3NDZE

The structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
SAVEVTYAITNSWGSGASVNVTIKNNGTTPINGWTLKWTMPINQTITNMWSASFVASGTTLSVTNAGYNGTIAANGGTQSFGFNINYSGVLSKPTGFTVNGTECTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the catalytic and carbohydrate binding domain of endoglucanase D bound to cellotriose
rcsb
source organism Clostridium cellulovorans
molecule tags Hydrolase
molecule keywords Endoglucanase D
total genus 21
structure length 107
sequence length 107
chains with identical sequence F, G, H
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ndzE00
1HEJC 1E5BA 3NDZE 3NDYE 2RTTA 5DHDA 1EXGA 5DHEA 2CWRA 1QBBA 1QBAA 1HEHC 1XBDA 2XBDA 2CZNA 1E5CA 1EXHA 1C7SA 1C7TA
chains in the Genus database with same CATH superfamily
2QPSA 1BZOA 2J8OA 4P48A 1MY5A 3BAWA 5FCUH 2F0CA 2VDLB 3WJJC 4DNLA 1ZT7B 3KYNB 2WD0A 5T33H 3GMPB 1QSFE 4WU5A 1JDCA 4I0KA 4X7TB 1UM4H 3ZHFA 4XVOA 1UB5B 5ITBH 2X70B 1W8EA 2AXFA 4PWFA 3VNZA 4HISA 4PJDF 3P0YL 4UTAH 2WTPA 3HE7C 3B37A 1NCGA 5K1VA 2HLFD 1I4FB 3N2JA 1N0LB 3G9VA 3IGFA 3NZ8B 4NUJB 4YSQA 5EBMB 2Q6WB 5B3NA 1H9DA 3CG8A 2R1WB 5BVPL 1VZHA 2DWEA 4KK9C 5EIIB 4M6AA 2ODIA 1CBVH 3QUZA 4NPKA 5I8EB 2XG5A 4K5OA 4G8GB 4MCYA 2QZ5A 1GGBH 2DEXX 5FA3B 4QTIL 3VRIB 1P53A 2FDBP 3MLZH 2SODB 1CTNA 3W0WB 1AJ7H 1N6QL 4YSSA 1JE6A 4Q0XL 3WUZA 3ZHKA 2BMKB 5K1NA 2D0HA 1MDAA 2FD6H 2ESVE 1DQLL 2F8VA 4N8UA 1QFWH 2EEDA 3Q6FA 2IBZY 2HLAB 1MCEA 1ZLSL 2XA3A 4HXAL 4BQCA 5I0DA 1O9VA 5JYLA 3L3GB 1WRFA 3FAWA 5BZDB 4PYHA 4LB8A 1EZUA 3WTUA 3FU6A 2X2UA 4OM0H 1IM3D 2G3MA 4BKLB 1E9OB 3QPQC 5T1DL 1NGWA 1ZHLB 2YPVH 4H1LA 4XPFH 2X4OA 5TK4A 3WO4B 3L6FA 4PIBA 3FOLA 4KV5F 3S3DB 3L48A 3FOMA 4HIJA 1KGYE 5DDHB 5CN1A 1OCWH 3ZUCA 4M8RA 4R3SB 3QEQA 4S1QH 3MGOA 5TQ2L 2XNAA 2FJUB 4HH9B 2V2XA 4HKBA 4K3EH 4M48L 3LH8A 2NUPA 2FBOJ 3BMVA 3FB6B 1F3JB 3P4LA 1ASPA 3LKNA 5F1NB 4QWWC 4KOBA 4BFNA 5EO9A 3S9DB 1NAKL 1G7QB 1BXXA 2Y6SC 3RYMA 1S7WA 5GS2D 4CJ1A 3MV7B 4XPFL 2A9NL 4KUZL 3RTQB 2EYRB 5C0RL 5DHYB 1HL4A 3NP3A 4OZGE 4IIQC 5IFAL 1ZD6A 3CDGA 4F8TA 5E94A 1XTMA 5L2KE 2VN6A 4GG6B 1FZJA 2NXYB 1AGCA 1LO5B 1BVKA 4HBCH 4X0NA 3MRCB 1VZIA 3ZDWA 2WUBH 1IVTA 4AJ0A 4ZNCD 2VQ4A 3W38A 1BVNT 5I17A 5LJYH 1EO5A 5AW4B 4OY9A 2EEAA 4QRUA 5GGSB 4ZMLA 1RULH 4K3GA 2KH2B 3LHAA 4Y19E 5ADOH 2B4CH 1EZLA 1RSYA 1T5XB 4LCVA 4MDRA 4P0DA 3ZDZB 1IBYA 3ZN6A 5JHLA 3SHSA 2ARJB 2DQJL 2DYSB 2ZPKH 3QULB 3OKOB 3ESPA 3OSVA 1OOWA 2AJSL 5ELIA 2WWNA 2VN3A 4KROC 3RWCA 4JHZA 4JHWL 2C3VA 1BM3L 3C75A 1TG8A 1TJMA 3AUWB 1EXGA 3MRNA 1T21A 4A67A 4AMKH 2E7BA 1G7LA 3ELAT 4K9EL 3VD3A 3GO1H 3W5NA 3SCMB 3WXVL 1BBJB 4NO2B 3ESOA 1BLNB 3K4ZA 2DQHL 4OZFB 3V0GA 3K8KA 1Y0LA 2ZIDA 2G9KA 3RVVD 4Z7AA 3IGKA 1TETL 3BJ91 3OXSB 1GW6A 4FMFA 1U8OB 5GS0C 5KS9A 2LW3A 3DX0A 4YDLC 2NQ3A 4OLVL 1LO0L 2J4WH 3T0ED 3ZGHA 4UQEA 2BH0A 3W2DH 5D7HA 4IGBB 2X7LA 5I16B 25C8H 1PW3A 4P23D 5F7EL 2QKIA 4BKSC 4AT6B 1WITA 2WYHA 5EORL 1BFTA 1JWMB 3MA7A 1E4XL 2VXVH 4KQ3H 2FR4B 3SKNB 3QFJB 1NBZB 1A1OB 4Y5YB 4F7CA 3IMSA 1E2VA 4Y5VC 1BSIA 3BPNB 3NZ8A 4JRYB 4NUJA 3BKYH 4XN8A 3VMNA 1MJ8H 3UTQB 2FT8A 1BVZA 4UTBA 3Q01A 1J5OL 1IEAA 5IVZB 3RI5K 3ISRA 3U46A 4CMMA 1LK3L 2PTTB 3AWGA 4HGMA 1Y1DA 5J1AA 2K7PA 4CMHB 4L18A 1E4WL 2FVNA 5B38B 5CCKH 3H42L 3RZCD 2QQNL 5IMMA 1DFXA 2WKGA 3FT4B 1E6JH 5EU7C 4JW3A 3QORD 3ULUF 5B4MC 4HXBL 2JJTC 1W72H 1EVTC 4HGWB 4P3CL 2ORBH 1OE2A 3O8XC 4J2QA 3RUGF 3ATAA 4AYFA 5CEZL 1DVFC 2AI0L 2HWZL 3QUML 4HHAA 3UXFA 4O9HL 3DJTA 2ICEA 2CO2A 1B9KA 1RZJL 1S9VA 1PPIA 1AE6H 1N2RB 4R2GD 5IHUL 1PL3A 2OI9B 5FCSH 3AG3B 1JGIA 3S36X 1CT8B 5F9AC 5IVXE 1RHHB 1HTYA 3GBEA 3L5WB 2VZOA 2YIHA 2IH1A 3HOGA 5F7DB 1IFRA 3SEPA 2K1MA 4LCCB 3T4AC 5JPMB 3BQUB 2J88H 3QZNA 5EZOH 1TZGH 2LLLA 2Z93B 3NDYE 4U6XB 4Z23A 4FP8H 4L1DA 3BN9C 4HJGB 4OQTA 4HETA 4R97C 1P7BA 4OM1H 3GXMA 3N1PC 4XP5L 2Y2WA 1LO3L 3P2TA 1IFGA 1C5CH 1FV1A 2Y3AA 4BK5C 1ODAA 2XN2A 4TVUA 1K85A 4X5RA 1QNZH 1MREH 4FNTA 5KG9B 1PBYA 3KWXA 3VQMA 2WB1A 3TBSA 2MNJB 1MWAL 2XU9A 5TQ0H 5FFOA 5I15H 4HK3N 4JM4H 3I6KB 4RRPA 4RWYH 3RJOA 4ZI8A 2IIJA 1AO7B 1JS4A 3UPRA 3ET9F 5BVJA 3HC4H 3HC0B 4DP2X 3H54A 2IDFA 3FFOA 1WHPA 3AREA 4I0PB 5C3LD 2LHAA 2WJ7A 4XNZB 3S98A 5I9QB 2AMUA 1FSKC 2BCKB 2B2XH 4RFEB 1RZIA 3M17B 3DVFA 4MA8L 3U6RA 3BW9A 1WCBA 5C6TH 4I8DA 4YHIB 4IKIA 3SE9L 3G6AA 2GJJA 4YDVB 5ESVB 4JPVH 5KW9H 4YPGA 2XQBH 5L2KA 1VADB 1RZFL 2IAMC 3C8KB 4PSPA 1IGFH 5C3IA 4Q56A 3LEXA 3O2DA 3QVAA 4HIHA 1WWCA 2HZHA 1SUJA 1WAAE 4LKXB 4Y4HC 3A23A 3ZTNL 3II2A 3LV3B 3FHQA 4PJXE 2NY7H 2XI9A 2VUOA 2R15A 1T2JA 3LRSB 4OJFH 3MC0A 2E47A 2V17H 4Y2DC 2AVFA 2B1AH 3RWIA 1JFQH 1ZE3H 1B0RB 4XPHL 3VSVA 2KZ1B 3M46A 5C0JB 1JN6A 4M62L 4KGJA 4ONHB 5GJTL 4PGEA 1XF3A 1FZKA 4PJ7F 4CU7A 1JIBA 1G9NL 4PJ5D 1DQDL 1SUHA 1JVLA 3I9IA 4KNSA 3II3A 3LRLA 2AQ3A 3F5WB 4LEXH 4MAUH 4X8XA 1YN7B 3QIWA 3LKQA 3G9AB 3WL9A 1JTOA 5IQMA 2WWMD 4RETB 2VR5A 4QGTA 4A6YB 4M6NL 4U7MA 4JCWA 5DRWB 4YXHL 3IBEA 3VG9B 2VXUH 5C0ND 3LZNA 1F56A 1FYTD 4PJ9A 2LT9A 4RRPM 3LZQA 4KH9A 4XBMA 4XNYL 1T3FB 1UA3A 1ADQL 4PG9B 2X1OA 3IPBA 1MQKH 4PRHE 4A04A 1U2HA 1G9EA 3KPQB 4JPIA 1VEOA 1EHXA 1KZYA 3F04A 1E4XH 4TKWA 3ZE2F 1ZHKB 4JFHD 1A6TB 4LIQE 3D33A 1KXQA 4PJEF 4Z7UF 4DEPC 3ZRSA 3KD4A 5D1QB 4KY2A 3K71A 2Y2TA 5CSZB 4W4OC 5KVDE 4D9RE 2Y3NA 3N6YA 5DQ9B 1H6TA 4WW2B 4L8CB 3HC3H 4PU2A 1KDIA 5DYOB 2X6CA 1NJ9B 1NLDH 2BIOA 3D52A 3PWLB 4AEIL 4QRRE 4GW5A 5F9WB 3UTTB 1YVLA 1FVEB 3L5XH 3S37L 4GSUA 4MJ5B 1OSYA 5CNHA 2R39A 2RCSL 4R8WH 3ARZA 4Y4FB 4M8QA 3TBTB 4O02B 4X6FA 4XPTH 3BXNA 2QQNH 2VSMB 2APTA 3FW6A 5FW6A 4WFFD 4Z7NF 4W4OA 1GGIL 3HE7A 4CILA 1C5DA 3OLIA 5HPMA 5I19L 2HA1A 1MFMA 4X7CC 4HIXH 1KV7A 5AVTB 4NJAL 2YOCA 4K2UL 2NY0D 4PLKD 1ICTA 4UZSA 4KVNL 4KITB 3VGGA 4YHKL 1MXGA 3OQRA 2FUTA 2JCWA 3UEZA 3IETA 2DQEH 1QSED 2PYFA 3R06A 3BJLA 4UB0H 2M2DA 4YUEL 2Q86A 4NXKA 5SX4H 3RX9A 4BK8A 2ITDB 3K2UL 3NFNB 4Z7IA 2Y1YA 2A1WH 4H20L 3FQ2A 1Z5LA 3VI3A 1T1ZB 4A2LA 1NGPH 2QT6A 1CGUA 1XR8B 4IBLT 2Y7NA 3QJVB 5MENA 1SEQL 4M7KL 2R0LH 3HNTL 4S0TD 3U2JA 2N1KA 3NTCH 3O9WA 1M05B 1U8KB 1CFMA 3EJZD 2VDQH 3B2VL 4YSDA 3CSBA 5LAPA 3RTQA 1CXFA 3QI9A 4JFDE 5CD5D 5KANI 5KWYC 2YO3A 1JZIA 4L1SA 1XCQB 2IANB 3BZFA 1SBSL 4Z8FL 1BVOA 2OCJA 3BP4A 4XVTL 4ZW7A 3FQNA 3T65B 4ZUSB 2YUVA 4OGAD 4PJIE 3RQ3A 3UBXG 1E5ZA 1WTGT 3EYQD 3BWUC 2GTZA 4NP4H 4DKTA 4EI5B 4ES9A 2BOLA 4OIIL 5CJ8A 3O2WL 1UTDA 3PL6C 2IWFA 4HD9A 4ODXB 3C6EA 5GSRB 2YK1L 3C9NB 1GKOA 4G1EA 4KK5D 2OXGA 4MNGB 3ARUA 4H25A 3CZEA 2Q8AH 1JNNH 2WN2A 3O41B 4TRPL 1BD2A 5T1KA 1KXTA 4HUKB 4LO9A 2DLHA 5GRYA 2HSIA 2AV1A 5EOQL 3ULUH 3ISWA 1AOZA 2DQFB 3LNHA 4QHNA 3RY6C 1D5XA 5EU5B 3MCLL 4E5XB 2H3NA 1I9IL 4UV4H 1RJYA 4IOIA 5CWSB 1F8TL 3N41F 4P5TB 1J8RA 3TCXA 4WK2B 1RJZB 1AD0A 2YR3A 1GH7A 2ITCA 2VLJD 2KPNA 1VDGA 2YARA 1X4ZA 2RCSH 3DGCR 4R8WL 1P1ZA 2IXQB 2B9AA 3UYPA 2NDFA 4B7IA 5AB9A 2FQEA 4H0LC 4HCRL 2DWDB 5DS1A 2QV2A 1U8PA 4U1KA 3V7MA 3VXME 3UYOD 2OP4L 3M1CA 1SOSA 3TP4A 2VMJA 3R1GL 4DQAA 5B1CA 3T04D 1IGJA 2DL9A 3O2WH 3FU3A 5E5RB 5BQ7A 1M3IA 4RCAA 2WNWA 2GYSA 2Y5TA 2ZYHA 5TQ2H 4E9QA 1HI6A 4Z7QE 1KCRH 3GPSA 4E68A 4OV6F 4JFEA 5MEOB 4WGVB 3CDZB 1WWAX 4C59B 3D85B 5CUSH 3F7VB 4D7PA 5JORA 2IH3A 4NNXB 5KSBE 4GEIA 3DV6A 3ILQD 4JO2H 1FFNA 4PJBB 2ZKYA 5D7IB 3CBRA 3T6ZA 3U9PH 4AUYA 3SDXE 5DQ9A 3SQRA 3MRRB 4MD5A 1CGTA 1VA9A 5CJOL 5D9SA 2NSXA 4K15A 3QORA 4G6AD 4IGBA 4HHGA 4A66A 3KLQA 1QFWL 3PWUB 4Y5XA 4M7LT 2QSTA 3INUH 3OZKA 4PRHD 4QYOB 3KZ8A 2PWEA 4NO2A 2W9EL 3PQYA 5JLZB 2XZCH 5AOLA 4G72B 6FABL 1YEGL 5I1AB 4GKSA 1YECL 4WW1B 1DLHB 3IWUA 2J72A 1GPOH 2OI9C 5GRWA 2VLKB 1HAUA 1HVXA 1KT2B 1PQZB 1UASA 3BPOB 1RULL 4AQ1B 2UUDK 2PTTA 5IG7A 4OZHB 4P04A 1DJHA 4ZPVA 4BRVA 4ZYKB 5ESQA 3FQWA 3GI9L 1SHXA 5AYTA 1AZVA 3CSTA 2NW3A 3EBGA 4AGLA 3HRZC 4DUXA 3WIIL 1L0XA 3MBXH 3WY3A 1TYRA 1YEEH 4NKIL 3F00A 1E8ZA 2FGWH 4QOKD 1A6WL 4IIQA 4KK8C 5GRVK 3X14A 4I77L 3MROB 5DT1L 3IFLL 4FKHA 4LOUC 3S3PA 5ANMA 3CSPA 1KLFA 1A1NA 1LILA 4PRIE 4AKOA 4HAGA 1JRHI 3DMMD 4HJUA 1V3LA 2Y6SD 3C12A 3ULVD 3Q8EA 5KSBF 3HUJA 4LCWE 1OAYL 5F1SA 4B97A 5GGUB 5EZLA 3BAIA 1UXWA 3VGDA 1FG2B 1KPRA 4FL4C 4LKCA 5DMIH 4CGTA 1J1PL 2B8OT 5IBLD 4XI5C 2C1PA 3RKDD 2ZONA 4MDJA 1DO5A 1JWUA 1D2PA 1NDGB 1EDQA 1L9QA 3GZOA 4Z5RB 1JXKA 3H6AA 5IIEB 3DYPA 4DTGH 3NCXA 2CD0A 2D73A 1Q94B 4HIJB 1CFVH 5FIEA 1I8IA 4JFHE 5D7EA 6CGTA 5ICYB 4OFYD 3OJVC 1KXTB 1J0JA 2RB8A 2WNXA 1DO6A 3MGOB 2MKLC 4LRIA 5IKCB 3SIKA 1FV1B 1I3RB 2A9CA 2YQ2A 3VD2A 4NQQA 4H0IA 2UY7B 4M43L 4X42A 1D5XB 1UZ8B 4LCCA 1KYOJ 4ACTA 1P5VB 4M61B 4PI2A 3KLDA 3DTXA 1OF2A 1LEIA 1NLDL 3U1QA 2X1XR 2XIIA 4Y4KD 2NTFA 1H8OA 2V33A 3OKEB 5ES4B 1A9BA 2VJ0A 3U0PB 1QLFA 2RFXA 5MEQA 1KSRA 4ZTPH 1EUTA 1PNDA 3GS4A 5IT2L 1FVCB 4LPCA 4X9YA 2BMKA 5KVGL 5KS9E 1D5ZB 1CI3M 2ED8A 5HI4C 4I18C 3DV4B 1INQA 2Q7YB 1J10A 2A83B 3LX9A 4X9BA 1G7IA 2BSTB 4GXVH 2XV0A 3MRMA 2GJ6D 4OI9A 3X17A 3OLEA 4C4BA 1G9NC 5C0CB 4DP6X 3BPNC 3GMNA 3EGXB 5DHMC 3MYJB 1UT1A 1PLAA 3V9CA 1NGWB 4H1LB 3V4LA 2ODHA 4IW4C 2EC9U 2F8XC 3DMMC 4K7PL 4HWZA 4X9HA 1P4IL 1WSST 2R1YB 2WQUA 1LWJA 4HJEA 4YPJA 5DK2A 2YQBA 5E2UL 4KK8D 2HXAA 5E4EC 4JVPA 3V4VH 4Q9BA 1Z3RA 4I9WD 4X99B 1DFBL 5HDWA 4AJWA 4JZNB 1HJBC 5TH2A 4P99A 3LN9A 3V6FA 2H1LM 5D2NE 3UBFA 2C26A 2PR9A 4PY7A 4J3WA 1JXDA 5JHDB 5JQHC 4QRBA 3IDIB 4L5FL 5FYKD 2YGNA 4JFOB 1IARB 2GUOA 4YSTA 3CIQA 1XF3B 2OSYA 2JMRA 3ESNA 3EOAA 2FJFA 2YPLE 3QUKA 3W3BA 3EYFA 4P23B 2UZXA 3D2TA 1P4IH 4X6CF 5F3HB 4KTEH 2CCVA 4UTCA 4WY7H 4YXKL 4L0ZA 3SO3B 4PGJA 4JK0D 1DP0A 4BKTC 3P4OB 5B1AB 3MUUA 3TN0C 2J6EL 5HI3C 1QZNA 2BFVL 3PGDB 1R5WA 3ECQA 3ZDYB 1KPVB 4FFVD 5HYQA 3BXNB 1T3FA 5H2BA 1Q1JH 4OZHA 4KZCA 4ACPA 2H26A 3QIBA 3U9WA 3FU7B 2XFXB 3TV3L 1ZGLA 3LEYL 4J3OD 2WLLB 3BISA 4NGHH 1SNRA 3V6ZB 3QIWB 3WL9B 4QHUB 1SFHA 4NENB 5KSAD 4QRRB 5CSZA 1OTUD 2BHYA 2BSSA 5EZPA 1BD2E 1MF2L 1NM4A 3QNXB 4KU1A 4BXSV 2XYBA 2I60H 3GTTA 2BOBB 5KYWA 4P4KB 1LYQA 1ZANL 1YPZF 3FMGL 3B1UA 2UZYB 4PJ7E 3IDXH 4JFXA 4Y89A 3R7QA 1NWOA 1OCCB 3BEVA 4E41B 1J0IA 3EO0A 2P5PA 1ROWA 4FI8A 4BFIB 4WQOA 3LRHA 9CGTA 5K9KA 1MCDA 5CINH 1UWGL 1XXDC 5TGBB 3T8XB 3RGVD 3AM8A 1MH5B 4CSZA 1J05A 4PRIB 4C8XA 4G8GE 3MV7D 3O81A 4KKAD 4ZMOA 3FT2A 3EFOB 1U8LA 1Z9PA 3GEFA 3PNWA 5FUZH 4LU5H 2OMZA 3FH7A 4QAWA 2CPCA 2JKLA 5IB3A 1LE9B 4UINL 2CRMA 2CKBA 3BKCH 2KMWA 1KJVB 1ZLEA 5IFHL 5CEZE 1F58L 2ZICA 2FATH 3BSZH 3P3RA 1T1WA 3AJ7A 3D4YA 3MV11 4I1RA 2HTKC 1NKGA 5EEUA 3OKEA 2Q76B 4CUCA 3LDBB 3NZSA 4OUOA 4XWOC 2UY6A 4OB5L 3WNLA 1QHOA 1T7YA 4QCIB 2A0LC 2OA9A 1DR9A 2GC4C 5EB9A 2J57A 2P80A 2YAFA 2YFOA 4APXA 1U9KA 2K7QA 1RP8A 2Q5BA 2WSDA 1ITBB 3SDCC 2WZ6A 4NN6C 2OJEA 1ORSA 3ULSA 1JI2A 4HA1A 5I6XB 2G4GA 2Y7MA 2G5BB 2XN9D 3L4TA 1ZIAA 1DBBL 1N64H 3SOBH 5IFHH 2B14A 3KPTA 2EDDA 1YJDC 4PS4H 4F7KA 3VCLA 1Q9KA 2BVOB 3BKYL 3RVXD 5FKPB 1W6LA 2DM2A 4MXQD 3VM7A 3GPEA 1E5YA 4N3TA 5E8PB 1UURA 4R7DB 4HJTA 3WNJA 1WLHA 1EJ8A 3E6FA 4EO5A 4AIOA 1HOEA 3IJHA 3QDGB 2MCMA 4QLWA 1M6OA 4BCYA 5A2JH 1H3PL 2BJML 3ZDXF 1DANT 4LASL 4MNHA 4GXUM 1S8DA 3FQXB 1K3ZA 4HU8A 3VWKC 3NA4A 4HKJB 3HI1A 3NACH 4LDOB 1JYWA 4PHXA 3M07A 5E08L 2I32A 4IRJC 2JXMB 4CSSA 5I0VA 4KDTC 4XVSL 4MZ2A 3MLTA 3WNNA 3WXVH 4PRPA 4PJHE 5HDOA 5KAQF 1FUNA 1XDTT 3V55A 4QYOA 3RA7L 5EO9B 3II1A 3WFEH 5B7MA 1NL0L 3RE0A 1WFUA 3D6GA 3MTXA 2FCBA 3FS9A 4I0PA 1CVSC 4LBAA 4G7QB 2MOGA 3SDXB 4PY8I 4MAYD 3A6CL 3GWJA 3HUJF 1K6QL 1XF1A 1EEUA 1MKFA 2GQHA 2IDUA 3IN0A 1ZT1B 4TVPL 1RIVH 3EFDH 2A9ML 1WEJL 2YXMA 5I75C 1FZKB 3LHPL 4UNTA 1KLUB 2XXGA 3BSHA 1G84A 3W39A 5I30H 3TWCL 1QQDB 2OSLB 4ABQA 3RP1A 1G9MH 1V10A 2Y5TB 3TEXA 4ORGA 3QRBA 5BOZG 3QXAB 3VQ2C 4KROB 3GMMA 4Z7WA 1H0DB 1ZIBA 1TJGH 3IJSA 3X3GL 3D85A 4U7KA 1O6SB 4IJ3C 1QKZL 1UB6A 4OF0A 5KVEL 4AWJC 2KBGA 3RY6A 1HCVA 4FD0A 3TEYA 3B7YA 1FAIH 5AAPA 1LWRA 2EQDA 2XWZA 1RMFL 2QMJA 1YNLL 2ENQA 1OE1A 4PBDA 4ZMQA 3T71A 1A6AA 3QJRB 2JIXB 4D0BA 3DBSA 2BOCA 5BZZA 3W81A 2AQTA 5EOTB 3DOHA 1TKWB 1LEGA 5FK9B 5HP5A 1T89C 1JWSB 4NQXB 1KWKA 4MA7L 5SWZA 3G5ZB 4TVPE 1DQQA 3LPFA 2X6AA 4P5KB 1MFEL 4PCSA 1M1XB 3Q0HA 4DESA 4L9LB 1DL7L 2DV6A 4LLDB 4DEWA 3WS3A 5GZOD 1P7KB 2HT3C 3H85A 3PS6A 1AGEB 1FRGL 5TDOA 4CVUA 4YNYA 1CE6B 4JFQA 2XIBA 3SGJC 3NJNA 3OLGA 4NLAA 3ZR6A 5C0DB 2WB7A 3FTVA 3N04A 4PIRF 1ZEAL 4MNGE 1JV5B 4DZ8B 2PNDA 3BZ4B 2BWQA 5CMAA 3L4CA 1RUMH 2YPLD 1M57B 2F74B 2IAMD 5HDBE 1B90A 2Z8SA 4PJEB 2W0FB 3QCTH 5BOPA 3S5LB 1E7UA 2V3EA 5CEYA 3TN0B 3HN8A 5DURB 4DN4L 1JTTA 4JKKA 4Q6IC 2RMNA 5KBPA 3KLHD 2F53E 3RB5A 4Z7VB 3VXSA 5EBWB 4FJYA 2W9EH 1FLRH 4KY1H 1CICA 4BZ2H 4POZC 1NCBH 2RTTA 1J9RA 3B43A 3VI4B 2KERA 4EE2A 1HHHA 1WZKA 3E8UH 5DJCB 2R51A 4IOSD 4NEHB 4YBQC 3Q3GA 4JPWH 3J2PA 2VZ1A 3CVBA 4OZFG 1MVYA 4XOCA 1IEHA 1OAKH 4MVBC 5AFAA 2J12B 1XIWA 2WLHA 5KBNC 4Y1AD 1KBBA 2G5UA 3PGFH 1FC1A 3VFTB 4UTAL 2BERA 1ZDSA 3DYMA 5CCHE 3ULVF 4N3UA 3OWEA 2MFNA 3FU9A 4G6KH 4XC3L 3BLKA 1KENH 1OTSC 3QZWA 3ZT6A 3QNFA 5GZOC 2XWBB 2CK0H 4WEBH 4L3FA 1I9RL 1XB3A 5FYJE 3RJQB 1CFQA 1R24A 1SXSA 2VXSH 4DSYA 2KKQA 2Z65C 5AW3B 3FTYA 4J7RA 2OULB 5DD1L 5L4JA 2EO9A 3EBIA 3A4DA 3QFDB 4FAAB 5A2AA 4NP4L 4OZIA 3RIFK 1WCQA 4I77H 1E67A 3P9WB 3O4LD 1C12A 1SJHB 2EAEA 3L3KA 4KKQA 4HC1H 1WIUA 2WBKA 4JDTL 4WGKA 4CVXB 4U1SB 3WO4C 5EU7E 3UJIH 3SKJH 2AJ3A 3IE4A 2UXVA 3P40A 1MCPL 3R4DA 1TNNA 4XTRC 1AYRA 2D9QB 3IM1A 3DX7A 4H0GA 4LSVL 3KWUA 5MI0C 2C7UB 3G08B 4FI6A 2VAJA 3SPVB 4EUPB 4JPWL 5KZCB 1DJZA 3C08L 4PR5A 2X38A 3T0EE 2AERT 5AB1A 5D7KD 4FFZH 2VMCA 1CDIA 2VB5A 1AHMA 1KLUA 4X4XB 4TTGA 3QWRD 2IXQA 4WVRA 1CF8H 1MCFA 1QSFB 4KXAA 3ZDXE 2IMNA 1SYVA 5F7AA 4M9PA 3KCPB 2EVGA 5I8OL 2E6QA 5C08D 1ZLUK 5CILH 2F54B 3MV8A 4HC1A 4YHKH 1GHFH 4XBGA 4G8IA 3K0YA 3QISA 1XGTB 2BP0A 4MCZA 3WFEL 1FN4B 1ETZA 4N2NA 2TRYA 1RUAH 2WM0A 2YBGA 5DA0B 5F3HA 4QHNB 4X5WB 4XAWH 1A8JH 1VADA 2QFPA 4IJ3B 4NRXA 4KXDA 2VH5L 3MZGB 4P5TA 4YQXL 2VOTA 1AD0B 4YFDB 4HDIB 2IH3B 4NNXA 3VGHA 3FN0L 3O8XA 2NQCA 5DVLA 3AXIA 2TRHA 3QUHA 2K4AA 3C6LB 3TA3C 5IBUG 4G7YH 3OHXB 4GKSB 2B2XL 2WLLA 3CZKA 3HC3L 4RMQA 5C0AB 1IGMH 3FPYA 2W0LA 3HPLA 4LGPB 3A0OA 1P7QB 3EH3B 4J3BA 4N1CA 3MMEB 4L1TA 4WKZB 3MLVL 5ENWA 1F42A 4EN2A 2DM4A 1O5DT 3VI3E 4IK6A 1MAKA 4L37B 4UYQA 1KCVL 4P5MB 4XX5A 2WVSA 3AMKA 3W57A 4YJZL 4NKOB 5HGHA 3DECA 1II4E 3RG1C 5AD0B 2EIKB 1SZNA 4HOXA 4MMYA 4KMTL 2A6IB 3D8MA 4Z7UA 2AXJA 4PJEA 3NCYS 1ZLVH 1NFDE 1MZYA 1DVFB 1IFHL 3B9KA 3FQ4A 3ULVH 4CAGA 3I50H 4R4BA 3FT1A 4G8GA 3TN0A 4HIXL 5H4YA 1TVDA 3ZR5A 2OZNA 4N0CC 6TAAA 3AZUA 4NQUA 4RRPG 5BRZB 2VZVA 1XQ4A 3GM8A 1ZHNB 5HHXL 1EO8H 4K07A 1F90L 1O7VA 2YBRA 3MLXH 2ZWSA 4JZJC 1NPUA 4Z3FA 2Y1VA 3FO1B 3K8LA 2XZZA 4Z95L 4EQ3A 1LJMA 1BA9A 1J05B 3OHXC 4PJFA 3BH8B 4LLWA 3F8UB 5D6DC 3LVTA 4DAGH 2ZUXA 2YQGA 5FKAA 2HJLB 1OM3L 1E5CA 1FFPB 2OJEB 4HJSA 4B3EA 1I1YB 2VR9A 3QJXA 3B7RL 4UIKH 2Q87A 2K8MA 5T1LD 1THAA 4MXVE 2GAZA 5ESAA 4QHMA 4TYUA 4Z7QB 2GJRA 4NI6A 2L4OA 3V9FA 3GSOB 3BESR 5DCCA 2FBJL 5FO7A 4EVNB 2QTVA 4KI5D 4NC2B 4O02A 1DQMH 3GDCA 2QPEB 2GHWB 3LEYH 2ICEC 3AS3A 1WBXB 2E46A 1UXWB 1BCIA 5D5MB 4DAGL 4AKQA 3KW7A 2XG4B 3EFOA 1OXYA 1B0GB 1W72L 2V2WB 1BQHG 1DBMH 2TSAA 3MLSH 4QCIA 1D6EB 1DN0A 3FQUA 2P44B 2MPAH 4X8JB 1FH5L 3HZKA 4JE0A 2AK1H 2APBA 2GSGA 4QTFA 1KCSL 4DEUA 4K7FB 3QR2A 4HCFA 1CGXA 4O4YH 3PRZA 4O58L 1T0MA 4G7RB 3OKMB 3S37X 1T04A 3Q2NA 1QATA 2WQAA 4I0CC 4W9KC 1G7QA 3CGTA 4TNEA 1FPTL 1X7SA 2EDFA 3LDBC 4LASH 3I2CL 5DHYA 3ZL2A 1F11A 1PZSA 3D25B 5DWPA 5F3BB 3IDXL 4ZFOA 2C4FU 1QLEB 2QQKH 3ASOB 5TF0A 4KWUA 5I1JL 1OQOA 2C7UA 3G08A 5D1XA 4TN9A 2LU3A 4FQ1H 3PHOB 5DF0A 2AKRB 5JPMC 5E56A 3O9WB 4BK5A 1UA6L 5HHVH 4ANWA 5FUCC 2E75C 4WKXA 4YZFF 1BZ8A 3L7EA 3UZVB 3MI6A 4HX1A 1RCYA 1M7IA 1NDGA 1WBYA 4MB5A 5T5FH 1I3UA 2XY2A 4XO8A 4FNLL 1A4KB 1TQBB 3VFVB 1OT4A 1TEFA 5K9JL 1XF4A 5HDQL 1EMTH 3PP4L 3PGCA 5EZOL 1KLGB 5C09E 1EDYA 2BSEA 5I0XA 2LTQC 5CR1A 2GFBA 1U58B 2GJ6A 2FBRA 3O6KH 4RMSA 4HMCA 3N44B 4ODWB 1A7QL 1TVBB 1BF2A 4G80A 5D4JA 4CN6A 4DP0X 2JCCE 4D0DA 3K3QA 4UDTA 1H6UA 4AM0B 3G5WA 4HV8A 5E6RB 4KKAC 1A6VH 1QR4A 4YLBA 3EOAB 4RBPK 4GAJH 5E1HB 4M8VA 1EDHA 1VLXA 3BZDA 5LQBH 2D31B 2Q2EB 3OXSA 4ZXBB 5KSUB 3GBNH 4N2GA 1RKRA 2V2TB 3IT8D 2P8MA 3G6JF 3EFFA 4P3CH 4DP8X 1TSHA 4HSAC 4ICWA 5FOJA 3TLRA 2J1YA 2C4FT 2HRPH 2KI6A 3TM6A 1BXUA 3WTYA 5EO1B 1EAPB 2VZTA 3VWJA 2RH0A 3B7UX 5CINL 1R34A 1GZQB 1QBLH 3U9UA 4UMGA 1IGYB 4OVVA 3VRLF 5DC4B 1EJFA 1RK1A 2DQUL 2ZCLH 4FLQA 3RUGA 3ALWA 4RBPH 3H55A 5G5DA 4OGXL 3CZFB 4J3OH 5AKTA 4DEPB 3P3SA 4A7UA 1QPPA 2EDRA 1YNKH 5AWNL 1GY2A 3AXLB 3DTUB 4PAZA 5C8JA 2NY2C 3QCVH 1L9MA 1CGYA 4PEEA 5JIIA 4QD2E 4KTDH 4BQ8A 3IGAA 2FSEB 4FFYA 5ITFB 1A2YA 2P24B 1M9SA 1E28A 4N2AA 3BDYH 3TNNA 3V6FB 3RFZA 3WE6B 2WUCL 4IBVA 1NUNB 1CLZH 2ZTBA 1RPUA 4PJ5E 2WBXA 3K2MC 3HG3A 4AG4H 2COVD 4N0UB 3VXQA 2FH6A 3N9GH 5K9QI 3Q8CA 1QX1A 2AJZA 3SDCD 3DV6B 1XHHA 5D70H 2PXYB 1RZ7H 3R8BB 5HHQB 4YDZA 1CIDA 3UERA 3UJJL 1UVQA 3VQ1C 2CDEB 3DRTB 4ATWA 1FFPA 3RNKA 3HIZA 4HPYH 4A7GA 3GZQA 1XGQB 1LP9F 4KZDH 1AFVL 1LDSA 1O6TA 2NYYD 2Y7OA 2R83A 4XCNB 1UD2A 2G0KA 2QVFB 5TGBA 3T8XA 1A6AB 1AGDB 4QGYA 2EXYC 1PDKA 2NX5A 2WGNB 4XRCB 3N1GC 1OAQH 2LV4A 4AENA 2VZ3A 3V5HB 1E43A 2GIXA 3G6JA 3QRLA 5BRQA 3B8YA 3BVVA 1U8LB 2R7EA 3JT0A 4N5UA 5D1QC 3ARDB 1JV5A 1JF6A 2AXHA 4FNUA 4N0FB 2OMYB 1NBQA 3D18B 4D8PA 3T3PF 3FQUB 5C0FA 5EBLA 5IROC 3B83A 3QE5A 1F4WL 1KDJA 3NCFB 1U33A 4QRRD 4ZFQA 4PP1C 3QEUA 4JREC 5IEKB 2Z31B 5HDRA 1AAJA 3QG6A 4XXCA 5FHAL 3U6XA 1U2YA 4F7EB 4BELD 2QVKA 4IHOA 5EORH 3B2XA 3FSOA 4XNBA 2B0SH 4YGAB 2NQDA 3KPRE 4FTVE 4RH4A 3SKOB 2G60H 1C08A 3Q1SH 1H9VA 1XL6A 4XOEA 1YEJL 2DH3A 3STLB 3HFFA 5BZDA 4O4YL 3QJFB 3PJSA 4JDEB 5HYIA 3HC0A 1MHHB 4KUZH 4K3DL 3MRIA 4BDVB 1OLZA 4PJAF 2JKXA 1DL7H 2WXOA 3TJHD 4YDKH 3STZB 4ZNEA 2I9TB 1NBVL 3BAXA 3AS2A 5LGHL 1LDPH 1OT1A 4GAAA 3CFBA 4QXTA 3UL4A 2J2ZB 4G42B 2WCSA 2IEPA 4CVZB 1H5BA 5F8QC 1BAFL 3U7WH 1QI3A 1ECZA 2AJSH 3VJ6A 4NNYA 4PWHA 4CKQA 3BX7C 4G80B 3H3KA 3UBHA 3GSNB 1RIHL 4XC1L 5DZPA 1S7RA 3HZVA 4NM4L 2YGOA 4TQ8A 4WWKC 1JZ5A 1UT9A 3VX0A 4GJTB 4PRBA 3T0VA 3S4SG 4Z76B 2NTSP 1D3CA 3GD1C 4I4WB 4PJHF 1KB9K 4X50A 3B5GA 1IC0A 4PG2C 5DK0A 4LHUG 4GSQA 4N2EA 2F8OA 2CNYA 1PVHA 4KK9D 3GSVA 3DETD 1HHGB 3NABH 4AE0A 2YZ8A 1YUHB 4DK5A 2EINB 1DZ0A 1WFOA 2ZG3A 2CR0A 3F05A 1ESOA 4XMUA 3SGDI 3TO4C 4KZ0A 2ZJSL 5IW6A 3UPCA 3LKPA 4JO8A 3BD5A 2PF6A 1E6OL 5D5MF 3ABLB 1P84K 1UZGA 1WC7B 3VFNA 2Q8AL 4M1GH 5DFWH 4Q6KA 2A83A 1K8IB 2EC9T 3V0AC 5BCAA 4P4KC 5E9DD 1V7MH 4E36A 2VM4A 1G5GA 3O3DB 5C8JB 1XIWD 1UWFA 2EE2A 2VRQA 1M6OB 2D3NA 1KV3A 5E6ZA 2VDQB 2VO5A 2ZG2A 1KC5L 4DKEL 3KL3A 2ZUQB 4LQFH 1GGTA 4NPYB 4WWKB 2DQMA 1ZEAH 4F7CB 5K9QG 4RGNC 3SE6A 4F7TB 3RWDA 3KL0A 1SPDA 2BC4A 3RDTB 3MHZA 3BQVA 5BZWA 4MLIA 5ITBL 4JN1H 4G9FE 1K2DB 1S5IH 3NZUA 3FQYA 1NCAH 2ZXAA 1WS8A 2PWDA 3LS4H 3UTTD 5KTEL 2VLRD 4YHZL 1FIEA 2FSDA 3D87B 1CIUA 2G60L 1G7HA 4Q4IA 3GI9H 1PZ3A 1TEGA 1VACA 5KUMA 5E7BA 2AQQA 5EFIB 3H9HA 3IVKB 3R0NA 4PJ5B 4B5EA 3TEZA 3EYSL 3OXRA 1NFDB 3WUWA 1AC0A 4GBXC 3P1VA 1LD9A 4FEMA 1MI5B 4F7MB 1BJMA 1YYLH 4NQVA 5EBLB 3K4AA 1I1FA 1WHOA 3MRBB 3ZK0A 3VYPA 4EVNA 3GGWB 3WO3B 4IRJA 1WBZB 4UTAA 4UT7L 3ZTNH 1TLKA 3P4NA 4G5ZH 2HB0A 3C5JA 5E8NA 2ZWNA 4GSRA 4W9CC 1RZFH 7PAZA 5J0BA 4L0YA 1F3DH 5D1ZD 2JK5B 5HGBB 3GFUA 2OBGA 1OCRB 2E27H 1ZPUA 3X13A 3HI5H 3CHSA 5ADPH 1P5UA 4F37F 3S0PA 2GY5A 4KKLC 4BZYA 4Y5VB 5T33L 5CHNA 1FO0L 1MFAL 1MAMH 5FAAA 2H2SC 3P2BA 3BCDA 4OLWH 4ONFH 1N12A 1PCXA 3G5YB 4NKDA 2BM3A 1N0LA 3EDDA 3NMEA 5CGBA 3GS7A 1N4XL 1JGDA 2VO8A 2NT0A 2Z34A 3BYYA 4IKLA 4F1ZA 1CR9L 5HVHB 1XCQA 2IANA 3BZFB 3VI4A 3MNVB 1G7PB 2NY6B 3H53A 3O45A 1GYVA 2XPYA 2R4SH 3EOTH 4JL2A 4D9QE 1MWAH 3O3AA 4GLRH 4PJ9D 3ZDZE 4HCRH 2DWXA 5F7DA 1LEKB 3LKRA 4NN7B 5F7NC 4PUBL 3PPSA 3B3IA 4M7ZC 2F2HA 2W92A 5HXMA 3FCTA 3VFRA 2PW2B 5TDOB 2X70A 2Y07H 4PRHA 3SGDH 2FRGP 4HS8L 5GHWL 4N2BA 1KLGA 1U21A 2UUDH 4NQCA 2DM3A 4B7LA 3AREC 5IHHA 4TSCL 3T6VA 1R3JA 4F15C 4OZIF 1BOGB 1LP9E 1YY9D 3AW5A 2L0DA 5A2CA 4ZO8A 2FEEI 1I1AA 4HT1H 2A4EA 4YK4B 4JFDB 4BE5A 2XKNB 4KZDL 3PLYA 2XG5B 4MCYB 4Z7UE 2Y7QA 3KDPB 1K72A 3D0LA 2NY4D 5DVKA 1JVKA 3MLUL 1QI5A 4G9DA 1V5JA 3MRFA 5C0BA 3B34A 1OD7A 2EDQA 3DX7B 4OCWL 3ZKMC 4YH6A 3V9EA 3RA7H 1NAMB 4FG6D 4FLRA 3KVQA 5AZ2L 1LP9B 1CYGA 3NEOA 4DGYL 3V6OC 3HJEA 4ES8A 4WFHE 1SYSA 3GJEB 4KJQD 3OPZL 3VH8G 1XAUA 4FABH 3CFDA 1HZHL 2H45A 2P28B 2ADJB 3ATFA 1YMMA 2ZKHH 2OMWA 4ZUVA 3QT2A 1Q9OA 1IBFA 1QA9A 4KK6C 2K70A 4JG5A 5HVFB 4HIEA 1R0AH 1OTSD 5E23A 1T1YB 1L9TA 1WAEA 4QJ5B 3F62A 4PG9A 1USZA 3S8GB 1BFVH 1NGPL 3IKCA 4LP5A 4AEHH 1A22B 1RU9H 1C7SA 4R84A 1G7LB 2FIKA 3KPLA 2NDGA 1BD2D 4P59L 2VDKL 1OGAA 4FX5A 2MH4A 4PGEB 4FQIL 2VL5A 1T1XA 2MQ0A 3SOBL 3MBWA 3VDBA 1DVTA 5HDBB 4AQ8A 3GDBA 3F5WA 2C3VB 4RNRA 3W11D 4GG6A 1CURA 1EAJA 2DD8H 3QAZB 5GGVY 2XA8H 1GGIH 1BAGA 2CHDA 2QKSA 4PJAB 1Q9WB 3CFJA 3O6KL 1QRNE 3RGHA 3DSFL 5M7QA 1AR1B 4FTDA 3SKNA 2KLTA 4S2SA 4K8RH 1DBKH 3L9YA 4KK5C 3VE0A 1T03H 2C9AA 2L7EA 2Y23A 3M8OH 1U8OA 3NJXA 2FO4B 4P2RA 1DQML 4LNVA 2OMUA 3MGAA 4TMPA 3EJSA 1UFGA 4ZBJA 5HGDA 2XVGA 2EDHA 3KLAA 1CGVA 5HHNB 1SEBB 1P5UB 4JBSA 5DEZA 1YJDH 3I6SA 3VXPA 3S97C 5CHNB 3TO2A 1E27A 5C97A 2IBBA 1TJIH 2O6PA 2WXMA 3IK2A 1C8QA 2C9UA 4JY5L 4LLMB 3WGVB 1D7FA 1L9SA 2A6DB 4CRPA 4S0HA 2YAEA 3DSFH 4G59C 4WI2A 5KVDL 3PWJB 3Q7JA 5FYLE 2PCPB 5HHOB 1PG7X 3AT8A 2XN9B 5K33A 1BZ7A 2BZCA 2I27N 3Q9PA 1JVOA 2HJLA 3C08H 1P0SE 2DIBA 3GSWA 3STLA 1C5DB 1W72A 4ELKB 4QWWD 4A2GA 1D2OA 2YPVA 4KAQH 5DHVA 2X2IA 4G70B 4UQ3B 3VFOB 1U0QA 1AQMA 1HNYA 4HOWA 1OP3H 3ASWA 3ULUD 1NGYB 5EOTA 4ZFZB 3QIUB 2LU5A 2NX5B 2W94A 4KHTH 4F8LA 2AJYL 3TBCA 4XP1H 4X6FB 3RTQD 2Z31A 1ES0B 1PCSA 4ABWA 5D2NA 3LEVH 3P11H 4P2OC 2GTZB 2NLJA 2WZAA 5F3FA 5LBSH 4MQSB 5JZ7C 4YSPA 1G6VK 5JQIB 1PZAA 4RGMB 4MMYB 5EF1A 2BSRA 3QQNA 5C0FB 1UCBL 5E2UH 3DTXB 2VXSL 3MJ8A 3EYVA 3QJOA 3O0RL 2ZZUT 2PWGA 4XZ4A 2NTFB 1AG0A 1Z1WA 2E59A 2HJKA 4Q6YA 2HYMA 2KZKA 3LH2H 2P46B 4GI8A 2X0WA 4YR6B 2Q86B 3OHMB 2IH1B 1NSNH 3BP7B 1E0OB 3APDA 4XAKE 1L3WA 2GPZA 3LRMA 4S1SH 1OAZL 1X9RA 3ZYJA 4B9ZA 4H44C 4E9LA 1FGNH 4NOFA 5AYUH 1JCVA 1MNUH 1M42A 4FQLL 3HE7D 5SX5H 5BS0E 1PG7H 3ZDYE 1IAKA 2CBOA 2QVTA 2VDOB 1KIQB 4LCUB 3UBGA 4A6YH 1GA2A 4MJIE 1DUYB 4X6DF 2ARWA 4ZUVB 5FPIA 1KXVC 5IV2A 3SY0A 5FV2A 3C2SA 5K39B 3VFNB 3L3OC 1KJMB 1V3MA 4N6RA 3NQIA 3D69A 4HIEB 4FQ1L 1OWWA 4NN6B 4X99A 3EGSB 3P4MB 4HUNB 1GC1L 4ZJ9A 5JHLH 5SX5K 3SKUD 4DGIH 2V9RA 4FE9A 3H9SD 3E3QE 3GSRA 3IDNB 1BLIA 3DJSA 3CDZA 2HRLA 3MXWH 2EEBA 1GL4B 1UXLA 5FM5M 3KYOA 2XVKA 4RQQB 5JNYB 4DTGL 4O2EA 4R83A 2E7LC 4NYLB 2ZUUA 1RV6X 5EIIG 1JZ4A 1ZTXE 5LG6A 4D9QD 4KJWC 1A65A 1QFWM 4XP9H 2AXGA 3D08A 4K9EH 4Y5YC 5AOIA 4C4KO 2IQAA 1XBRA 4C83B 3ARBD 4N2CA 4AM0A 3QCUL 5MENE 3RWGA 4HK3J 1X44A 4I2XB 4C47A 2D4FA 4MMXA 2YPKA 5MHSD 2VR6A 2OR7A 3QORC 2Z7ZA 1LMKA 1INDH 3AREB 3MJ6A 1AYOA 5LWYH 2VMDA 4KKNA 3Q6GL 3W82A 5C0IA 1B0RA 3HKFA 1IJNA 2VC2B 5KOMC 3RNQB 4EXPX 5I5JA 5DJDB 1H5BC 2XQYG 4ODUA 2FGZA 5LDSA 1YPZA 2AAVA 3H4HA 1D5BA 3POCA 4QRSA 3A3YB 5HYEA 1I8MB 3ARXA 1XX9C 2R69A 2JCCB 4WAFA 1OANA 2XA8L 1XR9B 4XCEB 4XT1C 2PTUA 5D9SB 3ZZLA 2IBGA 4X4YB 5F70A 1QUNA 1UQSA 4A6YA 4N2KA 4G5ZL 1OGTB 3PDDA 2NY5C 3OKOA 3QDJE 3K6SA 1RL1A 4TVPH 4R2GB 4C56E 2G30A 4AY0A 2MTAA 4KUCF 5LWYL 4Q74A 4L8BB 2MWCA 2FYYB 1UHVA 2EDNA 1GOHA 1MCCA 5K9KB 2EVJA 1FORH 2B20A 4DW2L 4M4RB 3WOVA 4BZ2A 5C0GA 4H8QA 1IGTA 4DJMA 1A66A 3ARWA 1A1MA 4P9HC 3V4VL 4OIBA 1IKOP 3SGEI 2VQUA 2Y5QA 4NP9A 1AXTL 4M6OL 1KB5H 5D2NB 4LVOC 1LDPL 4WEMB 3PNWB 2X05A 4N2FA 1V27A 2YMOA 3C2AL 3BO8B 2Y4SA 3V6OE 2XTJC 3VDCA 4Z5RA 4K71C 4U3XA 2ZKHL 4A55A 3ETSA 2EDBA 1U3NA 4R26H 1LO2H 1MIEL 1HSBA 5ETUB 4APQB 1Q94A 2FB4H 4KKRA 5BXFA 3R0MA 1RVFH 2X2HA 4OF5A 2NSQA 4PJIF 3HE6C 2CR3A 4YQXH 4KQ4L 4DH2A 5I5MA 3B9DA 3DUUA 1ZA6A 4BFBD 3BHBA 5D7JC 2ZCKH 5FYJD 1KJ2H 1MIMH 3WKML 1PZ5B 1C16A 2W0PA 2YPLB 5C71A 3NCJH 3OZ9H 4RAVA 3B9KB 1SXBA 3VWJC 2AF2A 5DRXA 4KI5F 2NY2D 3TJEL 5J1AB 2YD3A 3CDYA 2C1OA 4N8VG 3IMBA 1BX2B 4HMEA 1ZHNA 4QHPA 5ANME 5I6NA 1HT6A 3F58L 5J4MA 3EYSH 1OY3B 3GKZA 2P5EB 2ZX6A 3ZZ1A 3C5XA 3U4BL 5EU6B 4W9HC 3U0TA 4ZRGA 4BGDA 3V0WH 1OOAA 4M5ZL 2HKHH 3B8SA 3TYFA 5FYKH 2R23B 4X80H 1I7ZB 3K5RA 1UD8A 4RZCB 5EC1B 4ESKA 4PW9A 2BNUB 4HFUH 4IDLA 4NXSA 3CZGA 3QDMA 4EKXA 2NY3D 4FERA 4JGMA 1B4TA 4F20A 5IQOA 4AZ8A 4TTDC 4OD1H 1U6AL 3NFPB 4LQFL 2YK1H 4GRWB 1RXLA 4Y16B 5KUKA 1QMUA 3WNIA 4OIIH 5DK0B 1A47A 4HD5A 3SDYH 5T5FA 3V4PB 2ADIB 4W9IC 4AEFA 4PRPB 1FYTE 1T20B 2H0PA 4HCIA 2H32A 3HRPA 3QW9A 4QHLB 5FUZL 1HHGA 4P46C 2CK0L 4WEBL 5C07B 4KX8A 3I3EA 1FAIL 1NCDH 2B1HL 4PRDA 5DRZA 2IFFH 4FQXB 5T1KD 4ETYA 3LKPB 3BZEA 4FQQB 1RUQH 5C0AE 3TPKA 4DGUA 4UT9A 3U0WH 3PGFL 3MXWL 1Y7VA 12E8H 3T2NL 3LSOA 2QFRA 3GSVB 1M56B 1XF5A 2RR3A 5KSBA 4Q2ZB 1BIIA 3MCLH 3OGCB 5IUCA 4Q89A 3KH3A 1HAWA 1OSZB 1V05A 3BI9X 4L23A 1YMMB 2E4TA 2H4EA 4DVRH 1QWNA 4PY7B 2IPUK 1HILB 1RSFA 4UOJA 2G2NA 4WUKL 1A0QL 2BCKA 1TVHB 3QO0A 4ELME 4XX1G 3PGCB 3BKJH 1NL0H 1EBAA 3I02A 3L1EA 3GLZA 3G6AB 1GIGH 5INCA 3IAPA 4PJ8D 5DHXB 1OGSA 5AYUL 2UWEA 3MNMA 3K6OA 3LVEA 4P46B 1HINL 3QEQD 1XVSA 2M8XA 3NH7L 1JZ7A 2DRUA 5GJSH 3UP1A 5SWQB 1QSVA 5A6IA 3IDMA 3DXAD 4FQXC 4P4RA 1BZ7B 5D6DA 4M8UA 1F41A 4UZUA 1P1ZB 3FCGA 3QEHB 4AQ1C 3MSPA 1H3UA 2WXLA 2FZ3A 4RX4D 3C5SB 4RWHA 5D7JD 3ARBA 3ALPA 1I8KB 2A99A 3ILPA 5HGDB 4QTHB 4HUXA 2R2BA 3P4NB 5CD3B 1HH6A 3OG6B 4F8PA 2YD9A 4X0KB 2BIHA 5T5NG 2F58H 3QXWA 2VLKE 3OD3A 4H26B 2AFNA 4JFYB 2W9LA 1PY9A 4UB0L 4YUEH 3CK0L 2KUTA 5KZCD 5C2BH 4ZW5A 4NFDA 4WNQB 5C9JA 4RMUA 4W6WB 3QUZC 3H3PH 2R1WA 2RQ8A 5HPOA 3DX9B 35C8H 1VB9A 1TEYA 3KYKL 4XN4A 4F37K 4NJAH 1MWAA 2H6PA 3B4NA 3D3VD 2JI2A 4WNJA 4BFKA 3KHQA 3NABL 3DGDA 2EIZB 2V5MA 1QSFD 3KXFD 1N6UA 1OSPH 4OGYL 1BX2A 5GRZA 2Z1KA 1VF5C 4OCYL 1BJ1J 2OZ4H 4Q58C 3L3DB 2NW3B 4WK0B 3CXHK 2ZG1A 2CGRH 4LEOB 5D1ZA 4M62H 1RIVL 3P9MB 1JGLL 4JRYE 4ZZFA 4DFHA 2PXYA 2GJZB 3TZVA 5A16A 3MVSA 5DS8A 3LH2L 1CDBA 3TV8A 3OZLA 2F5AL 3SZ6A 3B5TA 1JI1A 5T1LB 5TTRA 2QHRL 4JGNA 1TZOA 4MLSA 4PREB 2OLDA 1B6UA 5ANMB 4TLSA 4FFTA 4F57L 3US9A 1Z9LA 3UOAB 3MLUH 3F12B 2JQMA 4RMBA 4YXLL 3TCLA 5C0EB 2ZE0A 5DRNA 5IVNA 1ACYH 3CXFA 3PJLA 5EA0L 3QDJD 2PKDA 3AAZB 2LAAA 5HHMD 4KNUA 3MA9H 1A4JA 2CM6A 2FWLB 2IG2H 1AGFB 4XZUA 2V37A 3IFPB 3INOA 3KH4A 4GKZA 3MLPA 2Z8RA 1AHKA 5ABZA 4MWFA 2ALAA 4GSDL 1PTZA 4NRZB 4OAWB 3KPMB 3RAJH 1S9WA 3V6OA 1S4IA 3UGEA 3NACL 4RIRB 3W0WD 5L88H 5T3XE 5E8OB 5IJVA 1EJOL 3P77A 1KCWA 4OCLC 1L7IH 4P2CG 2OYPA 4X5XB 1JGUL 3RHWF 1CG9B 5AZEL 2A1WL 4H20H 2JI3A 2R0WH 4F1SA 3U4EA 1LO5A 5FDYA 3LSOB 5L2KD 1AI1L 1S5HA 5JPNA 2B5IB 2OK0H 1QI4A 1DVQA 3QDMD 4Q2ZA 5DS2A 3UAEA 4PWJA 3HMWL 5E9DA 1U91B 2GSIA 3I2CH 5IB4B 2BNRB 4K5PA 3FQXA 3WY1A 2CO6A 2YAPA 4I2XE 4WFGD 1YUKB 3RVUD 3EAKA 3MACL 2BXZA 2A9DA 3FUIA 1TZGL 1Y1UA 1MHEB 4XBGB 5CBAB 3FSAA 4F9LC 2EZ0C 4R7DA 5C0CA 3KPSD 3NIDE 2XTJE 3PL6D 5LCVL 4LOEA 2D2CC 1ZHBA 4K5NA 3HA0A 3V4PH 3A67H 2MOQA 1BIHA 4M00A 2J1KA 4JKPH 1HHKA 1KCLA 4O2FB 1D6VL 3JV4B 4EI0A 4W1TA 3WEXB 3LXBA 4HDIA 1ZE3C 5D2LA 4JY4B 3D48R 1RZJH 4LPXA 1QLFB 2RFXB 5MEQB 4FXGA 2OYKA 3HG4A 3S5ZA 2WQVA 1P4BH 1Z3GH 4BSJA 3NPSC 4JQVA 5GSVA 3DGGA 5EU3B 3DI3B 2WIIA 4JZJA 1RU9L 1B88A 3BC9A 2X7LB 2AJYH 5C0GB 5CFAA 5JXEC 1A7PL 3UZEC 1GS6X 3VTMA 4EJ1C 5JHAA 2R2EA 1N3NA 2EEXA 2VLLA 3GXNA 2DTMH 1DQKA 4NNPL 5F9JA 3D3VB 5FGCE 1QASA 4PJHB 2V5TA 3CE1A 3HVDA 4XB7A 2WLYA 4OM1L 1OO2A 2NX5E 4W6XB 4W93A 5IVXF 4EI5D 1ZGLP 2X40A 1UGNA 4FP8L 4TNWF 2OTWB 3PWVB 4CDGC 2AAAA 4G7VL 2QV4A 1IM3B 2ZWYA 1NGXA 3E0GA 4S10A 5C0RH 3FTSA 2EXSA 5ALBH 2IG2L 3SN6N 1HCYA 4LARL 3FTGB 1FFOA 2YEZB 3BVTA 5DJYB 4DZ8A 3PREA 5J3HD 1KJ2B 3PWNB 5A2FA 4N2DA 5DJ2B 2XWDA 4OCWH 5HHOA 1YQ2A 1CL7I 4M6ML 4NKMA 5KVGH 1ITCA 3BH8A 2XQYA 3EO0B 2ZOLA 1L9NA 2DTSA 3APNA 5EC2B 4NQDD 3HB3B 2V6HA 1H3GA 3FB7B 1G7HB 1E5BA 4DUVA 5FFLA 2H0JA 3P4OA 4ANXA 4F9LA 3HI5L 1HSBB 1BXVA 1Y6KR 3ZVVA 2EP6A 3L3IB 3LOWA 2OMBA 3TZVD 2Q8BH 2Y7SA 4RVBA 5HJ3B 3WHE1 5JXED 1PEWA 5HHXH 1UWXH 2QSCH 4JCLA 3GJFK 1UOWA 3HNVL 3L5WA 4GP5B 4FULA 4M3KB 3CN1A 5E1IA 3ZT5A 1RUAL 1CXKA 2Z91A 4PRAB 2XRAH 3KXFA 5IQ9B 4KK6D 1WT5A 5EIIA 4P57A 4EZJA 1IAIL 2NZ1A 1MH5A 4NRZA 4OAWA 2EYSA 4U1HB 1CE6A 4G8AC 4JFQB 1FNGA 4LQ1A 3H2PA 3V5KA 5DJ6A 4FLHA 4IRSC 3TBYA 5I1EH 2R56H 1PD1A 1DVUA 2XNAB 3HBZA 3QWOB 2CLZB 5I1IH 4OW6A 4AEHL 5I0ZA 1KFAL 1OIOA 1R33A 1MRDH 3N85H 4L29A 4MZRA 4ZOAA 4DKFH 5F7EH 2ZUQC 2WV3A 1OTTC 3MV9E 2PUQT 4JFXB 2Q7AA 3DKHA 4N0YL 2ITEA 3HZMB 5LGYA 5FC9A 3RBSA 3OAZK 2R69H 3BUDA 2FLMA 4M5YH 3BVDB 4AVKA 1BGXL 5DRZB 3ZHDA 3IMTA 4QXGH 4NQEB 1U3JA 4ZOBA 4GRLC 2PO6D 4ZOEA 3FO2A 3ATEA 3QUYA 1IMHC 1VEPA 4GKNA 3CHRA 1ZXKA 5B3JE 3ARGA 1Q90A 4GXVL 2WXHA 5E4IA 1DBJH 4E41E 3WIAA 1DSWA 3LN4B 4NZRH 2GG1A 32C2A 4WJG3 1TQUA 1BM3H 4MKMA 3RL2A 1OPGL 1SJMA 3FRPA 5HYJB 4QXVA 1ACZA 2OKMA 4OLYL 2IAMA 5AENA 1S7SA 2Y69B 3F7PC 3VG0L 4A7TA 4A7GF 4AH2A 2F54A 2CK2A 3MV8B 2GK2A 4U31A 1OM3H 5JNYA 5B8CC 2HG5A 4UOQA 2ORBL 1UJ3A 2AABH 2PCXA 4F3FA 1NBYB 3EGSA 3P4MA 3X3GH 2D31A 5KSUA 3G5VB 2VLME 4ZXBA 4HSQA 2NY0B 1C1EL 4Y1SA 1S8DB 3MZTA 2ADIA 4P07A 3MRCA 1N8OE 4L2YA 5EZIH 3V0WL 4B27A 2L7JA 1J8HB 3P3TA 4S11A 1CFVL 2PETA 2ZX7A 2Y1ZA 4LSPL 2GBVA 5I23A 2OL3A 4Z3IA 4KKCD 4LSTH 2VMEA 4U6VL 2AABL 1S5IL 1HCZA 4IM8A 3BAEL 3GB7A 1M7DA 1D9KD 3FO0H 4FRWA 4AXWA 1D5RA 3LD8C 5CSBA 3U36B 3QULA 1FNEB 1S78C 4PJCB 3SQBB 3ZU8A 3EO9H 2X2JA 3TL5A 1JYXA 1MRFL 3UFIA 5EBGA 1XSKA 5E00B 4MVBD 2ADJA 3PCYA 3CWGA 5LBGA 1CLCA 4OCNC 5FOBB 1ML0A 5EU4B 4KQ4H 4LDEB 1KEML 2K78A 4Y2DA 1ZJBA 4WNQA 4B0MB 3O4OB 2B08A 4YC2C 5DUBB 5DMKB 2NZ9D 1L4IA 4JMNA 2EIJB 1OTTD 1TVHA 2HJFB 3QO0B 1LO2L 1MIEH 4R2GC 1S7VB 3T2PA 4X83A 5E95B 3FT3A 5JO5A 1K4DB 4F27A 1GYWA 4I88A 2WYZA 5T1MA 3RU8L 2DQDL 3HPLB 1PKOA 4FF9A 1TZHA 3CSGA 3KJ6L 2Y36H 1IGTB 5AL8A 3UC2A 3NA9L 1JMXA 2FWOA 1I8AA 5HJBA 4JPKL 2E8ZA 4XXWA 4K71B 3EO1B 1RPQA 2XXCB 4YMPA 3VM5A 1UD3A 4U3CA 1HXYA 3IU4H 3WY4A 4WFFE 4PRPD 2VLRE 2W88A 4PREA 1ZRUA 5FYJH 4Q6IA 4GH7B 1A6VL 3B9AA 2RHEA 1KTKE 4Z18A 1YPZB 2X0UA 2F7QA 4UM8A 2NRDA 1OP3K 3IETB 1BVLB 4MJHA 2DMKA 1D6VH 1I4FA 1JV2B 2X4SA 2V5YA 1P4UA 5K59F 5I75B 4WWOA 2B7DT 4P5KA 4I9XA 5IMMB 1LWHA 4MRBA 4P2QB 1Z5LB 5L0QB 3KJ4C 2CXGA 1TFPA 1W8OA 2A6IA 1SEBA 4XNXH 4QRRA 1MCPH 3BGFC 3ECBB 1F5WA 1UB6B 3QH3B 3VXPB 1T5KA 3QNXA 5CEXA 2CHNA 2CMRH 4XR8C 4GG6E 4YX2L 1KIPB 2DEYX 3EDEA 4PD4J 1ORQA 4WJ5B 5B3SB 1THCA 1PF3A 5IMOA 1IEBA 1B3JA 2FATL 3T4AA 2XICA 2A6JB 4PJXF 1QSEE 3UAAA 4UM9B 3SDAB 5EU6A 4LLVB 1QVOA 1WUNT 1M2OA 4KJWD 5I1EL 4LSRL 3OMIB 4P49A 2WVVB 3KGSA 3CX2A 1H8SA 3VH8B 4R5VA 3T0EA 3GZPA 3FRPB 2RALA 5ALBL 5JPMA 1PJWA 4UT9H 3COOA 1JP5A 4PLJC 1GOGA 1T0NB 2DLGA 3NP4A 3FZUD 3BPLC 3G04B 3PWPA 4YHPB 4JR9L 4IS6A 1X6NA 4L9LC 3OVUB 3IDGA 1BBDH 3Q2LA 4HXAH 2PP7A 1MW1A 3RWFA 2FHBA 3JV6A 1KBGH 2Z8WC 4YE4L 2JTDA 4PGCB 4IMKA 5LXGH 2D3JA 1IU1A 2OQJB 5CS7A 3EHBC 3K4DA 1AGFA 1WDAA 2P3YA 5C0NC 1AP2B 3U4KA 2RJMA 3BAYA 3LPPA 1T83C 3NT0A 5FB8B 4WI8A 1JNNL 4TRPH 3VFUB 4IHBA 1JNLH 4HU2A 4OJFL 4J8RB 4NX0A 1UD4A 3CFIC 3QFDA 3GSXB 4XNDA 5EH1A 3BP7A 2BY1A 4ZFOB 2RACA 3QDGD 3F83A 1G4MA 1IC5H 3QCUH 3WFHA 1ETB1 4LSQL 2WKLA 3WY2A 5JW3L 3FQRA 2JB5H 3OAYK 3O6LL 3DX1A 4N87A 2UV3A 1BV8A 3K81A 4QXWA 5FECB 4MA1B 5TE7H 4Y9FA 3HC2A 5AAWA 1IGJB 1QFHA 2VUYA 2Y2YA 4PP1D 1EQWA 4X6EA 3O2VH 3H42H 2AMGA 2VLJE 3SDDD 3UTPD 2R0KH 3ZL4L 2BIMA 4EMZA 3BGMB 4L8DB 3SPGA 3R19A 3ESVF 1IFHH 2JJSC 3O6FD 3OKKB 4U1IA 3TEUA 1WCBB 35C8L 3GRWH 4LCWB 4X9GA 1JD7A 4WTZA 3NJLA 2OYLA 3NIGE 5FF6A 2HVJA 5KSAA 4BHUI 3AM8C 2JWYA 4FJZA 4ZMZA 3V8OA 4N28A 1T20A 5DMGD 1MFUA 3L3KB 1UOVA 4Z3GA 2HUHA 1FBIL 5DJ2A 1YHPA 4NWTL 4CVXA 1TDQA 4PQXA 1BQHA 5DI8B 2X4PB 3VFMB 3D39D 3SPJA 5J6HB 5KVEH 3IGLA 2J1XA 4MQXD 2Z0BA 3GKWH 4MBRA 4H2AA 1A14L 5GQBA 5I8KL 1VHPA 1JAEA 4HVBA 7FABL 4ALAH 2HN7B 1IGCL 2HTKD 4S0SD 1AXSA 1AGCB 5I19H 1VFBA 4KKBD 4AUUA 2WLIB 1I1FB 3HAEH 1RI8A 2CRIA 2VSKB 4CN4A 3PHQB 2P8LA 4J3TA 2QSQA 5T3ZH 1NCCL 2BY3A 4BGLA 3NRPA 3MLSL 2N1TE 1FO0A 2P1YA 3CUPB 1O9WA 1ZA3A 3OKYA 1A21A 4P5MA 5I74B 2I7OA 4Z7OE 4ABVA 4UUJA 1FP5A 5PAZA 4P05A 1CK0L 1A6TA 2JNZA 1Q8MA 5GGVH 3AY4C 2FBJH 3TH3T 2AJZB 2AGJH 2WXJA 4WKZA 5JHMA 3HS0C 3V0VB 3F7RA 3CNKA 4FNRA 3JWDH 3WMPA 3X1NA 4AT6A 2IAAC 4X0KA 3RNKB 1FG9C 2E7DA 1ANUA 5LN8A 2BNRD 1BW8A 2ITDA 3LZRA 3V0JA 3PUUA 3UTTA 3F7LA 1A02N 2OFQA 4FZ8H 4IEFA 1SVCP 2QQLL 1AGDA 1JZ6A 4N0UA 3VXQB 3EDKA 4WI7A 4AQEA 3JUZA 2J6EH 2WQ8A 3O8XB 1Y0LB 1QFOA 2UZIH 1PX3A 4LLUA 4J1UA 4KKZA 4PW3A 4F2ME 3TF4A 5BRZA 4ZFFB 4W9ZA 4A7VA 1CZ8L 4HS3A 1NANI 4N0RA 5DJXA 1E30A 3O3BB 2CUAA 5B4MD 3SY6A 2XTJB 3IDGB 4G71B 4F80A 1DVZA 3GLAA 5ABDE 4PGDA 3TBYB 5EEYA 2JCCF 4XAKD 2A4CA 1RIUL 2N59A 1XGUB 1A3LL 1KB5A 1TTBA 1DFBH 3U6XS 3V52L 2Z92B 2APXA 2FQFA 1XCWA 3GHEL 1P4LB 3BVNA 2GITB 1IL1B 4BXVA 3H7BA 1LVEA 3OG4B 1CDYA 2JELL 3ARPA 4XP4H 3V5KB 4UNVA 3I84A 1EK3A 4PJ8C 1E5AA 1J8KA 4V1DB 1FVCA 4U1LA 3AU0A 4UI2A 4NIKB 4PJFE 2AS5M 3SD5A 4FA7B 2F19H 3L1OL 2AZUA 2D7PA 3EW3B 3TONA 4IBQA 1WISA 4KMLB 4Z77A 2PR4H 2DMHA 2OMVB 4YZFE 5EUOF 2B5IC 2VLRB 4OFIA 4OU3A 2LVEA 2WXIA 1IGCH 1CFNA 2VITB 4OTXL 3DO7A 3BFQG 4HF5L 3T6WA 4AV4A 3UG3A 2GEEA 2AVGA 2GIYA 3OX8B 3ZT7A 4NO0A 4ELMA 2R2CA 1PIFA 4LLAA 3ARTA 3BKCL 43C9B 3R4RA 5FO7B 1N6QH 5DZNA 3VFVA 2BX5A 2CUHA 1IV8A 2EYTA 3F7YB 4PV9B 3M86A 3BUQA 1W0VB 3ML9A 3VGBA 2CJTA 2W60B 4PJIB 5JR1L 2F18A 1JTPA 3VFTA 1Z9SB 4N86A 1J1OH 2H3KA 1RUML 2NXZD 4GLRI 4JZNA 1HIML 1ZHLA 2PN5A 1T6WA 4WHYG 2EE9A 4IOIB 4MAYC 4OJDH 12E8L 2A38A 4PH8A 1CXHA 2H0EA 3CXDH 2KT6A 4CU8A 2EH8H 3H56A 3C60D 3O41A 1VGKA 4KO5A 3TA4D 1WA2X 1JZHA 4EBQL 3JTTA 3SPIA 2O1AA 1AR1D 2CALA 1TQWA 2EVIA 1BQSA 3LIZH 3D06A 1T2QL 2R2HB 1IBHA 2YEVB 2P5WD 4S1RH 2WIIB 4Z7WF 2IWKA 1IBZA 3TT1H 4XVUC 2ZP0T 4P3DB 4GUPA 3WTTA 4DPAX 1S7WB 4G3YL 5KYUA 2GTQA 4LVNC 1H15A 4OT1L 3UEQA 1OCWL 2ICWB 1KG0B 3DJRA 4GAYA 5CJXA 1O7DC 1IJ9A 4F7MA 5GSVB 4UIMB 3T2QA 5I5IA 3FONB 1NEZG 2X12A 3GGWA 4QRFA 4D7BA 1Q1JL 3FFCD 3EJZC 3AFLA 2XACC 1AKJB 1LNUB 1TQBC 3GBML 4U6YA 5LXGL 1A2YB 4FMVA 2OXHA 1GZQA 5E6IA 1YCSA 3MV9B 1J0KA 1U8CA 4HBCL 4DHLA 2HFGL 4K0OA 1M71A 1QBBA 2A6DA 2EDEA 5B8CA 4NQCD 5DJ0B 4MS8D 2E7LA 1CYWA 3CN4A 2BP0B 2H3XC 4MCZB 4O02L 5JW5B 4XOBA 3VRJB 4KMTH 3VSQA 4IBYA 4XGZB 1YNTA 1WZLA 3PWLA 3BZ5A 1EO7A 3X14B 1L6ZA 5J12C 3QK0A 3B7TA 3IJYA 1OAYH 3I6LD 1J8SA 1NKOA 3TBTA 1JF1B 4G3YH 1CR9H 3V5HA 1WE5A 4PRIA 1CICD 2D9CA 5FUOL 4L4VA 1A3QA 2DIAA 4K3HA 2NR6D 1HJCA 1N70A 1QPXA 2N4IA 3C60C 3UO1L 1I75A 2VT0A 4WUUE 4ADIA 1RZQA 2X6VA 5T1JA 3ARBB 2XWRA 4P2QA 3S3SA 3RWJB 4IBWA 2X88A 4XCNA 4A2HA 3U79A 4GW5B 1WH0A 1PNCA 4LRNH 3QQ4B 4WO4B 2VN4A 1Y18B 2ZX9A 3H6JA 4L4TD 2Z4TA 2XPZA 1G9MC 3FRPG 1I8IB 4W9DC 1LE5B 4BSVA 5G2NA 2DKUA 3NH7H 4ODSH 4E42B 3TNNB 1MDTA 1BOGA 1RERA 3EIFA 4GO9A 4L29B 5CJ5A 4WK4B 4DP4X 4NFCA 4UU9B 2DY2A 1BQLH 1MCQA 3CAFA 4OJEH 1K5WA 5MERB 3VXSE 1YN6B 1MG3C 3ZE1E 2GTWA 5T3XL 1R75A 4RISL 1L5GA 4GQ9H 1ZOXA 1R5VB 3O3UN 4ZFGL 1M6UA 3CX5K 1VSCA 2DPKA 5GRUL 2VXQA 2N7BA 4NQEA 4LSTL 1D5ZA 3B3IB 4XPBL 2XBTA 5D6CB 3SY0B 3ATBA 2YS4A 3FN3A 2XJLA 1CJYA 3IXAB 3S8WA 1HQRB 4MA1C 4UM9A 3TZVB 3O45B 1G1YA 4WENB 1V7NH 3MCKA 1CD1B 1IZJA 1ND0B 2ZUTA 3BT0A 1RFDH 2CA3A 2HKFH 3GJEA 2PW1A 3H9SB 3ZTJH 2E56A 4YVNA 1Y07A 4IOFC 3MYJA 2O61B 4AVHA 4Q97A 3VGAB 4LRNL 4MAZA 4OD2A 1HYRC 1X5YA 2NXYD 5IESH 1S7RB 3HZVB 4Q9QH 3KBFA 1AMXA 4U1HA 3FQNB 3T65A 2VDLL 5EPMA 3BE1H 2KZWA 2R4SL 1OEZW 3MNWB 5A43C 3AAZA 1B0GA 1FFRA 2ATPB 3E7JA 3BUIA 1R4XA 5FGBA 5CLTA 4LE8A 4CSPA 1PMYA 1I1AB 2WP3T 3P11L 1ADQA 1FAKT 1X5ZA 3BUBA 3DSNA 4JQVC 5AOMA 1I9RH 1X7TA 3SKOA 3VXMA 4YX2H 5IQNA 2GUOB 1DZBA 1GYCA 4KX7A 1Q9LA 3ARFD 1SJEB 3C5ZA 1BQHB 1B4JH 4XBEL 5SWZD 3KLHC 3IEAA 1MRCL 3KS0J 4JDEA 4ZX4A 1J12A 1C8PA 2DQFA 4XCCH 5IFJA 5F96H 4E2OA 3G5VA 3RTLA 4X8GA 4HCRA 4XHQA 4LEXL 4BHUA 5J8OA 3QRFM 3VQLA 4U1IB 1TTAA 2X10A 4N2HA 3UDWA 3UG4A 3V5DB 3GMRA 4KKCC 5FF6B 1A6PA 3C5ZD 2HRPL 4B60A 5I2IB 5B21A 4WFHD 2LAGB 3C87A 4LMQE 4TQIA 3CFUA 3VXMD 4B50A 2OTPA 2YMTA 3GYRA 3QNYA 2MCAA 2I60L 3MUJA 3VXNA 4Y2LA 1TJIL 1AHWB 3TT3L 1MF2H 4X6CA 4WHYH 1WD9A 4U1JA 5GRVL 3U6RB 2WYTA 5FX3A 4L8DA 3D2UB 3SDDA 3OBAA 3NIDF 4MQXC 3VYOA 4I18A 1TITA 4OQTL 3TXAA 3KPOA 2W9DL 3HE6A 1MNUL 4AQAB 5TE4L 3AACA 1VFBB 3BKML 3QIWD 2WNGA 4PB0L 2QPFA 1TTFA 1F97A 4YO0A 1G9HA 1XO8A 1L3NA 2W1NA 2ITCB 4HH8A 4JO2L 1EWHA 3HVNA 2X4PA 4JN1L 4AGNA 2QSVA 2ZKXA 4DOHE 3U7YH 5JZ7D 3FU8A 2F1AA 4JX0A 4AJVA 4BQ9A 5F7BA 2AJUL 5G4NA 1WC7A 2V5SA 3CVHL 1SRDA 1WQVT 5CZKA 1KXVA 2WZ5A 1AQ8A 1CTOA 2E6PA 4MD0B 5HHMB 3OJDA 2BSSB 4JB9H 2NNRA 4Q7DA 4XCFL 3S2CA 5JIPA 2MSPA 5FYKU 1E27B 3MUZ1 3OF6A 4CC4C 3MJ7A 4K94H 4JM2B 5I1KH 5KYXB 2H26B 3DK2A 2XHNA 2Y72A 4JFFA 2C8NA 1J0ZA 4JHAL 5FHAH 3N06B 5CU5A 5AVQB 3V7AE 5KN5B 3G5XB 5IB5B 2DQEL 2VRKA 3CZFA 4WF7A 1JUFA 1G5AA 3U1SL 5KOVC 3G6JE 1MCRA 4JG0L 3GK8L 5IMKB 4BQ6A 1A8ZA 1KYUA 1H8LA 1R6VA 3TIDA 1KYFA 1E4KA 4OGXH 4KJYA 5D93C 3RX8A 2WQRA 4Y4FC 3RAJL 4WW2F 4MD5B 2N7AA 1GZHA 2BINA 5TD4A 5IOPA 1A9EA 2FNWA 4RDQG 5D6CA 1MPAL 5EF2A 4N4YB 2CZNA 3A24A 3CD4A 3DX8A 3PAZA 4R7NB 2A73A 3MV8D 5CJQH 1U42A 3W37A 1TUPA 4NJ9H 3APCA 1XGRA 3TA3D 2DKMA 1CE1H 3Q6GH 5CJBA 3O6LH 2WTRA 3FTWA 3H3BC 4TNWK 5L7XL 5I1AA 2BZDA 2PO6A 3L9RA 4GO8A 1ZDQA 3BUYB 4POUB 4Z9KB 4Z7NB 3OAZH 2ZUYA 2JLLA 3ETBF 3CHOA 3IDYB 4LCWD 2HUEA 3ZMEA 2L7UA 4O2CB 3U7WL 5C7XL 1PX4A 3T0EC 5I6LA 3N9GL 4M1CD 5GGVL 3O3BA 1R5IB 1NTDA 4J28A 3RWFB 3O4LB 1S9XB 4WTWA 1CE1L 4LOFA 3MRDB 3NIFE 4JPVL 4M93B 5KW9L 4G8EA 4EF3A 2BSCA 5E7FA 3VACA 1ADWA 1GGUA 4X4ZA 3N1FC 3OSKA 3HLKA 3WS6A 5J9PA 2GT9B 2CGRL 3L4WA 4XVSH 2Z64C 2DIJA 3PWPD 4R4FH 4F24A 5EF0A 4APXB 4Z7OF 5JOPD 1LK2A 4Z0BH 3HI1B 2YHGA 5I18L 5E6ID 3LD8B 2OSXA 1MCJA 2ZXCA 3DURB 3PY9A 4N6QA 3WD5H 3C6SB 1A14H 4PY8J 4W9EC 5I8KH 2UZIL 1GVIA 1G9NH 5K9OB 3DUSA 1TTUA 1YEHH 1G43A 5IM7B 3QNZA 2AQNA 4EIBA 3MBEB 5DUPH 3SKMA 1INQB 1NC2A 4LL1A 2HH0L 1CDJA 4EUPA 5KVFL 5F88B 5FW7A 1XF5B 2QGDA 1A7NL 5I1JH 1NA8A 2XPGA 4R6UA 3GBLA 1ZJAA 1NEPA 1F86A 2YD0A 1BJ1H 4NBXB 2K0RA 3MRFB 4H8UA 1DEEB 4PB9L 2YRBA 1NMCC 4EOWH 2DMBA 5IV2B 5M95B 5CLZA 5BRZE 1RD6A 3K46A 1L0YA 2GJ6E 2Y06L 4HKJA 5AB2A 3RKDC 1BECA 1WPCA 2BS71 1Q9KB 2BVOA 3NCEB 3A4EA 3FONA 4PJBE 5BJTA 1N68A 2O6FA 3ZZQA 1KPUB 2XWTA 1N67A 1XXFC 2X89D 3WSQH 3A5VA 4F9PA 3EGDB 4AV0A 4PYGA 3RB7A 5IREA 4QXUL 3V4UH 1IUZA 3N42B 1QSZA 3MV9A 3RGVC 3RRQA 5FO9B 1RZGA 3MACH 3FFDB 4WWPA 5DJ0A 3RZWA 3UZQB 4ABUA 3MFFA 1BBJA 3GXDA 5T1KB 4FS0A 5C0BE 4X6DA 4GW1B 5DFVD 4PTTA 1L7TH 3HRZB 2YAQA 1W9XA 4YVUA 5F71A 2FZ3B 5DC2A 4WUKH 2WXKA 1PZ2A 2R2HA 3IJYB 2DQIH 3ZTDC 3KWVA 4M4RA 3SGKA 2F7PA 2XZCL 1JFHA 2FJHB 5EEVA 1MREL 1T7WA 4X9IA 1HEJC 1F3RB 3QIBB 3D07A 3IRPX 2IADB 1JWSA 4NQXA 1QQDA 2J21A 1RLBA 1DVFD 4LLYB 3CQQA 1NFKA 1T80A 4LVHC 3SGEH 4PJ9C 3S36H 4JDVA 4NCC1 2A74A 5C07E 4OJCA 5F1IB 4FHBD 4PJGE 5AALA 5AEAA 1AIZA 4PJCA 1SXZA 4TOYH 2BW5A 3NCCB 1FH5H 4D3CH 4WFED 1RZKH 2V9UA 5ICXA 2EKSB 4NAMA 1KULA 4U6YB 3CFMA 3FU0A 5I0YA 5EEZA 5I1DB 4OGAC 4LSSL 2OR9H 4JE4B 2FL5A 3UBXI 1KCRL 5F6HI 4F7TA 5CMAB 1NAML 3MLYH 3GBNL 2VXQH 1ACCA 3I3DA 3SDYL 3GT6A 2GBAA 2W0FA 2WYIA 1SN5A 3BDXA 3W9EB 4OGQC 4QRPA 2WTRB 1MAML 4IKKA 4HOZA 1XAKA 3J8F7 5D7SL 2XZQL 4TQHA 2AI0H 2HWZH 3QUMH 3AROA 1GC1C 1AIFB 3BDBA 5I1LA 1E2ZA 4Y5XB 1ZVSA 5T1DH 5DD5L 4O00A 5AW2B 4ZMPA 5GZOA 2F08A 2DDQL 3PXLA 4OM0L 1XGYH 3VFPB 1A6ZB 4JFDD 1LE5A 1NFDA 1GCFA 4XX1E 3CV5A 4OCYH 3D09A 3FU7A 4CMHC 2XFXA 3HZYA 4TV3A 2ID5A 2FX7L 5I6PA 1XGUA 1UM5L 2I5YH 4IBSA 3NIDB 5HYSA 3CTTA 3IXTA 1RY7B 3JWOH 4HBQA 4JPQA 1U92A 4G8GD 1YYLL 3VI4F 5D2NC 4EI6A 1T4WA 4NC1E 2AEQL 1ED3B 3Q13A 5AW9B 2YRZA 4GIAA 4I3RH 5F1KC 3D9AH 1Q0XH 3DYOA 2VJXA 6FABH 4XO9A 3V0DA 1ID2A 3SDAC 1JNHA 4Z3TA 1ET8A 3BHBB 2PXYC 1SLVA 3L81A 4ADJA 3PP3K 3J7HA 1DHKA 3DA0A 4LESA 3EBAA 2YQ3A 4YFEA 2WUBL 3RWHA 4OIAA 4XB3A 3TF7C 1F4XL 3E80A 1YZZA 3WIFB 1VFAB 5L2JB 3DO7B 4AZUA 1BG9A 4YZWA 3L7EB 3UZVA 1IAKB 1FO0H 4LHJB 5DD6A 5DO2C 1MCSA 4XBPA 1F13A 1YEEL 4NKIH 4ZFOL 1DUYA 1NIBA 1TQSA 2D0FA 3BP5B 2F53B 2B1HH 4FQQA 3ECVA 1WZAA 1YEKH 3EYOA 3MBXL 5SWSE 1QRNB 1NC4B 5FKPA 5GS1A 3HI6L 1MI5D 5JMRA 2XWBA 3CVIH 3LNDA 3LYRA 3Q1SL 2X09A 5EZLB 1MFBL 2GHZA 3KPNB 3F65A 3ZL1A 2K3TA 4PV8B 1A9VA 1IC5L 4JRXA 1O9ZA 3HAEB 2W91A 3ISYA 1KN4H 3LQAH 3QQ9D 1MRDL 2JF1A 3BWUF 3OKNB 3P2DA 4H8VA 5ACMA 1PJ9A 4TLUA 5D71L 1YNLH 2HFTA 3ZE2B 5EG6C 3DRQA 3S96A 3FO0L 2AEQH 2IANE 4X9FA 1F02I 1IAOB 2YPVL 1IO4C 4XXDA 3IGUA 5E94B 1MUJA 4LL9A 2V2XB 5IB1A 5I6MA 2OZ4L 4LCYA 5I66A 3QQ9C 1V7NL 1OF2B 4JPSA 1MJUH 1LEIB 1FZOA 3GTVA 3KJ4B 3BEWB 2P4AB 5F1NA 4MA3B 1KYOK 3GMRB 5F9OL 5FDWB 2DQTH 5DD5H 3QEHA 4ZS7L 2A9NH 4FFWC 4U1GB 2WLNA 3APMA 3TX4A 4ZG1A 4OZIE 2LVCA 4LGSB 3VXNB 4XMPH 3QSKB 5IHZB 5E5MB 5J11B 1CVRA 2VSDA 3BSZA 2CLRB 4X7DC 1D7CA 4EDXB 2BIQA 1AY1H 3K6DA 4I1NB 3CLWA 3LXAA 1LL1A 2HT2D 2JJTA 2R0ZH 3PF2A 2VR8A 5BS0B 2PTVA 3FTGA 3MLVH 4X6EB 3VXOB 4OBRA 1N5YL 4JRYA 5HDBF 2H7WA 1SJVA 4XVTH 5SWQA 4XMPL 4KO9A 3E6HA 4L2LA 3MLRH 3DVGA 2FIRT 5BMFH 1NEZB 3QCVL 2G3XA 4FKEA 4MHHG 4MGXA 1YNKL 5AWNH 1XGTA 4EUPG 1UEYA 5F9OH 4I48B 1UZ6F 4KJYB 5FYLH 4PD4K 1YEJH 1NDTA 5B38A 3IPFA 5BW7C 2DYRB 2IDCA 1U95B 3I75B 1O6VA 4UMSA 5JXAL 3GMMB 4Z7WB 4ZMVA 4MJ5A 2OJZH 2R2BB 3S3BB 3EJYC 1T1XB 1AZRA 1JPST 3G6JB 5KYXA 4HHAB 3UTZA 3ULVE 4RFNB 3RFZC 3QJZA 4U1NA 1S3RA 2W65A 3VXRA 5T3XH 1R17A 2J1WA 1O5PA 4PJAA 1WG3A 3L3JA 1OKEA 2VERA 1QLEH 4URTB 2QGCA 2WXFA <