFD I;  5DZ5 A;  3BT1 U;  2CCX A;  3U74 U;  2JVE A;  2NBT A;  2L5S A;  4FAO E;  1KBA A;  4KSN A;  3EVS C;  1REW C;  3BT2 U;  3NDS A;  1S4Y A;  1CHV S;  1I02 A;  2MJ4 A;  4BDT B;  1TXA A;  4OM5 A;  1NOR A;  1NYS A;  1VB0 A;  1CDS A;  1XT3 A;  1LJZ A;  1KTZ B;  1PLO A;  2H64 B;  1CXN A;  1KBS A;  1HC9 A;  2MJY A;  2QC1 A;  1ES7 B;  4ZQY A;  1MAH F;  1NXB A;  3EBX A;  1M9Z A;  2N99 A;  2H8U A;  1HAJ A;  1RL5 A;  5IMT D;  3ERA A;  4RUD A;  2QJ9 C;  3KFD E;  4P7U A;  2VLW A;  1L4W A;  1NTN A;  2LA1 A;  1COD A;  1CRE A;  1JBD A;  3HH7 A;  5EBX A;  1HOY A;  2MHY A;  1FAS A;  4EY8 B;  1QM7 A;  3U73 U;  1NYU A;  1IJC A;  2H7Z B;  1LSI A;  1KS6 A;  1ERA A;  1B41 B;  1KU6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...