3NE5B

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CusBA heavy-metal efflux complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Cation efflux system protein cusB
total genus 60
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ne5B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ne5B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ne5B01
4H0LC 2D5DA 2QF7A 4HR7B 4GZYC 4XIGS 2R6GA 4H44C 3QJYA 3DXJC 1CFMA 3A8JE 1B9MA 3LWUA 3BG3A 2A6ED 3VR6A 1H9SA 1K8OA 2JEAI 1H9RA 4KHZA 3MXUA 1TKWB 4RCNA 3PUXA 1GUGA 2PNRC 1HTPA 3I4LA 2BA1A 3WDNA 3KLRA 1I6VC 2BA0A 1OXVA 5A35A 4KKTA 3QIAA 1E2WA 4G7OC 3L7ZC 4I7ZC 5BN3A 4DNTB 1EWHA 3W3AA 2EDGA 3BDOA 2D2CC 3OW7A 2O5IC 1IYVA 1VF5C 1GUSA 1DD2A 2Q8IB 1H9SB 1Y69U 2A6EC 3HGBA 2PPBC 2EJGC 2BE5D 3IFTA 4KI0A 3M7NA 2K32A 3ND9A 4OGQC 3VR2A 3T51B 5BN4A 2ZT9C 2KCCA 2DN8A 2JEBI 4G7ZC 3VR5A 3A8KE 1FR3A 3TZUA 3CRKC 1Q1EA 4PV1C 3D4RA 2K7VA 1ZKOA 5JEAG 5JEAH 2E75C 1HPCA 1IW7D 1Z7TA 4IQZA 1CI3M 1VCIA 3N6RA 1OXTA 3T53B 2AUJD 1E2ZA 4BA1I 1E2VA 2JE6I 3VA7A 4OO1G 4OO1H 3LNNA 2AUKA 3PV0A 5KNBA 2AWOA 1IW7C 4L8JA 1LABA 3GQBA 2A68D 4JBWA 4TQUS 1QJOA 1GHKA 1DCZA 1Y8NB 3NE5B 2L5TA 1O78A 4DNRB 1DXMA 1H9JA 2K33A 3VR4A 3PUYA 1BDOA 1OXSC 1IYUA 1Q12A 2EJMA 1GUNA 1ONLA 1V43A 2BE5C 1H9KA 2O5JC 1Y8OB 2A68C 3M85A 2NN6G 2NN6H 5KNCA 2IT1A 4KKSA 3PUVA 1VDZA 5C0XG 5C0XH 3OOCA 2E74C 4LJZC 3SE0A 1Z6HA 1O7LA 1GUTA 1FYCA 2CW0C 2V4DA 2F1MA 2E76C 4H13C 4IFDG 4IFDH 1Y8PB 3A8IE 1Q90A 4DK0A 1G291 2B8FA 2DNCA 2A6HD 3CRLC 5K36G 3QG1A 3M4YA 1HQMC 2B8GA 4KMUC 1YNNC 1K8MA 3H94A 2YYZA 4KN4C 4TKOB 2BDOA 5BN5A 2EVBA 1A6XA 3I72A 3T56B 3A7LA 2A69C 3D31A 1SMYC 3PUZA 1T5EA 3GD7A 3U9SA 3P20A 1GJXA 4G7HC 1H9MA 4KKUA 3VR3A 3A7AB 1YNJC 2KA7A 1Q1BA 3EQLC 3SDZA 2A6HC 2JXMB 3FMCA 4BA2I 1HCZA 2LMCB 3PUWA 3IKJA 4LK1C 1TU2B 3I73A 1GHJA 1ZYRC 2A69D 2EJFC 4DK1A 3FPPA 2NN6I 4KN7C 2DNEA 3AB9A 1OXUA 1LACA 2D62A 1V8QA 1B9NA 3OPOA 1OXXK 3ND8A 3RLFA 5K36H 1CTMA 1GUOA 3MFYA 1VF7A 5KNDA 1PMRA 4XTCS 4JK1C 2PCFB
chains in the Genus database with same CATH superfamily
2PI2A 3GTMH 4HR7B 3P1HA 1JA0A 1MJCA 3FDTA 1JWSD 4XLHA 2F0NA 1LTID 4LF9L 3PQIA 1S72B 1V1QA 1KQSA 5GAGC 3E1YE 4R4TA 4J15A 2K4KA 4JOIA 5IP9G 1J9OA 1C7YA 3M9BA 3FKIG 3KLRA 2F3WA 3R6KA 2WKDA 3NBHA 2LFNA 3L0OA 4PAAA 1QUFA 4K6DA 2NVYB 3PUMA 4X3UA 4FXDA 1N0VC 1DZ1A 3WWVA 5LL6S 1X3QA 1PKVA 3GV6A 2D0OA 1YIJB 2XNDA 3Q3AA 2X3UA 3OZUA 5H1SE 4TVAB 2ZT9C 3QE2A 1IBKQ 2DJFC 2KCCA 3MFGA 4OIKA 1Y14B 3SJZA 3BZDB 4UP7A 1HZBA 3S17B 5DEHA 4R8NA 2CHBD 5IT9L 5M5YH 5JEAH 1IBML 2E75C 3GTOH 2R93H 1XTCD 5JBQA 2NVQB 2M9VA 4Q5VA 2EIXA 3J80E 1SN8A 3VA7A 4A3JG 3MA2B 2OCEA 2VQEL 1QH0A 2DGYA 2LSSA 3H6MA 2Q8RE 4Y9RA 4ILWA 1STNA 3CCJB 4DNIA 4K5XA 2VYQA 1HVXA 2AHOA 5IP7H 2EQSA 3VNUA 3FEWX 1DYQA 2JQOA 3OWFA 1TXYA 1PZID 2K14A 3TP6A 2F4IA 3AYHB 2E8GA 4O0AA 1JCKB 2OF1A 4K14A 2R7FA 2E74C 2F0KA 2RDFA 3A0JA 3S9WA 5C0XG 1O7LA 5CGKA 2CW0C 2Q2UA 1OB2A 4DUZL 1KK3A 2KHSA 1K83H 2TMPA 2X85A 4UZFA 2F0UA 1XNRQ 1EWCA 3P26A 1LT3D 2A5HA 2KUMA 2Z6KC 4GLXA 4TKOB 3DM1A 5C5LA 1HJPA 3AVWA 4RKBA 1XPUA 1EQRA 1HNWQ 1H9MA 3UDGA 5IGDA 4M4SA 3E0EA 3A56A 1YNND 2Q6IA 3E6ZX 2X6WA 2YWEA 1YHQB 3ULPA 4K5VA 3Q22A 5FO9B 1VS0A 4XOPA 3IAYA 1VQCA 5ELDA 5E1FA 2Z1CA 3MFYA 1F77A 3CPXA 5IIFA 4QFMA 2JA5H 1BCPB 1BO0A 4ZCKA 2PCFB 3ISXA 3GDEA 1OB5A 1EU3A 1A63A 5M5XB 4XQNA 3P27A 1D6EC 3S2HH 1EYGA 4X07A 4IPDA 1ZM4A 3CCLB 3V7AA 1I94L 1TQOA 4UP8A 2HIVA 4RCNA 1G91A 1QGYA 1WTPA 4G7XA 2F0FA 4RAUC 3SK6A 5C3WA 4A3DB 2NPFA 1FNWA 3CF5A 3EFXD 3OZVA 3QB3A 4GN3B 4O1NA 2HDMA 3K58A 3CCQA 3C3LA 2BGJA 1LTTD 1QZHA 3CCUB 3HOUH 3H3VC 2VJIA 5LMNL 4BY7G 3A55A 4MTKA 3I56B 3WOEA 2WFWA 3GO5A 5IYCG 4TT3A 2VXWA 4QY7A 3T13A 3U6KA 2FMMA 4PC2A 1NR4A 1B4OA 3VO2A 3CD6A 2V7TA 1GO3E 4XYOA 1S5ED 3CCJA 2CQAA 2ZXRA 5I4DA 3CCVA 3CRKC 4HJ7A 3ER0A 5I2XA 4HE5A 2Z0SA 5JPNC 3SLDA 1EIYB 3HOWG 1FNCA 1Y1WG 3FPKA 3QFSA 3AFQA 5HGTA 2R93G 1U0LA 2VQEQ 3N6RA 4PC3A 1W3SA 4GN5A 4HAEA 3RR5A 5CBAE 2Z6KA 3JAMi 3C2PA 1I4GA 5BSYA 2ZL6A 2VBTA 1K3RA 5HKKA 2ZXOA 1C8CA 1HNXQ 4OOXA 4Z4SA 4GOPC 1AIPA 1CKNA 2X6LA 3AGQA 4GN4B 1SDFA 2Z8LA 3GVJA 4LWCA 4LNQA 2K03A 5KNCA 3W2GA 1DOLA 1K9MD 2F4VL 3SXHA 4ME5A 1VQLA 1L1OA 1HZAA 2EY5A 3S1RB 2NWGA 4OPSA 4LFAQ 5C3XA 1YJ9B 1KABA 3AQQA 3BU2A 5K36H 4OWTB 1TTTA 2C78A 1S4ZA 5J1ZA 2RC5A 2X8KA 1VQKB 4POGA 1DDIA 1PZKD 2K75A 1UD8A 4B43A 1YHQA 2NTTA 3F2UA 1YHAA 3K81C 1OTCA 1HFGA 1SNCA 2NZHA 4C2MB 3P20A 5J22A 1DONA 5H59A 1M4VA 1BR9A 2QEJC 2YWFA 5C4XH 4ZV4A 3KL9A 2G9HD 4ZCLA 3WNBA 5A89A 4N8FA 1ZM9A 4TMXA 1U5KA 2I07B 5GAEC 1W2BA 2L11A 2F0SA 1FNMA 3K7AB 1TY0A 2H5XA 3CCEB 4JI1Q 1UD6A 1RQPA 3F2BA 5I9OA 5D14A 1E64A 1IJEA 1M8AA 4BY1B 3BNWA 3CC7A 3H0GH 2Z6BA 3LWUA 2PMZE 1XQBA 4DUYQ 2KOLA 2QF7A 1D2EA 1E24A 2ALYB 4EX5A 4CDDC 4DPGA 2R93B 1VMPA 2I5HA 1K8OA 3ERSX 5LMNW 1H8EA 5ELEA 1BNZA 2R6HA 1L0XB 4DV5Q 1ESFA 3HOUB 3JAMc 4FXGC 3K5OA 4AQYQ 5EPLA 4NBSA 1QVGA 1OXVA 1PH5A 1LUZA 3K57A 1EFRA 3SKBA 4BBSH 2RC6A 2B63B 4CJ0B 1RJTA 3PGZA 4DAPA 4K0KL 3H3VH 1PH4A 3DEPA 3BCDA 4AF7A 1F9PA 2WYRA 4NB3A 2CQOA 1QOHA 3HOXH 4JI3Q 1BJKA 1JB3A 2NVTH 1V5VA 1WOPA 2XWBB 1EQVA 3ZUGA 1PYBA 3CCSB 2QEXA 1YNXA 3O13A 1X55A 4DR3L 3AFPA 1XYIA 2C9OA 2QA4A 1K83B 3HOWH 3OP1A 3NELA 1Y1WH 2ES2A 1JOKA 3GV3A 3SVMA 3SEBA 2PNHA 1ASZA 1GXDC 5DAUA 4DK3C 2Z4IA 3ZBTA 3LQ6A 1I3QB 2AUKA 1I94Q 1E3ZA 2AWOA 4DF7A 2B5OA 4CJ2C 2N78A 2UUAL 1Y1VB 1WPCA 4XLEA 3CCMB 1DXMA 1QUQB 2RSOA 2F0PA 4K5WA 4AH6A 1Q9SA 3L3OC 4QUFA 2V7XA 2RKSA 3PSIA 1V43A 2DY1A 2K01A 2P5ZX 4N8X1 5CV8A 3UDFA 1SBBB 4U9UA 5IK2A 3A3GA 2IPKD 2ZTGA 1PYSB 1KXLA 1QX4A 3JQRA 4LBYA 4IALA 2KCMA 1F60A 3DLLA 1K28D 3A8IE 2FX3A 3GVLA 4HJ9A 3E20A 1LYLA 1WTQA 2QE7A 4JI8L 4NXML 2RDGA 3G6JB 1GOZA 5C6AA 2IJ0A 5EGTA 2ZM6Q 4B3RQ 5F4JA 5DS0A 3MVVA 4DK6C 1VHOA 3U9SA 2WINB 4A93H 1STGA 4IOAA 5CMDA 1PTOF 5D3DA 3I90A 3CP8A 4LW1A 5JJLA 4RJLA 3BQJA 1K0SA 1SNDA 3K7AH 5C4XG 4J6HA 3Q39A 3RZOB 4LF7Q 4LK1C 3C46A 1BCPC 3A74A 4FF3A 1EWIA 1Q3LA 2C5HA 1G7CA 1E79A 1S5DD 2CW5A 1BBWA 3FKSA 2BH8A 4R4CA 2N49A 4A75A 2MHVA 3W2IA 3EVQA 5F2DA 2YU9H 4LF6L 3S1NB 2J7ZA 5M3FB 3H0GG 1K8GA 2M2LA 4P3IA 3D6WA 1TWHB 5A2QL 4GZYC 2ICIA 3J80i 2ZBVA 5I6WA 4WFN3 2BH2A 1COWA 2K28A 4L5SA 1WTRA 5LMZA 2F0IA 2ICEC 1TWCB 2ENBA 4DKAC 1FDRA 1JJ2B 3T1HQ 3I3CA 2VQFQ 1G6ZA 4XD7A 3OTOL 4ZCMA 2DETA 4YCVA 4EQPA 1OHHA 2BA0A 1AW7A 3RZOH 1EOVA 1E2WA 1GAQA 3N52A 2RSNA 3B82A 4XKVA 1N9WA 1G7SA 1B3AA 1H9SB 1Y69U 4H9GA 4JI4L 4ACAA 5LMNQ 4YAUA 3ND9A 3CC4A 5KRUA 4QB4A 1KK0A 2VUMH 2AQ3B 1WTVA 3A8KE 3CP0A 1TWAB 3MEHA 3KLWA 5HY6A 2K7VA 2F3VA 2SNMA 4RCZA 2AUJD 1NTGA 2B2YA 3EJIA 3OE7A 2UUBQ 4POFA 1PZJD 1E43A 4LF4L 4LF9Q 5C5MA 1MSHA 3Q6QA 1AFPA 3E9IA 1SFOH 3J7AV 4X65Q 2L1BA 1H95A 4DR1L 4PG3A 4JBJA 3T1HL 3HKSA 1Q82C 4NDXA 2QMUA 2Q2IA 2WB1E 1E1TA 4A3GB 4NMZA 1Y8OB 3SR1A 1KK2A 3AVYA 2NN6H 5HXBA 4R71A 1VQ9A 3MZ5A 3CCUA 5E4WC 1XXGA 4J8QA 3Q6RA 2XRQD 4XM3A 1WP6A 5KW9A 2F1LA 4Z4WA 5KEEA 4BY1G 4FWTA 2W6IA 3F8TA 5FO8B 2DNCA 1PFSA 2XTIA 2Z4HA 4C3HB 4OPVA 1EUJA 3CKIB 1Y0RA 3HS0C 5M5XH 4IUTA 1EIFA 1D1KA 3TMEA 3H91A 3PUZA 3GD7A 3K6OA 4A93G 4RD3A 2HDNB 3VR3A 4ZUJA 1YNJC 1QWYA 1HZ9A 4OO1I 1Q1BA 5M5WB 1N0UA 1B8AA 3VMFA 5JJIA 4A3IH 2LY7A 4NP5A 4RA8A 1VQDA 2KHIA 2WAQB 1QILA 3F1ZA 4A3EH 2HMAA 2UU9Q 1B9NA 3MAQA 2RHQB 5AFWA 2DY7A 1K0RA 3ZBUA 1D8LA 4RG1A 5KNDA 2ZITA 4YCUA 4ZKCB 4K6LA 3ONUA 4JK1C 1VQLB 2R6GA 3KFUA 1YIJA 1WTOA 3BS1A 1VQ5A 1OO9B 4DU9A 2PMZB 4JI7Q 4A3KG 1D5ZC 5FIUA 3MXUA 4G7WA 5AN9A 2IWHA 5FLXc 2I0QA 1KDBA 3D0FA 4BS9A 3OJWA 1PH6A 1STEA 4C3IG 4LF5L 5C44B 1SE8A 2Z9HA 1BBUA 3L7ZC 1EWHA 5M3MB 3BDOA 4YEJA 5DNFA 3I56A 1PVOA 1HRJA 1PFMA 3ZZ0A 4QL5A 3CC2A 2XNCA 1BCPD 2VZLA 4HMJA 1I50H 4BWGB 2MNAA 2OXPA 1PH7A 5CR3A 1HR0Q 2OK8A 1MSGA 3ASQA 1VQOB 3D4RA 5CYUA 3CMAA 2HCIA 3WXMA 1HPCA 3I4NB 1ZM3A 1WU8A 2IHFA 1D5MC 2WACA 1KHIA 3STBD 3NXWA 5THXA 3NP8A 2A68D 1NMFA 1U4RA 4FNFA 1DDGA 1QJOA 3QFTA 3WBKA 4DR1Q 4B3SQ 4FN5A 1XFOA 3EA6A 1M90C 3VR4A 3OAAA 5GV8A 5J3BA 4YAOA 4TMTA 1VQNB 3ULJA 2QTLA 3KJOA 2O2LD 3NHHA 1ONLA 2N55A 1IL2A 2PZTA 1LT6D 2JA9A 2MUYA 4QVJA 4R4IA 2MO1A 2VBUA 3ITPA 4B3FX 2X0KA 3HZXA 4KLKA 2WJVA 3ZC3A 4X06A 4YWLA 1GVHA 2FXQA 2F0DA 5EKKA 4BY1H 1PH8A 3HOVG 1X32A 1X56A 3ONYA 1B53A 1LTRD 2B8GA 2SDFA 3TQYA 4DV2L 2YV5A 4YHHQ 4XORA 1F2MA 1A8VA 1EY6A 2MPMA 2BVNA 1V1OA 1SJHD 3QO2A 4A3BG 5GQOA 1IHZA 1E1OA 4Q0FA 5ELCA 4UAIA 1SYFA 1FD7D 1UWVA 1VQIA 2SOBA 5JOBA 5A8AA 2XGTA 3KYHC 2VNIA 4X05A 3VYSA 1CSPA 3PIP3 4UHVA 1A3TA 1HCZA 1W2BB 1EFID 2B2VC 2NTSA 4DV4Q 4A3JB 3K0XA 3K0YA 2LXKA 4PZ7A 1V9PA 3T16A 2JN9A 4LF5Q 4P3YA 1YHBA 1STYA 1MBYA 1SEBD 3AVTA 3ND8A 2WB1G 2VS1A 5E3FA 1D1IA 1H42A 3S15B 1PMRA 4PABA 3G48A 4XONA 4XQFA 3CAMA 4X64Q 1XWEA 4JI7L 3CB4A 3S17H 1VQ8A 3S24A 2L9HA 4HSPA 1ELOA 3BG3A 1I4QA 5DN6A 4DXGA 1BBXC 3X3MA 3ZZUA 3CCVB 1UD4A 1G8ZD 1N05A 1QVGB 5ELFA 1E62A 1NAPA 2E2JH 2DOGA 1SE2A 4P22A 1QZGA 3QFCA 1XNQQ 4DNTB 5LL6X 5IY0A 5FO7B 3TS2A 1IYVA 4UP9A 4BPRA 2A6EC 4LF7L 1V0FA 1PTOD 1KNEA 1HHVA 2K32A 1WCMG 4LBVA 5B6IA 2EFGA 1HA6A 4ZCIA 5C4ZA 4G7ZC 2J4XA 2H4OA 1OB0A 3CXCB 3CCRB 3A5UA 3CRZA 3KF8A 4F7XA 3NTKA 4KV6A 1C9OA 2DUDA 2RQXA 4DV6L 1ET9A 1CHQD 4LFBQ 4JVZA 3KOJA 1SROA 1UEAB 4II2A 2JJ2A 3FKIB 2C4TA 5C44G 3QOLA 1DCZA 2RDHA 1O80A 1UE6A 4I65A 1XMQQ 2KVOA 4LBWA 2E5LL 3V05A 1CQVA 4NCNA 2HD3A 1Q12A 4EGVA 1BX1A 1EFUA 5E6TA 5COYA 3K5LA 2QDLA 1PJ7A 1X3PA 4DR2Q 2WR8A 4KKSA 1NUCA 1NMGA 2PO4A 1NJIC 2R3ZA 2B7BA 3TEHB 3SE0A 3WQZA 4OONA 1X65A 3V2TA 2E76C 5TSSA 4IFDH 2JA5B 2UUBL 4DR6Q 1MD2D 1Q90A 3HOVH 2A6HD 3VA5A 1EYDA 1IB0A 2I46A 1A3VA 1UEBA 4S3SA 5FLXE 3HOXB 1F20A 2BDOA 1CQXA 1SYBA 4IOCA 2A69C 2PQAA 4LBZA 1C48A 1T5EA 4HTHA 2RHSB 3PIPA 1RF2D 1F9QA 4DV1Q 1WORA 4LF8Q 4I7AA 1CNFA 2DCUA 2MFIA 1I7PA 1YJWA 3S2DH 4DV2Q 1I3QH 4PZ6A 3B78A 5ISRA 4LFCQ 3DDYA 2O4XA 5I2YA 4KN7C 3H3VI 1QNKA 1BXTA 1IZ6A 1LACA 4ZUIA 1VQGA 3NTIA 4IUNA 4IFDJ 3CQZB 1SKYB 3HRZC 2WZNA 1X3GA 4XTCS 1N34Q 3OJXA 1XB2A 4DQLA 2XVSA 3IRBA 5KNLA 4XIGS 1VQJA 1DOMA 2CH4A 1PRTC 1VQEA 1TWAH 3A8JE 4ZK9B 5BSXA 4B48A 1Z47A 4MTNA 2XOKA 1QVFB 4RMFA 3L2PA 1C4QA 4P72A 4BBSB 1NB0A 1E1RA 2Q8TA 4XQJA 2EE1A 3CTAA 3WOFA 1V1PB 3I55A 1N07A 1RD9D 1PFNA 4G7OC 3CCRA 3HKZB 3S1RH 3UDXA 3K7UC 1PRTF 1XE1A 1TUIA 1Q8KA 1YEZA 5FK9C 1DD2A 1BOSA 4XLFA 3TP5A 1HR0L 4B3TQ 1PA6A 4MYTA 3M7NA 4WZKA 1WCMH 2BOSA 2R7ZG 1F9SA 4XT3B 3PA1A 1B50A 2E2DC 2JJQA 5FL7A 1S5FD 2GA4B 4RHSA 1S5CD 3CPWB 4BA1I 1G2SA 2NB0A 3OSOA 4LF8L 2IY5B 1IBLQ 2L5TA 4DNRB 5CV9A 4N3GA 2C5CA 1J5EQ 3BCFA 1FRNA 1SSOA 1VQHA 5EMNA 3LGJA 3TP8A 2F4VQ 1HUNA 2AQ1B 5C0XJ 2F0TA 1KNAA 3M7GA 3M85A 3J81i 3ZPNA 4QJFA 4JV5L 2UXBL 5IODA 4DN4M 4R9WA 1BPLA 4MNOA 3LX0A 5FNZA 3CC2B 5M3FG 4X8IA 1EP2B 2ZJQA 1G291 4LAAA 1W35A 1HQMC 2R61A 2ZTEA 1VLYA 2LZJA 1BCPF 1X9NA 1MHWC 1S4MA 1A6XA 4DR7L 1YITB 1SMXA 1U9RA 3D4WA 4IO9A 5KGUA 4P74A 3HOZB 2VNUD 1GJXA 2V7WA 1P16A 4TSSA 1WOOA 1SNOA 4HIKA 2WIIB 1AP0A 2XIWA 4UAJA 5IGFA 4GS3A 4DR5L 2GVBA 3MEFA 4C3JG 5C4JB 1K73C 3SEJA 3S14B 1GHJA 1BUVT 2JK8A 4OIJA 3GP7A 1N33L 4DK1A 3RMHA 5JAVA 1I6HH 1SMYD 2M5SA 3RLNA 4JI5Q 2JA6B 1T9HA 5IGBA 3CU7A 3CMEB 4PC1A 4BBRH 2VUMB 2D3LA 4CKEA 3NBHB 3HP3A 5ELBA 2F4NA 1GAWA 1E3PA 3URYA 5FO0A 2QN6A 4ZKBB 1A0IA 1SYEA 2L12A 3Q6SA 4DUYL 4ZQ3A 4X65L 2K5WA 3CC4B 1SAPA 4O2DA 1KMHA 5FJ8G 2UXDL 1LV9A 4IW3B 1SE3A 2PZWA 4PZ8A 4RGMA 3K5NA 2CBXA 3AU7A 5L46A 2EDGA 2OBSA 1KTKA 3OW7A 2OBTA 4IFDI 1VF5C 3CPWA 3I2ZA 4DGZA 4B3XA 4WZTA 4XOTA 4QCLA 2EJGC 1TS3A 4M53A 1A62A 3HOYH 1QE6A 2PW7A 4OGQC 4LC0A 2R7ZH 3T51B 1EOTA 2BPOA 4JI4Q 1HNWL 1VQ6A 1OGIA 1CZGA 1D8TA 2MO0A 3SK4A 3S2HB 1JOOA 3T53B 1OXTA 3KBXA 4RDJA 2HQLA 1SFOB 4GNXB 1VQ4A 1VQ8B 4L8JA 4X7DA 3EIVA 3GQBA 3WBJA 1BF4A 2FJ2A 4JBWA 2OBRA 2WPDA 3MMPA 1GHKA 2VQFL 2B2YC 1BVSA 2K33A 2VB3X 4U68A 3J80c 3KJPA 1VJSA 1OXSC 3VYUA 3PO3B 1IYUA 3S2DB 2KVMA 5IWAQ 2E2HH 1GUNA 1IJFA 1TLLA 1I5FA 2BCOA 5ELNA 2O5JC 4RKLA 1D1NA 1YITA 1JNYA 3J81E 1A15A 2R7ZB 1G2TA 1FL0A 4P12A 5DM73 4HJ8A 1EEFD 4QVAA 3BDCA 5LHY1 4WQMA 1TR5A 5K5PA 4TN1A 4ULLA 2D74A 1MIUA 5M3FH 1XJVA 3NTHA 2WV6D 1Y8PB 4AC9A 3U4ZA 1K28A 1YVCA 4CHTB 5DLQE 1R4PB 3RUZA 3MTSA 4XLCA 1EQQA 3CXCA 4IPCA 4R4OA 1WTHD 1EP3B 4A3LG 2DYIA 5FO1A 5GV7A 2OTLB 4LFBL 3VYRA 3HEJA 5C0XI 4QGUA 1CA5A 3I7FA 2K50A 2KA7A 2XNAC 1RHPA 4A3MH 2E1RA 3ES9A 1P8LA 1AZQA 3NK9A 1LTAD 4F87A 5C3EG 3A8KA 4NXMQ 4CQJA 2K52A 4TRDA 1D7QA 3G7LA 3NPPA 1FJGQ 2KECA 2NN6I 5M5YB 3R6JA 4OPOA 1TS5A 2DNEA 3MXNB 3F2DA 3VDYA 1OXXK 3GTPH 1VLOA 1UUPA 2JN4A 4GKKL 2EY6A 4JYAQ 2Q6KA 1TWGH 5IYDH 1Q86C 3F2CA 3PA2A 3OIPA 2JA5G 4J1MA 4NKLA 2X6YA 2IHEA 4B3RL 3WYAA 3QJYA 2ATWA 1E1QA 3R93A 1F2LA 4JI8Q 2R9VA 2PW5A 1E63A 3VR6A 3A35A 4QUZA 1UD2A 5FLMH 2F0GA 1WJJA 2LXJA 2XN9C 4P2CB 4PMWA 1PJ6A 3S16B 4P6VF 3G4SA 2FMCA 1JA1A 1G7TA 2B2UC 1VQ6B 4X7EA 2EYHA 4EQ5A 2GVAA 2F0EA 4H7BA 4I7ZC 5FLXL 4YALA 4C0SA 4P73A 2CC2A 4PGOA 4BY7H 1EY4A 2C77A 3TS0A 4V190 1GUSA 1XX8A 1CNEA 4WRDA 4P9SA 1VQMA 4BXXG 1UAPA 3HOYG 2ZZGA 2KEEA 1HZEA 1JJCB 4PMCA 4FXUA 1PRTB 3E3XA 5FA6A 1EY8A 5EQ0A 1FR3A 2DIEA 1IYJB 1D5XC 1I50B 4QIWE 3FVQA 1XNRL 5F4OA 1JICA 1RCVD 3S1MH 1LT5D 4HJ5A 3KF6A 1K3BC 2QGGA 2ID0A 4DAYA 4PMBA 1K8AC 1TIID 1KD1D 3AEVA 3U58A 2B2UA 3G71B 4UZUA 1TT2A 2XRSD 1KC8C 2R92B 2RCFA 5HZBA 4P1VA 4CKCA 3RN5A 1FGBD 2I5LX 2EJMA 4KHPQ 4HIMA 2L0CA 2BE5C 4K0KQ 2ZBUA 3I55B 1DG1G 4HCSA 1AE2A 2NUCA 4K1XA 1CSQA 5FKAC 2IT1A 1I6HB 1BX0A 4X0CA 1ICFB 2MJ8A 1ASYA 1JORA 3GTGH 1QGZA 1KC8D 4BY7B 1PRTD 4RHRA 5IYNA 3GVKA 5K36G 1R5BA 5I6YA 3I4MG 3ZJYC 4GQNA 3ZIAA 1YNNC 1IBMQ 2JA7B 2Q2TA 4A3FG 4IPGA 1WTHA 5M3MH 1NB9A 3MXNA 3NUCA 4CBVA 1XMOQ 2ZTCA 1ZYRD 2I5MX 4B9WA 1IBKL 1T6XA 1WD1A 4OX9L 1KK1A 5TRDA 2SEBD 1TVCA 4FF2A 3CC7B 3PO3G 3GTOB 2D9RA 1I4PA 4HCEA 2KEDA 1PYWD 3OEEA 1ML0D 1I4HA 2F3IA 5IGCA 3AVXA 5C3EH 4BA2I 3PIO3 4B3MQ 1EEID 3PCOB 4ACBA 3WY9A 3KUPA 1CK1A 3FPPA 1GJRA 2VBSA 3DUZA 3C2QA 2AHOB 3G4SB 3RLFA 3I4NH 3FPUB 2OEOA 4ALPA 1L2FA 5IYDG 3AVVA 3OZWA 5GROA 4AYBG 1PH9A 3GTKB 1AZPA 2GJKA 1BKBA 2Y0SG 4OX9Q 1B9MA 3C1FA 2NBFA 1Q46A 4OXPA 1XMOL 4OELB 2GQFA 1SLJA 3PUXA 1YJNB 2BA1A 3WDNA 1S3OA 4OOVA 5EAYA 4MYUA 4FYDA 2HHHL 1LTLA 1KAWA 1U4LA 2RF4A 5AJ3L 5A35A 5C3EB 4RPBA 3PVDA 3ONAB 1VMCA 2QA4B 3ASSA 4XNFA 3W3AA 1N8RC 2F0HA 1GD7A 2E5LQ 2O5IC 3AMUA 1FRQA 4QV2A 2BV3A 4RD4A 3SJPA 2GJPA 2JA8G 1IL8A 4II3A 3HGBA 5T1GA 4TMVA 1R9TB 1VHEA 3IFTA 2HQEA 4JOIC 4KHPL 3GTJH 3ASTA 2C2WA 4UZEA 3G71A 3VR5A 4X3TA 2WSSA 2PMDA 3KDFB 1WVLA 2HCCA 1K8AD 1SYCA 2Q2HA 1XPRA 1IW7D 1N34L 4DR4Q 3BC9A 4IQZA 1TS4A 2VW9A 1E2VA 3BZCA 3M3YB 3LNNA 1PXUA 2EYLA 3CQZH 3IL8A 4DAVA 5JEAJ 4A3JH 4B44A 3H09A 1GM5A 4KJOA 1EIHA 1AMOA 4RWSC 1O78A 4P25A 2EY2A 3TSSA 3S15H 1PTOH 4B3GA 2BMWA 4JG2A 4ROXA 3Q0AA 3NQTA 4RLZA 4ZGNB 3T1YQ 3H9NA 5CV6A 3B6YA 4HIDA 5C0XH 3W5OA 3JC66 4PNYA 1Z6HA 2BDNA 1WSVA 1CKMA 2F0WA 2CNDA 4XL9A 1EFTA 2ZJPA 5EPJA 3RY8A 1EY5A 2J7KA 3RN2A 4C3IB 4X64L 3HFZB 1QUEA 5IYBG 1Y0YA 4A3FH 3G6EB 2HIXA 1QFYA 1E0BA 5M3MG 3GTJB 2N3SA 3D31A 4FXKC 4LF4Q 1YLOA 4K2LA 2F0OA 2UUAQ 4DV7Q 4QQBX 4KKUA 3UE1A 2IX3A 4IN3A 4E6IA 4TMWA 1CZWA 2WB1B 1LM0A 3C1EA 2KQ3A 1RTNA 2FFKB 1Y1VG 2D62A 2NZ1D 1V8QA 5CDFA 3VO1A 2KJXA 4DR4L 1GUOA 2B39A 2LS01 2OQ0A 4DV6Q 1UMKA 2RA4A 2CF4A 4FP5D 3DHQA 1JWUD 4OWXB 2B2WC 4U673 1N06A 1SE4A 3CW2C 4OL7A 1EFWA 4FK8A 1W87A 3MHBA 2B3GA 1E3XA 5IE8A 1BQQT 4PQXA 1H9SA 1Y1WB 2XSCA 1P4MA 1EWYA 1H8HA 4EH1A 1TWHH 3DWPA 4DUZQ 2NV4A 2QDBA 4OWWB 1EU4A 1PLFA 3G05A 2B63G 1YX2A 2ZXIA 4XXEA 5C4XB 3VNVA 4DV5L 1HH2P 3KDFA 3QIAA 1MRZA 4APVA 3I91A 4XMYA 3HOUG 3PIOA 4M1KA 1M90D 2GK7A 3GTLH 5IYCH 2K5VA 4B3SL 5GAHC 2JA8H 4ZRZA 2ZZFA 3M4OH 1ENFA 4KY7A 5CV7A 3BJUA 1F9RA 1A2TA 2V7VA 5CV5A 4RDLA 1BMFA 3VR2A 2F03A 3J81c 2XZPA 2IW3A 4DA2A 4GNXC 4K8IA 1LLRD 1L1OC 2WZPP 3SK8A 3CCQB 1TWFB 2PIAA 1RQRA 2D9UA 4P71A 1QFJA 3NBIA 4WJ4A 4A4IA 1SKQA 4B08A 1PTOC 4GNXA 3D6CA 4HMIA 1HA5A 1IBLL 1VQ4B 1VQ9B 2Y0SE 4RCOA 1JMCA 1K9MC 4A3CH 1NRKA 1L0YB 1LTGD 1WFQA 4Y7NH 3RLOA 1VQMB 2ZM6L 1KZLA 4JW0A 5I9PA 3PUYA 1BDOA 2L55A 5D3IB 2DERA 3V96A 3CESA 3CMMA 4X3KA 4GKJQ 1VQ7B 1TVXA 2NN6G 3PUVA 4DFAA 1EFCA 1N32L 2AMCB 4O42A 2F0VA 4HIZA 1B7YB 5BR8Q 5IYWA 1SNPA 4H13C 1NBMA 4EQOA 4DK0A 1JJGA 3CW2A 3QG1A 4AYBB 2B2WA 1VQKA 4P75A 3W2EA 3AGPA 2E2IH 5IYBH 2QEXB 3CCSA 1STHA 1EXMA 4B4DA 4KN4C 4N9PA 1AN8A 1EYAA 3T56B 3A7LA 1IKMA 1CM9A 3CP2A 2JIZA 2K1BA 4LUOA 4C3HH 5TR9A 3OMCA 4A3DH 2GREA 2KENA 4K8JA 3SDZA 4L63B 2J0TD 3J81L 1SNMA 2GJRA 3NSWA 2HCJB 2JA6H 2V31A 4WJ3M 2HDLA 4IUUA 4A3EG 3H0GB 1Y1VH 5G3LF 3W2HA 1K73D 4JI3L 1N33Q 2BF4A 1CTMA 2EYJA 2DY8A 4Q7JB 1B70B 2CWAA 1HA3A 1A2UA 4H0LC 4V0BA 3TBIB 3I4MB 3GSIA 1KRHA 1QVCA 3NWSA 2JA7G 3UI2A 3UE0A 1DARA 1ET6A 1N8RD 2JEAI 4DV0Q 2XNJA 1W34A 4A3KH 4ABNA 4KHVA 4NNJA 1GUGA 3HKZG 1EYCA 2B63H 1WOSA 1FNDA 2OTJB 1RL2A 4L6TB 3RNUA 4F7DA 4A76A 2BM1A 4PC6A 3K80C 1Q82D 3W1GA 4CDFC 3CMAB 3ICEA 1W6JA 4M1UB 4BBSG 4MIUA 1DJRD 4DR6L 1PTOB 2F0QA 3OWEB 5CV4A 3PF4A 1B2TA 2A73B 2PE3A 1VQPA 4KI0A 3BY1A 2N8NA 3U4VA 3HOXG 1PDQA 4YY3Q 1RKNA 5EKIA 1EZ6A 1H85A 4JI1L 5KSWB 4LUZA 2DN8A 4LUVA 4Z4ZA 2NYZD 1N32Q 1Q1EA 1PFBA 4YY3L 5ELOA 4KTAA 2Y0SB 1VQNA 1Z7TA 4GOPB 1EY0A 1CI3M 3OHXC 4M8AA 4IZ8A 3R8BA 4Z1MA 3TDQA 4X62Q 4P26A 3SLNA 3QSYA 1F2YA 1FJGL 2CCZA 1O7IA 2A19A 2QTZA 2X69A 4JI6L 4A3CG 1NJID 2RVLA 1Y8NB 5EBCA 1M1KC 1QCBD 2EY1A 5L37A 4JCVE 4RCYA 1JWMD 4GLAC 3PENA 2WP8J 3S14H 4C1NI 1ZUNB 1LO5D 4LFAL 1PH2A 2OTLA 2GPJA 4B3ML 5EJWA 1W0KA 3P75A 2ZTDA 3A5ZB 2JP1A 2A8VA 1FYCA 1NE3A 4NXNQ 1EQTA 3NWTA 2QW7A 3CRLC 1FNBA 2KBNA 4YIJA 5HGQA 4N9TA 1MJEA 1XNQL 3I4OA 2FHTA 2XWJB 5TV2A 3A1PA 4L5QA 4CGYB 5IT9E 2FINB 2RBMA 4YHBA 1HNXL 4A3BH 1PJ5A 1YNJD 4C3HG 3WNCA 1YBYA 3H15A 2DEUA 2B7CA 3LVBA 1QNUA 2L4NA 1HNZL 3CPFA 4A3DG 2VJJA 4XT1B 1QB5D 3TZDA 1KDCA 4IUVA 1B44D 5CBEE 4G1BA 1U2RA 2VNJA 2JA6G 3OMGA 4P2NA 2EXDA 1O7YA 3S1NH 3J81j 3E5SA 1NSNS 1OXUA 2D0PA 2NVXB 3G6EA 1MGSA 1JB9A 3K5MA 2QCPX 1NY4A 2ASBA 2FVGA 2VNKA 5IWAL 5BR8L 1YI2B 2QGQA 2Z6BD 3BVZA 4AIMA 3BZKA 4ZYSA 1STBA 2ZXPA 4YWMA 3DXJC 1I8DA 2JA7H 3RZDB 1HQRD 1KLGD 1GR1A 4XN3A 3ZZTA 1JJ2A 1ILQA 4R4QA 4G4KA 3FJOA 4LFCL 3NENA 1CUKA 1MABA 3Q38A 4RD1A 2EYOA 2X53S 5C4JH 1X3EA 4G6IA 4DV1L 4A3BB 2D2CC 3JQPA 4RPDA 1MKHA 4ZGQB 5KYLA 4M2LA 4DV3L 1OGJA 3JU4A 3KBGA 2F0LA 4XLAA 1UE5A 1U4PA 2K5DA 4WWVA 1NNXA 4L5TA 5BN4A 3I8ZA 3IFDA 2VB2X 4XKWA 2VUMG 1EIGA 4GLVB 2XEXA 1HTLD 2MGSA 3RZDH 3LQEA 2XGJA 3DWAA 2C5BA 4OHJA 1WTWA 4Y9UA 3JAML 4DR3Q 3I70A 3SK5A 4HN7A 2UXDQ 2JE6I 2L15A 3ERQA 5KNBA 5E4XA 1CKOA 2K04A 2PYKA 1Q81D 2WAQG 2QDXA 4YAFA 3OKXA 1LT4D 2D3NA 4ASUA 5C44H 4DR5Q 1CA6A 3HKZE 3QWNA 1I18A 5LMUL 1L0WA 2HT1A 1JC7A 2YTYA 1KIXA 4Z4UA 5M9OA 1PHJA 3A8IA 1JE5A 3SHLA 4AQYL 1VDZA 1JQYD 2BM0A 4HEDA 4HE6A 4LJZC 3BYYB 1S40A 2YTVA 2CK3A 2ZZQA 1VQFA 1TWGB 3OEHA 3S16H 4IFDG 4CDCC 3K8AA 3BH4A 4L5RC 4RD0A 4RGNA 2TSSA 4EVOA 3D8GA 4MHEA 4KD3A 5J39A 1W9XA 3GTGB 2AQ2B 3EROA 2EVBA 5C4HA 5M5WH 1SNQA 5CORA 1I4RA 3Q23A 1SYDA 2F52A 1U4MA 5AJ3Q 4RD6A 3A7AB 3BYTB 3QFRA 3EQLC 4A3EB 3DEOA 4KD4A 1EZ8A 2JDIA 2CRVA 2YWHA 2E2JB 1YJWB 2CFMA 4A3IG 2ZXHA 2CH4W 4FVMA 4AF6A 1TU2B 2B2TA 2NVYH 3FP9A 3I73A 2KCTA 4AVZA 3KK7A 4ME3A 4JV5Q 2UXBQ 2QKIC 4KK7A 2OWOA 1QVFA 1PV4A 3W2DA 2JJ1A 3GTKH 2B29A 3HAGA 3S1MB 4YELA 3R3OA 3J81k 3B8HA 2V7QA 1V1PA 4DXFA 4E0FA 1STAA 1V0EA 2D5DA 1J6QA 5A2QE 1JR0D 3T4AC 4M0LA 1VQ5B 1CFMA 4YCWA 3T1YL 2R92H 3MC0B 3PO2G 1RIPA 1H9RA 1KQSB 1S72A 3DWQA 1TKWB 2WKCA 3Q8DA 3E0JA 4XDXA 4C2MH 2PNRC 1HTPA 3I4LA 4IJHA 1NR2A 4JI0Q 3A8JA 2VBVA 3MXGA 4C3IH 4KKTA 1KJZA 3DM3A 1AEXA 3S1QB 3SGIA 5KIXA 2HUGA 4WJWA 1B2RA 1D2BA 2Q6LA 4FF4A 4QHYA 1W6KA 1IHMA 1T6ZA 2VNHA 3HOVB 3U50C 1Q8IA 2BN4A 1X54A 4IJLA 1E22A 2B2VA 3J7ZC 2DJGC 4F88A 5DSZA 4YHHL 1B3QA 3GTMB 1FNVA 3ASRA 4QUCA 1VQOA 3M3YH 2OK7A 3AVUA 5E7NA 2PQAB 1ZKOA 3CHBD 4X6AH 5G3LD 4ODGA 4PC7A 3D3RA 3STBC 3R2IA 4QMGA 4Z9CB 5EKLA 4OO1H 4Z4VA 1EY9A 2A1AA 3ASPA 4R8IA 3K59A 3PV0A 4B9XA 2QILA 1HXYD 5IOCA 1PH1A 3S1QH 2BSAA 1F2ZA 2HHHQ 1H9JA 2K05A 1JT8A 3BY2A 2W6JA 4C1NK 1PH3A 4Z4RA 4KY5A 4Z4TA 2G5DA 1SRUA 3HG9A 1H9KA 1VQ7A 2B2TC 3M4OB 2RCNA 2A68C 4XYQA 4IUQA 3HOYB 2M00A 3OOCA 2ZJRA 4YAWA 4R1JA 4JI0L 1HR0W 1GUTA 4UY8C 2CVRA 2IX1A 1R5OA 4DQKA 4YXWA 1VQPB 3J7A5 1NDHA 2EIFA 3V76A 2GK6A 1Q86D 2B8FA 2JYOA 3M4YA 1DOKA 4Z4YA 1ENCA 1K8MA 2E1BA 4OEMB 5BN5A 2P3MA 4DR2L 5NUCA 3OTOQ 4OP7A 3U6BA 1TWCH 1VQBA 3KEWA 1TWFH 2EYPA 4A3FB 1N08A 3BVGA 3ZYYX 1G6PA 1Q81C 2WJYA 2WAQE 4KY6A 4RGTA 3HOZH 2A6HC 1RODA 4JBMA 4C3JH 2UUCQ 3W5UA 1ZYRC 1VQAA 4LF6Q 1SR3A 3MCAA 3JAME 5GADC 3U9OA 5IYRA 1R9TH 5JPMC 1J5EL 2YWGA 2C4UA 1N36Q 4BBRG 4CDEC 2LKVA 5A88A 4GKKQ 4JYAL 1II3A 4H44C 2C35B 2F0JA 4K2KA 4WZEA 4QIWB 5LMUQ 2R92G 3A3BA 2A6ED 4UDUC 3PO2H 4X66L 1UD5A 3W5VA 2PQEA 3TN2A 1GKHA 3RD4A 2PI2E 3OIQA 5TY0A 5FJ8H 2OTJA 2BGIA 1I6VC 2IL8A 4A3MB 1QGAA 5CC4A 1RDPD 4C3JB 2OQKA 2JA8B 5IYQA 4X3SA 1KD1C 4JPBW 3D4DA 1KDAA 2CWPA 4B3TL 1C0AA 3QOJA 4NW2A 4G1VA 2Q8IB 2PPBC 4J0QA 1J9ZA 1YZ6A 1WD0A 3R2TA 2SNSA 2JEBI 5J3OA 5IGGA 3TZUA 3L9AX 2OT2A 1UD3A 1IXRA 4KJNA 2NVTB 3BVMA 3PO2B 1MI2A 1QFZA 4AYBE 4IPHA 2UUCL 4OO1G 1E2ZA 4JBKA 4QF4A 4C43A 1ZXTA 1IW7C 1R5NA 1LABA 1WTXA 3P7JA 3MXPA 4TQUS 1CQFA 4WZLA 4ZLTF 3NE5B 2MQHA 3I1FA 1Z9FA 4FF1A 2EOTA 4GKJL 4IUPA 2K5QA 4DV3Q 1FX0A 1QG7A 3D26A 3KF8B 4X7CA 4ID6A 4A3IB 3KLSA 2KHJA 3OYYA 4RFBA 1GUWA 3WNDA 1ENAA 4DV4L 2EXZA 1CT1D 4A3GG 1EP1B 1FGUA 2V7UA 2F1MA 3TP7A 4F8MA 1ILPA 4TSFA 3EN2A 5FOBB 1R4QB 1JB7A 1TS2A 1CHPD 1A8PA 3W5HA 2AKWB 4KMUC 3J7YW 2NVQH 2X6GA 4TMZA 2EYFA 3H94A 4XR6A 1T6YA 2YYZA 2K5HA 5KYIA 1TY2A 3I72A 4FDBA 4A3LH 3TRZA 3MHPA 3W2FA 1SMYC 4RM0A 4Y7CA 3FHWA 5JVG3 3OW2A 1AH9A 1JOQA 3Q24A 1KTVA 4G7HC 1HZCA 4A3MG 3HOZG 4XQQA 2JXMB 2ZTNA 1DM0B 5IT9c 3FMCA 3CCLA 3CD6B 1DGSA 2LMCB 5IYPA 3IKJA 1WDTA 1KRSA 3PUWA 1B23P 4RGOS 3GTLB 2EJFC 4HSVA 3VYTA 4H02A 2AWNA 1X3FA 3ULLA 3MWYW 3UDIA 1ZEQX 1X6OA 2CW0D 4NXNL 4X7FA 5DM63 3PF5A 1FNUA 1VF7A 1HNZQ 4CKBA 1XMQL 1GVPA 2UXCQ 1W0JA 1GO2A 4P6YA 3EBEA 3TREA 1SM4A 3GTPB 2VY3A 4Y7NB 2YU9B 2YTXA 3BDLA 2ZL7A 1UNSA 3W1BA 3PMFA 4WORA 3E9HA 3LO8A 5FLMG 2I1LA 4KHZA 1AE3A 1BLIA 4G57A 1I4XA 5IP9H 1XPOA 4JI6Q 3FKIH 4X66Q 1HUMA 3J7AF 4X62L 1J8IA 2F43A 4GOPA 1SYGA 5BN3A 1HFNA 3FRPB 2X6XA 1G7RA 4DR7Q 3OFNA 1FVIA 5J35A 3M4QA 2EZVA 1YJ9A 2NZOA 3KF6B 1N36L 2OYNA 2V1CC 2BE5D 2E2IB 4DAYB 4N3NA 1KLUD 4BBRB 4DV7L 4BXXH 1WOCA 1CKNB 1NBWA 1E7ZA 2EYMA 5JJKA 5EPKA 1IKLA 3J80L 5F4MA 1RTOA 4FO2A 3LWEA 1B1ZA 5HURA 5T1IA 1JE4A 4PV1C 4A93B 4UPAA 5JEAG 3CMEA 3M4PA 3PUNA 3NQIA 3A54A 4ZAIA 1VCIA 1ICWA 4Y52H 1SJED 1LTSD 1A3UA 1L1OB 3GIRA 3U2QA 1G51A 1NCVA 4MN3A 4JI2L 4B47A 1ESRA 3QR8A 2XZOA 2A74C 2Q6OA 3DMUA 5EBDA 4DAMA 1SXTA 1UE1A 5HZAA 1ZM2A 5JJZA 4DV0L 1QUQA 3CCMA 5IP7G 1S0UA 3GTQH 1O7ZA 4EQNA 1QG0A 2ZL5A 1M1KD 2VL6A 2UU9L 4MZ9A 4HIOA 3OW2B 4RD2A 5JVH3 4A3KB 1KAAA 2G9DA 4CJ1B 4A3GH 2PLFA 2MP1A 2VZAA 4JC0A 2V4DA 1S5BD 4IURA 4NPSA 4HJAA 3HOWB 3I4MH 4JI5L 2K6AA 1KL9A 1T5XD 3CCEA 2K5NA 1EY7A 3KLSX 3JQQA 4XN0A 2UXCL 4JMQA 2N88A 4RH6A 1WSRA 2IX0A 1EL0A 1BQEA 1YI2A 2ZZEA 5IGEA 2F0MA 1UE7A 2PZUA 5D65A 5H5JA 1Q7YD 3PO3H 2R7DA 4YWKA 2JSOA 2KCNA 4C56C 1KRTA 3X3NA 1WYDA 2NVXH 2HLDA 1Q7YC 4RDKA 2A69D 3AB9A 1LTBD 3NEMA 4JI2Q 3OPOA 3I4NG 4G5GA 1YJNA 2XZLA 2H1EA 1WCMB 1XTDA 2CKZB 4OOSA 3GTQB 2GN5A 2E2HB 1WI5A 4LMQD 2EPBA
chains in the Genus database with same CATH topology
4HR7B 3P1HA 3FDTA 1JWSD 4XLHA 2F0NA 1LTID 1J9OA 3KLRA 2F3WA 2WKDA 3NBHA 2LFNA 4K6DA 4X3UA 2NVYB 4FXDA 1DZ1A 5LL6S 1X3QA 1PKVA 3GV6A 2XNDA 2ZT9C 2KCCA 3MFGA 4OIKA 3BZDB 3S17B 5DEHA 4R8NA 2CHBD 5IT9L 5JEAH 2E75C 1XTCD 2NVQB 2M9VA 4Q5VA 3J80E 3VA7A 3MA2B 3H6MA 2Q8RE 4ILWA 1STNA 4K5XA 1HVXA 3FEWX 1DYQA 3OWFA 1PZID 3TP6A 2F4IA 1JCKB 2OF1A 4K14A 5C0XG 2E74C 2F0KA 2RDFA 3S9WA 1O7LA 5CGKA 2CW0C 2KHSA 2TMPA 2X85A 2F0UA 1EWCA 1LT3D 2A5HA 2KUMA 4TKOB 3DM1A 5C5LA 4RKBA 1H9MA 5IGDA 3A56A 1YNND 3E6ZX 2X6WA 4K5VA 3Q22A 5FO9B 3IAYA 4XOPA 5ELDA 5E1FA 2Z1CA 3MFYA 1F77A 5IIFA 1BCPB 1BO0A 2PCFB 1EU3A 5M5XB 4XQNA 1D6EC 1TQOA 4RCNA 1G91A 1WTPA 4G7XA 2F0FA 4RAUC 3SK6A 5C3WA 4A3DB 1FNWA 3EFXD 3QB3A 4O1NA 2HDMA 3K58A 3C3LA 1LTTD 3H3VC 2VJIA 3A55A 3WOEA 3GO5A 4TT3A 2VXWA 3T13A 2FMMA 1NR4A 1B4OA 4XYOA 1S5ED 2CQAA 2ZXRA 5I4DA 3CRKC 5I2XA 5JPNC 5HGTA 3N6RA 4HAEA 5CBAE 3C2PA 1I4GA 5HKKA 2ZXOA 1C8CA 2X6LA 1SDFA 2Z8LA 3GVJA 2K03A 5KNCA 1DOLA 3SXHA 4ME5A 2EY5A 3S1RB 2NWGA 5C3XA 1KABA 5K36H 1S4ZA 5J1ZA 2X8KA 1PZKD 1UD8A 2NTTA 3F2UA 1HFGA 1SNCA 4C2MB 3P20A 5J22A 1DONA 1M4VA 1BR9A 2QEJC 2G9HD 2I07B 2L11A 2F0SA 3K7AB 1TY0A 1UD6A 5I9OA 5D14A 1M8AA 4BY1B 3LWUA 2KOLA 2QF7A 2R93B 1VMPA 1K8OA 1H8EA 5ELEA 1BNZA 1L0XB 1ESFA 3HOUB 4FXGC 3K5OA 5EPLA 1OXVA 3K57A 1EFRA 2B63B 4CJ0B 1RJTA 4DAPA 3DEPA 3BCDA 1F9PA 1QOHA 1JB3A 2XWBB 1EQVA 3O13A 1XYIA 2C9OA 1K83B 1JOKA 3GV3A 3SVMA 3SEBA 1GXDC 5DAUA 2Z4IA 1I3QB 2AUKA 1E3ZA 2AWOA 4DF7A 4CJ2C 1Y1VB 1WPCA 4XLEA 2RSOA 1DXMA 2F0PA 4K5WA 3L3OC 4QUFA 2RKSA 1V43A 2K01A 5CV8A 1SBBB 5IK2A 3A3GA 2IPKD 2ZTGA 4IALA 1K28D 3A8IE 3GVLA 1WTQA 2QE7A 2RDGA 3G6JB 1GOZA 5C6AA 5EGTA 2IJ0A 3MVVA 3U9SA 2WINB 1STGA 5CMDA 1PTOF 5D3DA 3I90A 3CP8A 1SNDA 4J6HA 3RZOB 4LK1C 3C46A 1BCPC 4FF3A 1Q3LA 1E79A 1S5DD 3FKSA 2MHVA 5F2DA 3EVQA 3S1NB 2J7ZA 5M3FB 2M2LA 3D6WA 1TWHB 5A2QL 4GZYC 2ICIA 4WFN3 5I6WA 1COWA 2K28A 1WTRA 2F0IA 2ICEC 1TWCB 2ENBA 3I3CA 1G6ZA 4XD7A 4EQPA 1OHHA 2BA0A 1AW7A 1E2WA 3N52A 2RSNA 4XKVA 1B3AA 1H9SB 1Y69U 3ND9A 5KRUA 4QB4A 2AQ3B 1WTVA 3A8KE 1TWAB 3MEHA 2K7VA 2F3VA 2SNMA 2AUJD 2B2YA 3EJIA 3OE7A 1PZJD 1E43A 5C5MA 1MSHA 1AFPA 3J7AV 2L1BA 4NDXA 4A3GB 4NMZA 1Y8OB 3SR1A 2NN6H 3MZ5A 5E4WC 1XXGA 4J8QA 2XRQD 4XM3A 1WP6A 5KEEA 5FO8B 2W6IA 2DNCA 2Z4HA 4C3HB 3CKIB 3HS0C 4IUTA 1D1KA 3TMEA 3H91A 3PUZA 3GD7A 3K6OA 3VR3A 4ZUJA 1YNJC 1QWYA 4OO1I 1Q1BA 5M5WB 2LY7A 4NP5A 4RA8A 2WAQB 1QILA 1B9NA 3MAQA 5AFWA 2DY7A 5KNDA 4ZKCB 4K6LA 4JK1C 2R6GA 1WTOA 3BS1A 1OO9B 4DU9A 2PMZB 1D5ZC 3MXUA 4G7WA 2IWHA 1KDBA 4BS9A 1STEA 4C3IG 5C44B 3L7ZC 1EWHA 5M3MB 3BDOA 4YEJA 5DNFA 1HRJA 1PFMA 1BCPD 4HMJA 4BWGB 2OXPA 5CR3A 1MSGA 3D4RA 5CYUA 2HCIA 1HPCA 3I4NB 1D5MC 2WACA 3NXWA 3NP8A 2A68D 1U4RA 4FNFA 1QJOA 3EA6A 3VR4A 3OAAA 2O2LD 3NHHA 1ONLA 2N55A 2PZTA 1LT6D 2MUYA 3ITPA 4B3FX 3HZXA 2WJVA 2F0DA 5EKKA 1X32A 1B53A 1LTRD 2B8GA 2SDFA 4XORA 1F2MA 1EY6A 2MPMA 1V1OA 1SJHD 3QO2A 1IHZA 4Q0FA 5ELCA 4UAIA 1SYFA 1FD7D 2SOBA 5JOBA 3VYSA 3PIP3 1A3TA 1HCZA 4A3JB 1EFID 2B2VC 2NTSA 3K0YA 3T16A 1STYA 1MBYA 1SEBD 3ND8A 5E3FA 1D1IA 3S15B 1PMRA 4XONA 4XQFA 1XWEA 2L9HA 4HSPA 3BG3A 1I4QA 5DN6A 4DXGA 1BBXC 3X3MA 1G8ZD 1UD4A 5ELFA 1NAPA 4P22A 1SE2A 4DNTB 5LL6X 5FO7B 1IYVA 2A6EC 1V0FA 1PTOD 1KNEA 1HHVA 2K32A 1HA6A 5C4ZA 4G7ZC 2J4XA 2H4OA 1OB0A 3KF8A 4F7XA 3NTKA 4KV6A 2RQXA 1ET9A 1CHQD 1UEAB 4II2A 2JJ2A 3FKIB 3QOLA 1DCZA 2RDHA 1O80A 4I65A 2KVOA 3V05A 1CQVA 1Q12A 4EGVA 5COYA 3K5LA 1X3PA 4KKSA 1NUCA 2PO4A 2R3ZA 3SE0A 3WQZA 3V2TA 2E76C 5TSSA 4IFDH 2JA5B 1MD2D 1Q90A 2A6HD 3VA5A 1EYDA 2I46A 1A3VA 4S3SA 5FLXE 3HOXB 2BDOA 1SYBA 2A69C 1C48A 1T5EA 4HTHA 1RF2D 1F9QA 5ISRA 3DDYA 2O4XA 5I2YA 4KN7C 1QNKA 1BXTA 1LACA 4ZUIA 3NTIA 4IUNA 4IFDJ 3CQZB 1SKYB 3HRZC 4XTCS 2XVSA 5KNLA 4XIGS 1DOMA 1PRTC 3A8JE 4ZK9B 1Z47A 2XOKA 1C4QA 4BBSB 4XQJA 1E1RA 2Q8TA 2EE1A 3WOFA 1V1PB 1RD9D 1PFNA 4G7OC 3HKZB 1PRTF 5FK9C 1DD2A 1BOSA 4XLFA 3TP5A 3M7NA 2BOSA 1F9SA 4XT3B 1B50A 2E2DC 5FL7A 1S5FD 2GA4B 4RHSA 1S5CD 4BA1I 1G2SA 2NB0A 3OSOA 2L5TA 4DNRB 5CV9A 2C5CA 3BCFA 1HUNA 1SSOA 3TP8A 2AQ1B 5C0XJ 2F0TA 1KNAA 3M7GA 3M85A 3ZPNA 5IODA 4DN4M 4R9WA 1BPLA 3LX0A 1G291 4LAAA 1HQMC 2R61A 1BCPF 1VLYA 2LZJA 1A6XA 1U9RA 2VNUD 3D4WA 3HOZB 5KGUA 1GJXA 4TSSA 1SNOA 2WIIB 1AP0A 2XIWA 5IGFA 4C3JG 5C4JB 3S14B 1GHJA 1BUVT 4OIJA 3GP7A 4DK1A 3RMHA 5JAVA 1SMYD 2M5SA 2JA6B 5IGBA 3CU7A 2VUMB 2D3LA 4CKEA 3HP3A 5ELBA 3URYA 4ZKBB 1SYEA 2L12A 3Q6SA 4ZQ3A 2K5WA 1SAPA 1KMHA 1LV9A 2PZWA 1SE3A 4RGMA 3K5NA 3AU7A 2EDGA 1KTKA 3OW7A 4IFDI 1VF5C 4DGZA 4QCLA 4XOTA 2EJGC 1TS3A 1QE6A 2PW7A 4OGQC 3T51B 1EOTA 1CZGA 3SK4A 3S2HB 1JOOA 3T53B 1OXTA 3KBXA 1SFOB 4L8JA 3GQBA 1BF4A 2FJ2A 4JBWA 2WPDA 1GHKA 2B2YC 2K33A 2VB3X 4U68A 1VJSA 1OXSC 3VYUA 3PO3B 1IYUA 3S2DB 2KVMA 1GUNA 2BCOA 2O5JC 4RKLA 3J81E 1A15A 2R7ZB 1G2TA 5DM73 1EEFD 3BDCA 5LHY1 1TR5A 5K5PA 4ULLA 3NTHA 2WV6D 1Y8PB 4CHTB 1R4PB 3RUZA 3MTSA 4XLCA 1WTHD 3VYRA 3HEJA 5C0XI 1CA5A 2KA7A 2XNAC 1RHPA 1AZQA 3NK9A 1LTAD 4F87A 4TRDA 3G7LA 3NPPA 2KECA 2NN6I 5M5YB 1TS5A 2DNEA 1OXXK 1UUPA 2EY6A 3OIPA 4J1MA 4NKLA 2X6YA 3QJYA 1E1QA 3R93A 1F2LA 2R9VA 2PW5A 3VR6A 3A35A 1UD2A 2F0GA 2XN9C 4P2CB 4PMWA 3S16B 2FMCA 2B2UC 2EYHA 4I7ZC 2F0EA 4H7BA 5FLXL 1EY4A 4V190 1GUSA 1XX8A 4WRDA 1UAPA 2ZZGA 2KEEA 1HZEA 4PMCA 4FXUA 1PRTB 1EY8A 5EQ0A 1FR3A 2DIEA 1D5XC 1I50B 3FVQA 1JICA 1RCVD 1LT5D 2ID0A 4DAYA 4PMBA 1TIID 2B2UA 4UZUA 1TT2A 2XRSD 2R92B 4CKCA 1FGBD 2EJMA 2L0CA 2BE5C 4HCSA 2NUCA 5FKAC 2IT1A 1I6HB 2MJ8A 1JORA 4BY7B 1PRTD 4RHRA 3GVKA 5K36G 5I6YA 4GQNA 3ZIAA 1YNNC 2JA7B 3MXNA 3NUCA 4CBVA 1ZYRD 4B9WA 1WD1A 2SEBD 4FF2A 3GTOB 1I4PA 4HCEA 2KEDA 3OEEA 1ML0D 1PYWD 1I4HA 5IGCA 4BA2I 3PIO3 1EEID 3KUPA 1CK1A 3FPPA 3DUZA 3RLFA 3FPUB 2OEOA 3GTKB 1AZPA 2GJKA 1B9MA 3C1FA 2NBFA 3PUXA 2BA1A 3WDNA 4FYDA 1U4LA 5A35A 5C3EB 3ONAB 1VMCA 4XNFA 3W3AA 2F0HA 2O5IC 3AMUA 2GJPA 1IL8A 4II3A 3HGBA 5T1GA 1R9TB 3IFTA 2HQEA 3VR5A 4X3TA 2WSSA 1WVLA 2HCCA 1SYCA 1IW7D 3BC9A 4IQZA 1TS4A 1E2VA 3M3YB 3LNNA 1PXUA 2EYLA 3IL8A 4DAVA 5JEAJ 3H09A 4KJOA 1EIHA 4RWSC 1O78A 2EY2A 3TSSA 1PTOH 4B3GA 3Q0AA 3NQTA 5CV6A 5C0XH 4PNYA 1Z6HA 2BDNA 2F0WA 4XL9A 5EPJA 1EY5A 4C3IB 1E0BA 3GTJB 3D31A 4FXKC 4K2LA 2F0OA 4KKUA 2IX3A 4IN3A 4E6IA 1CZWA 2WB1B 3C1EA 2KQ3A 1RTNA 2FFKB 2NZ1D 2D62A 1V8QA 5CDFA 2KJXA 1GUOA 2B39A 2LS01 2RA4A 4FP5D 3DHQA 1JWUD 2B2WC 4U673 4OL7A 1SE4A 3MHBA 1E3XA 1BQQT 4PQXA 1H9SA 1Y1WB 2XSCA 1H8HA 3DWPA 2QDBA 1EU4A 1PLFA 3G05A 2ZXIA 4XXEA 5C4XB 3QIAA 3I91A 4XMYA 2GK7A 4ZRZA 2ZZFA 1ENFA 4KY7A 5CV7A 1F9RA 1A2TA 5CV5A 1BMFA 3VR2A 2F03A 2XZPA 2IW3A 4DA2A 4K8IA 1LLRD 2WZPP 3SK8A 1TWFB 2D9UA 3NBIA 4B08A 1PTOC 3D6CA 4HMIA 1HA5A 4RCOA 1NRKA 1L0YB 1LTGD 1KZLA 5I9PA 3PUYA 1BDOA 2L55A 5D3IB 3V96A 3CESA 3CMMA 4X3KA 1TVXA 2NN6G 3PUVA 4DFAA 4O42A 2F0VA 4HIZA 1SNPA 4H13C 1NBMA 4EQOA 4DK0A 3QG1A 4AYBB 2B2WA 1STHA 4KN4C 4N9PA 1AN8A 1EYAA 3T56B 3A7LA 1IKMA 1CM9A 3CP2A 2JIZA 2K1BA 3OMCA 4K8JA 3SDZA 4L63B 2J0TD 3J81L 1SNMA 2GJRA 3NSWA 2V31A 2HDLA 3H0GB 5G3LF 1CTMA 2EYJA 2DY8A 4V0BA 4H0LC 1A2UA 3TBIB 3I4MB 3NWSA 3UI2A 1ET6A 2JEAI 4ABNA 4KHVA 4NNJA 1GUGA 1EYCA 4L6TB 1W6JA 4M1UB 4MIUA 1DJRD 1PTOB 2F0QA 3OWEB 5CV4A 1B2TA 2A73B 4KI0A 1PDQA 1RKNA 5EKIA 1EZ6A 2DN8A 2NYZD 1Q1EA 1PFBA 4KTAA 2Y0SB 1Z7TA 1EY0A 4M8AA 3OHXC 1CI3M 4IZ8A 3R8BA 4Z1MA 3TDQA 1F2YA 2X69A 2RVLA 1Y8NB 5EBCA 1QCBD 2EY1A 1JWMD 2WP8J 4C1NI 1LO5D 5EJWA 1W0KA 3P75A 2JP1A 1FYCA 1EQTA 3NWTA 3CRLC 4YIJA 4N9TA 2FHTA 2XWJB 4CGYB 5IT9E 2FINB 2RBMA 1YNJD 4C3HG 2L4NA 1QNUA 4XT1B 2VJJA 1QB5D 3TZDA 1KDCA 4IUVA 1B44D 5CBEE 3OMGA 1O7YA 3E5SA 1NSNS 1OXUA 2NVXB 1MGSA 3K5MA 2QCPX 3BVZA 2Z6BD 4ZYSA 1STBA 2ZXPA 3DXJC 1I8DA 3RZDB 1HQRD 1KLGD 4XN3A 1ILQA 4G4KA 1MABA 2EYOA 2X53S 4G6IA 4A3BB 2D2CC 5KYLA 3JU4A 3KBGA 2F0LA 4XLAA 1U4PA 2K5DA 5BN4A 3I8ZA 3IFDA 2VB2X 4XKWA 1EIGA 1HTLD 2MGSA 2XGJA 3DWAA 4OHJA 1WTWA 3JAML 3I70A 3SK5A 4HN7A 2JE6I 3ERQA 5KNBA 5E4XA 2K04A 2PYKA 1LT4D 2D3NA 4ASUA 1CA6A 3QWNA 1I18A 1JC7A 5M9OA 3SHLA 1VDZA 1JQYD 4HEDA 4LJZC 3BYYB 2CK3A 2ZZQA 1TWGB 3OEHA 4IFDG 3BH4A 4RGNA 2TSSA 4EVOA 3D8GA 4MHEA 4KD3A 5J39A 1W9XA 3GTGB 2AQ2B 3EROA 2EVBA 5C4HA 1SNQA 5CORA 1I4RA 3Q23A 1SYDA 1U4MA 3A7AB 3BYTB 3EQLC 4A3EB 3DEOA 4KD4A 1EZ8A 2JDIA 2E2JB 2ZXHA 4FVMA 1TU2B 3I73A 2B2TA 3KK7A 4AVZA 2QKIC 4KK7A 3W2DA 2JJ1A 3HAGA 3S1MB 4YELA 3R3OA 2V7QA 1V1PA 4DXFA 4E0FA 1STAA 1V0EA 2D5DA 5A2QE 1JR0D 3T4AC 1CFMA 3MC0B 1H9RA 3DWQA 1TKWB 2WKCA 4XDXA 3E0JA 2PNRC 1HTPA 3I4LA 1NR2A 3MXGA 4KKTA 1AEXA 3S1QB 5KIXA 2HUGA 4WJWA 1D2BA 4FF4A 1W6KA 3HOVB 1Q8IA 2B2VA 4F88A 3GTMB 1FNVA 4QUCA 1ZKOA 3CHBD 5G3LD 4ODGA 3D3RA 3R2IA 4QMGA 4Z9CB 5EKLA 4OO1H 1EY9A 4R8IA 3K59A 3PV0A 4B9XA 2QILA 1HXYD 5IOCA 1F2ZA 1H9JA 2K05A 2W6JA 4C1NK 4KY5A 3HG9A 1H9KA 2B2TC 3M4OB 2A68C 4XYQA 4IUQA 3HOYB 2M00A 3OOCA 1GUTA 2CVRA 2IX1A 4YXWA 2B8FA 2GK6A 2JYOA 3M4YA 1DOKA 1ENCA 1K8MA 2E1BA 5BN5A 5NUCA 3KEWA 2EYPA 4A3FB 3BVGA 3ZYYX 2WJYA 4RGTA 4KY6A 2A6HC 1RODA 1ZYRC 3JAME 3U9OA 5JPMC 2LKVA 1II3A 4H44C 2F0JA 4K2KA 4QIWB 3A3BA 2A6ED 4UDUC 1UD5A 2PQEA 3TN2A 3RD4A 3OIQA 1I6VC 2IL8A 4A3MB 5CC4A 1RDPD 4C3JB 2JA8B 4X3SA 3D4DA 1KDAA 3QOJA 4NW2A 2Q8IB 2PPBC 1WD0A 3R2TA 2SNSA 2JEBI 5IGGA 3TZUA 3L9AX 2OT2A 1UD3A 4KJNA 2NVTB 3BVMA 3PO2B 1MI2A 4OO1G 1E2ZA 4QF4A 1ZXTA 1IW7C 1LABA 1WTXA 3P7JA 3MXPA 4TQUS 1CQFA 4ZLTF 3NE5B 4FF1A 2EOTA 4IUPA 2K5QA 1FX0A 1QG7A 4ID6A 4A3IB 3KLSA 4RFBA 1GUWA 1ENAA 2EXZA 1CT1D 3TP7A 4F8MA 2F1MA 1ILPA 4TSFA 5FOBB 1R4QB 1TS2A 1CHPD 3J7YW 4KMUC 2X6GA 2EYFA 3H94A 4XR6A 2YYZA 5KYIA 1TY2A 3I72A 1SMYC 5JVG3 1JOQA 3Q24A 4G7HC 4XQQA 2JXMB 2ZTNA 1DM0B 3FMCA 2LMCB 3PUWA 3IKJA 4RGOS 3GTLB 2EJFC 4HSVA 3VYTA 2AWNA 3MWYW 1ZEQX 2CW0D 5DM63 1FNUA 1VF7A 4CKBA 1W0JA 3GTPB 4Y7NB 2YU9B 3BDLA 1UNSA 3PMFA 4WORA 4KHZA 1BLIA 4G57A 1I4XA 3J7AF 1HUMA 1J8IA 2F43A 1SYGA 5BN3A 1HFNA 3FRPB 2X6XA 3OFNA 2EZVA 2BE5D 2E2IB 1KLUD 4BBRB 2EYMA 5EPKA 1IKLA 3J80L 1RTOA 4FO2A 3LWEA 1B1ZA 5HURA 5T1IA 1JE4A 4PV1C 4A93B 5JEAG 3NQIA 3A54A 4ZAIA 1VCIA 1ICWA 1SJED 1LTSD 1A3UA 1NCVA 4MN3A 1ESRA 2XZOA 2A74C 3DMUA 5EBDA 1SXTA 5JJZA 1O7ZA 4EQNA 5JVH3 4A3KB 1KAAA 2G9DA 4CJ1B 2MP1A 2V4DA 1S5BD 4IURA 3HOWB 2K6AA 1T5XD 1EY7A 3KLSX 4XN0A 4JMQA 2N88A 4RH6A 2IX0A 1EL0A 2ZZEA 5IGEA 2F0MA 2PZUA 5D65A 2JSOA 2KCNA 4C56C 3X3NA 2HLDA 2A69D 3AB9A 1LTBD 3OPOA 2XZLA 2H1EA 1WCMB 3GTQB 4IUUA 2E2HB 4LMQD 2EPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0L C;  2D5D A;  2QF7 A;  4HR7 B;  4GZY C;  4XIG S;  2R6G A;  4H44 C;  3QJY A;  3DXJ C;  1CFM A;  3A8J E;  1B9M A;  3LWU A;  3BG3 A;  2A6E D;  3VR6 A;  1H9S A;  1K8O A;  2JEA I;  1H9R A;  4KHZ A;  3MXU A;  1TKW B;  4RCN A;  3PUX A;  1GUG A;  2PNR C;  1HTP A;  3I4L A;  2BA1 A;  3WDN A;  3KLR A;  1I6V C;  2BA0 A;  1OXV A;  5A35 A;  4KKT A;  3QIA A;  1E2W A;  4G7O C;  3L7Z C;  4I7Z C;  5BN3 A;  4DNT B;  1EWH A;  3W3A A;  2EDG A;  3BDO A;  2D2C C;  3OW7 A;  2O5I C;  1IYV A;  1VF5 C;  1GUS A;  1DD2 A;  2Q8I B;  1H9S B;  1Y69 U;  2A6E C;  3HGB A;  2PPB C;  2EJG C;  2BE5 D;  3IFT A;  4KI0 A;  3M7N A;  2K32 A;  3ND9 A;  4OGQ C;  3VR2 A;  3T51 B;  5BN4 A;  2ZT9 C;  2KCC A;  2DN8 A;  2JEB I;  4G7Z C;  3VR5 A;  3A8K E;  1FR3 A;  3TZU A;  3CRK C;  1Q1E A;  4PV1 C;  3D4R A;  2K7V A;  1ZKO A;  5JEA G;  5JEA H;  2E75 C;  1HPC A;  1IW7 D;  1Z7T A;  4IQZ A;  1CI3 M;  1VCI A;  3N6R A;  1OXT A;  3T53 B;  2AUJ D;  1E2Z A;  4BA1 I;  1E2V A;  2JE6 I;  3VA7 A;  4OO1 G;  4OO1 H;  3LNN A;  2AUK A;  3PV0 A;  5KNB A;  2AWO A;  1IW7 C;  4L8J A;  1LAB A;  3GQB A;  2A68 D;  4JBW A;  4TQU S;  1QJO A;  1GHK A;  1DCZ A;  1Y8N B;  3NE5 B;  2L5T A;  1O78 A;  4DNR B;  1DXM A;  1H9J A;  2K33 A;  3VR4 A;  3PUY A;  1BDO A;  1OXS C;  1IYU A;  1Q12 A;  2EJM A;  1GUN A;  1ONL A;  1V43 A;  2BE5 C;  1H9K A;  2O5J C;  1Y8O B;  2A68 C;  3M85 A;  2NN6 G;  2NN6 H;  5KNC A;  2IT1 A;  4KKS A;  3PUV A;  1VDZ A;  5C0X G;  5C0X H;  3OOC A;  2E74 C;  4LJZ C;  3SE0 A;  1Z6H A;  1O7L A;  1GUT A;  1FYC A;  2CW0 C;  2V4D A;  2F1M A;  2E76 C;  4H13 C;  4IFD G;  4IFD H;  1Y8P B;  3A8I E;  1Q90 A;  4DK0 A;  1G29 1;  2B8F A;  2DNC A;  2A6H D;  3CRL C;  5K36 G;  3QG1 A;  3M4Y A;  1HQM C;  2B8G A;  4KMU C;  1YNN C;  1K8M A;  3H94 A;  2YYZ A;  4KN4 C;  4TKO B;  2BDO A;  5BN5 A;  2EVB A;  1A6X A;  3I72 A;  3T56 B;  3A7L A;  2A69 C;  3D31 A;  1SMY C;  3PUZ A;  1T5E A;  3GD7 A;  3U9S A;  3P20 A;  1GJX A;  4G7H C;  1H9M A;  4KKU A;  3VR3 A;  3A7A B;  1YNJ C;  2KA7 A;  1Q1B A;  3EQL C;  3SDZ A;  2A6H C;  2JXM B;  3FMC A;  4BA2 I;  1HCZ A;  2LMC B;  3PUW A;  3IKJ A;  4LK1 C;  1TU2 B;  3I73 A;  1GHJ A;  1ZYR C;  2A69 D;  2EJF C;  4DK1 A;  3FPP A;  2NN6 I;  4KN7 C;  2DNE A;  3AB9 A;  1OXU A;  1LAC A;  2D62 A;  1V8Q A;  1B9N A;  3OPO A;  1OXX K;  3ND8 A;  3RLF A;  5K36 H;  1CTM A;  1GUO A;  3MFY A;  1VF7 A;  5KND A;  1PMR A;  4XTC S;  4JK1 C;  2PCF B; 
#chains in the Genus database with same CATH topology
 2PI2 A;  3GTM H;  4HR7 B;  3P1H A;  1JA0 A;  1MJC A;  3FDT A;  1JWS D;  4XLH A;  2F0N A;  1LTI D;  4LF9 L;  3PQI A;  1S72 B;  1V1Q A;  1KQS A;  5GAG C;  3E1Y E;  4R4T A;  4J15 A;  2K4K A;  4JOI A;  5IP9 G;  1J9O A;  1C7Y A;  3M9B A;  3FKI G;  3KLR A;  2F3W A;  3R6K A;  2WKD A;  3NBH A;  2LFN A;  3L0O A;  4PAA A;  1QUF A;  4K6D A;  2NVY B;  3PUM A;  4X3U A;  4FXD A;  1N0V C;  1DZ1 A;  3WWV A;  5LL6 S;  1X3Q A;  1PKV A;  3GV6 A;  2D0O A;  1YIJ B;  2XND A;  3Q3A A;  2X3U A;  3OZU A;  5H1S E;  4TVA B;  2ZT9 C;  3QE2 A;  1IBK Q;  2DJF C;  2KCC A;  3MFG A;  4OIK A;  1Y14 B;  3SJZ A;  3BZD B;  4UP7 A;  1HZB A;  3S17 B;  5DEH A;  4R8N A;  2CHB D;  5IT9 L;  5M5Y H;  5JEA H;  1IBM L;  2E75 C;  3GTO H;  2R93 H;  1XTC D;  5JBQ A;  2NVQ B;  2M9V A;  4Q5V A;  2EIX A;  3J80 E;  1SN8 A;  3VA7 A;  4A3J G;  3MA2 B;  2OCE A;  2VQE L;  1QH0 A;  2DGY A;  2LSS A;  3H6M A;  2Q8R E;  4Y9R A;  4ILW A;  1STN A;  3CCJ B;  4DNI A;  4K5X A;  2VYQ A;  1HVX A;  2AHO A;  5IP7 H;  2EQS A;  3VNU A;  3FEW X;  1DYQ A;  2JQO A;  3OWF A;  1TXY A;  1PZI D;  2K14 A;  3TP6 A;  2F4I A;  3AYH B;  2E8G A;  4O0A A;  1JCK B;  2OF1 A;  4K14 A;  2R7F A;  2E74 C;  2F0K A;  2RDF A;  3A0J A;  3S9W A;  5C0X G;  1O7L A;  5CGK A;  2CW0 C;  2Q2U A;  1OB2 A;  4DUZ L;  1KK3 A;  2KHS A;  1K83 H;  2TMP A;  2X85 A;  4UZF A;  2F0U A;  1XNR Q;  1EWC A;  3P26 A;  1LT3 D;  2A5H A;  2KUM A;  2Z6K C;  4GLX A;  4TKO B;  3DM1 A;  5C5L A;  1HJP A;  3AVW A;  4RKB A;  1XPU A;  1EQR A;  1HNW Q;  1H9M A;  3UDG A;  5IGD A;  4M4S A;  3E0E A;  3A56 A;  1YNN D;  2Q6I A;  3E6Z X;  2X6W A;  2YWE A;  1YHQ B;  3ULP A;  4K5V A;  3Q22 A;  5FO9 B;  1VS0 A;  4XOP A;  3IAY A;  1VQC A;  5ELD A;  5E1F A;  2Z1C A;  3MFY A;  1F77 A;  3CPX A;  5IIF A;  4QFM A;  2JA5 H;  1BCP B;  1BO0 A;  4ZCK A;  2PCF B;  3ISX A;  3GDE A;  1OB5 A;  1EU3 A;  1A63 A;  5M5X B;  4XQN A;  3P27 A;  1D6E C;  3S2H H;  1EYG A;  4X07 A;  4IPD A;  1ZM4 A;  3CCL B;  3V7A A;  1I94 L;  1TQO A;  4UP8 A;  2HIV A;  4RCN A;  1G91 A;  1QGY A;  1WTP A;  4G7X A;  2F0F A;  4RAU C;  3SK6 A;  5C3W A;  4A3D B;  2NPF A;  1FNW A;  3CF5 A;  3EFX D;  3OZV A;  3QB3 A;  4GN3 B;  4O1N A;  2HDM A;  3K58 A;  3CCQ A;  3C3L A;  2BGJ A;  1LTT D;  1QZH A;  3CCU B;  3HOU H;  3H3V C;  2VJI A;  5LMN L;  4BY7 G;  3A55 A;  4MTK A;  3I56 B;  3WOE A;  2WFW A;  3GO5 A;  5IYC G;  4TT3 A;  2VXW A;  4QY7 A;  3T13 A;  3U6K A;  2FMM A;  4PC2 A;  1NR4 A;  1B4O A;  3VO2 A;  3CD6 A;  2V7T A;  1GO3 E;  4XYO A;  1S5E D;  3CCJ A;  2CQA A;  2ZXR A;  5I4D A;  3CCV A;  3CRK C;  4HJ7 A;  3ER0 A;  5I2X A;  4HE5 A;  2Z0S A;  5JPN C;  3SLD A;  1EIY B;  3HOW G;  1FNC A;  1Y1W G;  3FPK A;  3QFS A;  3AFQ A;  5HGT A;  2R93 G;  1U0L A;  2VQE Q;  3N6R A;  4PC3 A;  1W3S A;  4GN5 A;  4HAE A;  3RR5 A;  5CBA E;  2Z6K A;  3JAM i;  3C2P A;  1I4G A;  5BSY A;  2ZL6 A;  2VBT A;  1K3R A;  5HKK A;  2ZXO A;  1C8C A;  1HNX Q;  4OOX A;  4Z4S A;  4GOP C;  1AIP A;  1CKN A;  2X6L A;  3AGQ A;  4GN4 B;  1SDF A;  2Z8L A;  3GVJ A;  4LWC A;  4LNQ A;  2K03 A;  5KNC A;  3W2G A;  1DOL A;  1K9M D;  2F4V L;  3SXH A;  4ME5 A;  1VQL A;  1L1O A;  1HZA A;  2EY5 A;  3S1R B;  2NWG A;  4OPS A;  4LFA Q;  5C3X A;  1YJ9 B;  1KAB A;  3AQQ A;  3BU2 A;  5K36 H;  4OWT B;  1TTT A;  2C78 A;  1S4Z A;  5J1Z A;  2RC5 A;  2X8K A;  1VQK B;  4POG A;  1DDI A;  1PZK D;  2K75 A;  1UD8 A;  4B43 A;  1YHQ A;  2NTT A;  3F2U A;  1YHA A;  3K81 C;  1OTC A;  1HFG A;  1SNC A;  2NZH A;  4C2M B;  3P20 A;  5J22 A;  1DON A;  5H59 A;  1M4V A;  1BR9 A;  2QEJ C;  2YWF A;  5C4X H;  4ZV4 A;  3KL9 A;  2G9H D;  4ZCL A;  3WNB A;  5A89 A;  4N8F A;  1ZM9 A;  4TMX A;  1U5K A;  2I07 B;  5GAE C;  1W2B A;  2L11 A;  2F0S A;  1FNM A;  3K7A B;  1TY0 A;  2H5X A;  3CCE B;  4JI1 Q;  1UD6 A;  1RQP A;  3F2B A;  5I9O A;  5D14 A;  1E64 A;  1IJE A;  1M8A A;  4BY1 B;  3BNW A;  3CC7 A;  3H0G H;  2Z6B A;  3LWU A;  2PMZ E;  1XQB A;  4DUY Q;  2KOL A;  2QF7 A;  1D2E A;  1E24 A;  2ALY B;  4EX5 A;  4CDD C;  4DPG A;  2R93 B;  1VMP A;  2I5H A;  1K8O A;  3ERS X;  5LMN W;  1H8E A;  5ELE A;  1BNZ A;  2R6H A;  1L0X B;  4DV5 Q;  1ESF A;  3HOU B;  3JAM c;  4FXG C;  3K5O A;  4AQY Q;  5EPL A;  4NBS A;  1QVG A;  1OXV A;  1PH5 A;  1LUZ A;  3K57 A;  1EFR A;  3SKB A;  4BBS H;  2RC6 A;  2B63 B;  4CJ0 B;  1RJT A;  3PGZ A;  4DAP A;  4K0K L;  3H3V H;  1PH4 A;  3DEP A;  3BCD A;  4AF7 A;  1F9P A;  2WYR A;  4NB3 A;  2CQO A;  1QOH A;  3HOX H;  4JI3 Q;  1BJK A;  1JB3 A;  2NVT H;  1V5V A;  1WOP A;  2XWB B;  1EQV A;  3ZUG A;  1PYB A;  3CCS B;  2QEX A;  1YNX A;  3O13 A;  1X55 A;  4DR3 L;  3AFP A;  1XYI A;  2C9O A;  2QA4 A;  1K83 B;  3HOW H;  3OP1 A;  3NEL A;  1Y1W H;  2ES2 A;  1JOK A;  3GV3 A;  3SVM A;  3SEB A;  2PNH A;  1ASZ A;  1GXD C;  5DAU A;  4DK3 C;  2Z4I A;  3ZBT A;  3LQ6 A;  1I3Q B;  2AUK A;  1I94 Q;  1E3Z A;  2AWO A;  4DF7 A;  2B5O A;  4CJ2 C;  2N78 A;  2UUA L;  1Y1V B;  1WPC A;  4XLE A;  3CCM B;  1DXM A;  1QUQ B;  2RSO A;  2F0P A;  4K5W A;  4AH6 A;  1Q9S A;  3L3O C;  4QUF A;  2V7X A;  2RKS A;  3PSI A;  1V43 A;  2DY1 A;  2K01 A;  2P5Z X;  4N8X 1;  5CV8 A;  3UDF A;  1SBB B;  4U9U A;  5IK2 A;  3A3G A;  2IPK D;  2ZTG A;  1PYS B;  1KXL A;  1QX4 A;  3JQR A;  4LBY A;  4IAL A;  2KCM A;  1F60 A;  3DLL A;  1K28 D;  3A8I E;  2FX3 A;  3GVL A;  4HJ9 A;  3E20 A;  1LYL A;  1WTQ A;  2QE7 A;  4JI8 L;  4NXM L;  2RDG A;  3G6J B;  1GOZ A;  5C6A A;  2IJ0 A;  5EGT A;  2ZM6 Q;  4B3R Q;  5F4J A;  5DS0 A;  3MVV A;  4DK6 C;  1VHO A;  3U9S A;  2WIN B;  4A93 H;  1STG A;  4IOA A;  5CMD A;  1PTO F;  5D3D A;  3I90 A;  3CP8 A;  4LW1 A;  5JJL A;  4RJL A;  3BQJ A;  1K0S A;  1SND A;  3K7A H;  5C4X G;  4J6H A;  3Q39 A;  3RZO B;  4LF7 Q;  4LK1 C;  3C46 A;  1BCP C;  3A74 A;  4FF3 A;  1EWI A;  1Q3L A;  2C5H A;  1G7C A;  1E79 A;  1S5D D;  2CW5 A;  1BBW A;  3FKS A;  2BH8 A;  4R4C A;  2N49 A;  4A75 A;  2MHV A;  3W2I A;  3EVQ A;  5F2D A;  2YU9 H;  4LF6 L;  3S1N B;  2J7Z A;  5M3F B;  3H0G G;  1K8G A;  2M2L A;  4P3I A;  3D6W A;  1TWH B;  5A2Q L;  4GZY C;  2ICI A;  3J80 i;  2ZBV A;  5I6W A;  4WFN 3;  2BH2 A;  1COW A;  2K28 A;  4L5S A;  1WTR A;  5LMZ A;  2F0I A;  2ICE C;  1TWC B;  2ENB A;  4DKA C;  1FDR A;  1JJ2 B;  3T1H Q;  3I3C A;  2VQF Q;  1G6Z A;  4XD7 A;  3OTO L;  4ZCM A;  2DET A;  4YCV A;  4EQP A;  1OHH A;  2BA0 A;  1AW7 A;  3RZO H;  1EOV A;  1E2W A;  1GAQ A;  3N52 A;  2RSN A;  3B82 A;  4XKV A;  1N9W A;  1G7S A;  1B3A A;  1H9S B;  1Y69 U;  4H9G A;  4JI4 L;  4ACA A;  5LMN Q;  4YAU A;  3ND9 A;  3CC4 A;  5KRU A;  4QB4 A;  1KK0 A;  2VUM H;  2AQ3 B;  1WTV A;  3A8K E;  3CP0 A;  1TWA B;  3MEH A;  3KLW A;  5HY6 A;  2K7V A;  2F3V A;  2SNM A;  4RCZ A;  2AUJ D;  1NTG A;  2B2Y A;  3EJI A;  3OE7 A;  2UUB Q;  4POF A;  1PZJ D;  1E43 A;  4LF4 L;  4LF9 Q;  5C5M A;  1MSH A;  3Q6Q A;  1AFP A;  3E9I A;  1SFO H;  3J7A V;  4X65 Q;  2L1B A;  1H95 A;  4DR1 L;  4PG3 A;  4JBJ A;  3T1H L;  3HKS A;  1Q82 C;  4NDX A;  2QMU A;  2Q2I A;  2WB1 E;  1E1T A;  4A3G B;  4NMZ A;  1Y8O B;  3SR1 A;  1KK2 A;  3AVY A;  2NN6 H;  5HXB A;  4R71 A;  1VQ9 A;  3MZ5 A;  3CCU A;  5E4W C;  1XXG A;  4J8Q A;  3Q6R A;  2XRQ D;  4XM3 A;  1WP6 A;  5KW9 A;  2F1L A;  4Z4W A;  5KEE A;  4BY1 G;  4FWT A;  2W6I A;  3F8T A;  5FO8 B;  2DNC A;  1PFS A;  2XTI A;  2Z4H A;  4C3H B;  4OPV A;  1EUJ A;  3CKI B;  1Y0R A;  3HS0 C;  5M5X H;  4IUT A;  1EIF A;  1D1K A;  3TME A;  3H91 A;  3PUZ A;  3GD7 A;  3K6O A;  4A93 G;  4RD3 A;  2HDN B;  3VR3 A;  4ZUJ A;  1YNJ C;  1QWY A;  1HZ9 A;  4OO1 I;  1Q1B A;  5M5W B;  1N0U A;  1B8A A;  3VMF A;  5JJI A;  4A3I H;  2LY7 A;  4NP5 A;  4RA8 A;  1VQD A;  2KHI A;  2WAQ B;  1QIL A;  3F1Z A;  4A3E H;  2HMA A;  2UU9 Q;  1B9N A;  3MAQ A;  2RHQ B;  5AFW A;  2DY7 A;  1K0R A;  3ZBU A;  1D8L A;  4RG1 A;  5KND A;  2ZIT A;  4YCU A;  4ZKC B;  4K6L A;  3ONU A;  4JK1 C;  1VQL B;  2R6G A;  3KFU A;  1YIJ A;  1WTO A;  3BS1 A;  1VQ5 A;  1OO9 B;  4DU9 A;  2PMZ B;  4JI7 Q;  4A3K G;  1D5Z C;  5FIU A;  3MXU A;  4G7W A;  5AN9 A;  2IWH A;  5FLX c;  2I0Q A;  1KDB A;  3D0F A;  4BS9 A;  3OJW A;  1PH6 A;  1STE A;  4C3I G;  4LF5 L;  5C44 B;  1SE8 A;  2Z9H A;  1BBU A;  3L7Z C;  1EWH A;  5M3M B;  3BDO A;  4YEJ A;  5DNF A;  3I56 A;  1PVO A;  1HRJ A;  1PFM A;  3ZZ0 A;  4QL5 A;  3CC2 A;  2XNC A;  1BCP D;  2VZL A;  4HMJ A;  1I50 H;  4BWG B;  2MNA A;  2OXP A;  1PH7 A;  5CR3 A;  1HR0 Q;  2OK8 A;  1MSG A;  3ASQ A;  1VQO B;  3D4R A;  5CYU A;  3CMA A;  2HCI A;  3WXM A;  1HPC A;  3I4N B;  1ZM3 A;  1WU8 A;  2IHF A;  1D5M C;  2WAC A;  1KHI A;  3STB D;  3NXW A;  5THX A;  3NP8 A;  2A68 D;  1NMF A;  1U4R A;  4FNF A;  1DDG A;  1QJO A;  3QFT A;  3WBK A;  4DR1 Q;  4B3S Q;  4FN5 A;  1XFO A;  3EA6 A;  1M90 C;  3VR4 A;  3OAA A;  5GV8 A;  5J3B A;  4YAO A;  4TMT A;  1VQN B;  3ULJ A;  2QTL A;  3KJO A;  2O2L D;  3NHH A;  1ONL A;  2N55 A;  1IL2 A;  2PZT A;  1LT6 D;  2JA9 A;  2MUY A;  4QVJ A;  4R4I A;  2MO1 A;  2VBU A;  3ITP A;  4B3F X;  2X0K A;  3HZX A;  4KLK A;  2WJV A;  3ZC3 A;  4X06 A;  4YWL A;  1GVH A;  2FXQ A;  2F0D A;  5EKK A;  4BY1 H;  1PH8 A;  3HOV G;  1X32 A;  1X56 A;  3ONY A;  1B53 A;  1LTR D;  2B8G A;  2SDF A;  3TQY A;  4DV2 L;  2YV5 A;  4YHH Q;  4XOR A;  1F2M A;  1A8V A;  1EY6 A;  2MPM A;  2BVN A;  1V1O A;  1SJH D;  3QO2 A;  4A3B G;  5GQO A;  1IHZ A;  1E1O A;  4Q0F A;  5ELC A;  4UAI A;  1SYF A;  1FD7 D;  1UWV A;  1VQI A;  2SOB A;  5JOB A;  5A8A A;  2XGT A;  3KYH C;  2VNI A;  4X05 A;  3VYS A;  1CSP A;  3PIP 3;  4UHV A;  1A3T A;  1HCZ A;  1W2B B;  1EFI D;  2B2V C;  2NTS A;  4DV4 Q;  4A3J B;  3K0X A;  3K0Y A;  2LXK A;  4PZ7 A;  1V9P A;  3T16 A;  2JN9 A;  4LF5 Q;  4P3Y A;  1YHB A;  1STY A;  1MBY A;  1SEB D;  3AVT A;  3ND8 A;  2WB1 G;  2VS1 A;  5E3F A;  1D1I A;  1H42 A;  3S15 B;  1PMR A;  4PAB A;  3G48 A;  4XON A;  4XQF A;  3CAM A;  4X64 Q;  1XWE A;  4JI7 L;  3CB4 A;  3S17 H;  1VQ8 A;  3S24 A;  2L9H A;  4HSP A;  1ELO A;  3BG3 A;  1I4Q A;  5DN6 A;  4DXG A;  1BBX C;  3X3M A;  3ZZU A;  3CCV B;  1UD4 A;  1G8Z D;  1N05 A;  1QVG B;  5ELF A;  1E62 A;  1NAP A;  2E2J H;  2DOG A;  1SE2 A;  4P22 A;  1QZG A;  3QFC A;  1XNQ Q;  4DNT B;  5LL6 X;  5IY0 A;  5FO7 B;  3TS2 A;  1IYV A;  4UP9 A;  4BPR A;  2A6E C;  4LF7 L;  1V0F A;  1PTO D;  1KNE A;  1HHV A;  2K32 A;  1WCM G;  4LBV A;  5B6I A;  2EFG A;  1HA6 A;  4ZCI A;  5C4Z A;  4G7Z C;  2J4X A;  2H4O A;  1OB0 A;  3CXC B;  3CCR B;  3A5U A;  3CRZ A;  3KF8 A;  4F7X A;  3NTK A;  4KV6 A;  1C9O A;  2DUD A;  2RQX A;  4DV6 L;  1ET9 A;  1CHQ D;  4LFB Q;  4JVZ A;  3KOJ A;  1SRO A;  1UEA B;  4II2 A;  2JJ2 A;  3FKI B;  2C4T A;  5C44 G;  3QOL A;  1DCZ A;  2RDH A;  1O80 A;  1UE6 A;  4I65 A;  1XMQ Q;  2KVO A;  4LBW A;  2E5L L;  3V05 A;  1CQV A;  4NCN A;  2HD3 A;  1Q12 A;  4EGV A;  1BX1 A;  1EFU A;  5E6T A;  5COY A;  3K5L A;  2QDL A;  1PJ7 A;  1X3P A;  4DR2 Q;  2WR8 A;  4KKS A;  1NUC A;  1NMG A;  2PO4 A;  1NJI C;  2R3Z A;  2B7B A;  3TEH B;  3SE0 A;  3WQZ A;  4OON A;  1X65 A;  3V2T A;  2E76 C;  5TSS A;  4IFD H;  2JA5 B;  2UUB L;  4DR6 Q;  1MD2 D;  1Q90 A;  3HOV H;  2A6H D;  3VA5 A;  1EYD A;  1IB0 A;  2I46 A;  1A3V A;  1UEB A;  4S3S A;  5FLX E;  3HOX B;  1F20 A;  2BDO A;  1CQX A;  1SYB A;  4IOC A;  2A69 C;  2PQA A;  4LBZ A;  1C48 A;  1T5E A;  4HTH A;  2RHS B;  3PIP A;  1RF2 D;  1F9Q A;  4DV1 Q;  1WOR A;  4LF8 Q;  4I7A A;  1CNF A;  2DCU A;  2MFI A;  1I7P A;  1YJW A;  3S2D H;  4DV2 Q;  1I3Q H;  4PZ6 A;  3B78 A;  5ISR A;  4LFC Q;  3DDY A;  2O4X A;  5I2Y A;  4KN7 C;  3H3V I;  1QNK A;  1BXT A;  1IZ6 A;  1LAC A;  4ZUI A;  1VQG A;  3NTI A;  4IUN A;  4IFD J;  3CQZ B;  1SKY B;  3HRZ C;  2WZN A;  1X3G A;  4XTC S;  1N34 Q;  3OJX A;  1XB2 A;  4DQL A;  2XVS A;  3IRB A;  5KNL A;  4XIG S;  1VQJ A;  1DOM A;  2CH4 A;  1PRT C;  1VQE A;  1TWA H;  3A8J E;  4ZK9 B;  5BSX A;  4B48 A;  1Z47 A;  4MTN A;  2XOK A;  1QVF B;  4RMF A;  3L2P A;  1C4Q A;  4P72 A;  4BBS B;  1NB0 A;  1E1R A;  2Q8T A;  4XQJ A;  2EE1 A;  3CTA A;  3WOF A;  1V1P B;  3I55 A;  1N07 A;  1RD9 D;  1PFN A;  4G7O C;  3CCR A;  3HKZ B;  3S1R H;  3UDX A;  3K7U C;  1PRT F;  1XE1 A;  1TUI A;  1Q8K A;  1YEZ A;  5FK9 C;  1DD2 A;  1BOS A;  4XLF A;  3TP5 A;  1HR0 L;  4B3T Q;  1PA6 A;  4MYT A;  3M7N A;  4WZK A;  1WCM H;  2BOS A;  2R7Z G;  1F9S A;  4XT3 B;  3PA1 A;  1B50 A;  2E2D C;  2JJQ A;  5FL7 A;  1S5F D;  2GA4 B;  4RHS A;  1S5C D;  3CPW B;  4BA1 I;  1G2S A;  2NB0 A;  3OSO A;  4LF8 L;  2IY5 B;  1IBL Q;  2L5T A;  4DNR B;  5CV9 A;  4N3G A;  2C5C A;  1J5E Q;  3BCF A;  1FRN A;  1SSO A;  1VQH A;  5EMN A;  3LGJ A;  3TP8 A;  2F4V Q;  1HUN A;  2AQ1 B;  5C0X J;  2F0T A;  1KNA A;  3M7G A;  3M85 A;  3J81 i;  3ZPN A;  4QJF A;  4JV5 L;  2UXB L;  5IOD A;  4DN4 M;  4R9W A;  1BPL A;  4MNO A;  3LX0 A;  5FNZ A;  3CC2 B;  5M3F G;  4X8I A;  1EP2 B;  2ZJQ A;  1G29 1;  4LAA A;  1W35 A;  1HQM C;  2R61 A;  2ZTE A;  1VLY A;  2LZJ A;  1BCP F;  1X9N A;  1MHW C;  1S4M A;  1A6X A;  4DR7 L;  1YIT B;  1SMX A;  1U9R A;  3D4W A;  4IO9 A;  5KGU A;  4P74 A;  3HOZ B;  2VNU D;  1GJX A;  2V7W A;  1P16 A;  4TSS A;  1WOO A;  1SNO A;  4HIK A;  2WII B;  1AP0 A;  2XIW A;  4UAJ A;  5IGF A;  4GS3 A;  4DR5 L;  2GVB A;  3MEF A;  4C3J G;  5C4J B;  1K73 C;  3SEJ A;  3S14 B;  1GHJ A;  1BUV T;  2JK8 A;  4OIJ A;  3GP7 A;  1N33 L;  4DK1 A;  3RMH A;  5JAV A;  1I6H H;  1SMY D;  2M5S A;  3RLN A;  4JI5 Q;  2JA6 B;  1T9H A;  5IGB A;  3CU7 A;  3CME B;  4PC1 A;  4BBR H;  2VUM B;  2D3L A;  4CKE A;  3NBH B;  3HP3 A;  5ELB A;  2F4N A;  1GAW A;  1E3P A;  3URY A;  5FO0 A;  2QN6 A;  4ZKB B;  1A0I A;  1SYE A;  2L12 A;  3Q6S A;  4DUY L;  4ZQ3 A;  4X65 L;  2K5W A;  3CC4 B;  1SAP A;  4O2D A;  1KMH A;  5FJ8 G;  2UXD L;  1LV9 A;  4IW3 B;  1SE3 A;  2PZW A;  4PZ8 A;  4RGM A;  3K5N A;  2CBX A;  3AU7 A;  5L46 A;  2EDG A;  2OBS A;  1KTK A;  3OW7 A;  2OBT A;  4IFD I;  1VF5 C;  3CPW A;  3I2Z A;  4DGZ A;  4B3X A;  4WZT A;  4XOT A;  4QCL A;  2EJG C;  1TS3 A;  4M53 A;  1A62 A;  3HOY H;  1QE6 A;  2PW7 A;  4OGQ C;  4LC0 A;  2R7Z H;  3T51 B;  1EOT A;  2BPO A;  4JI4 Q;  1HNW L;  1VQ6 A;  1OGI A;  1CZG A;  1D8T A;  2MO0 A;  3SK4 A;  3S2H B;  1JOO A;  3T53 B;  1OXT A;  3KBX A;  4RDJ A;  2HQL A;  1SFO B;  4GNX B;  1VQ4 A;  1VQ8 B;  4L8J A;  4X7D A;  3EIV A;  3GQB A;  3WBJ A;  1BF4 A;  2FJ2 A;  4JBW A;  2OBR A;  2WPD A;  3MMP A;  1GHK A;  2VQF L;  2B2Y C;  1BVS A;  2K33 A;  2VB3 X;  4U68 A;  3J80 c;  3KJP A;  1VJS A;  1OXS C;  3VYU A;  3PO3 B;  1IYU A;  3S2D B;  2KVM A;  5IWA Q;  2E2H H;  1GUN A;  1IJF A;  1TLL A;  1I5F A;  2BCO A;  5ELN A;  2O5J C;  4RKL A;  1D1N A;  1YIT A;  1JNY A;  3J81 E;  1A15 A;  2R7Z B;  1G2T A;  1FL0 A;  4P12 A;  5DM7 3;  4HJ8 A;  1EEF D;  4QVA A;  3BDC A;  5LHY 1;  4WQM A;  1TR5 A;  5K5P A;  4TN1 A;  4ULL A;  2D74 A;  1MIU A;  5M3F H;  1XJV A;  3NTH A;  2WV6 D;  1Y8P B;  4AC9 A;  3U4Z A;  1K28 A;  1YVC A;  4CHT B;  5DLQ E;  1R4P B;  3RUZ A;  3MTS A;  4XLC A;  1EQQ A;  3CXC A;  4IPC A;  4R4O A;  1WTH D;  1EP3 B;  4A3L G;  2DYI A;  5FO1 A;  5GV7 A;  2OTL B;  4LFB L;  3VYR A;  3HEJ A;  5C0X I;  4QGU A;  1CA5 A;  3I7F A;  2K50 A;  2KA7 A;  2XNA C;  1RHP A;  4A3M H;  2E1R A;  3ES9 A;  1P8L A;  1AZQ A;  3NK9 A;  1LTA D;  4F87 A;  5C3E G;  3A8K A;  4NXM Q;  4CQJ A;  2K52 A;  4TRD A;  1D7Q A;  3G7L A;  3NPP A;  1FJG Q;  2KEC A;  2NN6 I;  5M5Y B;  3R6J A;  4OPO A;  1TS5 A;  2DNE A;  3MXN B;  3F2D A;  3VDY A;  1OXX K;  3GTP H;  1VLO A;  1UUP A;  2JN4 A;  4GKK L;  2EY6 A;  4JYA Q;  2Q6K A;  1TWG H;  5IYD H;  1Q86 C;  3F2C A;  3PA2 A;  3OIP A;  2JA5 G;  4J1M A;  4NKL A;  2X6Y A;  2IHE A;  4B3R L;  3WYA A;  3QJY A;  2ATW A;  1E1Q A;  3R93 A;  1F2L A;  4JI8 Q;  2R9V A;  2PW5 A;  1E63 A;  3VR6 A;  3A35 A;  4QUZ A;  1UD2 A;  5FLM H;  2F0G A;  1WJJ A;  2LXJ A;  2XN9 C;  4P2C B;  4PMW A;  1PJ6 A;  3S16 B;  4P6V F;  3G4S A;  2FMC A;  1JA1 A;  1G7T A;  2B2U C;  1VQ6 B;  4X7E A;  2EYH A;  4EQ5 A;  2GVA A;  2F0E A;  4H7B A;  4I7Z C;  5FLX L;  4YAL A;  4C0S A;  4P73 A;  2CC2 A;  4PGO A;  4BY7 H;  1EY4 A;  2C77 A;  3TS0 A;  4V19 0;  1GUS A;  1XX8 A;  1CNE A;  4WRD A;  4P9S A;  1VQM A;  4BXX G;  1UAP A;  3HOY G;  2ZZG A;  2KEE A;  1HZE A;  1JJC B;  4PMC A;  4FXU A;  1PRT B;  3E3X A;  5FA6 A;  1EY8 A;  5EQ0 A;  1FR3 A;  2DIE A;  1IYJ B;  1D5X C;  1I50 B;  4QIW E;  3FVQ A;  1XNR L;  5F4O A;  1JIC A;  1RCV D;  3S1M H;  1LT5 D;  4HJ5 A;  3KF6 A;  1K3B C;  2QGG A;  2ID0 A;  4DAY A;  4PMB A;  1K8A C;  1TII D;  1KD1 D;  3AEV A;  3U58 A;  2B2U A;  3G71 B;  4UZU A;  1TT2 A;  2XRS D;  1KC8 C;  2R92 B;  2RCF A;  5HZB A;  4P1V A;  4CKC A;  3RN5 A;  1FGB D;  2I5L X;  2EJM A;  4KHP Q;  4HIM A;  2L0C A;  2BE5 C;  4K0K Q;  2ZBU A;  3I55 B;  1DG1 G;  4HCS A;  1AE2 A;  2NUC A;  4K1X A;  1CSQ A;  5FKA C;  2IT1 A;  1I6H B;  1BX0 A;  4X0C A;  1ICF B;  2MJ8 A;  1ASY A;  1JOR A;  3GTG H;  1QGZ A;  1KC8 D;  4BY7 B;  1PRT D;  4RHR A;  5IYN A;  3GVK A;  5K36 G;  1R5B A;  5I6Y A;  3I4M G;  3ZJY C;  4GQN A;  3ZIA A;  1YNN C;  1IBM Q;  2JA7 B;  2Q2T A;  4A3F G;  4IPG A;  1WTH A;  5M3M H;  1NB9 A;  3MXN A;  3NUC A;  4CBV A;  1XMO Q;  2ZTC A;  1ZYR D;  2I5M X;  4B9W A;  1IBK L;  1T6X A;  1WD1 A;  4OX9 L;  1KK1 A;  5TRD A;  2SEB D;  1TVC A;  4FF2 A;  3CC7 B;  3PO3 G;  3GTO B;  2D9R A;  1I4P A;  4HCE A;  2KED A;  1PYW D;  3OEE A;  1ML0 D;  1I4H A;  2F3I A;  5IGC A;  3AVX A;  5C3E H;  4BA2 I;  3PIO 3;  4B3M Q;  1EEI D;  3PCO B;  4ACB A;  3WY9 A;  3KUP A;  1CK1 A;  3FPP A;  1GJR A;  2VBS A;  3DUZ A;  3C2Q A;  2AHO B;  3G4S B;  3RLF A;  3I4N H;  3FPU B;  2OEO A;  4ALP A;  1L2F A;  5IYD G;  3AVV A;  3OZW A;  5GRO A;  4AYB G;  1PH9 A;  3GTK B;  1AZP A;  2GJK A;  1BKB A;  2Y0S G;  4OX9 Q;  1B9M A;  3C1F A;  2NBF A;  1Q46 A;  4OXP A;  1XMO L;  4OEL B;  2GQF A;  1SLJ A;  3PUX A;  1YJN B;  2BA1 A;  3WDN A;  1S3O A;  4OOV A;  5EAY A;  4MYU A;  4FYD A;  2HHH L;  1LTL A;  1KAW A;  1U4L A;  2RF4 A;  5AJ3 L;  5A35 A;  5C3E B;  4RPB A;  3PVD A;  3ONA B;  1VMC A;  2QA4 B;  3ASS A;  4XNF A;  3W3A A;  1N8R C;  2F0H A;  1GD7 A;  2E5L Q;  2O5I C;  3AMU A;  1FRQ A;  4QV2 A;  2BV3 A;  4RD4 A;  3SJP A;  2GJP A;  2JA8 G;  1IL8 A;  4II3 A;  3HGB A;  5T1G A;  4TMV A;  1R9T B;  1VHE A;  3IFT A;  2HQE A;  4JOI C;  4KHP L;  3GTJ H;  3AST A;  2C2W A;  4UZE A;  3G71 A;  3VR5 A;  4X3T A;  2WSS A;  2PMD A;  3KDF B;  1WVL A;  2HCC A;  1K8A D;  1SYC A;  2Q2H A;  1XPR A;  1IW7 D;  1N34 L;  4DR4 Q;  3BC9 A;  4IQZ A;  1TS4 A;  2VW9 A;  1E2V A;  3BZC A;  3M3Y B;  3LNN A;  1PXU A;  2EYL A;  3CQZ H;  3IL8 A;  4DAV A;  5JEA J;  4A3J H;  4B44 A;  3H09 A;  1GM5 A;  4KJO A;  1EIH A;  1AMO A;  4RWS C;  1O78 A;  4P25 A;  2EY2 A;  3TSS A;  3S15 H;  1PTO H;  4B3G A;  2BMW A;  4JG2 A;  4ROX A;  3Q0A A;  3NQT A;  4RLZ A;  4ZGN B;  3T1Y Q;  3H9N A;  5CV6 A;  3B6Y A;  4HID A;  5C0X H;  3W5O A;  3JC6 6;  4PNY A;  1Z6H A;  2BDN A;  1WSV A;  1CKM A;  2F0W A;  2CND A;  4XL9 A;  1EFT A;  2ZJP A;  5EPJ A;  3RY8 A;  1EY5 A;  2J7K A;  3RN2 A;  4C3I B;  4X64 L;  3HFZ B;  1QUE A;  5IYB G;  1Y0Y A;  4A3F H;  3G6E B;  2HIX A;  1QFY A;  1E0B A;  5M3M G;  3GTJ B;  2N3S A;  3D31 A;  4FXK C;  4LF4 Q;  1YLO A;  4K2L A;  2F0O A;  2UUA Q;  4DV7 Q;  4QQB X;  4KKU A;  3UE1 A;  2IX3 A;  4IN3 A;  4E6I A;  4TMW A;  1CZW A;  2WB1 B;  1LM0 A;  3C1E A;  2KQ3 A;  1RTN A;  2FFK B;  1Y1V G;  2D62 A;  2NZ1 D;  1V8Q A;  5CDF A;  3VO1 A;  2KJX A;  4DR4 L;  1GUO A;  2B39 A;  2LS0 1;  2OQ0 A;  4DV6 Q;  1UMK A;  2RA4 A;  2CF4 A;  4FP5 D;  3DHQ A;  1JWU D;  4OWX B;  2B2W C;  4U67 3;  1N06 A;  1SE4 A;  3CW2 C;  4OL7 A;  1EFW A;  4FK8 A;  1W87 A;  3MHB A;  2B3G A;  1E3X A;  5IE8 A;  1BQQ T;  4PQX A;  1H9S A;  1Y1W B;  2XSC A;  1P4M A;  1EWY A;  1H8H A;  4EH1 A;  1TWH H;  3DWP A;  4DUZ Q;  2NV4 A;  2QDB A;  4OWW B;  1EU4 A;  1PLF A;  3G05 A;  2B63 G;  1YX2 A;  2ZXI A;  4XXE A;  5C4X B;  3VNV A;  4DV5 L;  1HH2 P;  3KDF A;  3QIA A;  1MRZ A;  4APV A;  3I91 A;  4XMY A;  3HOU G;  3PIO A;  4M1K A;  1M90 D;  2GK7 A;  3GTL H;  5IYC H;  2K5V A;  4B3S L;  5GAH C;  2JA8 H;  4ZRZ A;  2ZZF A;  3M4O H;  1ENF A;  4KY7 A;  5CV7 A;  3BJU A;  1F9R A;  1A2T A;  2V7V A;  5CV5 A;  4RDL A;  1BMF A;  3VR2 A;  2F03 A;  3J81 c;  2XZP A;  2IW3 A;  4DA2 A;  4GNX C;  4K8I A;  1LLR D;  1L1O C;  2WZP P;  3SK8 A;  3CCQ B;  1TWF B;  2PIA A;  1RQR A;  2D9U A;  4P71 A;  1QFJ A;  3NBI A;  4WJ4 A;  4A4I A;  1SKQ A;  4B08 A;  1PTO C;  4GNX A;  3D6C A;  4HMI A;  1HA5 A;  1IBL L;  1VQ4 B;  1VQ9 B;  2Y0S E;  4RCO A;  1JMC A;  1K9M C;  4A3C H;  1NRK A;  1L0Y B;  1LTG D;  1WFQ A;  4Y7N H;  3RLO A;  1VQM B;  2ZM6 L;  1KZL A;  4JW0 A;  5I9P A;  3PUY A;  1BDO A;  2L55 A;  5D3I B;  2DER A;  3V96 A;  3CES A;  3CMM A;  4X3K A;  4GKJ Q;  1VQ7 B;  1TVX A;  2NN6 G;  3PUV A;  4DFA A;  1EFC A;  1N32 L;  2AMC B;  4O42 A;  2F0V A;  4HIZ A;  1B7Y B;  5BR8 Q;  5IYW A;  1SNP A;  4H13 C;  1NBM A;  4EQO A;  4DK0 A;  1JJG A;  3CW2 A;  3QG1 A;  4AYB B;  2B2W A;  1VQK A;  4P75 A;  3W2E A;  3AGP A;  2E2I H;  5IYB H;  2QEX B;  3CCS A;  1STH A;  1EXM A;  4B4D A;  4KN4 C;  4N9P A;  1AN8 A;  1EYA A;  3T56 B;  3A7L A;  1IKM A;  1CM9 A;  3CP2 A;  2JIZ A;  2K1B A;  4LUO A;  4C3H H;  5TR9 A;  3OMC A;  4A3D H;  2GRE A;  2KEN A;  4K8J A;  3SDZ A;  4L63 B;  2J0T D;  3J81 L;  1SNM A;  2GJR A;  3NSW A;  2HCJ B;  2JA6 H;  2V31 A;  4WJ3 M;  2HDL A;  4IUU A;  4A3E G;  3H0G B;  1Y1V H;  5G3L F;  3W2H A;  1K73 D;  4JI3 L;  1N33 Q;  2BF4 A;  1CTM A;  2EYJ A;  2DY8 A;  4Q7J B;  1B70 B;  2CWA A;  1HA3 A;  1A2U A;  4H0L C;  4V0B A;  3TBI B;  3I4M B;  3GSI A;  1KRH A;  1QVC A;  3NWS A;  2JA7 G;  3UI2 A;  3UE0 A;  1DAR A;  1ET6 A;  1N8R D;  2JEA I;  4DV0 Q;  2XNJ A;  1W34 A;  4A3K H;  4ABN A;  4KHV A;  4NNJ A;  1GUG A;  3HKZ G;  1EYC A;  2B63 H;  1WOS A;  1FND A;  2OTJ B;  1RL2 A;  4L6T B;  3RNU A;  4F7D A;  4A76 A;  2BM1 A;  4PC6 A;  3K80 C;  1Q82 D;  3W1G A;  4CDF C;  3CMA B;  3ICE A;  1W6J A;  4M1U B;  4BBS G;  4MIU A;  1DJR D;  4DR6 L;  1PTO B;  2F0Q A;  3OWE B;  5CV4 A;  3PF4 A;  1B2T A;  2A73 B;  2PE3 A;  1VQP A;  4KI0 A;  3BY1 A;  2N8N A;  3U4V A;  3HOX G;  1PDQ A;  4YY3 Q;  1RKN A;  5EKI A;  1EZ6 A;  1H85 A;  4JI1 L;  5KSW B;  4LUZ A;  2DN8 A;  4LUV A;  4Z4Z A;  2NYZ D;  1N32 Q;  1Q1E A;  1PFB A;  4YY3 L;  5ELO A;  4KTA A;  2Y0S B;  1VQN A;  1Z7T A;  4GOP B;  1EY0 A;  1CI3 M;  3OHX C;  4M8A A;  4IZ8 A;  3R8B A;  4Z1M A;  3TDQ A;  4X62 Q;  4P26 A;  3SLN A;  3QSY A;  1F2Y A;  1FJG L;  2CCZ A;  1O7I A;  2A19 A;  2QTZ A;  2X69 A;  4JI6 L;  4A3C G;  1NJI D;  2RVL A;  1Y8N B;  5EBC A;  1M1K C;  1QCB D;  2EY1 A;  5L37 A;  4JCV E;  4RCY A;  1JWM D;  4GLA C;  3PEN A;  2WP8 J;  3S14 H;  4C1N I;  1ZUN B;  1LO5 D;  4LFA L;  1PH2 A;  2OTL A;  2GPJ A;  4B3M L;  5EJW A;  1W0K A;  3P75 A;  2ZTD A;  3A5Z B;  2JP1 A;  2A8V A;  1FYC A;  1NE3 A;  4NXN Q;  1EQT A;  3NWT A;  2QW7 A;  3CRL C;  1FNB A;  2KBN A;  4YIJ A;  5HGQ A;  4N9T A;  1MJE A;  1XNQ L;  3I4O A;  2FHT A;  2XWJ B;  5TV2 A;  3A1P A;  4L5Q A;  4CGY B;  5IT9 E;  2FIN B;  2RBM A;  4YHB A;  1HNX L;  4A3B H;  1PJ5 A;  1YNJ D;  4C3H G;  3WNC A;  1YBY A;  3H15 A;  2DEU A;  2B7C A;  3LVB A;  1QNU A;  2L4N A;  1HNZ L;  3CPF A;  4A3D G;  2VJJ A;  4XT1 B;  1QB5 D;  3TZD A;  1KDC A;  4IUV A;  1B44 D;  5CBE E;  4G1B A;  1U2R A;  2VNJ A;  2JA6 G;  3OMG A;  4P2N A;  2EXD A;  1O7Y A;  3S1N H;  3J81 j;  3E5S A;  1NSN S;  1OXU A;  2D0P A;  2NVX B;  3G6E A;  1MGS A;  1JB9 A;  3K5M A;  2QCP X;  1NY4 A;  2ASB A;  2FVG A;  2VNK A;  5IWA L;  5BR8 L;  1YI2 B;  2QGQ A;  2Z6B D;  3BVZ A;  4AIM A;  3BZK A;  4ZYS A;  1STB A;  2ZXP A;  4YWM A;  3DXJ C;  1I8D A;  2JA7 H;  3RZD B;  1HQR D;  1KLG D;  1GR1 A;  4XN3 A;  3ZZT A;  1JJ2 A;  1ILQ A;  4R4Q A;  4G4K A;  3FJO A;  4LFC L;  3NEN A;  1CUK A;  1MAB A;  3Q38 A;  4RD1 A;  2EYO A;  2X53 S;  5C4J H;  1X3E A;  4G6I A;  4DV1 L;  4A3B B;  2D2C C;  3JQP A;  4RPD A;  1MKH A;  4ZGQ B;  5KYL A;  4M2L A;  4DV3 L;  1OGJ A;  3JU4 A;  3KBG A;  2F0L A;  4XLA A;  1UE5 A;  1U4P A;  2K5D A;  4WWV A;  1NNX A;  4L5T A;  5BN4 A;  3I8Z A;  3IFD A;  2VB2 X;  4XKW A;  2VUM G;  1EIG A;  4GLV B;  2XEX A;  1HTL D;  2MGS A;  3RZD H;  3LQE A;  2XGJ A;  3DWA A;  2C5B A;  4OHJ A;  1WTW A;  4Y9U A;  3JAM L;  4DR3 Q;  3I70 A;  3SK5 A;  4HN7 A;  2UXD Q;  2JE6 I;  2L15 A;  3ERQ A;  5KNB A;  5E4X A;  1CKO A;  2K04 A;  2PYK A;  1Q81 D;  2WAQ G;  2QDX A;  4YAF A;  3OKX A;  1LT4 D;  2D3N A;  4ASU A;  5C44 H;  4DR5 Q;  1CA6 A;  3HKZ E;  3QWN A;  1I18 A;  5LMU L;  1L0W A;  2HT1 A;  1JC7 A;  2YTY A;  1KIX A;  4Z4U A;  5M9O A;  1PHJ A;  3A8I A;  1JE5 A;  3SHL A;  4AQY L;  1VDZ A;  1JQY D;  2BM0 A;  4HED A;  4HE6 A;  4LJZ C;  3BYY B;  1S40 A;  2YTV A;  2CK3 A;  2ZZQ A;  1VQF A;  1TWG B;  3OEH A;  3S16 H;  4IFD G;  4CDC C;  3K8A A;  3BH4 A;  4L5R C;  4RD0 A;  4RGN A;  2TSS A;  4EVO A;  3D8G A;  4MHE A;  4KD3 A;  5J39 A;  1W9X A;  3GTG B;  2AQ2 B;  3ERO A;  2EVB A;  5C4H A;  5M5W H;  1SNQ A;  5COR A;  1I4R A;  3Q23 A;  1SYD A;  2F52 A;  1U4M A;  5AJ3 Q;  4RD6 A;  3A7A B;  3BYT B;  3QFR A;  3EQL C;  4A3E B;  3DEO A;  4KD4 A;  1EZ8 A;  2JDI A;  2CRV A;  2YWH A;  2E2J B;  1YJW B;  2CFM A;  4A3I G;  2ZXH A;  2CH4 W;  4FVM A;  4AF6 A;  1TU2 B;  2B2T A;  2NVY H;  3FP9 A;  3I73 A;  2KCT A;  4AVZ A;  3KK7 A;  4ME3 A;  4JV5 Q;  2UXB Q;  2QKI C;  4KK7 A;  2OWO A;  1QVF A;  1PV4 A;  3W2D A;  2JJ1 A;  3GTK H;  2B29 A;  3HAG A;  3S1M B;  4YEL A;  3R3O A;  3J81 k;  3B8H A;  2V7Q A;  1V1P A;  4DXF A;  4E0F A;  1STA A;  1V0E A;  2D5D A;  1J6Q A;  5A2Q E;  1JR0 D;  3T4A C;  4M0L A;  1VQ5 B;  1CFM A;  4YCW A;  3T1Y L;  2R92 H;  3MC0 B;  3PO2 G;  1RIP A;  1H9R A;  1KQS B;  1S72 A;  3DWQ A;  1TKW B;  2WKC A;  3Q8D A;  3E0J A;  4XDX A;  4C2M H;  2PNR C;  1HTP A;  3I4L A;  4IJH A;  1NR2 A;  4JI0 Q;  3A8J A;  2VBV A;  3MXG A;  4C3I H;  4KKT A;  1KJZ A;  3DM3 A;  1AEX A;  3S1Q B;  3SGI A;  5KIX A;  2HUG A;  4WJW A;  1B2R A;  1D2B A;  2Q6L A;  4FF4 A;  4QHY A;  1W6K A;  1IHM A;  1T6Z A;  2VNH A;  3HOV B;  3U50 C;  1Q8I A;  2BN4 A;  1X54 A;  4IJL A;  1E22 A;  2B2V A;  3J7Z C;  2DJG C;  4F88 A;  5DSZ A;  4YHH L;  1B3Q A;  3GTM B;  1FNV A;  3ASR A;  4QUC A;  1VQO A;  3M3Y H;  2OK7 A;  3AVU A;  5E7N A;  2PQA B;  1ZKO A;  3CHB D;  4X6A H;  5G3L D;  4ODG A;  4PC7 A;  3D3R A;  3STB C;  3R2I A;  4QMG A;  4Z9C B;  5EKL A;  4OO1 H;  4Z4V A;  1EY9 A;  2A1A A;  3ASP A;  4R8I A;  3K59 A;  3PV0 A;  4B9X A;  2QIL A;  1HXY D;  5IOC A;  1PH1 A;  3S1Q H;  2BSA A;  1F2Z A;  2HHH Q;  1H9J A;  2K05 A;  1JT8 A;  3BY2 A;  2W6J A;  4C1N K;  1PH3 A;  4Z4R A;  4KY5 A;  4Z4T A;  2G5D A;  1SRU A;  3HG9 A;  1H9K A;  1VQ7 A;  2B2T C;  3M4O B;  2RCN A;  2A68 C;  4XYQ A;  4IUQ A;  3HOY B;  2M00 A;  3OOC A;  2ZJR A;  4YAW A;  4R1J A;  4JI0 L;  1HR0 W;  1GUT A;  4UY8 C;  2CVR A;  2IX1 A;  1R5O A;  4DQK A;  4YXW A;  1VQP B;  3J7A 5;  1NDH A;  2EIF A;  3V76 A;  2GK6 A;  1Q86 D;  2B8F A;  2JYO A;  3M4Y A;  1DOK A;  4Z4Y A;  1ENC A;  1K8M A;  2E1B A;  4OEM B;  5BN5 A;  2P3M A;  4DR2 L;  5NUC A;  3OTO Q;  4OP7 A;  3U6B A;  1TWC H;  1VQB A;  3KEW A;  1TWF H;  2EYP A;  4A3F B;  1N08 A;  3BVG A;  3ZYY X;  1G6P A;  1Q81 C;  2WJY A;  2WAQ E;  4KY6 A;  4RGT A;  3HOZ H;  2A6H C;  1ROD A;  4JBM A;  4C3J H;  2UUC Q;  3W5U A;  1ZYR C;  1VQA A;  4LF6 Q;  1SR3 A;  3MCA A;  3JAM E;  5GAD C;  3U9O A;  5IYR A;  1R9T H;  5JPM C;  1J5E L;  2YWG A;  2C4U A;  1N36 Q;  4BBR G;  4CDE C;  2LKV A;  5A88 A;  4GKK Q;  4JYA L;  1II3 A;  4H44 C;  2C35 B;  2F0J A;  4K2K A;  4WZE A;  4QIW B;  5LMU Q;  2R92 G;  3A3B A;  2A6E D;  4UDU C;  3PO2 H;  4X66 L;  1UD5 A;  3W5V A;  2PQE A;  3TN2 A;  1GKH A;  3RD4 A;  2PI2 E;  3OIQ A;  5TY0 A;  5FJ8 H;  2OTJ A;  2BGI A;  1I6V C;  2IL8 A;  4A3M B;  1QGA A;  5CC4 A;  1RDP D;  4C3J B;  2OQK A;  2JA8 B;  5IYQ A;  4X3S A;  1KD1 C;  4JPB W;  3D4D A;  1KDA A;  2CWP A;  4B3T L;  1C0A A;  3QOJ A;  4NW2 A;  4G1V A;  2Q8I B;  2PPB C;  4J0Q A;  1J9Z A;  1YZ6 A;  1WD0 A;  3R2T A;  2SNS A;  2JEB I;  5J3O A;  5IGG A;  3TZU A;  3L9A X;  2OT2 A;  1UD3 A;  1IXR A;  4KJN A;  2NVT B;  3BVM A;  3PO2 B;  1MI2 A;  1QFZ A;  4AYB E;  4IPH A;  2UUC L;  4OO1 G;  1E2Z A;  4JBK A;  4QF4 A;  4C43 A;  1ZXT A;  1IW7 C;  1R5N A;  1LAB A;  1WTX A;  3P7J A;  3MXP A;  4TQU S;  1CQF A;  4WZL A;  4ZLT F;  3NE5 B;  2MQH A;  3I1F A;  1Z9F A;  4FF1 A;  2EOT A;  4GKJ L;  4IUP A;  2K5Q A;  4DV3 Q;  1FX0 A;  1QG7 A;  3D26 A;  3KF8 B;  4X7C A;  4ID6 A;  4A3I B;  3KLS A;  2KHJ A;  3OYY A;  4RFB A;  1GUW A;  3WND A;  1ENA A;  4DV4 L;  2EXZ A;  1CT1 D;  4A3G G;  1EP1 B;  1FGU A;  2V7U A;  2F1M A;  3TP7 A;  4F8M A;  1ILP A;  4TSF A;  3EN2 A;  5FOB B;  1R4Q B;  1JB7 A;  1TS2 A;  1CHP D;  1A8P A;  3W5H A;  2AKW B;  4KMU C;  3J7Y W;  2NVQ H;  2X6G A;  4TMZ A;  2EYF A;  3H94 A;  4XR6 A;  1T6Y A;  2YYZ A;  2K5H A;  5KYI A;  1TY2 A;  3I72 A;  4FDB A;  4A3L H;  3TRZ A;  3MHP A;  3W2F A;  1SMY C;  4RM0 A;  4Y7C A;  3FHW A;  5JVG 3;  3OW2 A;  1AH9 A;  1JOQ A;  3Q24 A;  1KTV A;  4G7H C;  1HZC A;  4A3M G;  3HOZ G;  4XQQ A;  2JXM B;  2ZTN A;  1DM0 B;  5IT9 c;  3FMC A;  3CCL A;  3CD6 B;  1DGS A;  2LMC B;  5IYP A;  3IKJ A;  1WDT A;  1KRS A;  3PUW A;  1B23 P;  4RGO S;  3GTL B;  2EJF C;  4HSV A;  3VYT A;  4H02 A;  2AWN A;  1X3F A;  3ULL A;  3MWY W;  3UDI A;  1ZEQ X;  1X6O A;  2CW0 D;  4NXN L;  4X7F A;  5DM6 3;  3PF5 A;  1FNU A;  1VF7 A;  1HNZ Q;  4CKB A;  1XMQ L;  1GVP A;  2UXC Q;  1W0J A;  1GO2 A;  4P6Y A;  3EBE A;  3TRE A;  1SM4 A;  3GTP B;  2VY3 A;  4Y7N B;  2YU9 B;  2YTX A;  3BDL A;  2ZL7 A;  1UNS A;  3W1B A;  3PMF A;  4WOR A;  3E9H A;  3LO8 A;  5FLM G;  2I1L A;  4KHZ A;  1AE3 A;  1BLI A;  4G57 A;  1I4X A;  5IP9 H;  1XPO A;  4JI6 Q;  3FKI H;  4X66 Q;  1HUM A;  3J7A F;  4X62 L;  1J8I A;  2F43 A;  4GOP A;  1SYG A;  5BN3 A;  1HFN A;  3FRP B;  2X6X A;  1G7R A;  4DR7 Q;  3OFN A;  1FVI A;  5J35 A;  3M4Q A;  2EZV A;  1YJ9 A;  2NZO A;  3KF6 B;  1N36 L;  2OYN A;  2V1C C;  2BE5 D;  2E2I B;  4DAY B;  4N3N A;  1KLU D;  4BBR B;  4DV7 L;  4BXX H;  1WOC A;  1CKN B;  1NBW A;  1E7Z A;  2EYM A;  5JJK A;  5EPK A;  1IKL A;  3J80 L;  5F4M A;  1RTO A;  4FO2 A;  3LWE A;  1B1Z A;  5HUR A;  5T1I A;  1JE4 A;  4PV1 C;  4A93 B;  4UPA A;  5JEA G;  3CME A;  3M4P A;  3PUN A;  3NQI A;  3A54 A;  4ZAI A;  1VCI A;  1ICW A;  4Y52 H;  1SJE D;  1LTS D;  1A3U A;  1L1O B;  3GIR A;  3U2Q A;  1G51 A;  1NCV A;  4MN3 A;  4JI2 L;  4B47 A;  1ESR A;  3QR8 A;  2XZO A;  2A74 C;  2Q6O A;  3DMU A;  5EBD A;  4DAM A;  1SXT A;  1UE1 A;  5HZA A;  1ZM2 A;  5JJZ A;  4DV0 L;  1QUQ A;  3CCM A;  5IP7 G;  1S0U A;  3GTQ H;  1O7Z A;  4EQN A;  1QG0 A;  2ZL5 A;  1M1K D;  2VL6 A;  2UU9 L;  4MZ9 A;  4HIO A;  3OW2 B;  4RD2 A;  5JVH 3;  4A3K B;  1KAA A;  2G9D A;  4CJ1 B;  4A3G H;  2PLF A;  2MP1 A;  2VZA A;  4JC0 A;  2V4D A;  1S5B D;  4IUR A;  4NPS A;  4HJA A;  3HOW B;  3I4M H;  4JI5 L;  2K6A A;  1KL9 A;  1T5X D;  3CCE A;  2K5N A;  1EY7 A;  3KLS X;  3JQQ A;  4XN0 A;  2UXC L;  4JMQ A;  2N88 A;  4RH6 A;  1WSR A;  2IX0 A;  1EL0 A;  1BQE A;  1YI2 A;  2ZZE A;  5IGE A;  2F0M A;  1UE7 A;  2PZU A;  5D65 A;  5H5J A;  1Q7Y D;  3PO3 H;  2R7D A;  4YWK A;  2JSO A;  2KCN A;  4C56 C;  1KRT A;  3X3N A;  1WYD A;  2NVX H;  2HLD A;  1Q7Y C;  4RDK A;  2A69 D;  3AB9 A;  1LTB D;  3NEM A;  4JI2 Q;  3OPO A;  3I4N G;  4G5G A;  1YJN A;  2XZL A;  2H1E A;  1WCM B;  1XTD A;  2CKZ B;  4OOS A;  3GTQ B;  2GN5 A;  2E2H B;  1WI5 A;  4LMQ D;  2EPB A; 
#chains in the Genus database with same CATH homology
 4HR7 B;  3P1H A;  3FDT A;  1JWS D;  4XLH A;  2F0N A;  1LTI D;  1J9O A;  3KLR A;  2F3W A;  2WKD A;  3NBH A;  2LFN A;  4K6D A;  4X3U A;  2NVY B;  4FXD A;  1DZ1 A;  5LL6 S;  1X3Q A;  1PKV A;  3GV6 A;  2XND A;  2ZT9 C;  2KCC A;  3MFG A;  4OIK A;  3BZD B;  3S17 B;  5DEH A;  4R8N A;  2CHB D;  5IT9 L;  5JEA H;  2E75 C;  1XTC D;  2NVQ B;  2M9V A;  4Q5V A;  3J80 E;  3VA7 A;  3MA2 B;  3H6M A;  2Q8R E;  4ILW A;  1STN A;  4K5X A;  1HVX A;  3FEW X;  1DYQ A;  3OWF A;  1PZI D;  3TP6 A;  2F4I A;  1JCK B;  2OF1 A;  4K14 A;  5C0X G;  2E74 C;  2F0K A;  2RDF A;  3S9W A;  1O7L A;  5CGK A;  2CW0 C;  2KHS A;  2TMP A;  2X85 A;  2F0U A;  1EWC A;  1LT3 D;  2A5H A;  2KUM A;  4TKO B;  3DM1 A;  5C5L A;  4RKB A;  1H9M A;  5IGD A;  3A56 A;  1YNN D;  3E6Z X;  2X6W A;  4K5V A;  3Q22 A;  5FO9 B;  3IAY A;  4XOP A;  5ELD A;  5E1F A;  2Z1C A;  3MFY A;  1F77 A;  5IIF A;  1BCP B;  1BO0 A;  2PCF B;  1EU3 A;  5M5X B;  4XQN A;  1D6E C;  1TQO A;  4RCN A;  1G91 A;  1WTP A;  4G7X A;  2F0F A;  4RAU C;  3SK6 A;  5C3W A;  4A3D B;  1FNW A;  3EFX D;  3QB3 A;  4O1N A;  2HDM A;  3K58 A;  3C3L A;  1LTT D;  3H3V C;  2VJI A;  3A55 A;  3WOE A;  3GO5 A;  4TT3 A;  2VXW A;  3T13 A;  2FMM A;  1NR4 A;  1B4O A;  4XYO A;  1S5E D;  2CQA A;  2ZXR A;  5I4D A;  3CRK C;  5I2X A;  5JPN C;  5HGT A;  3N6R A;  4HAE A;  5CBA E;  3C2P A;  1I4G A;  5HKK A;  2ZXO A;  1C8C A;  2X6L A;  1SDF A;  2Z8L A;  3GVJ A;  2K03 A;  5KNC A;  1DOL A;  3SXH A;  4ME5 A;  2EY5 A;  3S1R B;  2NWG A;  5C3X A;  1KAB A;  5K36 H;  1S4Z A;  5J1Z A;  2X8K A;  1PZK D;  1UD8 A;  2NTT A;  3F2U A;  1HFG A;  1SNC A;  4C2M B;  3P20 A;  5J22 A;  1DON A;  1M4V A;  1BR9 A;  2QEJ C;  2G9H D;  2I07 B;  2L11 A;  2F0S A;  3K7A B;  1TY0 A;  1UD6 A;  5I9O A;  5D14 A;  1M8A A;  4BY1 B;  3LWU A;  2KOL A;  2QF7 A;  2R93 B;  1VMP A;  1K8O A;  1H8E A;  5ELE A;  1BNZ A;  1L0X B;  1ESF A;  3HOU B;  4FXG C;  3K5O A;  5EPL A;  1OXV A;  3K57 A;  1EFR A;  2B63 B;  4CJ0 B;  1RJT A;  4DAP A;  3DEP A;  3BCD A;  1F9P A;  1QOH A;  1JB3 A;  2XWB B;  1EQV A;  3O13 A;  1XYI A;  2C9O A;  1K83 B;  1JOK A;  3GV3 A;  3SVM A;  3SEB A;  1GXD C;  5DAU A;  2Z4I A;  1I3Q B;  2AUK A;  1E3Z A;  2AWO A;  4DF7 A;  4CJ2 C;  1Y1V B;  1WPC A;  4XLE A;  2RSO A;  1DXM A;  2F0P A;  4K5W A;  3L3O C;  4QUF A;  2RKS A;  1V43 A;  2K01 A;  5CV8 A;  1SBB B;  5IK2 A;  3A3G A;  2IPK D;  2ZTG A;  4IAL A;  1K28 D;  3A8I E;  3GVL A;  1WTQ A;  2QE7 A;  2RDG A;  3G6J B;  1GOZ A;  5C6A A;  5EGT A;  2IJ0 A;  3MVV A;  3U9S A;  2WIN B;  1STG A;  5CMD A;  1PTO F;  5D3D A;  3I90 A;  3CP8 A;  1SND A;  4J6H A;  3RZO B;  4LK1 C;  3C46 A;  1BCP C;  4FF3 A;  1Q3L A;  1E79 A;  1S5D D;  3FKS A;  2MHV A;  5F2D A;  3EVQ A;  3S1N B;  2J7Z A;  5M3F B;  2M2L A;  3D6W A;  1TWH B;  5A2Q L;  4GZY C;  2ICI A;  4WFN 3;  5I6W A;  1COW A;  2K28 A;  1WTR A;  2F0I A;  2ICE C;  1TWC B;  2ENB A;  3I3C A;  1G6Z A;  4XD7 A;  4EQP A;  1OHH A;  2BA0 A;  1AW7 A;  1E2W A;  3N52 A;  2RSN A;  4XKV A;  1B3A A;  1H9S B;  1Y69 U;  3ND9 A;  5KRU A;  4QB4 A;  2AQ3 B;  1WTV A;  3A8K E;  1TWA B;  3MEH A;  2K7V A;  2F3V A;  2SNM A;  2AUJ D;  2B2Y A;  3EJI A;  3OE7 A;  1PZJ D;  1E43 A;  5C5M A;  1MSH A;  1AFP A;  3J7A V;  2L1B A;  4NDX A;  4A3G B;  4NMZ A;  1Y8O B;  3SR1 A;  2NN6 H;  3MZ5 A;  5E4W C;  1XXG A;  4J8Q A;  2XRQ D;  4XM3 A;  1WP6 A;  5KEE A;  5FO8 B;  2W6I A;  2DNC A;  2Z4H A;  4C3H B;  3CKI B;  3HS0 C;  4IUT A;  1D1K A;  3TME A;  3H91 A;  3PUZ A;  3GD7 A;  3K6O A;  3VR3 A;  4ZUJ A;  1YNJ C;  1QWY A;  4OO1 I;  1Q1B A;  5M5W B;  2LY7 A;  4NP5 A;  4RA8 A;  2WAQ B;  1QIL A;  1B9N A;  3MAQ A;  5AFW A;  2DY7 A;  5KND A;  4ZKC B;  4K6L A;  4JK1 C;  2R6G A;  1WTO A;  3BS1 A;  1OO9 B;  4DU9 A;  2PMZ B;  1D5Z C;  3MXU A;  4G7W A;  2IWH A;  1KDB A;  4BS9 A;  1STE A;  4C3I G;  5C44 B;  3L7Z C;  1EWH A;  5M3M B;  3BDO A;  4YEJ A;  5DNF A;  1HRJ A;  1PFM A;  1BCP D;  4HMJ A;  4BWG B;  2OXP A;  5CR3 A;  1MSG A;  3D4R A;  5CYU A;  2HCI A;  1HPC A;  3I4N B;  1D5M C;  2WAC A;  3NXW A;  3NP8 A;  2A68 D;  1U4R A;  4FNF A;  1QJO A;  3EA6 A;  3VR4 A;  3OAA A;  2O2L D;  3NHH A;  1ONL A;  2N55 A;  2PZT A;  1LT6 D;  2MUY A;  3ITP A;  4B3F X;  3HZX A;  2WJV A;  2F0D A;  5EKK A;  1X32 A;  1B53 A;  1LTR D;  2B8G A;  2SDF A;  4XOR A;  1F2M A;  1EY6 A;  2MPM A;  1V1O A;  1SJH D;  3QO2 A;  1IHZ A;  4Q0F A;  5ELC A;  4UAI A;  1SYF A;  1FD7 D;  2SOB A;  5JOB A;  3VYS A;  3PIP 3;  1A3T A;  1HCZ A;  4A3J B;  1EFI D;  2B2V C;  2NTS A;  3K0Y A;  3T16 A;  1STY A;  1MBY A;  1SEB D;  3ND8 A;  5E3F A;  1D1I A;  3S15 B;  1PMR A;  4XON A;  4XQF A;  1XWE A;  2L9H A;  4HSP A;  3BG3 A;  1I4Q A;  5DN6 A;  4DXG A;  1BBX C;  3X3M A;  1G8Z D;  1UD4 A;  5ELF A;  1NAP A;  4P22 A;  1SE2 A;  4DNT B;  5LL6 X;  5FO7 B;  1IYV A;  2A6E C;  1V0F A;  1PTO D;  1KNE A;  1HHV A;  2K32 A;  1HA6 A;  5C4Z A;  4G7Z C;  2J4X A;  2H4O A;  1OB0 A;  3KF8 A;  4F7X A;  3NTK A;  4KV6 A;  2RQX A;  1ET9 A;  1CHQ D;  1UEA B;  4II2 A;  2JJ2 A;  3FKI B;  3QOL A;  1DCZ A;  2RDH A;  1O80 A;  4I65 A;  2KVO A;  3V05 A;  1CQV A;  1Q12 A;  4EGV A;  5COY A;  3K5L A;  1X3P A;  4KKS A;  1NUC A;  2PO4 A;  2R3Z A;  3SE0 A;  3WQZ A;  3V2T A;  2E76 C;  5TSS A;  4IFD H;  2JA5 B;  1MD2 D;  1Q90 A;  2A6H D;  3VA5 A;  1EYD A;  2I46 A;  1A3V A;  4S3S A;  5FLX E;  3HOX B;  2BDO A;  1SYB A;  2A69 C;  1C48 A;  1T5E A;  4HTH A;  1RF2 D;  1F9Q A;  5ISR A;  3DDY A;  2O4X A;  5I2Y A;  4KN7 C;  1QNK A;  1BXT A;  1LAC A;  4ZUI A;  3NTI A;  4IUN A;  4IFD J;  3CQZ B;  1SKY B;  3HRZ C;  4XTC S;  2XVS A;  5KNL A;  4XIG S;  1DOM A;  1PRT C;  3A8J E;  4ZK9 B;  1Z47 A;  2XOK A;  1C4Q A;  4BBS B;  4XQJ A;  1E1R A;  2Q8T A;  2EE1 A;  3WOF A;  1V1P B;  1RD9 D;  1PFN A;  4G7O C;  3HKZ B;  1PRT F;  5FK9 C;  1DD2 A;  1BOS A;  4XLF A;  3TP5 A;  3M7N A;  2BOS A;  1F9S A;  4XT3 B;  1B50 A;  2E2D C;  5FL7 A;  1S5F D;  2GA4 B;  4RHS A;  1S5C D;  4BA1 I;  1G2S A;  2NB0 A;  3OSO A;  2L5T A;  4DNR B;  5CV9 A;  2C5C A;  3BCF A;  1HUN A;  1SSO A;  3TP8 A;  2AQ1 B;  5C0X J;  2F0T A;  1KNA A;  3M7G A;  3M85 A;  3ZPN A;  5IOD A;  4DN4 M;  4R9W A;  1BPL A;  3LX0 A;  1G29 1;  4LAA A;  1HQM C;  2R61 A;  1BCP F;  1VLY A;  2LZJ A;  1A6X A;  1U9R A;  2VNU D;  3D4W A;  3HOZ B;  5KGU A;  1GJX A;  4TSS A;  1SNO A;  2WII B;  1AP0 A;  2XIW A;  5IGF A;  4C3J G;  5C4J B;  3S14 B;  1GHJ A;  1BUV T;  4OIJ A;  3GP7 A;  4DK1 A;  3RMH A;  5JAV A;  1SMY D;  2M5S A;  2JA6 B;  5IGB A;  3CU7 A;  2VUM B;  2D3L A;  4CKE A;  3HP3 A;  5ELB A;  3URY A;  4ZKB B;  1SYE A;  2L12 A;  3Q6S A;  4ZQ3 A;  2K5W A;  1SAP A;  1KMH A;  1LV9 A;  2PZW A;  1SE3 A;  4RGM A;  3K5N A;  3AU7 A;  2EDG A;  1KTK A;  3OW7 A;  4IFD I;  1VF5 C;  4DGZ A;  4QCL A;  4XOT A;  2EJG C;  1TS3 A;  1QE6 A;  2PW7 A;  4OGQ C;  3T51 B;  1EOT A;  1CZG A;  3SK4 A;  3S2H B;  1JOO A;  3T53 B;  1OXT A;  3KBX A;  1SFO B;  4L8J A;  3GQB A;  1BF4 A;  2FJ2 A;  4JBW A;  2WPD A;  1GHK A;  2B2Y C;  2K33 A;  2VB3 X;  4U68 A;  1VJS A;  1OXS C;  3VYU A;  3PO3 B;  1IYU A;  3S2D B;  2KVM A;  1GUN A;  2BCO A;  2O5J C;  4RKL A;  3J81 E;  1A15 A;  2R7Z B;  1G2T A;  5DM7 3;  1EEF D;  3BDC A;  5LHY 1;  1TR5 A;  5K5P A;  4ULL A;  3NTH A;  2WV6 D;  1Y8P B;  4CHT B;  1R4P B;  3RUZ A;  3MTS A;  4XLC A;  1WTH D;  3VYR A;  3HEJ A;  5C0X I;  1CA5 A;  2KA7 A;  2XNA C;  1RHP A;  1AZQ A;  3NK9 A;  1LTA D;  4F87 A;  4TRD A;  3G7L A;  3NPP A;  2KEC A;  2NN6 I;  5M5Y B;  1TS5 A;  2DNE A;  1OXX K;  1UUP A;  2EY6 A;  3OIP A;  4J1M A;  4NKL A;  2X6Y A;  3QJY A;  1E1Q A;  3R93 A;  1F2L A;  2R9V A;  2PW5 A;  3VR6 A;  3A35 A;  1UD2 A;  2F0G A;  2XN9 C;  4P2C B;  4PMW A;  3S16 B;  2FMC A;  2B2U C;  2EYH A;  4I7Z C;  2F0E A;  4H7B A;  5FLX L;  1EY4 A;  4V19 0;  1GUS A;  1XX8 A;  4WRD A;  1UAP A;  2ZZG A;  2KEE A;  1HZE A;  4PMC A;  4FXU A;  1PRT B;  1EY8 A;  5EQ0 A;  1FR3 A;  2DIE A;  1D5X C;  1I50 B;  3FVQ A;  1JIC A;  1RCV D;  1LT5 D;  2ID0 A;  4DAY A;  4PMB A;  1TII D;  2B2U A;  4UZU A;  1TT2 A;  2XRS D;  2R92 B;  4CKC A;  1FGB D;  2EJM A;  2L0C A;  2BE5 C;  4HCS A;  2NUC A;  5FKA C;  2IT1 A;  1I6H B;  2MJ8 A;  1JOR A;  4BY7 B;  1PRT D;  4RHR A;  3GVK A;  5K36 G;  5I6Y A;  4GQN A;  3ZIA A;  1YNN C;  2JA7 B;  3MXN A;  3NUC A;  4CBV A;  1ZYR D;  4B9W A;  1WD1 A;  2SEB D;  4FF2 A;  3GTO B;  1I4P A;  4HCE A;  2KED A;  3OEE A;  1ML0 D;  1PYW D;  1I4H A;  5IGC A;  4BA2 I;  3PIO 3;  1EEI D;  3KUP A;  1CK1 A;  3FPP A;  3DUZ A;  3RLF A;  3FPU B;  2OEO A;  3GTK B;  1AZP A;  2GJK A;  1B9M A;  3C1F A;  2NBF A;  3PUX A;  2BA1 A;  3WDN A;  4FYD A;  1U4L A;  5A35 A;  5C3E B;  3ONA B;  1VMC A;  4XNF A;  3W3A A;  2F0H A;  2O5I C;  3AMU A;  2GJP A;  1IL8 A;  4II3 A;  3HGB A;  5T1G A;  1R9T B;  3IFT A;  2HQE A;  3VR5 A;  4X3T A;  2WSS A;  1WVL A;  2HCC A;  1SYC A;  1IW7 D;  3BC9 A;  4IQZ A;  1TS4 A;  1E2V A;  3M3Y B;  3LNN A;  1PXU A;  2EYL A;  3IL8 A;  4DAV A;  5JEA J;  3H09 A;  4KJO A;  1EIH A;  4RWS C;  1O78 A;  2EY2 A;  3TSS A;  1PTO H;  4B3G A;  3Q0A A;  3NQT A;  5CV6 A;  5C0X H;  4PNY A;  1Z6H A;  2BDN A;  2F0W A;  4XL9 A;  5EPJ A;  1EY5 A;  4C3I B;  1E0B A;  3GTJ B;  3D31 A;  4FXK C;  4K2L A;  2F0O A;  4KKU A;  2IX3 A;  4IN3 A;  4E6I A;  1CZW A;  2WB1 B;  3C1E A;  2KQ3 A;  1RTN A;  2FFK B;  2NZ1 D;  2D62 A;  1V8Q A;  5CDF A;  2KJX A;  1GUO A;  2B39 A;  2LS0 1;  2RA4 A;  4FP5 D;  3DHQ A;  1JWU D;  2B2W C;  4U67 3;  4OL7 A;  1SE4 A;  3MHB A;  1E3X A;  1BQQ T;  4PQX A;  1H9S A;  1Y1W B;  2XSC A;  1H8H A;  3DWP A;  2QDB A;  1EU4 A;  1PLF A;  3G05 A;  2ZXI A;  4XXE A;  5C4X B;  3QIA A;  3I91 A;  4XMY A;  2GK7 A;  4ZRZ A;  2ZZF A;  1ENF A;  4KY7 A;  5CV7 A;  1F9R A;  1A2T A;  5CV5 A;  1BMF A;  3VR2 A;  2F03 A;  2XZP A;  2IW3 A;  4DA2 A;  4K8I A;  1LLR D;  2WZP P;  3SK8 A;  1TWF B;  2D9U A;  3NBI A;  4B08 A;  1PTO C;  3D6C A;  4HMI A;  1HA5 A;  4RCO A;  1NRK A;  1L0Y B;  1LTG D;  1KZL A;  5I9P A;  3PUY A;  1BDO A;  2L55 A;  5D3I B;  3V96 A;  3CES A;  3CMM A;  4X3K A;  1TVX A;  2NN6 G;  3PUV A;  4DFA A;  4O42 A;  2F0V A;  4HIZ A;  1SNP A;  4H13 C;  1NBM A;  4EQO A;  4DK0 A;  3QG1 A;  4AYB B;  2B2W A;  1STH A;  4KN4 C;  4N9P A;  1AN8 A;  1EYA A;  3T56 B;  3A7L A;  1IKM A;  1CM9 A;  3CP2 A;  2JIZ A;  2K1B A;  3OMC A;  4K8J A;  3SDZ A;  4L63 B;  2J0T D;  3J81 L;  1SNM A;  2GJR A;  3NSW A;  2V31 A;  2HDL A;  3H0G B;  5G3L F;  1CTM A;  2EYJ A;  2DY8 A;  4V0B A;  4H0L C;  1A2U A;  3TBI B;  3I4M B;  3NWS A;  3UI2 A;  1ET6 A;  2JEA I;  4ABN A;  4KHV A;  4NNJ A;  1GUG A;  1EYC A;  4L6T B;  1W6J A;  4M1U B;  4MIU A;  1DJR D;  1PTO B;  2F0Q A;  3OWE B;  5CV4 A;  1B2T A;  2A73 B;  4KI0 A;  1PDQ A;  1RKN A;  5EKI A;  1EZ6 A;  2DN8 A;  2NYZ D;  1Q1E A;  1PFB A;  4KTA A;  2Y0S B;  1Z7T A;  1EY0 A;  4M8A A;  3OHX C;  1CI3 M;  4IZ8 A;  3R8B A;  4Z1M A;  3TDQ A;  1F2Y A;  2X69 A;  2RVL A;  1Y8N B;  5EBC A;  1QCB D;  2EY1 A;  1JWM D;  2WP8 J;  4C1N I;  1LO5 D;  5EJW A;  1W0K A;  3P75 A;  2JP1 A;  1FYC A;  1EQT A;  3NWT A;  3CRL C;  4YIJ A;  4N9T A;  2FHT A;  2XWJ B;  4CGY B;  5IT9 E;  2FIN B;  2RBM A;  1YNJ D;  4C3H G;  2L4N A;  1QNU A;  4XT1 B;  2VJJ A;  1QB5 D;  3TZD A;  1KDC A;  4IUV A;  1B44 D;  5CBE E;  3OMG A;  1O7Y A;  3E5S A;  1NSN S;  1OXU A;  2NVX B;  1MGS A;  3K5M A;  2QCP X;  3BVZ A;  2Z6B D;  4ZYS A;  1STB A;  2ZXP A;  3DXJ C;  1I8D A;  3RZD B;  1HQR D;  1KLG D;  4XN3 A;  1ILQ A;  4G4K A;  1MAB A;  2EYO A;  2X53 S;  4G6I A;  4A3B B;  2D2C C;  5KYL A;  3JU4 A;  3KBG A;  2F0L A;  4XLA A;  1U4P A;  2K5D A;  5BN4 A;  3I8Z A;  3IFD A;  2VB2 X;  4XKW A;  1EIG A;  1HTL D;  2MGS A;  2XGJ A;  3DWA A;  4OHJ A;  1WTW A;  3JAM L;  3I70 A;  3SK5 A;  4HN7 A;  2JE6 I;  3ERQ A;  5KNB A;  5E4X A;  2K04 A;  2PYK A;  1LT4 D;  2D3N A;  4ASU A;  1CA6 A;  3QWN A;  1I18 A;  1JC7 A;  5M9O A;  3SHL A;  1VDZ A;  1JQY D;  4HED A;  4LJZ C;  3BYY B;  2CK3 A;  2ZZQ A;  1TWG B;  3OEH A;  4IFD G;  3BH4 A;  4RGN A;  2TSS A;  4EVO A;  3D8G A;  4MHE A;  4KD3 A;  5J39 A;  1W9X A;  3GTG B;  2AQ2 B;  3ERO A;  2EVB A;  5C4H A;  1SNQ A;  5COR A;  1I4R A;  3Q23 A;  1SYD A;  1U4M A;  3A7A B;  3BYT B;  3EQL C;  4A3E B;  3DEO A;  4KD4 A;  1EZ8 A;  2JDI A;  2E2J B;  2ZXH A;  4FVM A;  1TU2 B;  3I73 A;  2B2T A;  3KK7 A;  4AVZ A;  2QKI C;  4KK7 A;  3W2D A;  2JJ1 A;  3HAG A;  3S1M B;  4YEL A;  3R3O A;  2V7Q A;  1V1P A;  4DXF A;  4E0F A;  1STA A;  1V0E A;  2D5D A;  5A2Q E;  1JR0 D;  3T4A C;  1CFM A;  3MC0 B;  1H9R A;  3DWQ A;  1TKW B;  2WKC A;  4XDX A;  3E0J A;  2PNR C;  1HTP A;  3I4L A;  1NR2 A;  3MXG A;  4KKT A;  1AEX A;  3S1Q B;  5KIX A;  2HUG A;  4WJW A;  1D2B A;  4FF4 A;  1W6K A;  3HOV B;  1Q8I A;  2B2V A;  4F88 A;  3GTM B;  1FNV A;  4QUC A;  1ZKO A;  3CHB D;  5G3L D;  4ODG A;  3D3R A;  3R2I A;  4QMG A;  4Z9C B;  5EKL A;  4OO1 H;  1EY9 A;  4R8I A;  3K59 A;  3PV0 A;  4B9X A;  2QIL A;  1HXY D;  5IOC A;  1F2Z A;  1H9J A;  2K05 A;  2W6J A;  4C1N K;  4KY5 A;  3HG9 A;  1H9K A;  2B2T C;  3M4O B;  2A68 C;  4XYQ A;  4IUQ A;  3HOY B;  2M00 A;  3OOC A;  1GUT A;  2CVR A;  2IX1 A;  4YXW A;  2B8F A;  2GK6 A;  2JYO A;  3M4Y A;  1DOK A;  1ENC A;  1K8M A;  2E1B A;  5BN5 A;  5NUC A;  3KEW A;  2EYP A;  4A3F B;  3BVG A;  3ZYY X;  2WJY A;  4RGT A;  4KY6 A;  2A6H C;  1ROD A;  1ZYR C;  3JAM E;  3U9O A;  5JPM C;  2LKV A;  1II3 A;  4H44 C;  2F0J A;  4K2K A;  4QIW B;  3A3B A;  2A6E D;  4UDU C;  1UD5 A;  2PQE A;  3TN2 A;  3RD4 A;  3OIQ A;  1I6V C;  2IL8 A;  4A3M B;  5CC4 A;  1RDP D;  4C3J B;  2JA8 B;  4X3S A;  3D4D A;  1KDA A;  3QOJ A;  4NW2 A;  2Q8I B;  2PPB C;  1WD0 A;  3R2T A;  2SNS A;  2JEB I;  5IGG A;  3TZU A;  3L9A X;  2OT2 A;  1UD3 A;  4KJN A;  2NVT B;  3BVM A;  3PO2 B;  1MI2 A;  4OO1 G;  1E2Z A;  4QF4 A;  1ZXT A;  1IW7 C;  1LAB A;  1WTX A;  3P7J A;  3MXP A;  4TQU S;  1CQF A;  4ZLT F;  3NE5 B;  4FF1 A;  2EOT A;  4IUP A;  2K5Q A;  1FX0 A;  1QG7 A;  4ID6 A;  4A3I B;  3KLS A;  4RFB A;  1GUW A;  1ENA A;  2EXZ A;  1CT1 D;  3TP7 A;  4F8M A;  2F1M A;  1ILP A;  4TSF A;  5FOB B;  1R4Q B;  1TS2 A;  1CHP D;  3J7Y W;  4KMU C;  2X6G A;  2EYF A;  3H94 A;  4XR6 A;  2YYZ A;  5KYI A;  1TY2 A;  3I72 A;  1SMY C;  5JVG 3;  1JOQ A;  3Q24 A;  4G7H C;  4XQQ A;  2JXM B;  2ZTN A;  1DM0 B;  3FMC A;  2LMC B;  3PUW A;  3IKJ A;  4RGO S;  3GTL B;  2EJF C;  4HSV A;  3VYT A;  2AWN A;  3MWY W;  1ZEQ X;  2CW0 D;  5DM6 3;  1FNU A;  1VF7 A;  4CKB A;  1W0J A;  3GTP B;  4Y7N B;  2YU9 B;  3BDL A;  1UNS A;  3PMF A;  4WOR A;  4KHZ A;  1BLI A;  4G57 A;  1I4X A;  3J7A F;  1HUM A;  1J8I A;  2F43 A;  1SYG A;  5BN3 A;  1HFN A;  3FRP B;  2X6X A;  3OFN A;  2EZV A;  2BE5 D;  2E2I B;  1KLU D;  4BBR B;  2EYM A;  5EPK A;  1IKL A;  3J80 L;  1RTO A;  4FO2 A;  3LWE A;  1B1Z A;  5HUR A;  5T1I A;  1JE4 A;  4PV1 C;  4A93 B;  5JEA G;  3NQI A;  3A54 A;  4ZAI A;  1VCI A;  1ICW A;  1SJE D;  1LTS D;  1A3U A;  1NCV A;  4MN3 A;  1ESR A;  2XZO A;  2A74 C;  3DMU A;  5EBD A;  1SXT A;  5JJZ A;  1O7Z A;  4EQN A;  5JVH 3;  4A3K B;  1KAA A;  2G9D A;  4CJ1 B;  2MP1 A;  2V4D A;  1S5B D;  4IUR A;  3HOW B;  2K6A A;  1T5X D;  1EY7 A;  3KLS X;  4XN0 A;  4JMQ A;  2N88 A;  4RH6 A;  2IX0 A;  1EL0 A;  2ZZE A;  5IGE A;  2F0M A;  2PZU A;  5D65 A;  2JSO A;  2KCN A;  4C56 C;  3X3N A;  2HLD A;  2A69 D;  3AB9 A;  1LTB D;  3OPO A;  2XZL A;  2H1E A;  1WCM B;  3GTQ B;  4IUU A;  2E2H B;  4LMQ D;  2EPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...