3NDZE

The structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
SAVEVTYAITNSWGSGASVNVTIKNNGTTPINGWTLKWTMPINQTITNMWSASFVASGTTLSVTNAGYNGTIAANGGTQSFGFNINYSGVLSKPTGFTVNGTECTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoglucanase D
publication title The structure of the catalytic and carbohydrate binding domain of endoglucanase D bound to cellotriose
rcsb
source organism Clostridium cellulovorans
molecule tags Hydrolase
total genus 21
structure length 107
sequence length 107
chains with identical sequence F, G, H
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ndzE00
1E5BA 3NDZE 5DHDA 2CWRA 1XBDA 3NDYE 1HEJC 2XBDA 1C7TA 1QBBA 2CZNA 1EXHA 5DHEA 1EXGA 2RTTA 1QBAA 1HEHC 1C7SA 1E5CA
chains in the Genus database with same CATH superfamily
3TWYA 1NANI 3IJEB 3HUJB 4R0LB 5EC2A 2WCPA 1E7UA 2XXCB 4CW1A 1HC1A 1HZKA 2PO6B 3QXTA 15C8H 3MNVA 4P5MA 2DTML 1UH2A 2YO3A 3UJIH 1N0LB 2A6DB 4R7VA 4G6ML 1DCEA 1P7BA 1U91B 1ZLWK 3EH1A 4B9PA 5CP7B 1KBPA 1I7RB 3EO1B 2BM3A 4XNYL 4FZEH 3L3DA 4EEEA 3FU7B 5DA0B 4NQCB 3AQDA 3ZE2E 4P06A 1BV8A 2VXVL 4E9RA 5KVFH 2EIZA 4ZBJA 2G2NA 4XZUB 4NUPA 4OM0H 4S2SA 3RY4A 1T89C 5E03A 3OX8B 2HFEB 4G6KL 3FB8A 3ZDXE 4YEEA 5PCYA 5F9WC 3FFCA 1VADA 5E8PB 5FO7B 1BG1A 3N5AA 2GTZB 2FEDD 1VKXB 3O2VH 5HVGB 2CKBB 3IFLH 1CFNB 1ADQA 3E6HA 3FQXB 3NAAH 1J10A 3CDYA 1CXFA 5E9DE 4B7IA 2CDFA 1XH1A 1SLUA 1SFHA 2HRLA 2VC2B 3FKUS 4NFBA 1WZMA 3UDWC 1G7MA 5AVSB 1LILA 4XNMB 3VXTB 1F4WH 5ACZA 2Y72A 4MKMA 4UT9L 4DEPC 3VFMB 2VM3A 3MRLA 5KYNA 3F5WB 1QNZH 3UTZA 4TNWK 4AH2A 1FNSL 5EULV 4L29A 3IJYA 3VXSD 1ZY9A 1I9RL 1MF2H 3ZKXC 3G7TA 1T0PB 2V8MA 4LLVB 5HD8D 2EE0A 1UD6A 3REVB 2F58H 4AYID 2DDQH 3I3EA 3GEWB 2C4FU 3X1EA 2OV0A 1EXUA 3DRTA 3DROB 4UZSA 3WFDH 2XWDA 4I18A 4YHOL 4E0RB 3HHSB 4XI5D 2EIKB 1IV8A 2J8UF 1AGBA 4POZC 3NJNA 3ZDZF 2VDLB 1Y0LA 4PJXF 1T2XA 4CKQA 4ELDA 1SN2A 3FQWA 4GMTH 3LHPH 1ADWA 5JHBA 5IQ9A 5IEKB 5LBSA 2J88H 2L7UA 4KVNL 1UJTA 3X12A 1WFJA 2R1YA 3GSOA 3L2NA 5DVOA 4AOFA 3U9UA 2C1PB 1VGKB 1HCYA 2EDHA 3FO1A 4LU5H 4NQSA 4F37K 3TYFB 1RZ7H 4O00A 4V2BA 1LEGA 1PQZA 2QGCA 3NIGF 1XCTB 5DUMH 4LLMA 1NAKL 5D7LA 1IGIH 2H3NA 3MLVL 1G9MC 4RZCA 4PVMA 4XP6L 4AQ1A 5I17A 4JDEB 1ZHBB 4KDVA 1Z0NA 5FM5M 3B9AA 4MCMA 1GS8A 4HWBA 5G2NA 4X9FA 5GZNC 3HG3A 3QDHA 2Y3AA 4JHAL 4MA7L 4W9IC 3NQKA 2X42A 1NIFA 5I8KH 1HIML 4C56E 4Q9QH 4M6MH 2AJSH 3DI3B 4CADA 1HHIB 4YIQA 1TITA 3OKDB 2IWFA 4HWZA 4A04A 5KVDE 2CA4A 1U8HB 5DS1A 2R8SH 1T1XA 1EEYB 4OFQA 2HTKD 2X4UA 4N8UA 2A6IA 4YZFE 1B6UA 2WXNA 4OD3H 1CGSH 5DI8B 1FQ9C 4DKEL 3EBGA 4NUMA 1A6TA 4WTQA 2ZX8A 2WAHA 2G0LA 2HN7A 3P11H 4MS6A 4QRSB 4ZPTA 5FPIA 4IKNA 4NKIL 2D03L 1CL7I 1CZ8H 2QLYA 4MFHA 3UZEA 2ICCA 4ATTA 5B8CC 5DFWH 2QHRL 1C7TA 1MVUA 2Q7NA 2VXQL 4XBPB 5C0JA 3FRPA 3MFGB 5I1HL 4LAJH 4PJHE 2QGDA 4OBSA 1Z7JA 3SDDC 3V0HA 4TQ8A 2AXFA 1E42A 1G6RH 5DQJB 5KAQG 5LN4A 5DK2A 4PMEA 1BLNB 2CIKA 4UAHA 4HCGA 2Y0SA 1U3NA 3GUTA 4JFVA 1I8LA 1KIQA 1TQCB 2N3JA 4FEMA 2Z9TA 4X2UA 4KJYB 2H6UA 3NQIA 4XO9A 3L3HB 4XRCB 5C0NC 5EU7E 1SMOA 4WK4B 4F20A 2DM3A 3RKDC 3G6JE 4AVIA 2BOCA 4JY4B 2VW6A 4L8SA 4LHUD 3MODH 3W81A 1BQLH 4J7RA 2AQPA 4DKDC 4CJ0A 4ZXBB 3K1DA 5I1IH 1KIUB 4F7PA 5C0RL 4OF3A 1SUHA 2SODB 3RY6C 5A1AA 1ACYH 5DD6B 2B5IC 1YRKA 5CGBA 4A38A 2X05A 2D0FA 1UGNA 3OKNA 2JXMB 3ZN6A 2VMDA 4H5SB 1UWGH 5SX4I 2JVUA 3P9WB 4LDLB 3PNRB 3IXTB 4L8CA 2B8OT 1W0YT 2GAZA 3QEQE 4DUXA 3TJHD 4ENZA 1B4JH 4LASL 1YEGL 4A2EA 4XWOC 5CEXB 1OOAA 4NZRH 4JRWA 4MZ2A 1MRFH 2Y5EA 4S1SL 4ZS6C 3ARBA 2CGYA 4AGOA 2ADJB 3K6OA 3QIWA 5JQ6H 4FULA 5I1AB 5E4OA 2VMCA 1GH7A 3FO9B 2HJLA 3DVGB 4FMKA 3VWKB 4WNQB 1ODUA 2ZWLT 4ONGL 3RZCA 2COVD 4Y2LA 5GGRY 1HHKB 4V11A 3W39A 4AC4A 2UZXA 4ZMAT 5AL8A 1NGZA 5DJ6A 1WBXA 3DWTA 4TXVB 1RAMA 4ZTOL 4U1NB 2BJML 1NKOA 1OGAB 3V0DA 4BQ8A 3D18B 1UC6A 2ZP0T 1HDMA 2E9BA 1WLHA 3MLXH 2DL2A 5CINL 3NJKA 1A3QA 4F80A 2OJ1A 2V9QA 2ZUTA 2GBAA 1HAUA 1KGCD 1TVHB 2R15A 4HT1H 4P57B 3Q8CA 4R4ND 5HHOB 5IROD 2IBBA 3D4YA 1K6QH 3QUZA 4URKA 2A9CA 3N04A 3Q2CA 4PRBA 4YPJA 4K3DL 2XTLA 1D5ZB 1BX2B 3TEWA 4GMSH 3RI5K 3SPIA 1KEGL 4YDKH 5L2KA 4KZEH 3MV9D 1WVZA 1X5MA 3B8SA 4Y4KD 2EUZA 4BZ1L 4BRVA 2JKTM 4LSSH 3L81A 2IAMC 2XV3A 4TNFA 3UX9B 4X80H 1Y18B 4WKXA 3BZEA 2R0LH 4B9FA 4I87A 3AWEA 1G9HA 2GY5A 3WTXA 3W3BA 2YA1A 4UDUA 3UYRH 4HKJB 4WI2A 1PD6A 4GQZA 1WAAF 4KXZI 3U0PB 4LDOB 2YD5A 4E41B 2DMKA 3NESA 1O7VA 4K8RC 2DWEB 3BKYH 5AENA 1BVLA 1RULL 1GIGH 3PREA 3QPXH 4M62L 4B0MB 5C0AB 4GPVA 1Z3GL 1HSBA 4HHAA 4CVXA 1I85A 4A2MA 4K5PA 5KS9A 1JMXA 5E6RB 2OMZB 4TVPH 4GT0A 3VI3F 3HS0B 1P5VA 1YY8B 4PEEA 1J18A 5EO0A 3VD5A 5C8JA 2WZ0A 3IKCB 4PJEF 3BLPX 1ZHNB 1FSKB 1FV1A 1KJ2H 1Q1JL 3IEAA 4IRZL 3DVIA 4MMXA 4PJDF 4OD1H 3STLB 5MENE 1KCUH 3FCGA 1VZGA 2VMEA 4NNXB 4QIRA 5DD0H 3QJZA 3D2UA 3QNXB 4WHTA 4JFZL 2V2TB 3GSXB 3WV0A 3UTTB 2YUWA 4K8RH 5EA0H 4JY6A 4ZOEA 1T80A 4AL8H 3PHQA 5IREA 1JI2A 3QK0A 3SO5A 4AZ8B 3GB7B 4LP4A 5EO1A 4AIOA 4QOKA 1AS8A 1XIWA 2CBTA 2ENPA 4KHXH 3EDFA 5H2BB 2P52A 5K9KA 3NFSH 4UNIA 4MJ2A 2ICEA 1SLVA 5DHDA 2J72A 1A1NB 5AZUA 5H35A 3Q3GB 3ARYA 5DD3L 4AEHH 1KLFB 1XGPB 2WSDA 1KLGB 3V5KB 1MWOA 5JHDB 3WIHL 5EN2B 3V79C 1A7RH 4QRPA 1BQUA 2J8UA 4QRTA 4E9WA 5ABZA 4HS3A 2G4GA 1X4YA 2WXGA 3HC3L 1MCSA 4PJXA 4X5LA 4NBZB 3SCMC 1XD1A 1IC4H 1OSPH 2R27A 2YEVB 4ZUTA 4PD4K 3MBWA 1OAUH 2WK2A 3UTPD 1EO5A 3QPQC 4LSRL 2GG1A 2XQYG 4UMGA 2O5ZL 1YSOA 4JDTL 2GBTA 4L4TE 5C0CD 1BJMA 3RAJL 3EXJA 2X4SA 3NPZB 2DRUA 1NDTA 1QO3A 3S3CB 5K69A 1FNGB 4OH2A 1A5FL 2BFVL 2F6AA 4LRIA 3H7LA 4YHPB 1V7MH 2UWEB 5FDYA 3FRPG 1R5IA 3G04A 5AW4B 3UAJD 1I4FB 5IBLD 4A2HA 1F4XH 5I1CL 5CN2A 3PCYA 2KS0A 4KUZH 3ZZSA 2HVKA 2JK5B 5TDNB 2X2JA 2G9HB 2FEEI 3K8MA 4MCZB 4ABWA 1HN1A 3NJGA 3AM8A 4KV5E 4H1LB 4N68A 4BKTC 4BELD 1UACH 1UATA 4GQ9H 1IBGL 1PPIA 4WZ9A 3C5ZD 5K9OA 5SWQB 3V4VB 1K4DB 2A4EA 1T21B 4OFKA 1BGXH 3QUYA 1TEYA 1R0AH 1C9SA 5GHWL 4ODWA 1CU4H 3CVHB 1ITBB 3MQIA 2YGPA 2BO0A 1OB1A 4G8GD 5DJAA 3ZL1A 4UT6H 3D25A 3QWOA 3ZHKA 4U6XB 5T3XL 4RLDA 5ECGA 5FUOL 1GGBH 3MTXA 3QJFA 4BSVB 1OPGH 4G7RB 4KROB 1OW0A 3WKYA 4XB8A 3DLQR 2W9EH 1NBZA 4FTDA 4GKLA 2XC8A 1I82A 1TCMA 1XXDC 2B4CC 2XZQL 4WKZA 5D7SL 5K93A 3E9UA 1E8ZA 5DS8A 3BEVB 2XFGB 2P7TB 3NFNB 3X1NA 1BZ7A 1VFAA 1V27A 1FO0A 3QIBC 3TPKA 1KF9B 1A6UL 3S5YA 1JDDA 3N50A 1UZGA 3C2AH 2OSWA 1CG9A 4JFQB 4FQHA 3FFCD 4NM4H 4OAWB 3KPOA 4DN4L 1MFVA 2ICWI 1AHKA 1AZBA 2IH9A 3CQPA 2OK0H 1G7PA 1EVTC 5DXWA 4E5XB 3CE1A 2YGNA 4ERSL 3B7SA 5IW1A 1KB9K 4F8PA 2HUHA 1N6VA 3ARSA 2FDBP 3CZFB 5KBNC 1P1VA 4GSDL 3QHFH 2BP3A 4WFFD 4ZYKA 3SD2A 1X5GA 3BJLA 2RFXA 5D7IE 4PBWD 4ELME 3LKNA 5INCA 1LM8V 4LSTH 4KTEL 4XNXL 4HEMA 2RCSH 5GGQL 1SYVA 4HVBA 2Y5QA 2DN7A 5JORA 4U1KA 5JA8B 2OAAA 4ORZC 1IGJA 4N0FB 3L4WA 1SHSA 3T08A 2ZCLL 4M5YL 2W0PA 1M9SA 1B0RA 1DBKL 1TQBB 3BFWA 1XGTB 2HWZH 5KVGE 2AJXH 1FH5L 5EFIB 3VQMA 2X0WA 3LEVH 4A55A 5I9QC 5T33L 4FGMA 4MB4A 1WFTA 3THMH 2E7CA 3RNKA 3SYCA 4F9PA 3QUKB 4I89A 4PJGF 1PGRB 1VJSA 1NOLA 4OZIE 3K2KA 5EOTB 1TZIB 4H8WH 3NGBB 3MV11 3QRBA 2IFFH 3RBGA 1G5AA 1ZLUK 1AG6A 3CPLB 2X4TA 2DQEH 1GZHA 3CLFL 4JKPL 3G6DH 1QRNA 5DRZA 3NK4A 4JR9L 3IN0A 2FVNA 2Y6TE 1O6SB 2DYPA 3HZKB 1KEMH 4GLRI 4XNZB 3JWOC 3VSQA 2JKIS 2ED9A 3CDZA 4FI7A 3T4YA 2UVEA 1Q9WA 2H1PL 1LNUB 1RUKL 2P44B 2DQCH 2Z8SA 5D7LD 5CSZA 3ML8A 3UXFA 2Z65C 4Z3EA 2XN1A 1JG9A 3SIKA 3P77B 5HDLA 3U6RB 1YO4A 1M42A 2AJYH 6FABL 4RCAA 5IT2H 3NCJL 5EF3A 1NCAH 3JTTA 3MV8A 4AQEA 1YUHB 2WV3A 4KC3B 4Z3HA 1MWAH 1O5PA 3DX8B 4EI0A 4BHUA 5GRYA 3MV01 4TQPA 4ZXBC 5FYJH 4OLZL 3VQLA 3I6GA 4Y5YB 5K9QI 5CEZD 2BSDA 1H8SA 4OFYA 4IM8A 5SWZA 2APTA 3RLSA 3QCVL 2EIBA 4J3XA 4BIKA 3NTCL 4ABUA 1BZDA 5ACLA 4BQ9A 4JQVC 4I2XA 1XBDA 2NOYA 1SVZA 2G2PA 4D9QE 3QH3A 4XCYB 1R33A 2O72A 5INDA 2Y25A 1DUYA 4JZJB 5D2NB 2CPUA 1OHQA 5CGMA 3KWWA 5HDQL 2BH0A 4A2FA 4LOUD 1JGVL 2D7PA 2KHAA 1R6VA 3FONA 4I7ZC 1JZJA 1DQQA 1SXNA 3PDOA 3MMEB 2ADIA 3O3AA 1IARB 4MA3A 3UERA 5DZNA 2J2ZB 3UBGA 1UB6B 1W72H 4DVRH 2A9ML 4YSAA 4ETQA 1R19A 1WAAA 4APXB 4F2MB 1TFPA 2BCKB 3T0EA 4GP8B 2DS4A 5J11B 2LE9A 1XR8B 4JCLA 4KI5F 5F7WC 2HMID 4LHJB 4R3SA 3KPNB 2WXMA 3O9WA 3KWVA 1K4CA 2L7QA 3HNVH 5C0EA 1CL7L 4I1NB 4PJFA 3CSGA 1HQRA 1P2CA 5D7JA 1MVYA 4P3CL 2XHNA 4I9WD 1I8KA 3BPOB 1ZMYA 3ATDA 4KXDA 1D6VL 1M71B 4PJEA 2NY7H 5B1CA 3ZDYE 5GS1A 1J1OH 4PJDA 3WL9B 1A25A 1Q0YL 1QPKA 4EZKA 5DFAA 3GMPA 4M1DH 2ZF8A 1AXSB 4HS8L 4OF0A 3HAEG 2DWTA 1R3KA 1HOCA 1DJIA 3F7VA 3ZJAA 3S34L 2DLTA 1JFHA 3QISA 1YEHH 2OR9H 3BUBA 5IMLB 1AHWB 4IKJA 3V5DB 4LL9A 4QXWA 1GHFL 1M1XB 2ZOLA 3AXLA 2VABB 4KKAC 3LRSA 1FZJA 2F61A 4L8BB 1WFMA 2CK0L 5CJXA 1TSRA 5I66B 1CIDA 2NNXA 2NW2B 3ARBD 4CVWA 4DCQA 2VLLA 4PG9B 4CNIA 3QIWD 4UQBA 3LS4H 4GKNA 2DZEA 1KN2H 4MMZC 3MGTA 4H0IA 5KBLA 4Y1AB 4PJCE 4PREB 3SE9H 3RZCD 2FO1A 4QWWC 5HHMB 2W59A 1IM9B 5TDPA 5B1JC 4A67A 3OG6B 2Y07L 4RFEB 4ONFL 1ONQA 1GY2A 1NCBH 5JIKA 2DJSA 3VSTA 1YJDL 1IVTA 3DOHA 4X6FA 4Z3GA 4FQ1H 5KBMA 1FNEB 1AZZC 2RACA 1MELA 3BW9B 3GJFB 5CZXC 1I1FB 1RK1A 5DHYA 2LU7A 3W2DH 3WY2A 4DP7X 4YQXL 5IQ7L 1JZ3A 1PMYA 3M45A 4FQLH 3VXOB 1KTRL 3WEXA 4F9LA 5C0DB 4IEFA 5CHNA 1YNKH 3FCSB 3QW9A 4FFWD 4Y5VB 1XSJA 4OLYL 1PKQA 5AYTA 4G83A 3L9YA 2WVVA 4X5WB 4KO7A 1JPFA 2BS9A 4JFDE 3BUYA 4DOHE 3IGUA 3QUZD 2ZAIA 1WC7A 4F8NA 1SXZA 4MS8D 2XG5A 2VSMB 2W0KA 3DXAA 4Z7QF 1H3PL 4O02B 5AVQB 5L2KD 4QY8A 3FQRB 4HZLB 5EZLA 2QL1A 4YPGB 1BVZA 4L0YA 2ADFH 4PV8A 4AVHA 1TVDA 5I6LA 1AXTH 3M1OA 2VKWA 1JNLL 1PJ9A 3QFJB 4X6DE 5E2TH 5MEPA 2EXYD 3A3YB 5I30H 3LZPA 2LVCA 1RUQH 2CCVA 2AK4A 2YPVL 1Q1PA 2JCWA 3GBNL 3P9LA 1SF5A 5I1EH 1X3DA 1DANT 1HCVA 4M7JL 4XBEH 2YKKA 5ESQA 3MFFB 3QIUA 3WTYA 2ODHA 3B4NA 5I76B 4XNUH 2CIIB 2ENQA 4OCXL 1OTUD 25C8H 4Y4KB 3AB0B 1RK0B 2OTWB 1LP9B 2DWDB 3T2OA 4F7KA 2W07B 4JO1H 3T77A 2MCPL 3P0VH 4JG1H 4P59L 5GISH 3ZRSA 1JTOA 2YK1L 2G3MA 5I8CA 4TULL 4HJIA 2CXGA 4OCYL 4Z7AA 5JW5A 3WIIH 1KJMA 1Z5LA 1VEPA 4MVBC 2WAQA 2ZUWA 4N0CD 3FBQA 4RMUA 1ND0A 2IPTL 4NENB 5TE7L 5B22A 3KZ8A 1QHOA 3BFQG 2R23A 3HC4L 5DTFA 2AXGB 2X9XA 3D2UD 4NAMA 4ZUSA 2V5YA 1L0YA 3E8VA 4JZNA 1LO0L 5F6HJ 1BREA 1BMWA 1NC2A 3GS4A 3CZEA 3ARPA 4QOKD 4UQAA 4FYRA 2IC2A 4GW1B 4HSCX 1OAKH 5F3HA 2BERA 1XIWD 4K55A 1CLVA 1LGVA 2P5WE 1H6TA 1AO7E 4KZDL 2XX0A 3MLWL 5BW7C 1R46A 1IFHH 2OXGA 3QI9C 3LNGA 3FO0H 4DQOL 1CT8A 4TLUA 3HOGA 4OZFG 4JFPA 4MAYA 2DLFL 4OCWH 3HBZA 3NN8B 4XP5L 2H0FA 4NRYB 1JRHI 5IM7A 1ZT1A 2GB2A 1MG3C 1B2WH 1XTMA 2NY2B 1E28A 3CH1A 3VNYA 3FYIB 2VXQA 4QRPD 3BP6A 4BFBD 4MQ7A 4JO3L 3S3SA 4ONHB 2P47B 2DBJA 1TVBB 5D5MA 4ZUWA 1RZIA 5B3JE 1CFSA 3U4AA 5FW6A 4OCLC 4NZUL 3RYMA 2R2HB 4EMZA 1YEWA 2B0SL 4KDWA 4N0YL 3PP3K 1KENL 4NQDB 2DQJH 5F7MC 4Q9RH 1X44A 3KWTA 2F19H 4HPYL 1OLLA 5BS0E 5JW3H 2AEQH 3V7MA 4X5PA 3DX6B 4ZMNA 2MKWA 2VDRH 1FWXA 2R0KH 4JVUA 5F7LB 1QFWH 1YUKB 2ARJA 5TE4H 1NLDL 3VE0B 1RFDH 4F7CB 5KYXB 3HVNA 1HYSD 1F4YH 1A47A 2I60L 5AW0B 5A2BA 3CFCL 2VZVA 3EAKA 3TBWA 2YQ2A 2YAHA 4G71B 3AT9A 3D39B 1UXSB 2C9PA 4JPSA 3OPZH 4UQ2A 3WKPA 4RA3A 4DO4A 4F7EB 3J8F7 1JK9A 3VTTA 2RJMA 2KT6A 4YHMH 2FEDC 2ORBH 2X4PB 2IOOA 1VCAA 4BWUA 5D1QA 2HAZA 4IGBA 2GSMB 2BLFA 3QUYD 1DFBH 2QKSA 4WUUA 1FC2D 4EDXB 1T03L 5G5DA 2X2UA 4ZFZA 1U8IA 1AQ8A 2Z1KA 2FEEL 4UT7L 4MB5A 2BS8A 4YDIL 3BVXA 4WU5B 2CRZA 3C5ZB 5IHHA 5C09D 1ID5I 4QNPE 1D6EA 1P7KB 3QE5A 2EEBA 3MDJA 3KHQA 2BSBA 2O6DA 5HD8C 4HEPA 4LVOC 2XT1B 5EC2B 8FABB 4PLKD 1M53A 3Q8BA 4G8IB 4KH2A 3MNVB 1WS8A 3DK2A 3QJXA 4P5MB 2JCCE 1LVEA 4PGZA 1ZGLB 2YWZA 2JB5L 4JKLA 4KOBA 4K7PY 3K3QA 5B1KA 3ZTNH 3W9DA 4LNRA 3TEYA 3NUKA 4XNZC 1NAMA 4JO4H 4JRFA 4X0NA 1UZ6F 4PH8A 4FFTA 4XI5C 4F8QA 3WTVA 2XKNA 2EQDA 2YEZB 3L3DB 4B50A 1H15A 3REWA 3ARUA 5CN1A 3WJLA 3ES6B 4JPIA 4KJPD 1JVOA 2O5YL 3BGMA 2HG5B 1P0SE 1MNUL 5GGTL 2YFOA 3WUWB 3BWAB 3O3UN 1U4FA 3CJJA 1YPZB 4GRWH 3LH8A 4X0KB 3U48A 4HS6A 5CWSB 5KJ7E 2YD9A 1XSOA 1BOGB 2GIYA 3SDYL 4QT5A 5TE6L 1VADB 4HYTB 1J48A 1CWVA 3R4RA 2VLRA 4IBSA 1VGEL 4ISVA 1F0LA 4NRXA 1BIIB 1ZT7A 4Y5YC 3IU4H 3P3RA 4UB0H 4YHLL 3HG1B 5E2VH 3MO1A 1DQDH 3VU2A 4JHVA 4QF1B 4MAUH 4BZ1A 2J4WH 5ACZB 4NI6A 1L0QA 3KH4A 4XP4L 4D0DA 2WIMA 2B9AA 5SX5H 1J1XL 4XMLH 2IG2L 4X8JA 5E6IA 5C6TH 4AH2B 4ZSOE 3TGXA 3EH4B 3IJYB 3LDBC 1JZEA 5DZVA 4ICXA 2FX7H 4ACTA 2D3JA 4JREB 1ZSDA 2R1XA 1LO4H 3ESVF 4LK4A 1K72A 2HTKC 3LQZB 3QQ3A 5F1IA 5LXGL 3K8LA 3WN6A 3BDYL 4ESKA 3BPLB 2V2XA 4KO5A 1C7SA 3JUYA 1PZCA 2BX5A 3NK3A 1JWUB 2JH2A 3WJMA 3DRTB 2PXYA 2AABL 1OSEA 3CX5K 1HS6A 3Q6FA 2DYPD 1DFXA 4JG0L 1AACA 4QHNA 1INDL 5FWRA 4I18B 5C92A 3CQFA 5J57B 3P30H 4J2XA 2W60B 2EKJA 1O7DE 4K94L 4PCKA 4DW2H 3ZW3A 1EANA 1Y0LB 2H32H 5FUCC 2MNWA 4Z7UF 1PY0A 4OJFH 5GJSH 1A3ZA 5IMMB 3JVGC 3GS7A 4H0HB 4UANA 3K5SA 4KNTA 2X70A 3TTYA 3X12B 5IW3A 3IFOA 1ZTXH 3MV8D 4JCMA 5K9JL 1KCWA 3BPOC 3CIAA 5JQIB 4NQSB 1UWXK 4NPYB 4MQSB 4R7NB 4DETA 3FUMA 4IW4C 5ALBH 5TQ2L 1PQZB 2BCMA 3L2LA 3K81A 1T22A 3MOBH 1G7QB 5FW8A 3F62A 3NJJA 4MKTA 4Y16A 2H3NB 3QJOA 1CFQA 3VDBA 2HT3C 1CO1A 1DL7L 4OFYD 3QT2A 5SWZD 3Q0HA 4KHTL 4YSUA 3B2UC 2KQNA 3I02A 3MRJA 5FHAL 1L7IH 2DYRB 3BAEL 4I1PA 3HCVA 1QUNB 2EDTA 1J87A 4JKWA 1C5DA 1RZKC 1CDGA 2VZOA 3NACL 3NIFB 1V10A 5LB1A 3KM1A 1A7PL 1XB8A 2WYZA 5HDWA 4XCCL 4HWZB 3WIHA 4P5SA 4ZX6A 5TJWK 3FCBA 3TO2A 3WEOA 4MQTB 1IM3A 1T1XB 4Y8AA 1QFPA 3ATFA 2I9TB 1LO3H 2NYZA 1Y1UA 1JZ4A 1ROWA 4JX0A 4AYDC 1XH3A 4HIEA 1U58B 4OZGE 3TJHC 5L88L 1GC1C 4K5OA 3F3HA 4TRPH 3T0ED 3TBBA 3BO8B 4NHCL 1A6TB 3E9TA 1HEZA 2EKSB 2EICA 3O2WH 4FCHA 4OIAA 4UOW1 3O9WD 1BDYA 5DQDH 3UTSE 1MY5A 2Y7OA 3M8OH 3FOLB 5F1SA 3WXVL 1G6RB 4YHKL 2X4NA 4WFED 4ZW7A 5I1DB 5D7JD 3FFDB 3MACL 4POYA 3VW3L 1JGDB 3WD5L 3HNTL 4JPQA 4YHYB 2AEWA 2WCSA 3LZFH 2BNRE 2AXFB 4CN1A 1CK0H 1FORL 4GRLA 5MERA 5DFVD 4Q7DA 2VDKH 1GCYA 1P53A 2CIKB 5H94A 3GUTB 2QZ5A 1KIQB 4QXTA 1ITCA 2FUQA 1N7ML 4AKPA 2CJUL 4I4WB 4XPTL 2BFGA 1U3HA 2VH5L 4XPHH 4CN4A 4TNVK 3P3TA 3QUXB 2CXKA 3CZGA 4JQIL 4U1HA 1LQSR 3GSNL 1KBBA 3T1FA 5TK4A 3H3PL 1W91A 2FO4B 5AKSA 1K8IB 4JK0D 2AK1L 4U2YA 4V33A 2QLVB 4G42B 4P2OA 5IROC 4R4NC 5E08H 1NIAA 1BHGA 4I0PA 1PLGL 3N2JA 4RH4A 2QVMA 2RH0A 4JRXA 1CD8A 1ZA3A 4JN1H 2Z35A 3OKNB 2HX8A 1FG9C 2LVEA 2OJZH 4AENA 2N7SA 4RQQA 4Y4KC 2XVKA 1EAQA 4NOFA 3G6JA 3SJVE 1HXKA 4ZK8A 4XN8A 3ARBB 5IW6A 2KBGA 3WNPA 5C0IA 3Q2VA 5GRJH 5CP3A 5CKGA 3C08L 1KXQE 1HVXA 4FNRA 2J3SA 3QDGE 2F8XC 2KZ1B 2OR7A 1OP5K 2H3XC 4H8VA 4KTYA 3DDFA 4M6OH 4MD0B 3WFEL 4B0MM 2NXYD 2QADC 3EADA 1EZUA 2A4CA 1E3FA 1FN4A 3F04A 4JPKL 5BZWB 5I71C 1D7FA 3J07A 1WBXB 1IEBB 3NRPA 2FX9H 4H26B 3DJ9A 3DSFL 1ZIAA 5C1MB 1JHKH 2VUOA 2QKIC 1DBBL 1AR2A 2ITCA 3DXAD 8CGTA 1TZHB 3UEQA 4AXWA 2XQ0A 4X6EB 2BDNL 1DLFH 4G7YH 1LL1A 5C86A 4HPHA 3D0VB 2IXQB 4PS4H 3C60A 3QUZB 1GCFA 1KTKE 5L7XL 3TL5A 4PRBB 1RPQA 2AK4D 1TETL 3MLSH 3ZKMD 7PCYA 2VDPL 3IJHA 1PZ2A 4YHNA 1S9YA 4G6AC 4FP8L 4Q56A 2D7TL 2QTVA 3GHEH 5DHXB 4IRJA 1K2DA 2E7MA 1KTLA 3QIUD 2CUIA 5CLXA 1EGJL 4M6NH 5DD5L 4HMEA 3T0BA 1AKPA 1TZGH 4N6RB 3NPSB 4JM4H 4QMEA 5B7EA 3W9EA 1FE8L 1FA4A 4I9XA 4OLUH 3L9RA 2W8CA 4ZX5A 2FBRA 3GI8L 3OVUB 3D8MA 2UXGA 1WGOA 4ANKA 5ISZB 3MLUL 3BZEB 1UD5A 4H2CA 3CFDA 5TF0A 3G6AB 3N40F 5ITFA 1T1WB 1F86A 4UNVA 2FYYA 5EBMB 1VRSA 3RWEA 2DQIL 2NXZD 3U0WH 4UU9B 4OLWL 5MI0B 4CSZA 4FKHA 1LMKA 3ZDWA 3MNDA 3NCBB 3U7WH 3VXRD 2AZAA 4LCIH 1ZV5A 3HB3D 4N2MA 4EBQH 2X7LB 3V0VB 1BVLB 1IEAA 1QP1A 4FZ8H 2NY1D 1LK3H 3MJ8A 4XP9H 3L4UA 4HHAB 1HSBB 3WU1A 1MCCA 1DVYA 2NY0D 2Z91B 2OYPA 3RHWF 5DWUL 2XV2A 1NC2D 1UG9A 1P69B 5TH2A 5BOPA 1P5VB 3Q2NA 5EO0B 1YC8A 3ABZA 4MNHB 2ZOWA 5CBAA 5SV3A 4KK6D 2WLYA 1FV1B 5IBLC 3UAJC 5JPMB 5E23A 2XDHA 3KXFE 4ZQKA 1HHJA 2YAQA 5CUSL 3QEUB 4MLSA 5EV7A 1IBHA 3GZKA 1JSYA 1R5VA 2W9LA 3ML9A 4HIXL 1I9IL 4NKDA 3WJJC 4WHTB 2JELL 5FUZH 1MJ8L 2QEJA 1BYNA 3ZKND 4MAYD 3QO1A 1BEYL 1TKWB 1MCOH 4L3EB 4JY6B 1UCBH 2VZTA 5EMYA 1RUAL 5AFAA 1X5XA 3TVMB 1IQWH 1P9MA 1RPUA 2WXPA 1KYUA 1QG3A 3FU8A 1DJYA 1XIWB 3EGDB 5KJRH 1AS7A 5CKAA 3S6CA 1ES0A 4RNRA 3TT3L 2XY1A 1NSNL 4BZ2H 3BWUC 3FU3A 4OKVA 4KTDL 5I15L 2ZX5A 4ZMXA 3H9HB 2P5EB 1TTFA 1U8KA 2J1ZA 1A4BA 1IL1B 1JRHL 3K6FA 4FQCL 4QTIL 2J8UB 2W0LA 1RZJC 4Z0XA 1AJ7L 2FAUA 4HS3B 3ZDZB 1S3KL 2N1TE 4JVPA 4PJXB 5DYFA 1S4IA 4Z7UA 1WS7A 3WXWH 1CVSC 3CFKA 2WWMD 2X0UA 1J0IA 4AUUA 1QTPA 3MBWB 1R9FA 2W1NA 2IV9A 1NDGA 1FLTX 1IIKA 2Y6SD 1N5YL 2V4LA 2VDOH 1LO5B 5ESAA 1S9XB 2E6QA 2X4SB 4OTXH 5IQOA 1JXDA 3JV6B 4RGOH 2CLRA 4AYBA 5D1QD 1QO3B 1U21A 2ZE0A 3KDMA 2X38A 4P8QA 3US1A 4RVBA 1YYLL 3NIGB 4PV9A 1DQMH 5DYOB 3KJ4B 1OZUA 1R5IB 3GLDA 1DQLL 2PETA 3EJCA 5IFHL 4N9OB 2H0PA 5C9JA 3BCDA 4IIQA 4WUUD 2ERJB 1XF2B 1MCKA 2JQAA 2DIEA 5SWSA 2WVTA 2VLKA 3NCFB 3NSYA 4XC3L 4LNVA 3NJXA 4C83A 3KPRA 3L3JA 5EEZA 1A7BA 3CUPA 4OI8A 2YA0A 4ZZFA 3ARDA 5JXEA 2A9NH 4L4TA 2EYTA 3GXIA 2A77H 2EDKA 3LQMA 3C5XA 4K7PX 4WFGE 5C7XH 2IGFL 1PIGA 3MREB 4UOQA 1OB1B 4CU8A 3QAZC 2XA8L 3BPLC 4PJAE 2FBJL 3DX2A 4HBCL 2XQBH 3H85A 4UINL 5TGBA 3QJFB 5KBDA 3VFSB 5J7CC 3EJSA 1NBZB 3MA9H 5FEBA 4NM8H 5F9AC 4KI5D 4LEEA 4WKZB 2EILB 2R2CA 5AL0A 1RSYA 2D0GA 4PGCA 1NBQA 3WKML 2B1HH 4XAWL 1VB9A 1DZBA 4CGTA 4J1UA 1JAEA 3DX7B 4FFZH 5F7EL 1EZVY 3VUAA 2PW2B 1A6PA 5AB0A 1JMZA 2VLRD 4UAOC 2BC4A 1NQBA 1A14H 1G7PB 2YLHA 3MYZA 3IGAA 2ZNWA 1IBBA 3NFPB 5L6YH 4AQ1C 5FGCB 3V6ZB 3ILEA 3ZTDC 2R51A 3ABLB 2CUMA 1DVQA 2R69L 5ECJE 2KPNA 1XT5A 5IVZB 2R7EA 1PKOA 3P2BA 1JGUL 4ZYKB 1DO5A 3BGAA 4NN7B 2RFXB 3BKJH 3MJWA 4NKOA 3LKNB 5INCB 1YHPA 2WO4A 5KUMA 3D85A 5E6ID 1SYVB 4O2FB 2YPVA 4XB3A 1JZ8A 1QW8A 4U1KB 4PY8I 1IGCL 4TOYL 1QLEH 1IGJB 5CILH 1ILUA 1VIWA 4V1DA 3S98A 1TJHH 1WEJH 3L3OB 3QZNA 1TNMA 4KXBA 4TVUA 3SQBB 2NNRA 4ZS7L 2VNCA 4R26H 1HWWA 1DVFA 5DK0B 3VGGA 1N5AB 3BIAX 4HXBH 4E9LA 2PXYD 3VI4F 2ZG2A 5CFAA 3GT6A 3U2IA 3LD8C 5HHXL 1P4UA 3CZLA 4M7KH 5D7IA 2GSIB 3VGHA 5B39A 4ELMA 1A6VH 4LOUC 2EDWA 2EYSA 3UZEC 3OZ9L 4YDLC 4W9ZA 3QXDA 5FR3A 3HRPA 1W0WA 2Y36L 4OQTL 3MNZA 3PLYA 3BQUB 3GRBA 1BFVL 2X4TB 2DJUA 4YHYC 1QRNB 4IS6B 3WI9A 4ALAC 5JNYA 5T1DL 2DYPB 2HMIC 2X3BA 2CKNA 3AGWA 3VMPA 3S5ZA 1I8LC 3VRJA 3HUJE 4GAYA 3QO0A 1OV8A 4Y16D 3HC0B 1L7TL 3PHOA 4OZIA 4NI3A 3VG0H 5I1LA 3EGSA 1WWBX 3MV8B 2DBLH 4L8SC 2ARJQ 1BD2A 2BXZA 5DD1H 2AI0L 1C12B 2XLLA 2ZPKL 2V3EA 3C87A 4XNAA 3O11A 3OB0K 2QELA 1AC0A 3FYEB 2VW7A 1C1EH 2AVGA 5IVOA 1RP9A 1Z5YD 5SWZB 3ZL2A 2DEYX 1IM3D 3EUDA 2W9DL 4QHUA 2ED8A 4MXVF 4WU7B 4WF7A 1MRCL 3HKFA 4I3RL 5ILTH 3MCLH 2UY7A 3FAWA 5TQ0L 5HI5C 1ZANL 3W0WA 2WTPA 4FG0A 1DUYB 4P23A 4MTMA 2PW1B 1QASA 2YJQA 3ARBC 4PRPB 3QEGH 4MB3A 1W72B 3B5HA 2PTUA 5TF1H 3QIWC 4R8WH 3TN0A 1U0QA 2ADIB 4XPGH 1SEQH 5AAWA 1CF8H 3O3AB 4MA3B 2DY2A 2GSGA 3N9GH 3RZCC 1JS4A 4C4UA 1G1YA 3Q1EA 4IJ3B 2RQ8A 2CO1A 3QJTB 3G5VA 2NY3B 3VD1A 2X6AA 4AG4H 1KCSH 1A2YA 4GRLD 4W93A 4WVRA 2BY3A 5C0FA 5D7KE 3KLKA 1DVZA 3O9WB 1JNHA 3E7JA 2YD6A 1LDPH 1INEH 2APVA 4Y5XB 5DRNA 2VXTL 5EEUA 3EFDH 1Q8MA 1U3HD 3EJQA 4PLJD 3TA4D 2CO7A 5D7JB 3TH4T 5GS0C 3VI3B 1LWJA 4GOSA 3C9NA 1JV5B 4QAMB 4PJEB 2XWJA 5T3XD 2PABA 4KZ0A 3VFNA 5CCKH 4PJDB 4P2OD 3N3EA 1ZPUA 4I0PD 4JRXD 3SGEH 3GMPB 1XVSA 4ODSH 3C5JB 4MS8C 2BZ7A 4F91B 1B9KA 3CU1A 3C09C 3GDBA 4N9GA 5EG6C 1R3KB 3RDTC 1T2JA 3GGWB 2VR6A 2CGRL 3CC5A 3Q01A 2YQGA 1I3VA 1CC3A 3NPSC 4XAKD 4UOZA 2R2BA 3IDJA 3LRSB 4I0KA 2YMTA 5I8OL 3MJ9L 3TP4A 3ABKB 3KEHA 1G7IA 1GGIL 3POCA 3FSWA 2EXYC 5GS0H 2WLNA 4NC2B 4CNIB 1JPTH 4DERA 1URZA 4MBOA 5CJ5A 2HVJB 3TZVA 5E5UB 2XWBA 3MGTB 2DTSA 2OZNA 2TAAA 4WCYH 5HDRA 3UAFA 5MI0C 5HDBF 1OTUC 2YXFA 3U2JA 5GGTA 3VCLB 4IKLA 4UILL 3PAVA 4DO6A 1EPFA 4J3WA 1KFAH 3T6VA 2YBRA 3DX1A 2TRYA 3T8VA 2WWNA 2H6PA 4OLXL 2TSAA 2Q7YA 3L3IA 3QEQD 4DSYA 1I85C 1GKEA 2N1KA 5CZRA 1MIEH 5JA9A 2ICWA 3RBSA 5LQBH 3B9KA 4R96A 5DHYB 5E6SB 4RAHA 4G72B 3GD1C 4PWGA 4MJ5A 4PW9A 3WMSA 1RZ8A 5DVPA 3DV4B 4N0CC 3ZSTA 1QBBA 2EXSA 4HJSA 4MMXC 4K3EL 1U3JA 3LMJH 5AOZA 5BJTA 3GTVA 1J0HA 4NWTH 1EEUA 3CXFA 4ZFGH 4YWGH 1XZ0B 3BUYB 4QRQB 5SV4A 3OKEA 4L2LA 5JO5B 1WC7B 2DWSA 4Y9BA 4LPYA 1J0ZA 2HB0A 2XG5B 3PWLA 3DXAB 5LCVL 3LXAA 4K7PL 1ZLSL 4IRJD 3OMZA 1XIWC 3CZSA 1KZQA 1M05B 2OMVA 4EXKA 5D4QA 2VOTA 4FG2A 2EO7A 2BHYA 4X4ME 2XU9A 1N64L 2ICEC 1M2VA 5FYKD 2CO6A 3EO0B 3I6SA 3QWRA 1IMHC 4YDMA 5E99L 3GO1L 4TSCH 2P48B 3MOAH 1NJ9B 1NGXA 4EI5A 2AK4B 4HF5L 4QLRA 1NCCH 5DJ8B 3D12B 2DM2A 4JFDA 2XUWA 1HFUA 4OLEA 2NNAA 4YR6A 1MW0A 1EV2E 4QTHA 1V3MA 3QIUB 5HXMA 2AHIA 2MKLC 1QSFB 3EIFA 3Q13A 1A1OB 4NKMA 3ZL4H 3ULVF 4KUCF 3PL6A 5AYUH 3DMMA 4TNGA 1VESA 1HE8A 3NSFA 1EERB 2OZ4H 5HGHA 4C54A 1ZT4A 3BD3A 4FN0A 2D8KA 3UGEA 3T77B 3RWJB 1I8MB 3MLPA 1S3RA 1ZDSA 2YRZA 2EIJB 4ANWA 4QXUL 3C6SA 1A7OL 4X6DA 2XTSA 3D87B 5B39G 3FT4A 5GGSB 3PIQB 4ZUVA 1HZHL 2YSTA 1WICA 4GLRH 1VZIA 3OHXA 1LEKA 2OTUA 1CLZL 4N0UE 1HSAA 3G5WA 1HYSC 4LRIC 1AH1A 2O93L 4KK5D 4PRDA 1MEXH 1ND0B 2A6JA 3CZUB 4U6VH 5F96H 1VZHA 2AQQA 3UBXB 4ZMLA 4NZJA 5DO8A 1H8OA 1SFDA 2HRPH 4ZUSB 2GYSA 1MHCB 4Y9FA 2X4RA 4OGXH 4P9MH 1NC2B 1GPOH 1S7SB 4O2EB 3H2PA 4LCUB 4GFTB 3IXAA 2V9RA 3KVPA 2VSKB 3IFPA 3QUYC 5B1AB 1D5XA 4U4BA 4WI5A 3O3BB 1AZVA 3KYAA 1B0IA 3M6DA 1A7NL 3U1SH 1I75A 1JXKA 3HAEH 1JWMB 2OXGB 2ZUQB 4M61A 1CVRA 1CT8B 2Q3ZA 3JT0A 4JFPB 1JWSB 1AGDB 1OW0C 4NZTH 1D9KA 4DZBB 2VUKA 4UV4L 4AX3A 1E28B 3CH1B 3OAUH 1WP6A 3BP6B 4PJGB 3D0LB 2X2YA 1CFSB 4PLKC 4XCFH 1HX0A 1JNNL 4MXQD 1UZ8B 2J5LB 2P5WA 4JCWA 2VISB 2VDRB 1X9RA 2Q1EA 3EH3B 5F7DA 3P4MB 4JGMA 2B1AH 2F54A 1A3LL 1W80A 1EZSA 2O6CA 3UTOA 4PJ5A 2WVSA 5IHBA 2ARJB 4KJPC 5FAAA 1HJCA 2VXSL 2GVYA 4Q2ZB 1P7QB 2L7JA 4JQIA 3GSNA 1A0QL 1JZDC 3ARXA 1QLFA 4NQVA 3ROOA 4UQ2B 4JO5A 4W9KC 1NUFA 3CK0H 3GMNA 3KVDD 1JK9B 1USQA 2XV0A 5AW5B 5FKAA 1WWWX 3QZBA 5SWSD 3OGCB 2VLKD 2GTQA 3KPRD 4LCYB 5JR1H 4M5SA 4WO4C 4E41E 1BPLB 1NM9A 5DA4A 3CC1A 3ARDD 4IGBB 5JXED 2ZXDA 2VC2L 1OAQH 3GSVB 4L4TD 4JM2F 4MASA 5C0AE 1W16A 4B3EA 1LWRA 1RUMH 3LY6A 4XMPL 3VU1A 2X88A 3DECA 4OCNC 4FQIH 5E4EC 4JVWA 4J3OF 2E0PA 1E43A 3HE7A 4OJDH 3MV7B 4F9PC 3VD7A 2GI7A 3DURA 2H7WA 3U6XA 2HT4D 1TIUA 3VD3A 1NBVL 1IRAY 1EHLH 1D6EB 4R5VA 1K3IA 1EZVX 4AWJC 2BP0A 1ZVSB 4ODVL 4XNQA 3TBYA 3SKNA 5IOKA 3BH4A 4MA1B 3FU9A 4U31A 3UTTE 4M5ZL 2A2QT 4FL4B 4POUB 3W57A 1J1PH 3PWJB 5FA4B 3SKOA 1GZHC 3BAWA 4OT1L 3ZGHA 4YUEL 5JDJA 1NAMB 4HUCA 2WXQA 4U1SA 1X5KA 2COQA 2NY4D 2VDLL 2K9FB 2MTAA 1X4XA 3GPEA 3KBFA 3W38A 3C2SA 1M9WA 4IBVA 4QRUA 2AAAA 2KDGA 3IE9A 5EOQL 3J7HA 1JFQL 1F90H 1I31A 4ZNEE 3N41F 3WEAA 2VMFA 3QARA 3C6LB 3FBKA 3VFGH 4OVVA 3HFML 4HS6B 3IM1A 1EZLA 2YMXH 4OIFA 1WTGT 1VAHA 5JHDE 1J9SA 3AMLA 4QT5B 2JLLA 3F7YA 1QLRA 3D85D 4XHQA 5D1XC 2AITA 4ISVB 2WBKA 4EO5A 5FIEA 3FQ1A 4OGZA 3W37A 2PR4L 4PLNC 4QRAA 2ZXWB 2FZ3B 3X3FL 1EGJA 4V1DD 1TU2A 2M2DA 4ECNA 5CAYB 4RDQG 3WENA 5DDHA 3FB6B 2XNAB 4E42A 4N2OA 1KBGH 1DVFD 3CMGA 5KG9B 4DK6A 4ANVA 5F9DC 4Y2DC 3FMGH 4DWHA 4X8JB 1W9XA 1KV7A 3DIVA 4KGJA 4M4RB 4X5RA 4WAFA 1P5UA 4DEUA 1XB3A 1I53A 2Y7SA 1WZ1L 2R1XB 4OZFH 5BVPL 3MJ6A 3SE8L 3QQ3B 1AFVL 2YKLH 5EH1A 5F1IB 4Z76B 5JPNA 3LH2H 2A4ZA 4LPVA 4AGMA 1OVZA 2I7SA 4N4YB 1G1OA 1B0GB 1KGJA 2R4RH 2OMXA 3T0EC 1E5YA 2CH8A 2H32B 4JLRB 1U8NB 2MQ3A 3BVWA 3LJ3A 3ARGA 5L4MA 2W38A 1BSIA 1NH6A 3O9WC 1ZS2A 4WTZA 4DGVL 4G5ZL 5F72S 4RISL 4Q97A 1C8QA 3HI5L 5ETUB 5IF0A 1WA1X 4MJ4A 1PG7L 3SPGA 1KNOA 4NPKA 4K2UH 5D7JC 1I1AB 4WIQA 2XYBA 3IFOB 4KFMA 2E86A 5GS1C 2LR4A 4M43H 2M8XA 5I74B 1BD2D 2LLNA 2MPVA 3RVUD 5BV7C 3L48A 5DFVC 3HVDA 2F8VA 5E2WL 2XWXA 1JN6B 1T22B 3T71A 2CJ3A 2EEAA 4BUHA 2J71A 3ILQD 2QQKH 4OD2B 1CFQB 4MCYB 5FV2A 5DJCA 1UB5A 3MRJB 4Z7QB 1UJ3A 1TQWA 4PJBF 2UV3A 1UD3A 3R8BB 2I85A 3RB7A 5J5EA 2ATKB 3OZKA 3HHMA 5AQ0A 1CXEA 2R0ZH 3HCVB 4OV6F 5LDSA 3S8WA 1C5DB 1THCA 2VXUH 4KAQL 4TQEH 3W0WD 5CJXC 4YC2B 4P23D 3MLYH 2XXFA 2DIBA 4LT7A 4RFNB 4AV4A 4D8PB 3PAZA 1M7IB 3I50H 1CR9L 3H9SB 3FH8A 2FX8H 3TO2B 1EVUA 4D3CL 3NJVA 1KBVA 3TN0D 3S88H 4CUCA 2QQNH 5K9QG 1GYWA 4XPBL 1SOXA 1BMZA 4HHGA 1PYWB 3GK8L 4HIEB 3TV3L 4HSQA 4N8VA 4GSUA 4NWUH 4L8DA 5LDUA 3OV6A 1NMCB 4Y0GA 1DBAH 2J20A 4X9YA 4D9QD 3QC5X 4YGVA 1WBYB 2F1BA 4MNGE 3ULVH 4BKLB 4PWHA 3PY9A 5TD4A 2Q8AH 3ZU8A 1QWUA 2BWQA 1LO2L 2VDKB 1MJJA 1NKGA 3HG0A 4F9LC 2NXYC 4P9HH 1E4KA 4HK0A 3VXSE 5T3ZE 4GRLB 4JFUA 1XF3B 5DEGB 4OZGA 4GI6A 4OGQC 4AW4A 3CAFA 1UUNA 4QXTB 4Z7WF 3RFZA 1XCXA 4R7LA 1IC7H 3A4EA 3QUMH 2WXIA 3T3PF 4Z18A 1YAIA 4X9IA 3HN3A 1IKOP 2OLDA 2X12A 4NN6C 3FB7B 3OLEA 3F7LA 3HMWH 3PUCA 1HL5A 3FQ2A 3RKPA 5B1BB 3TNMB 2ZWYA 4DFHA 5F6IB 4V2CB 3ZQXA 3ALWA 1E9OA 2ZUVA 2F5BL 3O6FB 1J8SA 2BNRA 4K4KA 2X2IA 4PG2A 2HLAA 4FQJL 4LSQL 4HQQH 1ZA3B 3ZKMC 4BFRA 2ROXA 5EOCJ 3H9ZA 4UT9H 4ICWA 5AD0A 3EOYG 2BVPA 5KYWA 3V4PH 1G87A 4XN7A 1RCYA 1M7DA 2Q87A 4RQQB 3SPJA 4QO1A 3NEOA 1MFAL 3L5WA 4F2EA 3SPVB 4YDVB 4OV5A 1UH4A 5BRZB 1JYXA 2A99A 3UC0L 5JOEA 3G9AB 2H9GB 3EG9A 2PYEA 4KI1A 4RWYL 5C0IB 1NBYB 4F27A 1BFOA 1MCPL 4LL4A 2NXZC 2DKUA 2DQFA 4IHOA 3B9KD 1P4BH 3AC0A 2DQUH 4HFUH 1GA2A 2FGWH 2AJZB 3HB3C 5D2NE 4HUUB 2YPKA 3VVVA 1UA6H 5A3IC 1FN4B 3KYMA 5IJVA 4PJ9A 2NY1C 2BPBA 1OAYL 3A6CL 5GPRA 3O0RL 3DX0A 2IBZY 3WTSA 4RAVA 3AWGA 4X99B 2WLKA 5F3BA 2NY0C 3DUUA 3SJVA 4NFCA 5LGHL 1NFDF 3V95A 3TO4A 1CGWA 1L6PA 3X1BA 1UASA 3JVFC 3ULUH 4F2ME 2F7IA 4AXWB 3P0YH 4KK6C 1ET7A 1JVLA 4XVSH 3WSQH 3I84A 4B95C 2OMWB 2YQ3A 4JM2A 1MFEH 2YD3A 1ZXKA 2ZUQC 4LEOB 4MJ6A 5FUCE 4ADJA 1R3HB 2B3IA 4JFXB 5JDSA 1H6FA 3QWRD 3ZKNC 2WW8A 1IVLA 3C60B 1IBYA 1MJUL 2IGLA 4MAYC 4OUUA 2VZ3A 2Z4QA 3RTLA 4EI5D 3UJTH 3UAAA 5JHAA 4YFDB 1KJ3L 4WHYG 4JFDD 5DJDA 1MNNA 2OFQA 4NQEB 4PCSA 1IGFL 2VTFA 2G9KA 4IRJB 4R6UA 3OMAB 4OQTA 3S36X 3QG7H 5MHSD 2AEOA 3PL6D 5J1AA 3DMMD 3RL1A 2EH8L 1YG9A 3R4DA 3W9EB 2L7EA 1GGCH 1XGRB 4LQFL 4LMQE 2IWEA 5CXPA 5FYLL 3GXNA 1ACXA 5C71A 2VSCA 3S96A 1KCRL 2DYSB 2OPCA 1R75A 2OCJA 1MI5A 35C8H 5IKCB 2E9GA 3SDXF 1U42A 3HC2A 3U9PL 3UCRA 4R5TA 4HXAL 4N8CH 1HKLL 1TQSA 3HZYB 1BAWA 2GBVA 4XVJH 4J8RB 2WWMC 2D03H 2VT0A 3BZ4B 5K59F 1RJLB 3VTAA 4WW2B 2Y6SC 3ZHFA 1JCVA 3VFWA 3MJ8B 5FLVA 2EABA 4UQ3A 1E3XA 2Q86B 1Y6KR 3QEHA 1Q72L 1MOEA 1N18A 2J5WA 2IV8A 3D6GA 3HS9A 3MYJA 4Y1AE 4DQAA 3ZKSD 1EAJA 1GSMA 4WTZG 5D1QC 5TH2B 3Q8FA 3P54A 4XNBA 3C8HA 5FO9A 3A23A 1V3KA 4PJ8A 2UVFA 4ZQKB 3SBQA 3F12A 4NKDB 5D72H 1DZ0A 2CQVA 1DUZA 1CE1L 3AWFA 1F5WA 4U6YB 3RJQB 2GJZB 3WFHA 3DHPA 1D9KD 5TDOB 4AYGA 4GEIA 4UZGA 4K07A 3V4VL 5I5RA 5HI3D 5J4MA 4OCRH 5C0BB 5MP6H 3CVHL 3GMMB 2KC0A 3MRQA 3IJ9A 1ES0B 3AU1A 4AK2A 4UF7C 1J0JA 4FL4C 2EIDA 3FDWA 2DLIA 3SKJH 1PZ5A 2XI9A 4G3YH 4ZRGA 4Z23A 2P5WD 4OKVB 4N2HA 1X5AA 2CPCA 4NCC1 4C58B 1U8KB 3OJMB 3AZUA 3MNWB 2F54D 4NLHA 5HYSG 3O4OB 4KI5C 3KMDA 3WY4A 1XFPA 4PJ5D 3WJLC 3WELA 1XAUA 2VDOB 3QFJE 1UOVA 4Z7UB 3BPCB 1FCGA 1SPDA 1EO8H 3LXBA 3WDJA 3RWGA 2AJUH 2AMGA 4NJAL 5D4HA 4CDGC 3RGVB 3VH8A 1QACA 4N8VG 1HH9B 1T6WA 4M9PA 3V0IA 3DRQA 4TS6A 4LRNL 3H7BA 3QDJB 1XF5A 1MFBH 2O1AA 3KDMB 4ADIA 4HG4K 3I74A 2Y69B 2Z8WC 4PV9B 1DR9A 3U82B 1H5BA 4K73A 2VO8A 3K72A 1A6WH 2F9BT 3BT2L 3LHAA 1MREH 1TTGA 2Z93B 3ZGIA 1KXHA 4G43A 4DKFH 1A1MB 5IB4A 1WZLA 4KDTA 4NGHH 5C9JB 4PGJA 2WMPA 3MJ9A 2K45A 5AWNL 4PJBA 5I82A 3HE7D 2VE6A 3KPRB 4JDZA 4C83B 4DGIH 5E6IC 5IOPA 4J6RL 3KL0A 4AKOA 3ARDB 2L8AA 4LIQH 1G7LB 3AQZA 1OGSA 2NDFA 2WWKO 3WN5A 1IAIM 2UZIH 4LKCA 3U0TA 3ZBMA 4QHMB 4JUSA 1TPXC 3LXCA 5FHBH 5TGBB 3VGAB 2E7DA 2PXYC 4XWGL 3AY2A 2W88A 5HYJB 5LNGA 3VG9C 3KPLB 3T0DA 4EVNB 2NTFA 1M6UA 5T3ZL 5CNHA 3S3DB 5KYUA 3VWJA 1T0NA 3OHMB 3BD4A 3OXRA 3EYVA 3AAZA 5J1SC 4FF9A 3V8CA 3P2DA 4BH8A 3L45A 2W65A 4HAKA 3FF8A 5EO9B 4Z77A 5HYIA 4K9JA 3ARFC 3HJEA 3T8XA 4NUJB 4EN3B 4BE5A 2H0JA 5I74C 4MB1A 3FQUA 5MEQB 1AHMA 1QMUA 4NT6A 4ELKB 4PB9L 1TJGL 2Y2WA 4O51B 1I3RB 3IGAB 1ULVA 2TRHA 4Y16C 5LCVA 4D9LH 4TSAL 4WJ5B 4U0RC 1UEMA 1CICA 4HULB 4Z7WA 4AQAA 3MCG1 1YQVL 4GKZA 3DHUA 4NQDE 4CMMB 3OGOE 2PMZA 5F88A 3X3GH 5BNXD 1TLKA 4N6QA 2R7EB 5DLMH 5BO1L 1QLEB 3IF1A 3WKNA 4HJTA 4KKBD 2EDJA 1KC5H 4KO9A 3EW3B 4Y1SA 3TT1L 2WNKA 1XEUA 3CXDL 1SUJA 4XN5A 4IRZH 4EZJA 2XKUA 1ORQA 2VITB 5KW9H 1OARL 1AD0B 1LE9B 3F58H 3D39E 3UTPE 4OFDA 3QR1A 4V1DB 2DIAA 5ID1A 1KGXA 1DBMH 3OBAA 4P46B 4X4YB 4U7MA 3FUFA 1FH2A 3EBIA 1P4LA 3V6FA 1T83A 3ISWA 3FQTA 2CUAA 4XC1H 3KJ6H 1NMCC 3TCTA 5AOJA 5D4IA 1AAJA 1AG0A 4ODUA 2IF7A 3ARGD 4X7EC 2NX5A 1AGCB 1L9TA 2EYSB 1ZEAL 2V37A 4E9TA 4AEIH 3IDMA 1GZPB 1OSZA 1YEIH 3ZYZA 2XKSA 4CKVX 3MNZB 2MPAL 4K71B 3UZQB 4B97A 4F2FA 4RMBA 1KTDA 4R4FH 5ICYA 2PTVA 4PLOB 1A6AA 1V55B 4GRLC 5T5NF 4KBPA 4GYBA 4OCMC 4FYQA 4Z7IA 1GZQA 2HKAA 4X5XB 3G08B 2BP5M 3IWUA 3MRBA 3O45B 3V55A 2MWCA 4ZAKB 3VRJB 4GAYB 3L4YA 1A4KA 3QO0B 3IDYB 3MLZH 4YE4L 1CXLA 2YXWA 3I9GH 4LGPB 4NFDA 1U3HC 1NFDA 4PLJC 5E8DL 3PHOB 2WO2B 5DMIL 2KLTA 2O30A 1NMAL 3OR6A 1BAFH 1T7XA 3BGFC 2FQGA 3RPKA 4HGKC 3WUZA 4LDEB 4P2OC 3WMPA 3V0WL 3V9EA 4I0PC 2CLZB 1T1ZA 5D96B 5KVDH 3O11B 4ZZKA 2PP9A 3QZMA 1BF2A 5ITBH 2DQGH 3HHRB 2AGJH 3IJEA 3HUJA 4QHUB 4R0LA 1HZLA 2PO6A 2I69A 3CX2A 1O9VA 1N0LA 2A6DA 1WT5A 3A67L 4FNLH 1OP3K 4BK4A 1I7ZB 1U91A 5IEHA 4KUCD 5T1MB 1I7RA 1TOXA 3EO1A 3UPAA 1N26A 2EDEA 3PAUA 1S9WA 1ACCA 4HJJH 1CDHA 5FUOH 1HEJC 2X6MA 4NQCA 4WFFE 1O75A 5A2LH 3DGCR 1S7VA 4WY7L 1RMFL 4WI9A 3DBSA 4FFYH 4NZ8A 4XZUA 2Q8BH 3CZKA 2PCYA 3M7OA 4D9RD 1JGLL 3ECUA 3OX8A 5L2JB 1E90A 1S5IH 5E8PA 1VKXA 1AYRA 4KRPB 1F13A 1JNHB 2IPUK 3S5LG 3FQXA 2WKOA 4TUJB 5LHDA 1X9LA 5DRNB 3RA7H 1E8WA 2Z1PA 3CBJB 3S4SB 4XPFL 5DJ0B 2WUCH 5AW3B 3VFRA 1E6OH 2WBWB 1SN5A 3VXTA 2O5XH 3TC9A 2WXKA 4S1QL 1RU9H 4K23L 4FG4A 3VFNB 1NC4A 5IQLA 3VFMA 3IMWA 3LX9A 4M56A 3TXAA 3WLBA 5I19L 1RIUH 2BNRD 2NYYD 2R0WH 3L7EB 3MRPB 2EUXA 3BP7B 3V8OA 3HZVA 1RUPL 4LLVA 3JBG7 4N9GB 4O02L 3TH2T 3QQXA 4UTCA 1I3GL 1MIML 4XN9A 2WANA 1KN4L 4IRJC 1RL1A 3CC5B 3NIDF 1SXCA 1QBMH 2DQTH 4Z95L 2R2BB 3IDJB 5JW4Q 2AP2A 2YZ8A 3DROA 3HI6H 2BIMA 1VSCA 3MSPA 2EDOA 1G7IB 3BN9C 4YK4C 4ZMQA 4L4VB 4P2RB 2KQMA 2NSXA 2PYED 1UM5H 5B38G 4KMLB 4W4OA 1EA9C 5IFAL 5B3SB 5I1KL 1WA2X 3TZVB 2OI9B 2XWBB 3O2DA 4IRSC 2IBZX 3P69A 4XMUA 2ZXAA 4AUJA 3N55A 3NIFE 3PRZA 1Q90A 1GW0A 2C1PA 1OM3H 1VGKA 4H40A 3VXUB 5CEZE 4MD4A 2K0RA 4PJ9D 3UBHA 1FL6B 1XCTA 2A5UA 2JNZA 3L1OH 3P3YA 2UWEF 4Y9GA 3SJVD 3L5XH 3WHE1 3TO4D 4JDEA 5EZIL 1UOKA 5H37A 3DUHA 5CEYB 5F0MB 1FF5A 3KR3L 1RZ8B 3D34A 4KK5C 3HNSH 2ZCKH 2F74B 1CFVH 1KBKA 3L95A 1KWKA 4JM2D 3KLHD 1J8KA 2R29H 2ATPB 1AQMA 3HZMB 3MZGB 2F53B 3V52H 1TNNA 3JYCA 3OKDA 4KPHH 4P4KB 5T1LB 2D73A 5EIVA 5GGRB 2YD2A 4ANUA 3A21A 4J3OD 4M02A 2ZYRA 3FQNA 4M3KB 3FH7A 4J39A 3KBEA 4G6FD 3B2VH 1OAJA 3ZRFC 2OMVB 2DQHH 2ZJSL 1BBDL 1QEWB 5DI8A 4OQ1A 2XXGA 2CO6B 1QQDB 5E95B 1RVFL 4QRSA 4ODTL 1ZCRA 2C1OA 4EI5B 4FHKA 4JNXA 2BW5A 4OVUA 1NFKA 1DJWA 3EHBB 5IHLB 1PY4A 2DLGA 3F05A 3R06A 4W6WB 4XBPA 1N0XH 1MI5D 4GO8A 4QTHB 4IBYA 1D5BA 2VL5A 3AG3B 4NKMB 4F93B 4K9EL 1Q9KA 3DMMB 5JYLA 1JPSL 1H6EA 1E4XH 2KERA 2ZNXA 1DQIA 5GRVL 4MXQC 1ZT4B 2CZNA 3BKCH 1JF1B 4TLSA 1BLNA 2CBMA 2E56A 5FV1L 4XMVA 4GXVH 4KJYA 4J3TA 1SJXA 4FA6A 1NCGA 3K2IA 4XRCA 3L3HA 3QZPA 5DHVH 4E9YA 1PZDA 3HR5A 1VEMA 1HSAB 4JY4A 3FULA 2A6JB 3INUL 3L08A 4PJ8D 4AVJA 1RZFH 3CLEL 4G2AA 4IIQC 2V3DA 2VRAA 1D5MA 1KIUA 5DF0A 5ALCH 4IKIA 5D71L 1XX9C 4JG9A 4YEFA 2MTPA 5J9PB 1FVDA 5EUOF 4EI6B 2CR3A 1BPVA 3IXAB 5JXEC 1LTXA 4H5SA 2KL6A 3AFLA 3IFPB 4WTWA 2HH0L 2Z7ZA 5F6HI 3IXTA 3GSQB 1YEFH 4TMPA 1BQHB 5I73C 5CEXA 3RIFF 3GC3A 3ZHNA 4PRIB 3HJ0A 3BVVA 2J6EH 1TO5A 1YJDC 2ADJA 2P45B 1J5OH 4YL9A 3TNNA 2HT4C 5I1AA 3VI4B 15C8L 3T4AC 3UJIL 5JIMA 4AM0Q 1J8HB 1MFNA 1QYGH 2CK0H 3MRDA 2NY5H 1CQKA 3E8UH 3IRZA 4GW5B 5HDOA 1HHKA 3MN8A 1X5FA 4K3JH 4FZEL 2ODIA 5JHMA 2IJ0C 5TFSH 4ZW3A 5AVYB 1MQ8A 3RJOA 3DYPA 1M7UA 4QRRA 4P48A 3LNFA 4KTGA 4JFEA 3E1ZA 4U1NA 1ZLVK 5KVFL 3D3VA 2F54B 3N1PC 1OGAA 2NY4C 4K0OA 4JHBA 4OM0L 4YAQB 2IFGA 2ADYA 4PJ5B 4AQ8A 4ONFH 4NKQB 3BLBA 1M3JA 1E2WA 3H2WA 1YJDH 4Z7VB 2VDMH 3P73A 4JQXA 3ZK0A 5IWLC 4P07A 3GSNB 3O2VL 4D7PA 3IFLL 4AIEA 3PQYB 4EQ2A 4NQVB 3SDAA 3ROOB 3NAAL 3PJSB 1TVHA 4P57A 4NUQA 5HHOA 4M7LH 3VM7A 1HH6B 3FU5A 3CMOH 2BVQB 1GS7A 1BX2A 2RIKA 4HJ1A 1F4WL 2DW5A 1MKFA 3GUFA 4KOCA 4WJKB 4TVPE 4H8PA 1F42A 4AIXA 4E9XA 4Y4FA 4IKKA 5E0FA 5GRUH 3BVTA 4JHUA 2YD1A 1MF2L 1DVFC 4D7BA 5LN8A 1LLAA 2Z6FA 2ZX6A 5HGGS 2OMTA 3EH2A 2F58L 2BRRH 1QD0A 2YUZA 2DDQL 3LKPB 3OAZH 4BINA 7PAZA 1S78D 1SLWA 3NABH 3VWJD 4HKJA 4XO5A 4UTBH 3U0PA 2BP0B 3WEBA 4XNQB 3TBYB 3SKNB 3WFDL 4E41A 2B2XL 3H1ZA 1WIUA 3SBRA 3BXNB 3ZE0F 1XD0A 4L3EE 2X2HA 3SKOB 1U41A 3TONA 3CSYB 3K2MC 1JHLH 4GMTL 3LHPL 5F0PB 1E9PA 4U1SB 2BNQB 3EDDA 2J88L 3MKKA 4LVHB 5CS7A 2OMZA 4OIBA 4NO2A 4XPAH 3ORJA 4U3SB 3HS0A 2Z7YA 3DHJA 3TBVB 3JV4B 5HGDB 2QSTA 4LU5L 3US0A 1CICD 1RZ7L 3SQOH 3PWUB 4B3VA 2C4XA 3STLA 3ZT6A 5KSAB 3HBPA 3ZZQA 1AR1D 1RIVH 2JJTC 1QI5A 2P5EE 3A22A 3BAXA 3GMLB 1IGIL 2GBUA 3CXHJ 3ZYJA 4TULH 3RVUC 2V2TA 1NCDH 3HG2A 1GRWA 4DAGH 5IMOA 2CD0A 2J8UE 2EEDA 4BK5A 1WIPA 3ARWA 5D96C 5FS5A 2YAFA 3ZDZE 4PJXE 1WBZB 3GB7A 1NEZB 3ILQC 4U6HB 3KD4A 4HDIB 3TLRA 1EEZA 1SHMA 4MDRA 5I8KL 2V2WB 5H2BA 4Q9QL 4M6ML 1WAPA 1KXTB 5KVGH 2AJSL 5DDHB 4ZW8A 2A73B 2IVFC 1A1NA 3KL5A 2NZ9D 2RB8A 3IDGB 4E42B 1ACZA 3Q3GA 5IHZB 2ZYSA 4QKTA 2R8SL 1U8MB 2FYVA 3CFQA 5L4IA 4P23C 3NIGE 1XGPA 5D8JH 1UFUA 4HUNB 1KLGA 4OD3L 1CGSL 5IJBC 5JHDA 3MLWH 5KTEH 4XP1H 2NX5D 2BMKA 1YYML 2G2RB 3TN0C 5IBUG 4LPUA 1TTAA 1OTSD 3ASNB 5AAWC 3P11L 5JPNB 4U33A 3T6XA 4L1TA 3B2PA 5DC0A 5FO2A 1CZ8L 2XPYA 2FHFA 3SE4A 5HDBB 4N2AA 5E56A 1PSKH 2BVUA 2QVKA 1R1CA 3ARGB 3TIEA 3ALXA 2XBZA 2VM4A 3KS0J 4U3CA 4G8FB 5DUJA 4QYOA 1WCBB 3MAWA 3IAGC 1G6RL 5F44A 2AQNA 2YD4A 1KBWA 1KNOB 3QZWB 5GJTH 4YHPA 2UWEA 4RGNB 5DJYB 3BC9A 1I4FA 3NCEB 5JMOC 1QSVA 3L7FB 3ULAB 2AW2A 3G5YB 4AGQA 3Q5OA 2IMMA 4ANXA 1VFBA 4N28A 4MCZA 4KKCD 4F58H 3F8UB 4ZW6A 2LTQB 1NLDH 1Z9NA 4PRNA 4GI8A 2VSDA 4AZUA 1J9RA 3CFCH 3V4VA 1K4DA 3BWSA 3K4AA 3MODL 1T21A 1BQLL 1OL0A 3CVHA 4O9HH 4X83A 5I1IL 5F70A 1UB5B 1UJ3B 2PO6D 2UYLB 3FSOA 1ACYL 2ENYA 3IE4A 4X7SH 5AVVB 4H7VA 4YO0B 4ZNCD 3X1GA 2G60H 2IH1A 1UWGL 2UZYB 2DH3A 2XVLA 2WUBH 4ABVA 3QNYA 3KPSA 2RAMA 3QDAA 3N85H 4A7UA 5I24A 2WM0A 2A74C 1B4JL 5JHLH 3HW7A 3BEVA 2P7TA 4NQCD 4R7XA 1LP9F 5CCGE 4NZRL 4MDIA 1MRFL 3FRUB 3MRHB 1AGFB 3BH9B 1F56A 4FI8A 5C3IA 3GRWH 3K0WA 4ZT1A 3U46A 4HEME 5JQ6L 5D93B 1IBZA 4JFQA 3ZMEA 4RFOH 5FGRA 3HN8A 3SEPA 4HC1H 2A38A 4Q6IA 1KJVA 4X6CF 4ZTPH 5LLIC 2DH2A 2CMRH 2FIKB 4OB5H 3ROLB 1FFRA 4PP2A 1QHQA 3B9KC 4OY9A 1HHGB 4DO5A 3NH7H 3CZFA 1CQYA 1MJJB 3GSUB 2ZCHH 4DPAX 3EKCA 2QTEA 4GINA 4X7DC 1NC4D 3L4TA 3QUMB 2R56H 4AYMC 5FCUH 3ILDA 5KJ4A 1MW2A 5I0XA 3CN1A 3MLXL 5F3FA 1FLRH 3B7TA 5D7KD 2LGNA 4A7GF 4HT1L 4HUXA 1QRNE 4OGAD 1NZRA 5B7FA 3B5GA 5EUOA 1K6QL 1MFDH 1XGTA 1ZRUA 2CG9X 2CA3A 2G5BA 3AJ7A 1SVBA 4GKOA 4GMSL 5ANMA 5IIEB 1IUZA 3M7FB 1E9OB 1PAMA 4YDKL 4KZEL 4AM0B 3TA3A 1JZFA 3SGDH 3V4PB 4EI5C 3MGOA 5BQ7A 4K94C 1TZOA 4JJOA 1X5LA 5EOTA 1TZIA 3MV8E 3QR0A 4MZ3A 5TPWH 2ENSA 5DU7A 5KYWB 4X80L 3O4LA 3ESNA 4DUWA 5EDXA 3RP1A 2R0LL 2EDFA 2XTJB 3D05A 2VN5A 3PL6C 4DP2X 3DMMC 3QAQA 4QO1B 3BP5B 1C5CH 1S9KC 3HZKA 3UYRL 4LOFA 4RGMB 1Q9LA 1Z9SA 1OQXA 4LEBA 4NRZB 3B3BA 2ICES 3EG9B 4FXGA 1P4IH 5E9NA 5I6PA 5SWZE 2PYEB 4BFKA 3O6KH 2NZ1A 1LNUA 4EUPH 3BKYL 3TPUB 4G80B 5J13B 2OR8A 3P77A 1GIGL 2DQFB 2C3XA 3U6RA 4DP5X 1T3FB 3QPXL 4YDZA 3UBXI 2I5YH 2X41A 4F8OA 3AQXA 3OHXC 1FYTB 1URIA 1B2YA 1YUHA 2YPKB 4GG6F 4TVPL 5ICXA 1MZZA 3EZ8A 4WHDA 5CD3A 2ZICA 5IB1B 5IJVB 4Z8FH 2ISDA 3HR6A 1OALA 5FKPB 5F3BB 4P05A 2YXVA 1U30A 3H8NA 1KJ2L 4HSAC 4OD1L 1KCUL 4I48B 1MVFA 3EO9H 3RWFB 1CD1B 1WAAE 1IAMA 4B41A 3L8QA 3FSAA 4K8RL 5EA0L 1G0DA 1ECZA 4GO6B 5AAMA 4L4JA 4AL8L 2JQZA 2MOGA 4XCYA 1N6UA 2PR9A 3GMQA 1VDGA 1EHNA 1SGKA 4JZJA 4WWPA 5JDSB 4Q8BA 4KHXL 2ZSVB 2YC1B 1R3JB 1J9TA 1E2VA 3FC8A 1D9KC 1ZE3C 3NFSL 4OKDA 3I85A 2IOMA 2WQRA 4B6ZA 3VI3E 3GXDA 1XL6A 4WI7A 5HI3C 1OP9A 1WIOA 4PN6A 1HXYB 1OIOA 4PJEE 4ONOA 4RX4A 5DR5H 1EH9A 1UB6A 4PJDE 3FU0A 4AEHL 3NA9H 5L9DH 4F2MA 3IFNH 1XF4B 3ARRA 5FM4A 1XR8A 1QFWI 1WCQA 1A7RL 2JFCA 4BRJA 1UM6H 3KPNA 1WITA 4KMTL 1IC4L 1OSPL 3QCUH 3S96B 3NMEA 3UOAB 1OAUL 1MI5B 1BXVA 1W2KT 4JHWH 4QHLB 1KDIA 3WO4C 1YPZF 5HVHB 3R0NA 5D2LF 4KKLD 1Z2KA 4ZUUA 1J88A 4F1SA 3N41B 3O3DA 3OB8A 3WTTA 2OP4H 4UQ3B 1E6JH 3QEHB 4N1CA 1CBVL 1V7ML 1F4XL 3HNTH 3LSOA 4KUZL 2BVOB 4DESA 1EMTH 5FGBC 2CHZA 2WJ7A 3RVTC 2G3ZA 1EFXA 1YN6A 2J21A 1UACL 5IMLA 1AHWA 3V5DA 4PJ8B 2NY6B 1M1XA 4GQ9L 1IQDA 3T5WA 3AREA 3L16A 4TQHA 3F12B 2FQDA 5EEXA 4A1RA 4Q4EA 5I66A 1BGXL 2XA3A 1DUZB 4KY2A 4EDWH 3S36H 1N70A 4H1LG 1AXIB 1CU4L 2NW2A 1ML0A 3HE7C 3WFHB 4WTXA 4PG9A 2QPFA 3H53A 3OG4B 1Q38A 3VXMB 1GGBL 4P3DA 1OPGL 1PKQE 3MHZA 4PREA 3K6DA 3MRQB 5LJYH 4HCRH 1H3VA 2W9EL 2XG4B 2HKHH 1IM9A 2WD0A 3FS9A 4JBSA 4RFEA 2E7HA 2DWXA 3APMA 4LSVH 1G6VK 2HTLD 5DWPA 1U3YA 1FFPB 2V3FA 3DXAE 3T0AA 2VRQA 1NFIA 1U95B 4M8RA 5GGVY 4QRRD 5E6YA 3TH3T 3D3VD 3AY4A 4A2GA 1OGAD 4ES9A 1FNEA 3ZIYA 3BW9A 3GJFA 4AE0A 2JSFA 1TT6A 3GMOA 2A6KA 5E2JA 1WFIA 2CNZA 3VXOA 5JUEH 2X9WA 5C0DA 4PB0H 2V17H 1RH8A 2I27N 4NM4L 3FCSA 1SQ2N 3RE0A 1FZKA 3S0PA 2AK4E 3W1ZA 3SDAD 2OK0L 3GBDA 1GYUA 4W6XB 3VH8B 4U1LB 5HHOD 3BI9X 2VLMD 3B5TA 4LDCA 4OF5A 4R2GB 2E6JA 5DEZA 1QSFE 2B08A 3H7BB 1VACA 3QHFL 1IJNA 1KOAA 1NIDA 4PWFA 1E0OB 3U30B 4O02A 1TEGA 3CFJB 4E5XG 3VX1A 1AYOA 4LLDA 3K72B 3OWRA 4HZLA 1PG7W 4LSTL 4XE0A 4YPGA 5DVKA 4EIGB 2RCSL 4G43B 4XO8A 1HNYA 1NMBH 4Y4FD 5IB4B 5AYQA 1F3JA 2WQVA 4BZYA 4FDWA 2WMPB 1DBBH 3QFJA 4LLWB 4Y9EA 4U2ZA 1QWNA 4PJBB 2C9SA 4QRBA 4KKBC 1IKNC 1N4XH 4YVUA 4TUUA 2X0VA 2VE6B 5AW8B 3OJDB 4KKNA 3WDIA 1P5UC 1OOWA 2HWZL 1ZTMA 4O5LH 2AJXL 3MFFA 3LEVL 1UGKA 5I76A 3HN5A 1X5YA 2QZQA 2I24N 4E41D 3THML 5L7XH 5JPNC 1KELH 5T8IA 3U1QA 6TAAA 4L3CA 4LKCB 1NICA 3U0TB 4WHYH 1LP9A 2W07A 2ITDA 3BUPA 4LLQB 3E6FA 1J5HA 4H8WL 3HPJA 1ID2A 1LXMA 4MJJA 4MJIA 3SOTA 5E51A 2NTFB 5DD5H 4FYSA 1YDPA 5KYUB 2IFFL 3TEZA 1T0NB 2GKIA 2DQEL 2VN4A 3G6DL 3EYVB 4P2AA 2YXMA 1KEML 4LGRB 3RVXC 4PIRF 3SSGA 4G5AA 4M1GH 5AOKA 1ORSB 5E0QA 4TQIA 1TZ8A 2WNXA 3GM8A 5I8EA 2OYMA 3IMSA 1O6VA 2OQJA 4FJYA 3RVWD 3T8XB 2DQCL 1PZ3A 2AXGA 4J8QA 3E2HB 2QHLA 4ZQTA 2AJYL 3B1TA 1OP4A 5IT2L 1YMMA 4PJGE 5IVXF 4MCNA 1YEJH 3CFTA 5ESVB 1E27B 1USZA 4KQ4H 1MWAL 4APQB 4BFJA 2J25A 3OR7A 4OCSH 1MPAH 2ZCZA 3DDGA 4IK7A 3KBHE 2QSVA 4KFZC 5FYJL 4ES8A 1AR1B 4A7GA 1OK8A 5CD5D 4Q89A 4F15B 3B43A 3IF1B 3NN8A 3VNZA 3UBFA 1OM9A 3NP4A 5FYLD 5F7KC 1L5GB 1DQKA 1S2EA 3ARZA 3WGVB 3HRZB 5JHDD 1ORQB 4JW3A 4PGBB 4G7VH 4P2CG 4AJYV 1MFCH 1MCHA 1WF5A 4ZFQA 5ID1B 4ONHA 1TVBA 4J3VA 4MAZA 3V6FB 2GW5A 3L2MA 1GOHA 3AXIA 4NQDA 2ZOUA 4FI6A 3TYGH 3FQTB 2RHEA 2F7RA 5BOJA 4TPRH 1X6LA 1ZK5A 4JPVH 3QJHA 4ODUB 1W72L 1AP2B 3GSWA 3OAWA 4DVRL 3DTXA 3DX6A 4AVKA 4N90E 1SDAB 1PS3A 3CFBB 3II2A 3QSKB 5KYXA 3VE0A 4F7CA 5IJKA 2NRDA 3TCLB 4Y2NA 1OSZB 4NN5C 2AJVL 5HTSA 4WSGA 4RWHA 3D39A 1O9WA 3MV7E 2NQ3A 4F7EA 3CHQA 1IZJA 3HNVL 1E4KC 2H6OA 1L9PA 2GJ6B 4GG6A 4ZODA 2IOIA 3LZOA 3BYTA 4QXVA 3KW8A 2EUVA 3AS3A 2WC7A 1A4KB 4TYUA 2Y4SA 3RFZC 1JK8A 2NY7L 3OAYK 3QG6B 2VN3A 1J1OL 3PP4H 1NFDB 3QA3B 1CGXA 3CD4A 1U8JA 4N5ED 7FABL 4M1DL 3OR6B 1TZAA 5IBTH 4KI5E 4KROD 2NT0A 4M93B 4WU5A 1T1ZB 2J1YA 3H3BC 1YEHL 1PFCA 2NYYC 2OR9L 1P7KA 3KPSD 1AVAA 1JOIA 1KYOJ 1TEFA 1ERNA 3LIZH 3IGLA 8FABA 3QRGL 4G8IA 4LHUG 2VLRE 1ZGLA 1MSPA 5IEHB 1H8NA 3LS4L 4HA1A 5MEOA 1KN2L 2YGQA 5J0BA 4N25A 3SE9L 4LEXH 1BM7A 2DL9A 2QQQA 2YEZA 3D69B 1S9WB 1XGYH 4H8QA 1HESA 5DJZA 3ES6A 3VXQB 3CWGA 3QJQB 4JFYB 1S7VB 1NCBL 1YA5A 2WXFA 4LL1A 1JZ7A 3RX9A 3ASOB 2HG5A 2NQCA 3WUWA 3SDXB 3BWAA 4OLVH 5KWYC 1YPZA 4X0KA 4FQ1L 5CWSA 3II3A 3ZQWA 1BOGA 2O26U 3KPPA 4PJ9C 3W2DL 3DGGB 3IPEA 3KCWA 3KGUA 1B3IA 4FQLL 1Y7VA 3S48A 5B21A 1BIIA 4IBTA 3E80A 1AOZA 3TO4C 3HG1A 4FQXB 1GMEA 4KVCH 3VRLF 3WG7B 4Y4HB 1CUOA 3PXLA 5I6NA 3D51A 4JPWH 4OZ4A 3VFRB 4QF1A 2OTPA 3PGFH 4L2YA 1OSYA 3MCKB 4JM2C 1NC4B 3KLHC 5AKRA 5I75B 3V0JA 1MRDH 2D4DA 3WLBB 1G0XA 1UURA 4PGDA 5T3ZD 3IS0X 2ADFL 3ISRA 4B5EA 1F02I 2XN9A 3HZVB 4J3OC 1AXTL 4LCVA 3CDGA 3UEZA 4DJMA 3LQZA 4L9DA 3O4LD 5I30L 1NEPA 1RUQL 4TNEA 2F18A 4KVPA 2ZQKA 4WEEA 2RD0A 2VMJA 1JWUA 2DJ4A 4GAJH 5I1EL 2HX7A 1IGCH 5ABDE 2N7AA 1RLWA 4XBEL 4JFOB 1JZ6A 2OMBA 3G3LA 1GTFA 1HT6A 4XNUL 3UG3A 2W60A 25C8L 4BM7A 4FJZA 2MIZA 5M7QA 4Z7QE 5IMMA 4IU2B 1HINH 4S0SD 4JO1L 3ZO0A 4XCEA 3BWZA 4L9LA 1SY6H 4YJZL 4BE6A 3P0VL 3LKSA 4JG1L 3CFEB 3DKHA 3L3KB 1JPGA 3JYBA 5GISL 1RHHB 4NDMB 4OSUH 2VCOA 4NPYA 4MD4B 4R7NA 1CF1A 1P1ZB 3WIIL 3GJEB 3ZYIA 4WEMB 2OL3H 3DO3A 3MZTA 1G7QA 3AXHA 2JKXA 4HX1B 4OF6A 1DQJA 4UQCA 5KSVB 4WDIB 1W8EA 1KULA 4JE0A 4I77L 5DQ9B 5ELIA 4HUWB 1XGUA 2LW3A 3RU8H 5H4ZA 1QKZH 4HKBA 3L95B 1QUNA 2KDYA 5FXCH 1OAKL 2FL5A 5JW4N 1XF1A 3HZ3A 2ZG1A 2ZAGA 2XVGA 3DJTA 1QBLH 2IAAC 1IFHL 1ZVYA 1R3IH 3FO0L 3FQNB 2I9TA 2EUWA 4OCWL 4JMXA 5B4MC 3FPXA 4RX4D 4XN1A 3SO3C 1FNHA 3BT0A 1RJZA 4OM1H 1U58A 2XN0A 3MRGB 1G9MH 1B2WL 2X10A 3RDJA 3BO8A 2EKSA 4M8VA 4B53A 2EE6A 5M95B 2W9DH 4CSPA 2C1OB 3L9BA 3VD9A 1G0YR 3PWPB 3N1QC 1T7VA 1BJ1H 3FOLA 3R06B 5TQ0H 3CTTA 1G6RA 4N2FA 5F9JB 5T3XE 2DQJL 1D5BB 2VL5B 5I1DA 4A68A 4Q9RL 3FFDA 1Q9KB 2F19L 3FTXA 4N2EA 1JGDA 1E40A 4JRXE 5JW3L 2AEQL 3DETD 1UOWA 4DUVA 3N6YA 1VENA 2CE6A 2VDRL 1WTLA 3GSRA 2R0KL 5TE4L 1QFWL 2Q5BA 1OCOB 1RFDL 1TYEB 1BZQK 1F4YL 9PCYA 5MENB 4WK2B 1B9ZA 2FLMA 2PPEA 2AQSA 2X1OA 4TF4A 4I4WA 2DOCA 4LLYB 2CWRA 5GRZA 1CTOA 1T04B 4XAKE 2CRYA 3U30C 3OPZL 1RP8A 3HR5B 3BSZH 3WFBH 1H5BC 3QUXA 1WZKA 3FHAA 1YEDB 4R90H 1EFXD 4ZFFB 3H54A 1P84K 5BRZE 2ORBL 2APBA 1IC5H 2FO4A 1K8IA 4KDTC 3ARED 3V9FA 4G42A 3CBRA 3UO8B 5B3NA 4NBXB 2PP8A 2CBOA 1G1KA 4PI0A 1D5MB 1XR9A 3D9AH 3B83A 3LK