3NDZE

The structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'SAVEVTYAITNSWGSGASVNVTIKNNGTTPINGWTLKWTMPINQTITNMWSASFVASGTTLSVTNAGYNGTIAANGGTQSFGFNINYSGVLSKPTGFTVNGTECTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoglucanase D
publication title The structure of the catalytic and carbohydrate binding domain of endoglucanase D bound to cellotriose
rcsb
source organism Clostridium cellulovorans
molecule tags Hydrolase
total genus 21
structure length 107
sequence length 107
chains with identical sequence F, G, H
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ndzE00
1EXGA 1E5BA 5DHEA 3NDZE 2CWRA 1QBBA 2RTTA 1EXHA 1HEJC 1XBDA 2CZNA 1C7SA 2XBDA 1C7TA 5DHDA 1QBAA 1E5CA 3NDYE 1HEHC
chains in the Genus database with same CATH superfamily
2DIJA 3OKMB 2C4XA 4F91B 3VXMA 4U0QB 1NJ9B 2B39A 2HKHL 2NNAB 4HJGB 1HZHH 2FZ3A 1NGYA 3QR1A 3G6JE 5AVSB 4E68A 4KHTL 1T4KA 2E9BA 2VN6A 1Q1JL 3MDJA 4NUGL 5CIPB 4AUUA 5EOTB 4JY5L 1ZT1B 3KWWA 1X7SA 2A9AA 3JV6B 4Y8DC 2J1XA 4ETYA 1I9RH 3JTTA 5HGDB 1UQSB 1NUDA 2W0KA 4JAMA 3KLKA 3CLFL 1H6UA 2P5PA 4POUB 3ME0B 1LP9F 1KTLA 2AJ3A 5HYFA 4L8CB 5F0JB 3D0LA 5BZWA 2XKSA 1PQZB 1MNUH 2R2CA 3WEXB 1BXXA 3QWRD 5FA3B 1VEOA 3HAEG 1S46A 3V52H 3GIZL 2QMJA 2IH9A 2D4DA 3ZHNA 3H4FA 3A24A 4JRLA 2CPCA 1ONQB 5GHWH 3BE1L 4P23C 2ZUUA 2EYSB 2FD6L 5FF6A 4D9RD 3ARGC 4UILH 2VJ0A 3QYNA 1E2VA 2SEBB 1T3FB 3NK4A 3GUTB 4WW1A 4OZ4A 1JK9B 3UDWC 3QI9A 3LAFA 3EDFA 4H5SA 1RQ5A 4JRYD 3TH3T 5ENWA 5FA4B 2WXNA 2G75B 2VC2L 5M94B 2Q20A 2OR8A 3CSYB 1CF8H 4GBXC 5C0BE 5B3JE 3RHWK 1AACA 1L9TA 4KRMB 5FK9B 2FWOA 5E8NA 1SOKA 5HDOA 2O26U 3MRFB 3CZEA 4LBAA 4PW4A 1S3RA 5IW6A 4UB0H 2ITCB 1F18A 4JDEA 4NPYB 2K8QA 4DEPC 1A2YA 4OLWL 2EIEA 1KGWA 3UJJL 4JPQA 1V27A 4QIRA 4F58H 5E08H 4L3CB 1DDHA 2B3RA 4NSKB 1QASA 3CFCL 2NY3D 3RIAK 4I48B 5F3HA 3QRGH 4NLAA 4TTDD 1K6QL 2FR4B 4FABL 2FX9L 3JT0A 2WO4A 2ZAGA 4JFYA 4CL7A 3GBNH 4I77L 1I3GL 1OP9A 5D1ZD 5D4QA 5GJTL 3GSOB 4LQFH 2WHVA 4CVXA 1NAKL 2YUZA 3GKZA 2AV7A 1T89C 1PZ5B 1G7PB 2BHUA 4MX7A 3S35H 5HHPB 2GSMB 4X80L 4DZ8A 2O1AA 2AITA 3GO1H 1INEL 1E5UI 5F7LB 1NOFA 2X4PB 4UIMA 1NIDA 3T0EB 1KIPA 3QZMA 1WO2A 2BNUB 4LU5L 3KLHD 2ADGB 2XBZA 1E3FA 2Q8BL 4FLOA 4P8QA 1W16A 3BVNA 2WAHA 1WEJH 3CFEB 4U1LB 2BINA 5IVXB 1SZNA 4OLZH 4PAZA 3VA2C 4PRNA 4A2MA 1R5IB 2AEQL 4GW4A 3C5JB 3HBZA 4WZ9A 4RIRA 3MOAH 1JNHB 1HHIB 4PJIE 3SKJL 5EO1A 4MCNA 5GS1B 1ZANL 3CZJA 4EIGB 3W56A 3NVQA 2APBA 2BO0A 1HJBC 1G1CA 3BPOB 4HLEA 5FV2A 3U9UA 1D5RA 5MERB 4M7ZC 4PJGA 5F6HI 2BFGA 5DQ9B 5LAXA 4OD3L 4PV9A 4CJ1A 3F04A 1A7QH 1T21B 2CK0L 3K1DA 4L4VB 3ESMA 3DIVA 3WD5H 1VEPA 5INCA 1EGJH 4AGLA 1FNGA 4PWFA 2BSRB 4RGOL 4CGUB 4Q89A 4U1GC 1BVZA 4AMXA 4RRPA 1MCWW 2MQCA 2XFXB 5E9AA 1SY6L 2K4AA 5E4EC 5C0CD 4YNYA 2UWEF 3MJ9L 4XOEA 3KPOA 2UY6B 2VLKE 3HUJF 5K9QI 1YC8A 1EO8L 3POCA 3CHOA 3U4KA 3KPLA 2VKXA 2V7NB 2YWZA 1DZ0A 1KCUH 3WMSA 2ODHA 3N1MC 5IQNA 5EZJB 3UMTA 2Z91B 5ERWA 3QJHA 4HEPG 1M7DA 3M8OH 4YXHH 4Y88A 1BJ1H 1BF2A 1Z0NA 4LSVL 4M5YL 1PGRB 3SQBA 2WVVB 2D7NA 5J4MA 5L4MA 2HRGA 3DGGA 3DK0A 4Z7WE 1K85A 3VGBA 3T1FB 5GS0C 1OALA 2ZUQB 1EFQA 2CMRH 3CHSA 3BEVA 1T0NB 2F7RA 1ZE3H 3NIDF 4PUBH 2FIKB 2Q9OA 1L7TL 3GWJA 3S0PA 3A4DA 3ZT7A 1U8QB 1IM3A 4IJ3C 3VD0A 1XMEB 5ABAA 1A3RL 4PJBB 3D0AA 3DI2B 5DTFA 3I50H 3PWUB 1ZVSB 2XKUA 3BP5A 4J3OC 1R3JA 5IMLA 4WUUB 4S2SB 4FTVB 1AQDB 3TCLB 1MCHA 2X9ZA 5TK2A 2DIBA 3MJ7A 4W9EC 1XZ0B 2ADFH 2Z65C 3VFPA 2PO6D 1KGUA 2M1KA 4PG9A 2JCCE 3ZGHA 3HC3H 4N20A 4U7KA 5IK3B 1M1XA 2DRUA 1AGCB 1E8YA 3JUYA 4HVBA 2BVYA 2HRPH 3B2PA 4HWBH 3SE3A 5CO1A 1KN4L 3QJUB 4J6IA 5IESL 2N3JA 1UG9A 4OCNC 4GRWE 3DTXB 3SBPA 5C09D 5J0BA 1P1VA 1KLGB 3BUPA 4KDTA 4HH9A 4YX2H 2AANA 1BXVA 3BPNB 4OAWB 5KWYC 2P42B 2ZOKB 4I5BB 3LH9A 3Q43A 4NZFA 5KSUB 1JRHH 4MVBC 1FZKB 5EU6D 4G8GB 3U36A 5JXAH 2IQ9L 4POZC 3QEUB 3BT2H 1Z0MA 4MB1A 4XBGB 3JWDH 3DPBA 3X17A 4L18A 5H2BB 1L9OA 3TIDB 1G6RL 2OTUB 1VFBA 3GMNB 3PHAA 4BJLA 3BQUC 2FJFA 5SV3A 5GGVL 4N3TA 1NIFA 1WIUA 4R7VA 3BUTA 1MJJA 4I0PA 3QBTB 2W95A 2CO6A 4AM0A 4PJ7B 5HDLA 4WW2B 3WYRA 3UTZA 3NJKA 5DVLA 5KJ4A 3KXFA 3ZL1A 3CWGA 4G5ZH 1A7NL 3BI9X 5JIHA 1WCBB 2RFXA 1KFAL 2V17L 1LDSA 1JZGA 3IDIB 4XMLH 3GMOB 4PJHF 2WXFA 4LCCA 3MNWA 3AGVA 1BF5A 1HCVA 2I69A 2CWRA 2GB2A 3G9AB 1LHZA 3FTVA 5JW4R 4A38A 1BZEA 4WFGE 3EXLA 2D31A 2Y2YA 1DJWA 4G8FA 1BQ5A 4HQQH 4M00A 4JGMA 3WJJC 3AT8A 1XBRA 4Y9FA 5HHOD 5I17A 1HCZA 5B22A 1HU8A 4U7MA 2XWBA 1DYZA 1O75A 1WAAA 2YXMA 4YMPA 2A9NL 5CCKH 1BDYA 1FBIH 2KQMA 3MRLB 4ZSOB 1F45A 4F7CA 1NLBH 1TJIH 5C3TA 4NKQB 1A1OB 4DN3L 6FABH 3TGXA 2C26A 3NZ8A 2W9EL 3GSNB 3FFCE 1QEWA 1BFVL 1G4MA 2AZAA 5DD6A 5IMOA 4KX7A 1GPOH 2WKLA 3EJYC 2ICWJ 3TV8A 2APXA 4N9GB 2P5WE 2DI8A 4K8RC 2AQ2A 1QRND 5KVFE 1GZQA 2VXQA 3JZYA 3QUMA 5CWSB 5IW3A 1IC0A 2XHNA 3EJUA 2ZSWB 1B9KA 3QEQA 5GRYA 4YBQC 3ZTNL 1DQDL 3NSDA 1J86A 4D8PB 1A6PA 2XN2A 3G3LA 5B8CC 1X5AA 4K23L 2OQJA 1UHVA 2YN3A 1B0RB 4EKXA 2GIMA 4H0GA 3ECVA 3AXLB 1UA3A 4HIPA 4JZJB 5D71L 4Z95L 5EZPA 5LG1A 4JFSA 2AAAA 4UAHA 1OP5H 3IMUA 3IJEB 4NNYA 3LRMA 4BK5A 3GZPA 1FG2A 2ORBL 5HVWA 2FT6A 4L1TA 3CBRA 1ED3A 3A0OA 4D0CB 4LNVA 1H8SA 1LP9A 2XDHA 1C7TA 2BP5M 4FNLH 1RIUH 2ATPB 5GGQH 4AYSA 1FVCA 3TBVA 3AG4B 3LS5H 1MFAL 5ISZE 2M2DA 1HHJB 2J4WL 2QBWA 3B8SA 3QH3B 3BFOA 5FKAB 3UTSB 2X2IA 3QT2A 1LEGB 3I9IA 4QHKI 1DJHA 4OR1A 1COBA 2XN9A 3VI3F 4WTQA 2ZOLB 3SYCA 4LVNB 3ULUH 2YGNA 1JERA 1TDQA 5HHNB 2WYZA 2WQWA 4ZI8A 4Y9BA 3D2UD 1KGXA 4HIEB 3RWJA 3QIBD 4RGNC 1MH5B 1AP2A 2BW4A 2HG5B 1CE1H 3KPRD 3VI4B 2O6PA 4I3RL 3ARBD 3AY2A 1GS6X 4F92B 1K8IB 2HT3C 2YPLD 4XMKH 4U1HB 1TENA 1C5CH 3L5WA 4BQ8A 3HNSL 5KVDH 3PNWB 15C8H 4F3FA 5E1GA 4XNXH 3ZE0B 2QEJA 1A4JA 4AEFA 3SJVB 3L9BA 2AKRA 2X70B 5A16B 3PG2A 3C87A 2A74C 2VQUA 2ZYHA 2WLZA 1NFKA 1F13A 1BVLA 1E43A 2K6YA 4WWKB 5G4MA 3GMLA 2CU9A 3NH7H 2Z3FA 4D9LL 2VN7A 3QNFA 4U31A 3ZTCC 2MNWA 4U1IA 1J5CA 1OK8A 1MIMH 1NFIB 2NLJB 3DC0A 4PCKA 1CGSL 5D2LE 5JIDA 3SPVA 3V6FB 4GJTB 1TQUA 2EO9A 2OSLA 4ZUWB 1FC1A 1GY2A 3T4AB 2GITB 4N8PA 3HW7A 2X87A 3NFSL 1J7VR 1UZ6E 1B0WA 4OU3A 4XOCA 4QRUA 1T20A 1EUTA 4A2EA 4YDVA 4KXZI 5GGRA 2EKSB 3GYRA 1N5AA 4OZGB 4XGZA 4Y2DB 1EFXA 3R4RA 4X99B 3SBQA 3D3VA 4HOXA 4L9LB 3PWNA 4FTDA 3VFOB 2Y36L 3SPJA 1EZVX 4JHZA 4PW3A 1UJTA 4MLIA 1YC7A 1XSJA 4PJEB 3WFDL 1AC0A 4LVHB 1QUPA 1NCAL 5C0ND 5E8EA 4TL5A 3VQMA 3J2PA 3NDYE 1GYUA 2RACA 3LNGA 3FONA 1L0YA 2RR3A 5ECJE 5MEPB 3TZVB 3WELA 2LTQC 3V7AG 4K7PY 1QLRA 5JIIA 3IVKB 4WV1B 4LMQE 2Q7YA 5SX5K 1U4FA 1W72H 3PGFH 4WI6A 3Q8FA 4KU1A 4AITA 2PABA 2DOCA 1D5ZA 4WKZB 5E9NA 4YEFA 1AQHA 2BIQA 1GGUA 4IBVA 1L5GB 1Q0YH 1OY3B 4HFUL 4M7LL 3VG9B 5T33H 4NCDA 3O0RL 4OZHB 4V11A 4W9GC 4CMMB 1OL0A 2VLMD 5LGJB 4DKFL 4KK8D 4R90H 4GAFB 4KQ4H 3MLVL 3SYAA 5EC1A 5J06A 5JMOC 2B9AA 1MXGA 3N40P 1KJ3H 1UB6B 4PRAA 1BFOB 2KZ1B 3KL0A 4LOUD 1T7WA 5I24A 1CB4A 1EJ6A 5A43C 1TETH 4HBCH 2YAOA 4Z7VF 4M8QB 4R7XA 5GZNC 1YDPB 2R8SH 3BLBA 5FO8B 1FRGL 2XZQH 4M5ZH 4ZPTB 2ENJA 2ID5A 2JI2A 3FQXA 2A6KB 1KUMA 1KBPA 3UCRA 3ULUD 4WTZA 4JO4L 4TNVK 3WS6C 1CGTA 4WCYH 1CF1A 5DUML 3UZVA 2UWEA 4PEEA 5FUCE 1Z3GH 4L8SB 3RVXC 2ADIA 4O00A 1X5YA 5I66A 5IB2A 1RH8A 4KI1A 3KYMB 1NCTA 3HUJA 2IAAC 1LEKB 3ZZQA 4YEEA 2DM2A 2ZNXA 3FUIA 2AXFA 2EH8H 4XCYB 3L5XH 2VTFA 4FKHA 4I2XE 4GS7C 5KAQF 2EAEA 3UYRH 4HUWB 4CVZB 4PB9L 4KZDH 4NRXA 2ZWYA 4ZFZB 3ELQA 3LQAC 1QHPA 2FLBT 4RCAA 3H7BA 5IHUH 3GEFA 2K1MA 2MHAA 4NOBA 1WLHA 4N0FA 4WU7A 1TTRA 1F11B 5KBPA 4UOQA 1Z7JA 1KBWA 4MD4B 5F21B 5I8OL 4MHHG 3ZJAA 4ENED 4KRPD 4XCNB 1M7IA 1XH3B 2YFOA 4HIIA 1IGYB 3KLAA 2EDHA 1YJDC 4KVNL 4BQ9A 2OMBA 1CD8A 3S6CA 2WUCH 3OV6A 4I18B 3JV4A 2J6EA 1SYVB 4GXVH 2D3VA 2ZONA 3L8QA 4U6VH 5IBLD 4QCIA 2HAZA 1NBQA 5EUKA 4HIJA 5IREA 1U8CB 1FFOA 1IGFH 1FYTE 3IFLH 1KTCA 2X89A 4FKEA 4NZTL 1NIBA 3N42B 1BAFL 1KXTA 4NQCA 4OQTA 5DMKA 4J6RH 3VFSB 3GSUB 2XG4B 5AW7B 4AJ0A 4H8QA 5FCUL 1XL6A 1RK0A 3AY4A 4AMWA 3QP3A 3OAYK 1X4YA 4NKIH 1WK0A 5JZ7C 1BEYH 1MAMH 3TTYA 3C60A 4PP1D 1SJEA 3N41B 4FQLH 1T4WA 5LWYH 2CR0A 4MMYA 2VITB 4A39A 4AQ8A 4DIXA 3BVVA 2WXPA 4I9WD 2WBJD 4HISA 5G5DA 4A67A 5A7EA 3HFFA 4ZMPA 4JR9H 1SJMA 1HL4A 1BJ1J 5EDSA 2A6JB 5MHSE 1BV8A 2XICA 3NA9L 2HMID 2FJSA 3SD2A 2FO1A 2O61A 4LSTH 2VL5A 2HJFB 3LPOA 5D93C 5JUEL 2EDWA 3EBIA 1G9MC 1NMCB 1TTFA 3D52A 3EO9H 3ZDYF 2BVQB 1GGBH 2NY0B 1SRDA 3EJZC 3JWOC 5KVFL 5D7JA 4I3SH 5FO7A 2VXQH 3S8WA 3QUMH 3IAPA 3MJWA 2JI1A 4QLRA 1QA9A 4RFNB 3QFJB 5IHHA 4G43B 1WWBX 1LD9B 1SOQA 8FABB 3K5RA 2JKTM 4MJHA 5I1JL 4PJHA 3U4EA 4UQCA 3Q8EA 1OAQL 3TO4C 3U4AA 4GXFA 4JFPA 5C0RH 1KGIA 3CXDL 4HZLB 4LCYB 1KCSL 1EMTH 4FLHA 5F71A 3HE6A 2AC0A 2XVLA 5D1ZB 3WY2A 4XXWC 3VW3L 2E74C 5AVVB 2VDMB 1EA9C 2I9TB 3OKKA 3MLRL 2X9XA 1UC6A 3M45A 3U1QA 3SY0B 1IFHH 2IAMC 1AQKL 1I31A 4JFFE 4K2UH 3WIFA 2NQDA 2YOCA 1KYAA 5JPNA 4N2CA 4P99A 2CO1A 1CDBA 2IH3B 1HSBB 3BXNB 4L1DA 1I53A 1EZVY 2VN5A 4G3YH 2KH2B 4O4YL 2NDFA 4JFEA 2KL6A 3NZSA 4XP5H 3EFDL 2J5WA 3B6SB 5K33A 1OTSC 2MIZA 4NM8H 3UH8A 3RWHB 2D7OA 4CC4A 4RRPG 4UT7L 1S7QA 3VFNB 4XN8A 3WHE1 4LLAA 4LLMA 4GQQA 3RURA 3KCPA 1I3VA 2WBXA 3FFDA 3SDCC 3VYNA 3QR0A 5IJCC 4JPVL 1MCNA 4IS6B 1FF5A 5EZIL 3EGSA 5T1LA 1E50A 3T6XA 5DMYA 3KXFD 1I4FA 4MJIA 4TVUA 1NMAH 4M43H 1X6LA 3QDGB 2X6MA 4AENA 1RSYA 4H8WC 2DEYX 1BQRA 5T3XE 4ODUB 4E41E 4YOKA 2ZAIA 4MKMA 3MYZA 2ZT9C 4WY7H 4XVSH 3RVVC 1KIRA 2ZWZA 5E8OB 5KBMA 1DSFH 2H26B 2Y06H 4MCZB 1BM3L 2JXMB 3OSKA 2J2ZA 3ZKMD 1DVFA 1N3NA 1P53A 1UFGA 2P8MB 3HC0B 4QHUA 4LGPB 4UUJA 5EZOH 1AIFA 1C12A 3BVTA 1I9JH 3EYVA 2Z6FA 4J3VA 5GRVL 1N0XH 5EORL 3H9SD 3VWJB 3VI3A 5K59F 2F2HA 1A6VL 4E5XB 3MRJB 1XF5B 5I6PA 4JHAH 4NDMB 4NFDA 2FYYA 3HMWL 2R29H 3AU1A 3T9WA 1UURA 3QZWG 4XAWL 3UBXI 3MOBH 3OLIA 1RLBA 4JO3L 2Z7UA 4Y19D 1GC1C 4ELME 3WN6A 1JUFA 3DARA 1OAKH 3FT4A 1RZJL 2IVFC 2YIHA 4PCSA 3CZGA 4ANXA 1HH9A 3DXAE 3DECA 3QEQD 3V6ZB 1XHHA 4LSUH 4OCSL 1RULH 3KJ4B 3RTLA 2CRMA 3OAUL 2VN3A 3HHSA 2A5UA 1YY9D 4MXWL 1CK0L 3HG3A 5FGBC 4JMNA 1JJUA 5EU3B 5GISH 3P4OA 1USQA 4M61B 3OC8A 5E6UB 4GG8A 1QYGH 2PO6B 3I02A 3MA9L 4ZX5A 3UO1H 2W9LA 5TDOB 2J3SA 5IJDC 5E4OA 3ZHKA 2BOLA 2BSSA 1QVOA 3MGAA 4MCYB 4K5MA 4NPKA 5E6SB 2COVD 3MJGX 3O6LL 4PRHA 1PAZA 2E47A 4KMTH 3S96A 2A83B 3WI9A 3MX0B 4WAFA 5C09B 4MNGA 4CMHB 5A2JH 2NY5L 4KAQH 1WA1X 1HYSC 2Y4SA 1U92B 4FXLA 3HLKA 5IGXL 2VLLB 1DVUA 1PG7X 1RHHB 2LV4A 2VDRL 3SKMA 1J0ZA 4UTAA 1EXUB 1OWWA 3CMGA 2XN9D 4DEUA 2CO7B 2GTQA 4I85A 5I6XC 1L0XA 4BKLA 2CLZB 1PX8A 3BPCB 1WV7T 4OGXH 4ODWB 1SMDA 2YAHA 4GRLC 4JREC 4OI8A 1UD8A 4ZOCA 3VTTA 3AREA 5K1VA 4Z7UE 5AG9A 5FYLH 3QHFL 2FL5B 2AMUA 4NJ9L 5DUJA 4L4TE 4NQSA 4J3OG 1OGTA 3X3FH 4U6YA 3X1EA 3DK2A 2VNCA 1BXAA 2IANE 2C3VB 1CTNA 3S34H 3Q6FB 4HC1L 3RY5A 2QKSA 1AC6A 4AL8C 4HOMA 3QUXA 1AS8A 5F7NC 3SDYH 1XGZA 3VDCA 4DOHE 4IIQA 4QRRB 4C57C 5E2TL 4GUPB 2OXHB 1CICA 4ISVA 4E9QA 4MA1C 5F8RC 2ZKXA 2R1YB 4X5PA 4ZBJA 4RWYL 4QRBA 4QRPB 4HX1A 4CC0A 3RVWD 5T1JA 4ZMWA 3MRIB 3K6DA 2XC8A 3ATAA 4PG2C 2J25A 4QRQA 1RFDL 2EIJB 3MGTA 1D5BA 5HHOB 1ZGLP 1U42A 1HQ4B 4AEHL 5GQBA 1U6AH 2J6EH 2EVIA 3PL6D 4XZUB 2R1XA 1PG7W 2A2QT 4JN1H 4R7NB 2BSCA 3NIFF 3BO8B 4BFIA 4EEEA 3BN9D 4YHKL 1FO0L 4CVUA 3CSGA 3RIFK 4RMWA 1EFXD 4OQTH 2EDNA 3U4BH 1F4YH 1CR9L 3LIZL 5EF3A 5DRXB 5EZLA 2X42A 3FUFA 1JXDA 2ADJA 3MNDA 3V95A 2GJJA 4R4ND 5K5YA 1ZHBB 1BOGA 2IWGA 2VIRA 4K9EC 1N2RB 2IALB 3IJ7A 4UZSA 5CLWA 5L4IA 2F74B 3KLLA 2F1BA 1SM3H 5C0DA 1HEZA 2R0LH 3P11H 2H2SC 4XT1C 5BVJA 1C1EH 5I73B 2IDSA 4GIAA 4PU2A 2OMNA 3QDMB 4IRJB 1NC2A 4YUEL 3C8DA 3DVNB 4Z8FH 4WFED 3CVHB 3UTTA 1RZ8A 1IC5H 2OM5A 4GFTB 1D7DA 3RGVB 3GMPA 3CC5A 3RJOA 3S5YA 2XWZA 4F2EA 1V3JA 3VACA 3APDA 4LKXB 1NINA 4JY4A 4OGAC 1PX3A 4NNXB 1WSST 4KKLD 2XXGA 1CFQA 2N0MA 3DGDA 4BSWB 2GK2A 2YARA 2WUBH 5LDSA 4M6ML 2VDPB 1ZKAA 2P4AB 1QSED 3EFOB 5LBSA 5JNYB 4F2MA 1PAMA 2IJ0C 1DL7H 2RD0A 4JFWA 4LF3A 3JSSA 1KJ2B 5FUZL 3LVEA 4PR5A 2WWMC 4H13C 4CNIA 1MLBB 4Q14A 5J13C 3MYJB 1DR9A 2PPDA 3VXQA 3D2UB 1KLUB 2F1EA 3DURA 4LSSH 5F7FA 5FYLD 4YDLB 2KC0A 3QJQB 2DM3A 3HZVB 2DEWX 2ZPKL 1J9QA 3KPRB 3BIKA 3ZVVA 4FXGB 2GSIB 1WUZA 2MSPA 1KXHA 4WK0B 1J8HA 3S3JA 3C6LD 4L4VE 3IKCB 4TN9A 4HUKB 4MWFB 3CSTA 4GEIA 3WL9A 2HX7A 2DQ6A 4JFOA 1BJ8A 2D0GA 1F02I 4WO4D 3GMQA 4P2AA 3VRJA 2X4QA 3LPGA 3IU3A 3MU3A 1I3RB 1MDTA 1EVUA 1UXWB 2ALWA 4LPWA 4RNRA 2CKBB 4Y4HA 3LEXA 4FFZA 1L0QA 1NC4D 5DQJB 2IBBA 2P9RA 2X4RA 2X09A 1G7HA 4ZD3H 1EAOA 3BKCL 3POHA 3QEGH 4WHTB 4TSCL 1G7LA 3T0EC 2EDQA 3BVWA 4YDJB 5LNEA 4JANA 1MFBH 1DQQA 5J1TC 4TOYL 1TPXB 2X89D 4JZNA 3QZLA 2ODIA 1AZVA 4TLKA 1FGNH 1U30A 3O3AA 4WK4B 4NQCD 2HN7A 3T6QC 5T3XL 1AE6L 4HHAB 3O4LD 4RFOH 3PJSB 2WB7A 3M07A 3QA3B 2O5XH 4OFQA 1MCEA 5F89B 4KI5D 3TEUA 4UU9A 2Q8AL 2FO4A 4JLRB 1A4KB 1EPFA 1Q0XH 2AQRA 2B3IA 2OMYA 4OGQC 4XO5A 3QULA 1SXBA 3IDNB 4Z76B 4WTZG 1ZLUH 1FFNB 2EIBA 3QO0A 3OF6A 3VH8B 3F5WB 3C8KB 1RZIA 5IJVA 4ZXBA 3F2LA 3ZK0A 3H3PL 5IR1A 1KENL 3MCKA 5KN5B 2BCKA 3F12A 1MI5E 3RVUC 3T3ME 5DT1L 2D7QA 3RPIA 3LKOA 4JQIA 3CN0A 4EMZA 4C56D 2GEEA 1NGZA 3UAJA 4IU3B 3N9GH 4NQEA 3O3BB 2JJSC 1E42A 3D69B 2GFBA 1MFEH 1F58H 3HB3B 3NMEA 3RUGF 3JWNH 1P5UA 3ARDA 4NAJA 1JFQL 4JGNA 3FTSA 2OYPA 3HE6D 2B4CL 4LOEA 2G0KA 3ZTJG 3PWLB 4WI7A 5H4YA 1YA5A 4PHZA 3TV3H 3TBYB 2ZJSL 1KTBA 4PJ7E 2PCFB 3O2VL 3SCMD 4W9IC 1N6QH 3VSVA 3EH4B 5K93A 5CF3A 5ICXB 1TCRB 4JEGB 4OZIF 1BD2D 3DTUB 3TBTA 2XPYA 1XGUB 2IQAB 3S3BB 2EYRA 5HI5D 2PUQT 1HI6A 3CVIH 1D5IL 2F53D 5D5MF 3CH8A 5I5RA 3S97C 1U8LB 1JGVH 1QR1B 3F7QA 4JPKH 1E90A 4N2AA 3TT3L 1D6EA 4ZOBA 2RAMA 1DN2A 2WKGA 4H8VA 3ZRFC 4A6YB 3RFZA 1S7SA 5D8JL 4OGYL 3ETSA 4XP6H 4U1NB 4NN5B 5GIRB 3SBRA 5JXEC 1B2WH 4DQOL 3X14A 4KZCA 5DD1H 4IOIB 3FHQA 3T2OA 1I82A 3G5YB 1OW0A 5D4HA 5DD0L 3KYOA 4ONFH 3OR7A 4FADA 4M9OA 4YAQB 5K1NA 1ZD6A 1I8IB 5LQBH 5DHVA 1U8PB 4FXTA 3V0HA 5DZ9A 4QOKA 4B53A 4LE8A 3CTTA 4KUCD 3MLYH 3C5ZB 4WKXA 4PIBA 4XBEH 3VWKA 1C8PA 4XMPH 1J5OH 2DJ4A 1FI8C 1I8KA 4XB8A 3JYCA 5BUGA 2IH1A 2YEVB 1NPJA 5GRJL 4K15A 1UASA 1L9MA 1AXTH 1ZT7B 2IV9A 5H4ZA 1FZJB 1D6VL 1DVFD 3L54A 1W72B 2Y7QA 3NJXA 1T5XA 2WBJB 4NLHA 2VMCA 3TL5A 5JPMA 1UB5B 1NGWB 1MIEH 4H26B 1GZPA 5ERWB 4UV4H 4R5XA 4BFNA 2BWDA 2CLRA 1NQBA 2FATH 5DRZB 4ECNA 2APVA 1XH0A 3NCCB 4ALAC 4R4FL 4FEMA 4XI5D 3ATDA 3K4DA 3L3DB 1OP3H 1S7TA 2GT9B 1XMWA 5C08E 3W0WA 1TNMA 3N85L 4AIEA 4HZ1A 2ZX6A 2R2HB 2XRAL 4DFHA 1T0PB 2R1WA 4X7SL 1I1FA 4KDWA 4ICXA 4LCUB 3B9KC 5KYNA 1WBXB 1FPTL 3AM8C 3ATEA 5DA4A 3QJVB 3Q8AA 2JQMA 1NBYA 1YN6B 2ED7A 2CHWA 2HFGH 3HHRB 2E9IA 5ES4B 3CZKA 1YAZA 3MZGB 1JSYA 3ES6A 2ROXA 2RMNA 3CFTA 2A99A 3NIGE 1ET5A 3LEYL 1XGYH 4GP4B 4LKCB 4LSRL 3TBSA 4MXQD 5L0QB 2WQSA 3EO1B 2A1WH 3CFKB 1G7QA 1CGXA 4XPTL 5L7XH 1INQB 1CDCA 1M7XA 4X9YA 3GSVA 1D7FA 2BY1A 3CK0L 5ACZB 5IF0B 3X11B 1JWSA 4IMLB 1F8TH 2XY1A 4M3HA 4PRHD 3RBGA 1ZPUA 1W0VA 5DJDB 1BLNB 1NCDH 3GRWH 1I7UA 1T5KA 4PJ9A 5EN2B 3BGFC 4PQXA 3W2DL 3WXWH 5L88L 4OZFB 5CJOH 1ZA3B 5LBSH 1WPCA 2KS0A 4WNQB 3MA7B 1U58B 3ZDXB 4KQ0A 1C7SA 3RU8H 4U1KB 5FUOL 2EDOA 2HLFD 1GMEA 4U1JB 4YSCA 4XTRC 5JIPA 3NCFB 5DHDA 1CDJA 5DZAA 4PM1A 1TQVA 4HIHA 4JDVA 3VSQA 5DZJA 1TVHB 5DMGD 4R7DA 5AB1A 2H1LM 2OMXB 5DZLA 2IH8A 5TF0A 3WEAA 3RIKA 3GGWB 3H3KA 1IAOA 2WTRB 2H2PC 1P9MC 4H2CA 2WZPA 2IDCA 4FZ8L 1JWMB 3QUXD 3ESUF 4HUXB 2AEOA 4N28A 5IP4A 2MOQA 4JFDA 4I89A 4HSCX 3UPRA 1JFHA 1ZLWK 2ENYA 4M8RA 1CICD 4AMKL 2H6OA 3BH8B 1YEHH 4F7KA 1OE3A 1HWGB 3MXVL 3LS4H 3RB7A 4Y2NA 4BYHA 5I2IA 1ORQA 2GUOA 3OKDB 3VM5A 2QKIA 5EOQL 3NZHL 4FFZH 4G42A 5C0AE 1S7RB 1LE9A 5DJ0A 3MJ8A 3G9VA 5I76B 2YXWA 2ZWNA 4JDTL 2IDFA 3BFWA 2BP8B 5KBKA 4P3WA 5DJ2B 3EDJA 3TM6A 3GSXA 5B39B 3NN8A 5CUSL 5EULV 4ZFOA 1JV5A 3GTVA 3H9SB 1U8MA 2JB5H 3UTOA 2X53A 3FRPG 5T1MB 2F54A 2L7QA 2AK1H 3QHTC 3VGHA 2DQEH 2CO2A 1WUNT 4M48H 4DGYL 4F8LA 3CPUA 3V0WL 3ZO0A 3GMMA 4Y19B 4PCTA 1NCCL 3FTWA 5CBEB 1GMIA 1Q90A 5HI3D 2GK0B 4P2RD 2EEFA 4OF8A 2R2BB 1C16A 3I6KA 3LNFA 2DD8H 4LSQL 1NC2D 5BVPL 3H54A 5IB4A 2VQ1A 2ZWKA 3ESPA 3Q9PA 1S7VA 1M6UA 4BH8B 3UTTD 5AVQB 4X2UA 4KVCH 5L4FA 2ZXEB 5LO7A 5IJKA 2NT0A 4NM4H 3UC0H 2XXCB 4MS8D 2HLAB 1SGKA 3QCUH 2D7MA 4JQIH 5HHQA 1S7WA 3RWCB 3NUKA 1JPEA 4XP5L 1DANT 3OHXB 4KJWD 4WV1C 3MBEC 5CZRA 1TJHH 2NRDA 3V5KA 1Q72L 4ZFGL 3WFBL 1IAKA 1Z9SB 3VGEA 2W0FA 1MWAA 1SN5A 3PPEA 2GI7A 4FMKA 1INDH 4Y5YB 4WGWB 3DRTB 1K4CB 1T7VA 3VG9C 3MACH 5B38B 3EYUL 3H6AA 1GYWA 1A6TB 4U6HB 4LSPH 3FQWA 1EEUA 1S9XB 1XB3A 2F5BL 3ULVH 3I75A 3MNZB 3OMNB 2V2WB 1MLCB 2O4EA 3E3QE 4YN3A 1O6TA 1XWVA 3HG1D 5T1KB 5A2FA 4X6FA 1J8HD 4P9HL 4YR6A 3NFNB 4ZQKA 3TA3B 2VERA 3HMXA 3FNKA 3P9MA 3HVNA 1WJ3A 4NC0B 5DC0A 2IFFL 1OAYL 5HI4C 4PJ8A 1MHEA 4KXCA 3BGMB 3IDXL 4EBQL 5KBNC 2UY7A 5E1IA 2Y07L 3BAJA 3D6GA 3V4PA 5HY9B 4D9RE 1N7ML 4YLQT 1ADWA 2H45A 2HZHA 3UDWA 1G6VK 2BIPA 4EUPH 1WZ1H 3FW6A 3G5VA 1EX0A 3VB8A 1BA9A 1P6AB 4L8SC 2DLIA 1AHKA 4PJCF 5CMAB 3U7WH 1W0YT 4ZTPL 1XR8B 3BAEL 5HDQL 4JRYE 3F6LA 4UINH 3UTQB 2AQNA 4UQAA 2KLSA 1MFVA 1U8KA 4JPWH 2BRRL 5KAQG 2Z9TA 4JG1L 4NQQA 2NZ9C 2JKXA 3NCWA 5J9PB 4MAYD 1GVIA 1AGEB 2N7SA 2B0SH 5HYJE 2DYPD 2WYTA 3PL6B 4XC3H 3HN3A 3RUGA 2HKHH 5DHVH 4UANA 3DETC 4M4RB 3WHXB 2AJXL 2ITDA 4BZ1L 5IHZA 1PLGL 1NAMB 5G4OA 3OKYA 1ORSB 3MV8D 2BMKB 3OXRA 4Q52A 1I1AA 4PVBA 4B9CA 4G7YL 2ZUSA 5FKPA 3WN5B 1GW0A 3GZQA 1V10A 3AMLA 3GDBA 4HKJB 1O9VA 4NQTA 4OZIA 1LE5B 3QQ9D 3TFBA 3DX9B 5KSBB 1QLRB 4YO0A 3DV6B 5ICYB 4IIZA 4YXKL 3S37L 4HGWA 5T5FL 4WJG3 5D5MA 4ODHL 4PLOB 2OR9H 3PPSA 4PVMA 2X4NB 4Z7OE 1UA6H 4TLTA 3N44F 3PV6B 4G7RB 2GJZA 2FD6H 3P0VL 3UYPA 1DQLL 2YKLL 3DOIA 4W9LC 5ID0B 3EO0A 4P48A 4YHNA 2PTTA 3L6FB 1PY0A 1FFPA 1A4AA 2FECL 1MFMA 1U93B 2KBGA 3M1CA 3TN0B 2YFNA 2CHNA 5I1LB 4OD2A 4LRIA 1BZ7A 3GXFA 1SUJA 3WGVB 5I1HL 1L0PA 3N6YA 3OC5A 5IBUB 1CXKA 2E56A 3E0GA 5CCJA 4NHUA 3E80A 1OCOB 1T2QL 1QSEB 4NQED 4P5KB 3BP6B 4U1MA 1P1ZB 5HYSA 1OHQA 1ZV9A 4NP4L 5IG7B 2HFFB 3X1BA 3NGBC 1U8HA 5IV2B 2UYLA 4O2CA 4JG0L 1EJ8A 2I24N 4B5ZA 4QXGH 1Q4NX 3BZ5A 2P48B 3IFOA 3ULVD 5KS9B 3OGOE 2WN2A 2E6JA 4KJYB 4QHLB 2E86A 4OM1H 3IS1X 1BAWA 1EEYA 4IKNA 1UA7A 4HWNA 4OLWH 1HXMB 4X6CB 5D2LF 3UJJH 4YHZL 3KPNA 1HE7A 2GJ6A 4QTHB 3FQ1A 3HJEA 3C6LB 4RMVA 3SPGA 3EJQA 4FFWC 4RFNC 5CSZB 4NWUH 1FIEA 5HGGS 1ZXQA 2OPCA 4W9JC 4WO4B 5I9QC 1P7KB 1R17A 4MYPA 5IB5A 4HT1H 4IRSA 3VE0A 1BPVA 1I3GH 2EVFA 5C0CE 4NQVA 1AGFA 3M1BB 3LXUX 4PJFE 5DO2C 5ETUB 3DJTA 3TF7C 1A1NA 2HTLD 3PJNA 4AV0A 4WO0A 3ZE1E 2UZYA 3CZFB 3JTSB 4LLUA 1NC4B 5CEXB 4QNPF 3WTSA 4Y7MA 1MJ7L 1DBKH 2DL9A 4F5CA 4IKLA 4PJXF 3DHUA 5F9JB 4S1RL 1QFWL 4H44C 5C9JA 3B83A 3O6FC 4OBRA 2WQRA 3QIUB 5BZDB 4LU5H 4GKOA 4OLUL 3STZA 1F42A 1ZT4B 1FC2D 3QJOA 3PGDA 4U1SB 1G7MA 4EIZC 2F68X 2VR6A 4XWOC 1F0LA 1THAA 4NQCB 4RBPH 1S6NA 3VWKD 2CIKB 4U6XB 4JDZB 2WQAA 1ZGLB 3O4LB 1X7QB 1M6OB 4PJIA 4BUGA 4YGAB 1QKZL 1QHOA 4A1RA 5CM1A 5D70H 4ORZC 1P5VB 1CLVA 1E40A 1TIUA 3ARFB 5IMMA 4U6TA 1EO5A 3CD4A 4QGYA 3VXNB 1YRKA 3QS2A 3QWOA 4LGSB 3DMMA 4G6ML 2ZCLH 3LH2H 3GK8L 2ALAA 5ESQA 1BG1A 4U3HA 5EWIL 2H1XA 1VHPA 2ZXQA 2QPDB 3DV4B 1KPVB 1VSCA 3VFWA 1IO4C 1CYWA 4BQ6A 1XO8A 4LCVA 2PTUA 2ENPA 4UM9D 1YUHA 1S9KC 2AFNA 5BPPA 5J7CC 4UM8B 1YEEL 1LMIA 1NH6A 3R8QA 1NKRA 3T4YB 2XA8L 5CGBA 4I0KA 5C0GA 4P5TC 2GSGB 3MRGA 2IBZX 4GSDH 5BJTB 4C56B 5EN3A 1KCVH 1ZHNB 1QI4A 1KTRL 2CM6A 4OH2A 1Q38A 5AUMA 3REVA 2VQTA 2G2RB 4UIKH 4R3SB 1CFNB 5FOBA 5EU6E 4W6XB 1FCGA 2UV3A 3GSQB 3MO1A 5E5UB 1FJ1B 1YECL 3S5LA 1TZIA 3V5HB 5IT2L 3N1QC 2WWKT 4XN2A 5JHMA 2XBDA 4NWTL 5F7MC 2EO7A 3BW9A 1VF5C 4MMXB 4WEBL 1GGIL 4C58B 4ANVA 1NGXB 3ZYOA 2RBLA 3AG1B 1TO5A 1LO4H 3UGUA 1MJ8L 3FTUA 2WXKA 3PWVA 1S5IH 3SCMB 3MUGA 2VXSL 2IOIA 3WCYA 1HINL 3HRZB 2V3EA 1OF2B 3ZOAA 1N10A 2CPUA 4X5XA 1BD2B 1A7PH 3UZEC 2WD0A 1E2ZA 4DHLA 5BZZA 1BGXL 1MEXL 2JJVA 5K9QG 1H5BC 2Q3AA 1NEZB 2BNRB 1D5XB 2W60A 2Z35B 2F53B 1MWAH 1ZLUK 2WCPA 3RWEA 4LVOC 1E8ZA 4L5FH 4UTBH 4Y7OC 3ZLQC 2I9LA 2EDDA 5F1OB 4ZODA 1RMFL 3V4UL 1SYSA 4XVUC 4ZMTA 3TJHC 3NACH 3GJEB 4LPYA 3T6WA 3WO4B 3ZU8A 4E42A 5HVHC 5HHOE 1HH6B 2QQNH 5D6CA 3DX0A 3MCYA 1KN4H 4Q9BA 1TTCA 4BKSC 5CBAB 1TQSA 1F90L 1BZOA 3DBXB 2UX7A 4OSUH 3HMXH 3S35X 4NKMB 3TJEH 2A7BA 4EI5C 4JFDD 4L9DA 1FG9C 3OWEA 2GAZA 2H3KA 4P57A 3V4PH 3N2JA 4GUCA 5I5IA 2CDFB 4LARL 3AS3A 5JW4M 4JPIA 4ZS6C 3HC4H 3GZOA 5KYWB 1QRNE 4N2NA 4GO8A 4Q6IB 2HT2D 1B6UA 1MREL 1QBLL 5DVMA 4AQ1C 2YD1A 2VXTL 3INUL 3QFDB 5I30L 2XOTA 5KANI 2JKSA 3RY6A 1FV1B 1ETB1 2I7OA 3UBXA 4P46A 3EGXA 4ADJA 1KY7A 1RUKL 4AIZA 1IC7H 4G9FA 4OLEA 3FU3A 4MSWB 4YFDB 2Z93B 4RAVB 1QMUA 4Y16C 3UGXA 2B2XH 2YA0A 1MFCH 1YEDA 4DGVL 2VDNL 5EBMB 1QFWI 3VXSD 2X40A 2K0RA 3FQYA 2QDVA 3P4LA 2F7QA 2VMEA 3OBAA 2BNQB 3NRQA 4IRZA 3D0VA 4K7PL 4PTUA 4NXSA 4Y4FC 4UZUA 1XR9B 1ASPA 2HKFL 2Z4QB 2FT7A 5AKVA 3F6JA 3VXRA 4E9YA 4F57H 4TTGA 1MHPH 2F7IA 1AMYA 4R26L 4LDOB 3ZIYA 2KI6A 3ARTA 3HAEB 2A3TA 3BHBB 3LKQA 4CILA 4JM4H 2EQDA 4D0DB 4U3XA 2BOBB 2OMZA 3FFCA 2PR4L 5DMIH 1XIWD 4OUUA 5FW7A 3AWGA 3GHEH 1ZXKA 5KOMC 5ADPH 1KEMH 1OAZH 4NAMA 4PJCA 3QDJA 4LBEA 2COQA 3S7GA 5LCVA 4FQXD 2YPLE 5L8LB 2BSBA 4L05A 5BQ7A 1J1XL 4H8HA 1N26A 1SBBA 2EEAA 3HI6L 5JW4Q 4B9JA 5D72H 1EXHA 5D7LA 2R9HC 3NP4A 3FH5A 1JI2A 3P2DA 1KTKE 1QO3A 3P3SA 4ZAKC 5IFHH 3VXME 2JJTC 1HZHL 1YN7B 1EDHA 1CG9B 5GJSH 4APQC 4CGTA 5A2CA 5BOJA 1HILA 3K2IA 2ESVA 5C0EB 2Y2WA 3LOWA 5E1AA 1I9RL 1OEZW 3VFTA 4EIBA 4YHYC 2F9BT 4QWWC 4MZ2A 4OFPA 1JK8B 1OP3K 2VMFA 1N67A 3RGVC 3BMWA 1LVEA 3OKOB 3QJFB 2V2XB 1DJYA 4ZX3A 1GKOA 3CCHB 3M7OA 2DLTA 1MNUL 2PPFA 4HK3N 3A6CH 1MFAH 1RZJC 4Y5VC 3IDMA 2Q76A 3LRLA 3P4MA 3V52L 4AKOA 3ECBA 4ZMVA 4FQQB 1XX9C 1Z9OA 2QVIA 4P23D 3W11C 2VR9A 4RAUA 3ARGD 4UNTA 4HS8H 5GHWL 4MDJB 1GOGA 3ETTA 5TF1H 4UILL 1JXFA 3QJXA 1XF2A 5HDBB 3FO2B 3N43F 4OFYA 1P7QA 3EADA 5TGBB 3VYPA 2YEZA 3FUEA 4YE4H 3OX8A 2Y5TB 3LNEA 4XVJH 2CD0A 3GSRB 3QG7H 4K3EH 4YDLC 1PDKB 1JPTH 2FJUB 3D39A 4FXGC 1CF8L 3OJMB 2DL2A 3BWSA 4QEGA 1M05B 2YR3A 3SKOB 4KV5E 4Z7VB 5BO0D 5B1CA 1NSNH 1S8DB 2LE9A 2ZKHH 3FO0H 4XPBH 3BISA 2NY5C 4Y2OB 3V0EA 5SWQA 3HRPA 1MXDA 1AQMA 3PWPA 1HIMH 2VLME 5EU4A 4UB0L 3B7UX 3V4VB 4UNIA 5GS0H 1KPUA 1Y07A 1DTUA 4JY6B 3PIQA 4YHOH 4D9LH 1JVOA 3HPJA 5E03A 5A3ID 5FB8A 5EZLB 7TAAA 3KWXA 2OMWA 4FERA 1O6SB 3L7FB 4KH2A 1VERA 3ZRCC 5FUCC 3WDJA 5DJCB 3HZKA 2ICWB 5D2LA 3B5HA 5GZNA 4F58L 3SDDC 5E08L 1F6FB 1DBBH 1SBSL 3U46B 2BHZA 1MHCA 2NW2A 1K4DA 5C0DB 3U9PH 3DUSA 1IZJA 3QRGL 3V0AC 4YDNA 4P2RB 4KKBD 2WBWB 4HH8A 3HS0A 1VACA 3FCSA 3ULUE 2DI9A 1JHKH 3BGAA 3TFKC 3GBNL 3O6KH 4MNQD 3IGAB 4LQFL 3BEWA 4HETA 2V9RA 4ZMYA 4HV8A 2XTJE 4N8VG 3AG3B 3RL2A 1E4KA 2DJSA 3W38A 1FVEB 3S35L 3UZQA 5CFAA 2BP3A 3BQVA 5DUBB 2YZ1A 3HS8A 5E2UH 3GO1L 5KVDE 4FFTA 4ZQTA 2OYKA 5C6PB 1RZ7L 2PCYA 2B5IB 3DX1A 4PJXA 3TX4A 4TVPD 3LPWA 2NTFA 4X7CC 5JR1H 3DX6B 1HCYA 1PTZA 1T83C 2B20A 2ZUWA 3LZLA 4LAQH 4JJ5B 5AW3B 1UWEL 1WEJL 5ACLA 4OJYA 1R5VB 4KKQA 4N2EA 1RI8A 4AE1A 1I7ZB 4OLZL 1G5AA 4Z5RA 4LLQB 4X4MA 4HFUH 4NKDB 1RJYB 5C07B 1HNGA 1U36A 3MOAL 1I7RA 4I13B 4LHJB 4DKFH 5GXBB 1JDDA 4YBLB 1CVSC 2FO8A 3SE9H 3NEEA 1J1OH 2JTDA 2FQDA 1KJVB 1FAKT 1K3ZA 4HKXB 4L8BB 3HTLX 3Q2VA 3CMOL 3CUPA 5CLXA 5D1ZI 2CM5A 3HG1B 2FH6A 4BFJA 2MKWA 3GM0A 1CD1B 1A7QL 4EQ2A 2IWKA 4IDJH 3ASNB 3OMZA 3FB5A 4JRWA 3WD5L 4OBSA 1EGJL 1ZWIB 1TQWA 4YHPA 1FUNA 3I9GH 3F6IA 3ZHFA 4WTXA 3E6FB 3G04B 3HB3C 1SXSA 4LLYA 4IRSD 1BREA 2XQYA 4N9OB 2VB5A 4FXKB 1X9LA 3WE1A 2V3FA 4PJ5A 2HWZL 2OV0A 3O9WA 2BSTB 5AG8A 1QUNB 1Q9KA 4IK6A 4MJ6B 1A8JH 3BDBA 2L7JA 3G5WA 3W39A 1KCUL 5E6IC 4HS6A 2FUTA 4ODVH 4CKQA 3LQZA 4I9WE 2WINB 4I2XA 1EDQA 2X4SB 5I75B 5I6KA 5IMKB 4P2YA 3RQ3A 1O0VA 4UWQB 2AXWA 4MD5B 2X6BA 5D2NB 3ASWA 4MTMA 2NY2C 4KHXH 4MAYB 5BW7A 2ZCHL 3FH8A 3L1OH 3OZKA 2DYPB 1JTOA 2XIBA 4LCWB 3ROOB 4C54A 2VDQH 1EEZA 4JFTA 3CV5A 1R3HA 1QI3A 4DH2A 5GS0D 3ZKXC 5CZXC 1NIEA 3L5IA 1RPQA 4K8RH 4M7KH 1NICA 2CMRL 1RP9A 2YPKA 5FAAA 1UWFA 3MV8B 2WSPA 1DP0A 4XMVA 3O81A 4PUBL 4PBDA 1KB9J 1ZVHA 1IU1A 4ELKB 1RAMA 1JPFA 2A9BA 1ES0A 3T8MA 3QIWC 1PYWB 5DJXB 3I50L 3TO4A 2IG2H 1FYTA 3THMH 1BSIA 4NQDD 3IBEA 2JMRA 4XXWA 5IVXF 3TBCA 1MUJA 4L37B 1YEWA 4MRBA 2OMVB 1BAFH 3BDYH 4URTB 4XPFH 3C5ZC 1FWXA 2NUPA 3HC3L 9PCYA 5DO8A 3DSFH 1WRFA 4IU2A 1B90A 2DKMA 4LHUG 4X8JB 3VFGH 2IC2A 4HWBL 5J12B 2VLJD 2EO1A 3NTCH 4DN4H 1UM4L 3OKEB 2RGSA 4HULB 4IRZH 4YX2L 3KNBB 3Q48A 4MVBD 1FZMA 2C9RA 2DKUA 4YFEA 4POZD 2K9FB 2Z8VC 2VISA 3SYOA 1JRHL 3CDGA 2ICES 3L16A 2Q86A 1VESA 4MNHB 5CP7B 4ZTEA 5JXAL 1H9VA 3QYCA 3BT2L 4F9LC 1HXYA 3JWDL 1ODAA 3W57A 4Z7QB 4PHXA 3MN8A 3TS8A 4AYDC 1JPGB 2OI9C 4XBPB 1UM5H 3AFLA 3SDCA 5FGRA 4OT1H 2G2PA 4XWGH 2EDBA 5CSGA 4DVRH 4QHKJ 1N9PA 1VCBC 3PXLA 4HFWB 4KNUA 2ZX9A 1WQVT 5LCVH 4ZPVA 4L29B 2Y22A 1EHAA 4G5ZL 2CSPA 3KXFE 1QAWA 1T1XA 6CGTA 5IIEA 3V0VA 2FE0A 5IOKA 4TXVB 3MRKA 4XMLL 3BZEB 4K07A 1LQSR 3WENA 2YGPA 1W15A 3K72B 4C59B 5I1JH 3I9PA 3LXBA 3F58H 2CIIB 1T04B 2H8PB 3C6SA 4JRXB 5JQIB 2DICA 1KCSH 3QXUA 1RLWA 1OTUC 4EUPB 1H15B 3L4YA 2C7UB 4N6QA 2WPGA 4NENA 1S7SB 3QXDB 1RVFH 3MLRH 2X28A 4HQQL 2QPFA 4P2QB 4ZUUB 1PIGA 3TPUA 3TVMA 1KCRH 3WKQA 2OFQA 3WNKA 4R84A 1HZLA 5HPOA 1FNAA 2QZ5A 4IK7A 4XMZA 5BNXD 3VX1A 3ROLA 4PJBF 5CCKL 4JQVA 1FBIL 2QSCH 3FH7A 3LZPA 3QUYC 4NO3B 3KE0A 2VW7A 5EC2A 4DSYA 4Y1AD 1TJIL 1CT8A 2R2EA 4JFHE 4AC2A 6FABL 3OKLB 5TFSH 4M93B 2K3TA 1XGQB 3TO2B 3EJYD 1A66A 4YSSA 5AVZB 2EABA 3UGEA 1GPOL 3S3DB 4K8RD 5DU7A 1OB1A 3WUWA 1MNNA 5KBDA 4OIBA 2Y23A 4GO9A 4N68A 2B4CC 1T2JA 3NT0A 1Z9LA 2WC7A 4GIOA 3UOAB 5CD3A 5IUSA 4Y19E 1DBML 2Y72A 3O3UN 4P4RB 4UDTA 4YBQD 1WIPA 3K6SB 1YAIA 3BKJH 1H3VA 3QEQE 2AEWA 1NWPA 4QF1B 3H7LA 1JD9A 2AK4A 5FEBA 1E3ZA 3RDTC 4PRPD 1UENA 2X38A 1T80A 1VADB 3UACA 4BSVA 4C83A 3SEPA 3J27A 3RL1B 1RJZA 3CE1A 1AHWA 2F6AA 3KWTA 5KSVA 5IUCA 2C9VA 1F3DJ 2F8OA 1SLUA 1WZKA 3LX9A 4BA0A 2E9WA 3SE8H 1JDAA 1NCWH 2YPVA 5AVXB 3ISRA 4UM9B 1IGTA 1RIUL 5D7KD 1LP9E 4MQTB 2ZUVA 4PJ7F 5GGQL 4WW2F 2Y5QA 4R0LA 1MCOH 3LS5L 3T3PB 2X4OA 3ZGIA 4N5UA 5J11B 3CDYA 2EVGA 2ICCA 1UWXK 4AY0A 1KTDB 2WZ5A 5DCCA 3RWDA 1E27A 3LN4B 4YGVA 2P7TB 4XB7A 1LWJA 4E9LA 3ULUL 5DA0B 2R39A 4I4WB 2JQZA 3ES6B 2XN9E 4GRLA 4O2EB 4RGND 1MCRA 5EBLA 1G7JA 3OZ9H 4RBPK 3TNNB 5IW1B 5HD8C 3PXHA 1J0HA 3GC3A 3P4NA 1HHKA 2EACA 4NS0A 2NNXA 4XMKL 2NYZA 2AABH 3ECWA 1C5CL 2CRZA 3N04A 1EDYA 2MFNA 5KVDL 2IWFA 15C8L 3RWIA 5DFAA 1M2OA 4EZJA 4XNXL 4NZRH 1NM9A 2OR7A 1W0VB 5AAWA 3ABMB 5D7LD 4BBWA 2QTVA 5BS0A 1N68A 1KB9K 2FVNA 2WIMA 5CJQH 2VO8A 4OCSH 3WFEH 1CBVH 4U3SB 2NTSP 4GMSH 2YHGA 4F24A 1K8DA 1KWKA 3NIFB 4FQHB 2ESVD 1DVXA 4PY8I 4A6YL 4X0NA 5F1KC 1TFHA 3BMVA 1SLXA 3DO4A 3WTXA 1FL6B 3FBKA 3MRBB 4WJ5B 1MIML 1JRHI 4OW6A 1YJDH 4J4PC 2RA1A 1GAFH 4DVBA 1AR1B 1T1ZA 3DDGA 1RUQH 4HKZB 1YNTB 2BVUA 1JG9A 1G7IB 3OKMA 3PWJB 5JW4N 1HOCB 5EF2A 3FQTB 2NNAA 4HJGA 3S3SA 4F7PB 1OCZB 3PAZA 4HCFA 1E8WA 4BWWA 4G71B 4K0OA 4DNLA 2OTWB 1A9BB 5CIPA 3LNIA 2G3ZA 2FBJH 3FUHA 5EOTA 2AVGA 1ZT1A 2XI9A 3VRLF 3JV6A 4GQPH 3SQOL 4Y5YC 5HGDA 4OFYD 1HE8A 1P7QD 4JUTA 3U1PA 4V33A 3S98A 3R0NA 3ME0A 1IKNA 4PRID 5IB1A 4MB3A 2N59A 5D6DC 3NSFA 4L8CA 4MMZB 1T1YB 4K71C 3MRHB 1ZHLA 1P4LB 4F33B 5IHBA 1PQZA 2XVBA 5I16B 5KSBE 3WEXA 1W72L 1TFPA 3D39D 2YMTA 4K9JA 5FA3A 2V0AA 3NG5A 3F7YB 5EOCL 2OAAA 1NKGA 5GGUB 5INDB 1Q0YL 1ONQA 3GSXB 5T33L 2EYSA 3DPDA 3NYKA 4MYWB 4WFEE 2Z64C 4R90L 4KQ4L 2SEBA 1HHHB 1T3FA 3FFOA 3GUTA 4AGOA 1JK9A 2E75C 3VXSB 2PETA 5DDHB 3VI4F 1CE6B 4H20H 1KJ3L 4HLJA 5F7BA 5HGBB 1LEIB 5DK2B 1Q1PA 2CLVB 4QUOA 5CHNB 2Y7NA 5FA4A 5GZND 2G75A 1YPZB 1D5MB 3CSYA 1TETL 4HBCL 5FYJH 5IEHB 2WOBA 3ZE0F 1CDUA 1VJSA 3LKSB 1QSEE 4AEHH 4PSRA 3L3OB 5GRUH 2AW2A 5FK9A 2XZQL 2Z34A 4M5ZL 2WCSA 5AAMC 4WNSA 1HOEA 3MRFA 5CZKA 4JM0A 1ASQA 1E5BA 2NXYC 4WCYL 1E4JA 2ITCA 1TQCC 3IDUA 3N50A 1Z3GL 4EXKA 4NPYA 2C3GA 3PHOB 5B4MD 1XIWB 1V3MA 5FYLE 5D7IB 4IEFB 1BJMA 3HUJE 4X6CE 4AGNA 4FQXB 4GMTH 3IMWA 3UBHA 4L3CA 4O2FB 4EI0A 1Y6MR 3ZPDA 3DKHA 1QW9A 3L5XL 4NSKA 4OLXH 3WY4A 1JGUH 1OAXH 4I48A 2Z1PA 3UYRL 4ORGB 4OCLC 4OIAA 3QRBA 3VQ1C 1E5CA 1JV2B 1J8SA 1TNNA 2FR4A 4KZDL 3FSAA 1VGKB 2AV1B 2I7SA 4OZGF 5B1JC 2ZKYA 5IHUL 4L3FA 1NBVH 3GSOA 4JMXA 1VZIA 3V9CA 1PZ5A 3EH1A 1G7PA 3HLAB 5GZOC 1TEYA 3QNZB 2H1PH 4WU5B 5HHPA 4PJEF 1KELH 4NUJB 2P8LB 1KXVC 3SD5A 2X4PA 1B9ZA 2VAJA 3NIDE 3T0EA 2WUCL 5AWNH 2BNUA 1VENA 1CN4A 3FTXA 3IMRA 2CBTA 1KG0B 2ADGA 4GXVL 4U6VL 3QQ4B 2DW5A 4P3CH 1SEBB 1RY7B 3QO1B 3CFEA 1IGFL 3IFLL 4LP8A 4U1LA 4BFFA 5IVXA 3BKMH 3EJCA 5DHYB 4DP9X 5CJXA 4P23B 4H8WH 4J6RL 4WVRA 2OSYA 4W9ZA 3ARGB 1R5IA 4NQCE 4OZHF 4CSZA 3C5JA 2UVEA 2X10A 3S36L 4HPHA 5CFHA 1SJVA 3O4LE 5JZ7D 3C08H 2DQGH 1AGBB 1JNHA 1HHIA 4BXVA 4PGCB 5GS1A 3W37A 2NPLX 4NKIL 3ZKQD 2EDTA 5D1XB 1MAML 2XNAB 3EYQC 3BUQA 2P1YA 4FQLL 5LWYL 1Z5LB 2Z8RA 4K94C 2MPVA 4UQ2B 4XN4A 5DMJB 5MERA 4GBXB 5DQ9A 4W81A 4OCXH 1T21A 2FLMA 4L4VA 5TE4H 4JR9L 5FXCH 3BP4B 4S0SD 4HAGA 4W68A 3ABLB 4UNUA 1FAIH 4M8VA 4Y5XC 5DR5H 3IETB 2BSRA 3J8F7 2F5AH 5E2JA 1A3ZA 1Q8MA 1TKWB 3EOBB 5IVZB 1WZMA 1AZZC 1AJ7H 3BCFA 1PZAA 2XFXA 4HUUB 5FYJU 4DEPB 1EVTC 4UBDC 2UY6A 3EO9L 2ZCKH 1GGBL 4DQAA 2KPWA 1WDAA 2JKRM 2V7NA 4MAUH 4ZUVB 5FYJD 4NC1E 4C56E 2B9BA 3P1VA 4M3JA 4EZKA 1AH1A 3FYIB 3MV7B 5EZJA 2Z91A 1TCMA 3IAQA 4MA3B 5DSCB 2KT6A 3O41B 4Q2ZB 2HTKC 3TO4D 1A47A 1MY7A 3QIUC 4NQXB 1KLFB 5C0RL 4PJHE 5DFWH 1C5BH 5T1DH 1I1YB 5DGQA 2J5LB 1CO1A 1EMTL 2AJVH 2WVVA 1A7BA 4MNQB 3LD8C 3T1FA 2NY1C 4NBZB 1IARB 3NCYS 2MCMA 2IAMD 1Y0LB 3K2MC 4WGKA 4KK5C 3SDXB 1T0NA 1IFHL 1JS4A 2FIKA 5AOLA 4K2UL 2YPVH 4GQ9H 3DOSB 1IBZA 2LR4A 1DJGA 4GYBA 1U8QA 4NZJA 4ZMLA 3EYOB 3S88H 2WLIB 4CN6A 4PJBA 1BD2E 4G3YL 3PWUA 3FCGA 2EUWA 1OGAD 1ZVSA 2Q8AH 2Z4TA 1OTSD 3MZTA 1Z66A 4IYKA 4XNMB 4WUUA 1BX2B 5JO5B 5KVMC 2CJ3A 2XZCH 4KROC 1N70A 1G5GA 4FTVA 4JFEE 2WK2A 1AQDA 4S2SA 2BIIA 5EFIB 3TCLA 3N42F 4NM8L 2F53E 4XO4A 1HKLH 3VA6A 7FABH 1XZ0A 1OQXA 1HL5A 2WNWA 4YHMH 4CN4A 4ZMZA 2OCCB 4Y8AA 5SX4I 3SDCD 3H3PH 3ARSA 5IK3A 4RA3A 2BVOB 2W92A 3S5ZA 3B9DA 1ZDSA 1AGCA 2EDEA 1A14H 2W80C 4N22A 4OUOA 3T8XB 3KDPB 2EVHA 2HPOA 5B3NA 3N41F 4AV4A 3QZWB 3BT0A 4M7ZB 1CXLA 3DTXA 4NO0B 1KLGA 5J6HB 1ACXA 4LIQH 3L4UA 5A1AA 4OAWA 3FCTB 1O9ZA 2ZOKA 1PNCA 1FORH 4I5BA 4JGUA 3WNIA 4XCFH 1NMAL 2C4FU 3GZKA 3LY6A 4AL8H 1FZKA 4MJIE 5FM4A 6PCYA 4G8GA 1PKQB 2B8OT 3QEUA 4XBGA 2PXYC 2WXLA 3QJTB 4U1GB 5H2BA 3TIDA 2OTUA 3DUUB 3GMNA 43CAB 1KBGH 4WY7L 5E4EB 4XVSL 4ODSH 3IDJB 5EA0H 3CQQA 1DSFL 4NQVB 2X12A 2Y06L 3V55A 3FO9B 4PJ7A 4N0YH 4WW2A 1AS6A 2PW2B 2VW4A 4KJQC 5LNGA 4WGVB 1UJ3C 4EKJA 4FA7B 5FWRA 1CTMA 5EZOL 2GVYA 1WCBA 5JIMA 3F7VB 4HGMA 1I9JL 2LU4A 2GG1A 3IDIA 4HLZH 2Y6TE 2ZICA 4L3EB 3GMOA 1IBYA 3AAZB 3L9YA 3GB7B 1N0XL 5DGRA 1L9QA 2FB4H 4RLDA 3D25B 4XNUH 1D5IH 3VI3E 4YSDA 5CIPH 4JHAL 4ZUSB 1JTTA 2WAQA 3TU6A 5B7FA 2R29L 2E9JA 3IU4H 3WEBA 1M3IA 3MOBL 5AW0B 5JHDB 3U0TB 1VAHA 4OGYH 3U2SB 3RI5F 5DI8B 2Z31B 4FQPA 1OAKL 1OQOA 2C4FT 4M29A 4BSJA 1QPXA 5BO1H 4IJ3B 3WO4C 3FU6A 3QHZH 1IRAY 2C34A 5DD0H 4LSUL 2YD4A 3MRLA 1VDGA 4ZSOA 3IDYC 2ZOUA 1HAWA 1ZLSH 2AK4D 4AQEB 4NQDB 3I6LD 1A1OA 3APNA 3JWNE 1M2VB 2JE8A 3D7PA 5GISL 5AOIA 3GSNA 2QR0B 2XWXA 4FC3E 4C8XA 4AG4H 4QXTB 2OULB 1VB9A 2ZUXA 1QYGL 4WI5A 2OA9A 5J1AB 2FIRT 3UO1L 4N9GA 1Q94B 4CN1A 1GRWA 5MEQB 4RMSA 5CWSA 2EDRA 1TZAA 3I74A 5E51A 2ZSWA 4PJDB 4PRHE 4KMTL 3EKCA 3WXVL 2VLJB 3SKNB 1NUGA 5DXWA 1MG3C 4Q6IC 5C0GB 3L3JA 2WLJA 3B8YA 4LQ1A 4PH8A 4D8PA 4KAQL 4YPGB 3H42H 4MNGE 5D7SH 1B0RA 4TUOB 1JF6A 3AXLA 4JZJA 1ZHKB 2AGJH 4GRLD 1Q9OB 3BQUB 1E2WA 3HE7B 3IJEA 2UX6A 4G11A 1OVZA 1D9KC 3FOLB 1BM7A 1J05B 2WY3B 2JSFA 4WUKH 3ZX1A 4AGPA 3DNKA 5BRZD 1CL7L 4D0CA 4X9HA 4QJ5B 4TKWA 5FYLL 2ATPA 3IB4A 4DAGL 3R19A 3N85H 4TPRH 3X3FL 4X7SH 1HHJA 2QPUA 1KBBA 4KTDH 3QH3A 3S34L 5FKAA 2P24B 3UTSA 3H2WA 2CGRL 5BS0D 2L3BA 1LEGA 4OF6A 2DMKA 3SDYL 1VA9A 2ZOLA 3TEWA 5HHNA 1SFHA 4HIEA 3RTQC 4XVTH 4ZFFB 2LHAA 4G7QB 3WUWG 1MH5A 2HG5A 3P54A 3VI4A 1K8IA 5L4JA 5CP3A 4MA8H 35C8H 4B50A 1UXSB 3PNWA 2A6IB 4FKKA 2QADC 4LB8A 3FSVA 1U6AL 4Z7VE 2J6EL 3SJVA 1GOFA 2X70A 5A16A 1FFTB 3TBBA 3RKDC 1U3HC 2VM4A 4JN1L 3P9WB 2ZKWA 4CVWA 3QNYB 1Z9NA 4WWKA 4Y1AB 1DEEB 3EGDB 1CGWA 2CNYA 4OQTL 3HI1B 2AP2A 3U4BL 1F4YL 4FD0A 5IB3B 3OHMB 2BX5A 2WBKA 4NRYB 2ATKB 1OKEA 4BDVB 1N8ZB 5A2IH 2HFEB 4W70A 1NFIA 1MHHB 2NLJA 4TSAL 1AHMA 4C4KT 1FLRL 3V6FA 1P4UA 2H2SD 2H4EA 4WFHD 4ZUWA 3T4AA 1SM3L 2GITA 3P11L 3P02A 4HKBB 4OFKA 2I07B 5B8CB 2DBLH 3SBWC 3NFPB 4RQQB 2EKSA 5CGYC 4FJZA 4OZGA 4Y2DA 2X41A 4PRPB 3V6OE 5K9KB 2VZSA 4HPOH 3FT3B 5EO9B 4WI8A 4X99A 4BK8A 3EYSH 5TQ0H 4L9LA 3LEVL 3VFOA 2C1PB 3ECUA 5T3ZH 3UTTE 1IC5L 5GRWA 4PJEA 1JZFA 3NCJH 1NDGB 5E6RB 2DLFH 4YSAA 1J5DA 5MEPA 3TZVA 2DQTH 3U2JA 4WV1A 3SO5A 5DVOA 3WNPA 1J8KA 2WUBL 2X1OA 2JH2A 4NO2B 3FCUB 2VRQA 3E3QC 3SE4A 5FO9B 5B21A 4WKZA 3TNMB 1DL7L 2WWMD 4F2ME 1L5GA 1IGJB 1EHXA 5JA8B 1OE1A 4WHYH 4OZHA 5CR8A 1TG8A 2D2OA 4CMMA 1Z9MA 5C86A 5LGJA 1AZNA 2XWCA 3U0PB 5K69A 4RZKA 3N1GC 4RGNB 3ARRA 1BEXA 4OJAA 4LSSL 3IJ9A 4HU8A 1UB6A 4IJTA 1W8EA 1BFOA 1NDTA 1TQTA 1PF3A 3IXAB 1QRKA 3BDXA 4HLZG 3JBG7 1AD0B 4M8QA 1FGVH 5I1IH 1NCCH 1J8HE 1YDPA 1EANA 2ZG1A 4YDZA 1D7CA 1KT2B 1F5WA 3GBDA 2A74B 1E5YA 5D7LB 5FO8A 32C2B 3MRCB 4ZPTA 5E5MB 4FQ2H 2A6KA 4D3CH 3A67H 2D0HA 1U2CA 3CHPA 4HS3B 4RISL 4H40A 5I0YA 3NSJA 1GCYA 4L8SA 4XOAA 2ESVB 1AO7B 1VCAA 4JCLA 4Q6KA 4AYEC 2ITEA 3KYMA 4GG6B 1LEKA 2TSAA 1XSOA 4NPJA 1K3IA 4ZD3L 3ZDYE 5KW9H 4IBTA 5BV7B 3B37A 3QEGL 4XCYA 3T0ED 5I5MA 2E7HA 2IO5A 1KMGA 2EE6A 1TVDA 4HUWA 5IHWA 4CVZA 1CL7I 1JNNH 3O2DA 5F1IB 4ZFZA 3GIVB 4NB7A 2WZAA 4Q97A 2A9MH 1FGNL 4AQZA 2KUTA 1I8LA 4HG4K 5J8OA 1F11A 2OCFD 4MD4A 2O5YH 1JZ6A 4RFOL 4XCNA 1WD9A 3EYUH 3LRSB 1XH3A 1QSFD 1IGYA 3ALXA 1YEJH 3KS0J 4JQXC 4PRIB 4EO5A 2O5XL 5DFVC 2LTQB 3LN5B 4I18A 4YSUA 5BCAA 1Z6JT 1SYVA 2FQGA 1BZ8A 5DEFB 3BUYB 4XNQA 1AFVH 1Q0XL 1U8CA 2WKOF 4P9HH 1AS7A 4RETB 1IL1B 4IM8A 2E5EA 1CCZA 1LDPH 1ETZB 3VFSA 3T1WA 3GSUA 2XG4A 2Y1VA 1NFDB 3IDXH 4ALAH 2VDOH 3EYFB 1NCIA 3VD3A 1N7MH 1A6ZB 1AZCA 1N5YH 3PP3H 2YRPA 4UOW0 3LZFH 3Q3GB 3AS1A 4KBPA 2EEDA 2VITA 5HDQH 1TTGA 2WYIA 3SO3C 1U8NB 4JKKA 3SZKC 5E99H 1BF8A 3N9GL 5EEXA 3VYOA 3NEOA 4OI7A 3DLQR 1N12A 4KC3B 4NQEE 2A6JA 2Y6SC 1MFEL 1F58L 1CDHA 4FHJA 4HA1A 4E2OA 3ZE2B 3AS0A 4J3WA 5SWZB 3CZNA 2AJXH 3TTSA 5FGCB 2J7LA 2HJFA 2CUHA 3GSNH 3ULVE 2W38A 1OD7A 4LNRB 4ETQB 1E9QB 2BVQA 1N6QL 4H8UA 2V8MA 1UKSA 1ETJA 1MG2C 1RCYA 1B2YA 4GS7B 4M9PA 1EAPB 3QFJA 4AH2B 3LSOB 1C08B 4G43A 8FABA 1LD9A 1QHQA 5LN4A 4MZIA 3CVIL 1XF4B 2B14A 4YXKH 2NQCA 4HZLA 4A66A 4LCYA 3FB8B 4ZG1A 5K59E 4K5PA 1JGVL 4JPKL 2DI7A 5D1ZA 2CAKA 1UOWA 2I9TA 3ARVA 2B1OA 3UADA 3ARUA 3P0VH 5JXED 3MR9B 1YQ2A 4XP6L 3JVGA 3SY0A 5FHAH 5D96C 3OVUB 3GJFK 1OSPL 1G0DA 1IM9B 4Q4IA 1B2WL 3ALWA 5DD1L 2XXMB 1XAUA 1XCQB 2IH3A 1HSBA 3BXNA 1A9VA 4UQIM 4W93A 1FNSH 4ONFL 5H37A 2ZAHA 2HRHA 4IGBB 5FM5O 3D30A 3MLSH 1Q0EA 1MCLA 5LQBL 5AYTA 2GBVA 4FG6C 3PQYD 3B6SA 3NJJA 4G8GD 4DF9A 3RWHA 3H8NA 1XAKA 4XN5A 5C7XH 4J12A 1GS8A 5FS5A 3MLYL 5LXGH 2V5SA 3M86A 4XBEL 1MQKH 2LAAA 3V0FA 1KULA 3VFNA 4XMPL 2ZSVB 1J5OL 3T0VA 3CX2A 4HHGA 1PJ9A 3Q5TA 3U30B 4PLNC 4WTWA 4FLRA 5ILTH 4IS6A 4J1UB 2AS5M 5CP3H 3LNDA 1AXTL 5A6IA 2JCWA 1QPPA 4Q56A 3ABKB 3W39B 4ZW3A 5IROC 1A64A 1MIEL 1O7VA 3Q0HA 3QDGA 1DUYB 4PJAB 1KWGA 1U95B 1FHNA 2X0UA 3QAQA 4AI7A 2FATL 1AD9B 4ODUA 5T5NG 3WE6B 3QK0A 1OHZA 4XP9H 5FYKH 3V0JA 4BCXA 4XOBA 1LMKA 3DIFB 5D93B 2BDNH 2FQFA 5E8OA 4H0IA 1QWHA 2H26A 1E5ZA 4G6KH 3W0WE 2WTOA 3NAAH 4MCZA 3US9A 2JXMA 5DYFA 3R8BB 3B9KD 3E9UA 2P8MA 3HC0A 5LN8A 2EC9T 4GW1B 3VD7A 1KB5H 1YEFH 1QFWH 2HFGL 1MF2H 3U7YH 3HKFA 3VWJA 2TSBA 5EIIG 1XGYL 1CFTB 2EE2A 4E5XA 3MRJA 1NWOA 2A1WL 4NDMA 2GHZA 3LPPA 2B16A 5FLVA 4RAHA 1T0OA 2FGWH 3CHRA 2IF7A 3DYMA 4H4NA 5L7XL 3D85D 3EUDA 1RZGB 5CGMA 5E9DD 5GSRB 4CBZA 4Q6YA 2IAMB 5E2VL 4JN2B 3UP1A 1MCWM 3CFIC 3HI5H 1HHGB 1QKZH 4N2MA 2A38A 5SWSD 3WJMA 5AZUA 4JKPH 1NCDL 1A7RH 2A77H 3GRWL 3V6ZA 4NX0A 2W65B 4BRVA 1IJNA 3L4VA 1OGAB 3WXWL 1S78C 4J23A 5CJOL 5LBSL 3K4AA 5EU3A 3VXUB 1Q9WB 3AU0A 5BMFH 3NIFE 4M61A 3RGHA 2ZKMX 1UGKA 4XTRD 4K7FB 3RU8L 3WFHB 3VDAA 4Z78B 3I6GB 4OQ1A 5TDOA 1BBJB 1OGPA 2PPAA 4PGEB 5F88B 4XHJC 4MCYA 4ZOAA 4PWJA 3T5WA 5KTEH 2R51A 3FRPB 4FQJH 4QXUH 1PX4A 3DJZA 1MPAH 1PSKH 2A83A 1AIZA 2H2PD 3MX0A 3FT0A 4JO1H 5C09A 2B77A 5I0DA 4LEXH 1U92A 1CXIA 4XC1H 3UTSD 3S9DB 5A2LH 2E27H 1T1WB 3ESNA 1RHHA 5FFOA 3TYFB 1IC1A 3CH1B 1EXUA 2MKLC 2CO7A 3I2CH 1DJIA 1YMMD 3FPYA 3ZQWA 1F1DA 4JFDE 2CLZA 1XFPA 3BPCA 3IPEA 5IKCB 4ODWA 2J8UB 4HUNB 5ESAB 2CR3A 3LS4L 4PIRF 3S4SG 3FSWA 2FL5A 2QHRH 4TQEH 3WV0A 5F9AC 4HWZB 3WSQH 4H1LB 2F8IA 4B9KC 1J0KA 3ABZA 3UAEA 2C3VA 5FYKU 3Q6FA 4LO9A 1UTDA 1QZNA 3R06B 3SJVD 3T0WA 2GEQA 4MAZA 5KG9B 1A6AB 4QRRA 2R23B 4TULH 3AXHA 3O2DH 1AZBA 3N40F 5FYKD 4GUPA 2OXHA 4X5RA 3JWDC 5JHLH 1DJXA 2R1YA 2LOEA 4AKPA 4HD5A 2AK1L 2G3NA 4N0RA 4QRPA 4HUVB 2VE6B 2R7EB 1PD6A 2F54E 4RVBA 1JWUB 4M48L 1K2DB 1QX1A 2D8KA 1I1CA 3MRIA 1YPZE 5EIVA 5HHOA 2VLRD 3GLAA 1HQ4A 3KW8A 4TYUA 4KTYA 4ZO6A 3D05A 5DJAB 3VFRA 3KM1A 1BP3B 4XZUA 1UD5A 2DD8L 4R7NA 1JOIA 3DSNB 3BO8A 1HZKA 3DWTA 3ZDXF 3U1SH 5DRXA 3ZIMA 4JG9A 5LG6A 4KVCL 1ZHBA 1FH2A 4FL4B 4NM4L 1KDIA 3UC0L 3EHBC 3V7MA 1N2RA 2IALA 1R5WB 1NCNA 2WMPB 3QCUL 3RNKB 2C9QA 2F74A 3NRPA 4AKQA 2J1KA 4JQIL 5L6YH 3VNYA 3E8UH 3PY9A 4BA8A 2H9GB 1QBLH 4MMZC 3MBED 4GXUM 2F8VA 2VXTH 3MV01 3INUH 3P3TA 2G0LA 3QDMA 4RWHA 1TJHL 2VSDA 3DHJA 4IRJA 3CZUB 3V0IA 2G5UA 3OJ2C 2APSA 3DVNA 1E4XI 2ICWI 5I6XB 1INDL 4EN3B 1A8ZA 3CVHA 1SMOA 4L5FE 5I6LA 2EIDA 1TSHA 3MACL 3CN4A 4JREB 1VZHA 1XL4A 4LSPL 3FRUB 3RGVA 4DGVH 1IVLA 4ONHB 3ULVL 3P9LB 4Y0GA 1HAUA 5BRZB 3K81A 4LKXA 2WQUA 5F3FA 1KIQB 3K6IA 5E70A 5C8JB 4NNXA 5I1KH 3RZCB 1BQHG 1E9OB 4BSWA 4CBPA 2XKNB 4GH7B 4X4ZA 3QI9C 5ICZB 2WKOA 2JFCA 3EFOA 5JNYA 5TDPB 4A68A 5L2KB 1XGTB 2MQ3A 3GI9L 4GSXA 1KJ2A 4Z0XB 1QOKA 3VGGA 2IOMA 3KH3A 3L3OC 3ZUCA 5DJZB 1D2PA 1M71B 1MLBA 3MYJA 4ZRGA 3FHEA 4JZOB 4MA1B 3D2UA 4N8UA 4RDQG 1KLUA 2C1OB 3Q7JA 2I5YH 1HNFA 2VDMH 3HZVA 4XODA 3P73B 2EECA 3KPRA 4GEJA 1H6EA 4JFUA 3U7WL 3DJRA 1Q9LB 4FXGA 4UINL 3PDOB 2GSIA 3HG5A 4LFHD 1K5NB 4JPWL 4ZS7H 1JMZA 1BZQK 3MOQA 3IKCA 3WNLA 5H37H 1ACZA 4MWFA 2B0SL 3KL3A 3WIAA 4XC3L 4TNGA 4FNQA 3RUGE 3D06A 1I3RA 1UXWA 2ARJB 3DO3A 3ULUC 2GABA 3GMRB 2CKBA 4PB0H 2FK9A 4G8IB 4PS8A 2X4UB 4XXDB 5DQJA 4DPAX 1E4WL 1XB6A 2XTJC 4M1CC 1CZ8H 5IB1B 3H2PA 3IRCA 5FECB 4M03A 3BSGA 4WHTA 2J1WA 3OJVC 4OZIE 1ZHLB 5B1AB 4YDJA 2R69A 1SFDA 2HYMA 1AI1H 2UUDH 3GTNA 1T0MB 4YE0A 4EF3A 1H0DB 4FMFA 4KOBA 4CVXB 4ZMOA 1MRCH 5D5ME 2OR9L 1UA6L 2K6WA 4HHAA 4N1CA 2BY0A 3PJSA 2CZNA 3QG6B 3QZPA 4LEEA 5DLMH 2PW1B 3ECQA 5GGSY 3VD9A 3BD4A 3NA4A 3QA3A 3U9WA 2E4TA 4JFXB 4OGZA 1CI5A 5F89A 5JOEA 1T83A 5D1XC 1I3UA 2D9QB 3MKGA 4KKCC 5HTSA 1MW0A 4OFVA 4JLRA 1A4KA 3IDNA 4Z76A 1TYRA 5A2AA 3AUVA 2XVGA 1FFNA 5IBLC 1R4XA 5FX3A 1KIUB 3CHXA 1ZJBA 3F5WA 3VH8A 5J13B 1DQJB 3C8KA 4J39A 4BZYA 4QXGL 1HS6A 5KN5A 4N6RB 4N2OA 2CXGA 1PLAA 4E9TA 3EDDA 1ILSA 4UQ9A 2ZG3A 2NY0D 4OM1L 4AJYV 3CLEH 4L3AA 2EUZA 3OPUA 4JS7A 2I27N 4FFWD 2GJ6E 1SBSH 3FO1B 3QFJD 4IU3A 1XXFC 3O3BA 5IM7B 3D69A 3IPFA 4NWUL 5EPMB 3K46A 3L1EA 1QWNA 1XGPB 1DBJL 3OGCB 1V5JA 4JM2B 3OQRA 3U0WH 4HT1L 3ZDZB 5DO2D 5A6LA 3PWLA 3SDAB 2J5LC 3OB8A 2CUMA 5TH2B 3VSUA 4G1MB 5H35B 5IVOA 5F7UA 3CFQA 1WF5A 1JYVA 4YQXH 3TBYA 2BK8A 3KW7A 5DYOB 2PCFA 3FB7B 4G80B 1L6ZA 2CDGB 4PBWD 2P5EB 5ESVB 1DBKL 3VD4A 1PMYA 5ICXA 1TCRA 4JRFA 3ZMEA 4F5CE 1RZ7H 5HGHB 1XGUA 2R0ZH 1I7TB 4WWID 2IQAA 4GAAA 5KSBF 2BIOA 1N8OE 1L7IH 3A6BH 3F01A 3W9EB 4GT0A 4WSGA 1R3LB 1UWEH 4XWOD 4BE5A 2YO3A 3T71A 2AI0H 1QR1A 1U8LA 2IV8A 4A6YA 3B2UC 3VFUB 3WIHA 3ZL2A 1EHLH 1SXAA 2EEBA 2CO4A 1WWCA 4M7LT 4U1NA 5GIRA 5EEWA 1XD0A 3CPLB 1QSFB 4QYOB 1M42A 2ITFA 1IV8A 1L4IA 2PCPB 3BH4A 3KPMB 3OMAB 3G5YA 4IOIA 5D70L 5FC9A 4EDXB 4N0CC 1FZOB 3BZFB 1PEZA 2IIJA 1J87A 4YAQA 3NSYA 3CMOH 3L4WA 3ULSB 1I8IA 1J9RA 3V2AR 3JVFC 2ZCLL 3LH2L 1U8PA 3SE3C 4F8PA 2HFTA 1M56B 3QDGD 2O5ZH 3P0GB 4KDTC 5JIQA 2OTPA 5IWLA 1OCCB 1ULVA 3OAZH 3C5ZA 4QHMB 5BUAA 4ZFOL 1URLA 4I7ZC 3A4FA 3TEZA 3V8CA 2Q7NA 3CFJB 3QORB 5KS9F 1DQTA 4HJ1A 1ZSDB 5EU7E 3MLUH 8PAZA 1H6FA 2HWZH 2OZ4A 1ZT7A 4X6CF 4GSDL 5D1QB 1FZJA 4B6ZA 5EU5B 1KCVL 4KMQA 1W72A 2DMGA 3BUDA 4I0PC 2ZTBA 4FQCH 4F9LA 2WBJA 2UZXB 4OY9A 1DZBA 1NGWA 1UB5A 4H26A 4W9KC 2GTZB 4UIKL 1SLWA 4XAKD 3KPQB 2WSKA 3GLZA 4J7RA 1N6VA 3VWJD 4DP4X 5DRZA 2ZCHH 2E7LA 3AUWB 2HG0A 3ZKNC 4P4KB 1AKPA 3PAUA 2X2HA 3RX5A 4KKZA 3RNQB 4ZOEA 1E6OH 2WM0A 4E9WA 3L3DA 3RE0A 5GGSB 2O6DA 2GT9A 2K9UA 2MPAH 3Q8BA 2R2HA 1PY4A 3K7UA 1LO4L 3QPXH 4WFGD 7PCYA 4X6BB 1S5IL 2O6EA 3V0GA 3NSXA 4XH2B 4LCUA 4RFEB 1WBXA 2Z31C 4X6EB 2Y1YA 1NIAA 3M6DA 1JZHA 2K78A 2QPSA 3MLZH 3N0AA 4MS6A 1YN6A 1A7PL 5E1HB 1KOAA 1KYUA 1V3KA 4ZJ9A 3IAGC 2YA1A 3WIIH 2FBOJ 2JB6B 3H9YA 4JCMA 4LKCA 3TYGH 3LKRB 4KITB 1MWAL 3EO1A 3PLYA 4XR8C 3NCYP 3CFKA 4AYID 4L5FL 1INQA 4UTBL 4XVUD 3CVHH 4DWHA 3TJHD 3TT1H 5ACZA 3X11A 5EV7A 5IF0A 1EJOH 4ATWA 2CCWA 3NACL 3ARYA 3FMGH 4IMLA 2ZYSA 3FTYA 1PNDA 4PY7B 5DJDA 2IDTA 1BLNA 2QQNL 1PLBA 4KI5F 4D94A 1UM4H 1JYWA 3JQOB 2X4TB 5KVGL 1SLVA 5EN2A 2BXYA 2VDPH 2LFGA 4OSUL 4OZFA 5J56B 1RD6A 1ZA3A 3HMXL 4EI5D 5DEJA 3NOIA 2EDFA 3PQYB 3TJEL 3A3YB 4WNQA 1KJ2H 2MQ0A 1U58A 2XPGB 3M88A 3MA7A 1YYLH 4ZT1A 4U1KA 3STLB 3FS9A 4B9IA 2BY2A 1G9NH 4U1JA 4ZS6D 3V4PL 2HVJB 1E3XA 5CJ5A 4M1DH 1HKFA 2D4FA 3HE7C 2FAUA 3HC4L 1PZCA 3VSTA 1JNLH 4Z3TA 1CGYA 4P2OB 2JV6A 1TVHA 3K8MA 3VXOB 3O3EB 5LXVA 2BIHA 5KBLA 3L81A 2NX5D 3S8FB 2OMXA 3O4OC 1EH9A 3BRGC 3GGWA 1OK0A 3X3GH