3NDSA

Crystal structure of engineered naja nigricollis toxin alpha
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'LECHNQQSSQPPTTKTCSPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short neurotoxin 1
publication title Conformational exchange is critical for the productivity of an oxidative folding intermediate with buried free cysteines.
pubmed doi rcsb
molecule tags Toxin
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3ndsA00
2HLQA 2H62C 2K3GA 1W6BA 1YWHA 1MAHF 1REWC 1KC4A 1LSIA 2GOOB 1FSCA 2N99A 1JGKA 1IDIA 1ONJA 1UG4A 4FAOC 1NTXA 1HOYA 1TFSA 1BXPA 2CRSA 3NH7A 1CRFA 2UX2A 4OM4A 1KBAA 1CODA 1B41B 1G6MA 2QJBC 1QKDA 3KFDI 3EBXA 1KTZB 1KBSA 1QKEA 2CDXA 4IYEA 2L03A 2H64C 2OFSA 1KL8A 1CDRA 2QC1A 4UY2C 4FAOE 1NTNA 2MFAA 2UWRA 3VTSA 1KBTA 2CRTA 1IKCA 1LX5B 1KU6B 3EVSC 1FASA 1LXHA 3PLCA 4LFTA 1MR6A 2JQPA 4QTIU 1I02A 1S4YA 1LJZA 1ZADA 1JE9A 2QJ9C 3U74U 4DO8A 2H8UA 1ABTA 1CB9A 1IK8A 2H7ZB 3HH7A 1ES7B 2MUPA 4P7UA 1HAAA 1V6PA 5DO6A 2MJYA 3NDSA 1CCQA 2H7ZA 2BTXA 1RL5A 2H62D 1F8UB 2J8BA 1FRAA 1H0JA 4RUDA 1BTEA 1TGXA 1TXBA 1NYUA 1XT3A 2CTXA 2MUOA 5DZ5A 3QB4B 3FEVA 1COEA 4ZQYA 6EBXA 2PJYC 1HAJA 2NBTA 1IJCA 1CDQA 2L5SA 1KXIA 1IDLA 5EBXA 1LXGA 2QJAC 4BIKB 1IDHA 2X8BB 3LAQU 1CXOA 1KS6A 2HLRA 2MHYA 3ERAA 4AEAA 2CCXA 3NEQA 1QM7A 4HQPF 1CREA 2ABXA 2ERAA 2I9BE 1RGJA 1TXAA 2BHIA 2H5FA 5IMYC 5IMTD 1NXBA 1FF4A 2GOOC 1IDGA 3KFDE 2FD6U 3BT2U 2H64B 1VB0A 1DRSA 1M9ZA 2JVEA 1F94A 2LA1A 2PJYB 1KFHA 5DU1A 1FSSB 1CVOA 2VLWA 1CHVS 1ERAA 1HC9B 1FFJA 1CDTA 3U73U 1CDSA 2MJ0A 1IQ9A 2LCRA 2MJ4A 4XJJA 1ERGA 1L4WA 1HC9A 1CTXA 1PLOA 4EY8B 1CXNA 4BDTB 1JBDA 1NORA 4OM5A 3BT1U 1NYSA 1NEAA
chains in the Genus database with same CATH superfamily
2HLQA 2H62C 2K3GA 1W6BA 1YWHA 1MAHF 1REWC 1KC4A 1LSIA 2GOOB 1FSCA 2N99A 1JGKA 1IDIA 1ONJA 1UG4A 4FAOC 1NTXA 1HOYA 1TFSA 1BXPA 2CRSA 3NH7A 1CRFA 2UX2A 4OM4A 4KSNA 1KBAA 1CODA 1B41B 1G6MA 2QJBC 1QKDA 3KFDI 3EBXA 1KTZB 1KBSA 1QKEA 2CDXA 4IYEA 2L03A 2H64C 2OFSA 1KL8A 1CDRA 2QC1A 4UY2C 4FAOE 1NTNA 2MFAA 2UWRA 3VTSA 1KBTA 2CRTA 1IKCA 1LX5B 1KU6B 3EVSC 1FASA 1LXHA 3PLCA 4LFTA 1MR6A 2JQPA 4QTIU 1I02A 1S4YA 1LJZA 1ZADA 1JE9A 2QJ9C 3U74U 4DO8A 2H8UA 1ABTA 1CB9A 1IK8A 2H7ZB 3HH7A 1ES7B 2MUPA 4P7UA 1HAAA 1V6PA 5DO6A 2MJYA 3NDSA 1CCQA 2H7ZA 2BTXA 1RL5A 2H62D 1F8UB 2J8BA 1FRAA 1H0JA 4RUDA 1BTEA 1TGXA 1TXBA 1NYUA 1XT3A 2CTXA 2MUOA 5DZ5A 3QB4B 3FEVA 1COEA 4ZQYA 6EBXA 2PJYC 1HAJA 2NBTA 1IJCA 1CDQA 2L5SA 1KXIA 1IDLA 5EBXA 1LXGA 2QJAC 4BIKB 1IDHA 2X8BB 3LAQU 1CXOA 1KS6A 2HLRA 2MHYA 3ERAA 4AEAA 2CCXA 3NEQA 1QM7A 4HQPF 1CREA 2ABXA 2ERAA 2I9BE 1RGJA 1TXAA 2BHIA 2H5FA 5IMYC 5IMTD 1NXBA 1FF4A 2GOOC 1IDGA 3KFDE 2FD6U 3BT2U 2H64B 1VB0A 1DRSA 1M9ZA 2JVEA 1F94A 2LA1A 2PJYB 1KFHA 5DU1A 1FSSB 1CVOA 2VLWA 1CHVS 1ERAA 1HC9B 1FFJA 1CDTA 3U73U 1CDSA 2MJ0A 1IQ9A 2LCRA 2MJ4A 4XJJA 1ERGA 1L4WA 1HC9A 1CTXA 1PLOA 4EY8B 1CXNA 4BDTB 1JBDA 1NORA 4OM5A 3BT1U 1NYSA 1NEAA
chains in the Genus database with same CATH topology
2HLQA 2H62C 2K3GA 1W6BA 1YWHA 1MAHF 1REWC 1KC4A 1LSIA 2GOOB 1FSCA 2N99A 1JGKA 1IDIA 1ONJA 1UG4A 4FAOC 1NTXA 1HOYA 1TFSA 1BXPA 2CRSA 3NH7A 1CRFA 2UX2A 4OM4A 4KSNA 1KBAA 1CODA 1B41B 1G6MA 2QJBC 1QKDA 3KFDI 3EBXA 1KTZB 1KBSA 1QKEA 2CDXA 4IYEA 2L03A 2H64C 2OFSA 1KL8A 1CDRA 2QC1A 4UY2C 4FAOE 1NTNA 2MFAA 2UWRA 3VTSA 1KBTA 2CRTA 1IKCA 1LX5B 1KU6B 3EVSC 1FASA 1LXHA 3PLCA 4LFTA 1MR6A 2JQPA 4QTIU 1I02A 1S4YA 1LJZA 1ZADA 1JE9A 2QJ9C 3U74U 4DO8A 2H8UA 1ABTA 1CB9A 1IK8A 2H7ZB 3HH7A 1ES7B 2MUPA 4P7UA 1HAAA 1V6PA 5DO6A 2MJYA 3NDSA 1CCQA 2H7ZA 2BTXA 1RL5A 2H62D 1F8UB 2J8BA 1FRAA 1H0JA 4RUDA 1BTEA 1TGXA 1TXBA 1NYUA 1XT3A 2CTXA 2MUOA 5DZ5A 3QB4B 3FEVA 1COEA 4ZQYA 6EBXA 2PJYC 1HAJA 2NBTA 1IJCA 1CDQA 2L5SA 1KXIA 1IDLA 5EBXA 1LXGA 2QJAC 4BIKB 1IDHA 2X8BB 3LAQU 1CXOA 1KS6A 2HLRA 2MHYA 3ERAA 4AEAA 2CCXA 3NEQA 1QM7A 4HQPF 1CREA 2ABXA 2ERAA 2I9BE 1RGJA 1TXAA 2BHIA 2H5FA 5IMYC 5IMTD 1NXBA 1FF4A 2GOOC 1IDGA 3KFDE 2FD6U 3BT2U 2H64B 1VB0A 1DRSA 1M9ZA 2JVEA 1F94A 2LA1A 2PJYB 1KFHA 5DU1A 1FSSB 1CVOA 2VLWA 1CHVS 1ERAA 1HC9B 1FFJA 1CDTA 3U73U 1CDSA 2MJ0A 1IQ9A 2LCRA 2MJ4A 4XJJA 1ERGA 1L4WA 1HC9A 1CTXA 1PLOA 4EY8B 1CXNA 4BDTB 1JBDA 1NORA 4OM5A 3BT1U 1NYSA 1NEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLQ A;  2H62 C;  2K3G A;  1W6B A;  1YWH A;  1MAH F;  1REW C;  1KC4 A;  1LSI A;  2GOO B;  1FSC A;  2N99 A;  1JGK A;  1IDI A;  1ONJ A;  1UG4 A;  4FAO C;  1NTX A;  1HOY A;  1TFS A;  1BXP A;  2CRS A;  3NH7 A;  1CRF A;  2UX2 A;  4OM4 A;  1KBA A;  1COD A;  1B41 B;  1G6M A;  2QJB C;  1QKD A;  3KFD I;  3EBX A;  1KTZ B;  1KBS A;  1QKE A;  2CDX A;  4IYE A;  2L03 A;  2H64 C;  2OFS A;  1KL8 A;  1CDR A;  2QC1 A;  4UY2 C;  4FAO E;  1NTN A;  2MFA A;  2UWR A;  3VTS A;  1KBT A;  2CRT A;  1IKC A;  1LX5 B;  1KU6 B;  3EVS C;  1FAS A;  1LXH A;  3PLC A;  4LFT A;  1MR6 A;  2JQP A;  4QTI U;  1I02 A;  1S4Y A;  1LJZ A;  1ZAD A;  1JE9 A;  2QJ9 C;  3U74 U;  4DO8 A;  2H8U A;  1ABT A;  1CB9 A;  1IK8 A;  2H7Z B;  3HH7 A;  1ES7 B;  2MUP A;  4P7U A;  1HAA A;  1V6P A;  5DO6 A;  2MJY A;  3NDS A;  1CCQ A;  2H7Z A;  2BTX A;  1RL5 A;  2H62 D;  1F8U B;  2J8B A;  1FRA A;  1H0J A;  4RUD A;  1BTE A;  1TGX A;  1TXB A;  1NYU A;  1XT3 A;  2CTX A;  2MUO A;  5DZ5 A;  3QB4 B;  3FEV A;  1COE A;  4ZQY A;  6EBX A;  2PJY C;  1HAJ A;  2NBT A;  1IJC A;  1CDQ A;  2L5S A;  1KXI A;  1IDL A;  5EBX A;  1LXG A;  2QJA C;  4BIK B;  1IDH A;  2X8B B;  3LAQ U;  1CXO A;  1KS6 A;  2HLR A;  2MHY A;  3ERA A;  4AEA A;  2CCX A;  3NEQ A;  1QM7 A;  4HQP F;  1CRE A;  2ABX A;  2ERA A;  2I9B E;  1RGJ A;  1TXA A;  2BHI A;  2H5F A;  5IMY C;  5IMT D;  1NXB A;  1FF4 A;  2GOO C;  1IDG A;  3KFD E;  2FD6 U;  3BT2 U;  2H64 B;  1VB0 A;  1DRS A;  1M9Z A;  2JVE A;  1F94 A;  2LA1 A;  2PJY B;  1KFH A;  5DU1 A;  1FSS B;  1CVO A;  2VLW A;  1CHV S;  1ERA A;  1HC9 B;  1FFJ A;  1CDT A;  3U73 U;  1CDS A;  2MJ0 A;  1IQ9 A;  2LCR A;  2MJ4 A;  4XJJ A;  1ERG A;  1L4W A;  1HC9 A;  1CTX A;  1PLO A;  4EY8 B;  1CXN A;  4BDT B;  1JBD A;  1NOR A;  4OM5 A;  3BT1 U;  1NYS A;  1NEA A; 
#chains in the Genus database with same CATH topology
 2HLQ A;  2H62 C;  2K3G A;  1W6B A;  1YWH A;  1MAH F;  1REW C;  1KC4 A;  1LSI A;  2GOO B;  1FSC A;  2N99 A;  1JGK A;  1IDI A;  1ONJ A;  1UG4 A;  4FAO C;  1NTX A;  1HOY A;  1TFS A;  1BXP A;  2CRS A;  3NH7 A;  1CRF A;  2UX2 A;  4OM4 A;  4KSN A;  1KBA A;  1COD A;  1B41 B;  1G6M A;  2QJB C;  1QKD A;  3KFD I;  3EBX A;  1KTZ B;  1KBS A;  1QKE A;  2CDX A;  4IYE A;  2L03 A;  2H64 C;  2OFS A;  1KL8 A;  1CDR A;  2QC1 A;  4UY2 C;  4FAO E;  1NTN A;  2MFA A;  2UWR A;  3VTS A;  1KBT A;  2CRT A;  1IKC A;  1LX5 B;  1KU6 B;  3EVS C;  1FAS A;  1LXH A;  3PLC A;  4LFT A;  1MR6 A;  2JQP A;  4QTI U;  1I02 A;  1S4Y A;  1LJZ A;  1ZAD A;  1JE9 A;  2QJ9 C;  3U74 U;  4DO8 A;  2H8U A;  1ABT A;  1CB9 A;  1IK8 A;  2H7Z B;  3HH7 A;  1ES7 B;  2MUP A;  4P7U A;  1HAA A;  1V6P A;  5DO6 A;  2MJY A;  3NDS A;  1CCQ A;  2H7Z A;  2BTX A;  1RL5 A;  2H62 D;  1F8U B;  2J8B A;  1FRA A;  1H0J A;  4RUD A;  1BTE A;  1TGX A;  1TXB A;  1NYU A;  1XT3 A;  2CTX A;  2MUO A;  5DZ5 A;  3QB4 B;  3FEV A;  1COE A;  4ZQY A;  6EBX A;  2PJY C;  1HAJ A;  2NBT A;  1IJC A;  1CDQ A;  2L5S A;  1KXI A;  1IDL A;  5EBX A;  1LXG A;  2QJA C;  4BIK B;  1IDH A;  2X8B B;  3LAQ U;  1CXO A;  1KS6 A;  2HLR A;  2MHY A;  3ERA A;  4AEA A;  2CCX A;  3NEQ A;  1QM7 A;  4HQP F;  1CRE A;  2ABX A;  2ERA A;  2I9B E;  1RGJ A;  1TXA A;  2BHI A;  2H5F A;  5IMY C;  5IMT D;  1NXB A;  1FF4 A;  2GOO C;  1IDG A;  3KFD E;  2FD6 U;  3BT2 U;  2H64 B;  1VB0 A;  1DRS A;  1M9Z A;  2JVE A;  1F94 A;  2LA1 A;  2PJY B;  1KFH A;  5DU1 A;  1FSS B;  1CVO A;  2VLW A;  1CHV S;  1ERA A;  1HC9 B;  1FFJ A;  1CDT A;  3U73 U;  1CDS A;  2MJ0 A;  1IQ9 A;  2LCR A;  2MJ4 A;  4XJJ A;  1ERG A;  1L4W A;  1HC9 A;  1CTX A;  1PLO A;  4EY8 B;  1CXN A;  4BDT B;  1JBD A;  1NOR A;  4OM5 A;  3BT1 U;  1NYS A;  1NEA A; 
#chains in the Genus database with same CATH homology
 2HLQ A;  2H62 C;  2K3G A;  1W6B A;  1YWH A;  1MAH F;  1REW C;  1KC4 A;  1LSI A;  2GOO B;  1FSC A;  2N99 A;  1JGK A;  1IDI A;  1ONJ A;  1UG4 A;  4FAO C;  1NTX A;  1HOY A;  1TFS A;  1BXP A;  2CRS A;  3NH7 A;  1CRF A;  2UX2 A;  4OM4 A;  4KSN A;  1KBA A;  1COD A;  1B41 B;  1G6M A;  2QJB C;  1QKD A;  3KFD I;  3EBX A;  1KTZ B;  1KBS A;  1QKE A;  2CDX A;  4IYE A;  2L03 A;  2H64 C;  2OFS A;  1KL8 A;  1CDR A;  2QC1 A;  4UY2 C;  4FAO E;  1NTN A;  2MFA A;  2UWR A;  3VTS A;  1KBT A;  2CRT A;  1IKC A;  1LX5 B;  1KU6 B;  3EVS C;  1FAS A;  1LXH A;  3PLC A;  4LFT A;  1MR6 A;  2JQP A;  4QTI U;  1I02 A;  1S4Y A;  1LJZ A;  1ZAD A;  1JE9 A;  2QJ9 C;  3U74 U;  4DO8 A;  2H8U A;  1ABT A;  1CB9 A;  1IK8 A;  2H7Z B;  3HH7 A;  1ES7 B;  2MUP A;  4P7U A;  1HAA A;  1V6P A;  5DO6 A;  2MJY A;  3NDS A;  1CCQ A;  2H7Z A;  2BTX A;  1RL5 A;  2H62 D;  1F8U B;  2J8B A;  1FRA A;  1H0J A;  4RUD A;  1BTE A;  1TGX A;  1TXB A;  1NYU A;  1XT3 A;  2CTX A;  2MUO A;  5DZ5 A;  3QB4 B;  3FEV A;  1COE A;  4ZQY A;  6EBX A;  2PJY C;  1HAJ A;  2NBT A;  1IJC A;  1CDQ A;  2L5S A;  1KXI A;  1IDL A;  5EBX A;  1LXG A;  2QJA C;  4BIK B;  1IDH A;  2X8B B;  3LAQ U;  1CXO A;  1KS6 A;  2HLR A;  2MHY A;  3ERA A;  4AEA A;  2CCX A;  3NEQ A;  1QM7 A;  4HQP F;  1CRE A;  2ABX A;  2ERA A;  2I9B E;  1RGJ A;  1TXA A;  2BHI A;  2H5F A;  5IMY C;  5IMT D;  1NXB A;  1FF4 A;  2GOO C;  1IDG A;  3KFD E;  2FD6 U;  3BT2 U;  2H64 B;  1VB0 A;  1DRS A;  1M9Z A;  2JVE A;  1F94 A;  2LA1 A;  2PJY B;  1KFH A;  5DU1 A;  1FSS B;  1CVO A;  2VLW A;  1CHV S;  1ERA A;  1HC9 B;  1FFJ A;  1CDT A;  3U73 U;  1CDS A;  2MJ0 A;  1IQ9 A;  2LCR A;  2MJ4 A;  4XJJ A;  1ERG A;  1L4W A;  1HC9 A;  1CTX A;  1PLO A;  4EY8 B;  1CXN A;  4BDT B;  1JBD A;  1NOR A;  4OM5 A;  3BT1 U;  1NYS A;  1NEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...