3NE5B

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CusBA heavy-metal efflux complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Cation efflux system protein cusB
total genus 60
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ne5B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ne5B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ne5B01
4GZYC 3T53B 1Y69U 2K7VA 2D5DA 1ZKOA 3CRKC 4DNRB 1GUGA 2A6HD 2JEBI 2A69D 4XTCS 4IQZA 3ND9A 4LJZC 3MXUA 4L8JA 1Q1EA 2A69C 2E76C 3QJYA 1GUSA 5BN4A 3I73A 1GUOA 2EJGC 4OO1H 2QF7A 1K8OA 1QJOA 2DN8A 3VR6A 3A8JE 1B9MA 5K36G 3VR2A 3SE0A 3NE5B 2K32A 2A6EC 3PUZA 2O5IC 3TZUA 4DNTB 3I72A 2A6ED 2BE5D 3T51B 2KA7A 3PUWA 3QIAA 1VF5C 1H9SA 2DNCA 3M4YA 4I7ZC 1H9MA 5C0XH 4RCNA 3P20A 3I4LA 4LK1C 1GHKA 3OOCA 1Q1BA 5KNDA 1GHJA 1Z6HA 4G7HC 1E2WA 3PV0A 2PNRC 2L5TA 4KKSA 4IFDH 2F1MA 1VCIA 3ND8A 1H9KA 3VR3A 1ZYRC 3GD7A 1K8MA 4JBWA 4KKUA 2Q8IB 1HQMC 1EWHA 2A68D 1ONLA 1Q90A 2EJFC 3VR4A 3KLRA 3D31A 1H9RA 3U9SA 2A68C 3WDNA 1FYCA 3GQBA 2D62A 3LNNA 1CFMA 1DD2A 1GUNA 3MFYA 4JK1C 3RLFA 2AUJD 4OO1G 3N6RA 1Y8PB 1HTPA 2O5JC 2NN6G 2BA1A 5KNBA 3D4RA 5BN3A 1I6VC 1DCZA 1DXMA 1E2ZA 1FR3A 2AWOA 3L7ZC 3M7NA 1O7LA 2EVBA 3A8IE 3OW7A 1T5EA 1CI3M 1GUTA 2EDGA 4H0LC 3VA7A 5BN5A 3CRLC 2K33A 3HGBA 3LWUA 3OPOA 4H13C 3VR5A 4G7ZC 1YNJC 4DK1A 3A8KE 1O78A 2NN6H 2E75C 1LABA 3BG3A 1TU2B 2JE6I 2JEAI 2A6HC 3A7AB 2NN6I 1IW7C 3T56B 4DK0A 1V43A 3PUYA 5K36H 4KI0A 2BDOA 3H94A 2AUKA 5KNCA 1B9NA 1IW7D 2V4DA 2B8GA 1HCZA 1H9JA 4BA1I 3QG1A 3A7LA 1TKWB 4KN4C 1Z7TA 1LACA 2R6GA 2LMCB 1E2VA 1IYVA 1GJXA 1A6XA 4G7OC 1VF7A 1H9SB 4OGQC 5A35A 1CTMA 2CW0C 4HR7B 3M85A 2BE5C 5JEAH 2E74C 2PCFB 1SMYC 2YYZA 3FMCA 1G291 4PV1C 1VDZA 1Y8NB 1YNNC 2JXMB 3PUXA 4TKOB 1OXSC 3BDOA 2IT1A 1Q12A 4BA2I 4KKTA 4TQUS 1OXUA 2B8FA 3IFTA 5JEAG 2PPBC 2ZT9C 3SDZA 3EQLC 1OXXK 1Y8OB 4XIGS 4KMUC 3FPPA 5C0XG 4KN7C 2KCCA 3PUVA 1BDOA 1PMRA 3AB9A 2EJMA 3DXJC 4H44C 1IYUA 2BA0A 1OXTA 3W3AA 1V8QA 2DNEA 4KHZA 1OXVA 3IKJA 4IFDG 1HPCA 2D2CC
chains in the Genus database with same CATH superfamily
4GZYC 3KF8A 1BUVT 4WZTA 4GLAC 2RQXA 3A54A 4LF5L 2VNJA 2P3MA 1JICA 1LTID 1DOMA 4GOPA 2A8VA 3G05A 2WJYA 4RLZA 2K05A 1VQ5B 1U4MA 4FF1A 1F2YA 5IGFA 4MHEA 3D0FA 3OJWA 1VQOA 1GD7A 3K5OA 3HOYG 3GTLB 3OWEB 2BE5D 1KK2A 3RMHA 4NXMQ 3EBEA 1H9SA 4LBVA 1YHAA 1UNSA 5ELOA 4A3LG 2EIFA 1WTWA 2K75A 2GVAA 1E2WA 4AQYQ 5DM63 2L5TA 4LF8Q 3A35A 4A3KB 4CJ0B 2WZPP 2VJJA 1ZYRC 3IL8A 1BCPC 1Q90A 4QB4A 2M9VA 3U9SA 4JI0L 2WAQG 4L5QA 4LF7Q 4B47A 3JAML 1HZAA 4CDCC 3BY1A 3JAMc 2F0UA 1EY7A 1TY0A 1BPLA 3BDLA 4DR5Q 1NE3A 2MP1A 4CGYB 2EXDA 4LF6L 2ZTEA 4P1VA 3M4PA 5D14A 2BN4A 4P73A 2GK6A 1QH0A 3MEHA 4QY7A 2LXJA 2NTSA 4JI5L 4A3DG 4H13C 1EP2B 1MABA 4HCSA 3OFNA 2E75C 1SYFA 3CC4A 1KNAA 3HOZH 1LT5D 3R6JA 4B9XA 4A3JB 1JMCA 1NMFA 4HJ8A 1VQPA 3AFQA 2ZJRA 4LMQD 2PI2A 1LT3D 4KN4C 1RKNA 2MHVA 1NB9A 3HOWB 4DR6L 2R61A 4OOVA 3SR1A 1PRTF 5THXA 4Z4VA 4LWCA 5GROA 1SNPA 5J3BA 1VDZA 4F7DA 3T1HL 1GR1A 1I94Q 1VQHA 3CKIB 5IT9L 3RZOH 4K8JA 1Q12A 2KHJA 1OXUA 2PPBC 3J81c 1BNZA 4XIGS 4KMUC 1FJGL 3QFRA 1UD2A 1IXRA 3NBHA 4KN7C 1E3XA 1I18A 1E1OA 1JE5A 3MCAA 2V1CC 1PYSB 2IX3A 4L5SA 1EIGA 4P9SA 5H59A 3W3AA 3CMEB 1V8QA 2RVLA 4ZV4A 4PZ6A 4YWMA 2QE7A 2D0OA 3U4ZA 4K0KQ 2WAQE 4X3UA 1KC8D 1TWGB 4WRDA 4APVA 1Z47A 1VQ6A 4DXFA 3GVJA 4TMWA 1M90C 1KD1D 4DV2L 2RDFA 4R8IA 1L0YB 4M8AA 3L2PA 3I73A 4RFBA 4XNFA 1K8OA 1HR0W 1GAQA 4GOPC 1PDQA 4OWXB 1YNJD 5LMUL 1JT8A 5ELFA 1SRUA 3J81i 1J6QA 1Q46A 5IGEA 1YIJA 3U6BA 4KHPL 2B2WC 3ONAB 3OYYA 4HIKA 5C5LA 1V5VA 1KK0A 4E0FA 5IYDG 2F52A 3T16A 4JC0A 2F4VQ 1R9TB 3PO3B 4IFDH 2R93G 1BF4A 2CH4A 4IPHA 1J9OA 4JI2Q 1F77A 1E0BA 4RMFA 3QFTA 4QHYA 2CH4W 3G7LA 1KK3A 5E4XA 2D62A 5LMNL 1GUNA 4X64L 2ZZQA 4B08A 2Q6LA 2JA6H 4QUZA 1STEA 4DUYQ 4NP5A 1VQ4A 4HIMA 2JJ2A 5EJWA 4UZEA 4HJAA 1TWHH 4GN5A 3I2ZA 5KNBA 5IT9c 1MGSA 2G5DA 2EXZA 1N05A 4HIDA 4AIMA 1UUPA 3B78A 5JJIA 2H5XA 1F2ZA 1KXLA 5F2DA 4IJLA 4H0LC 1N8RD 3VA7A 2K33A 1VQLB 2CWAA 3OPOA 3CCUB 2LFNA 3A8KE 5FJ8G 1XX8A 1YITB 2NN6H 5IYRA 2DYIA 4OIJA 4G1BA 3SJPA 3PIP3 3DLLA 4AF7A 3CCMB 1D8LA 1PTOH 1U5KA 4JBKA 3GTKB 1PRTD 3CCLB 5CV9A 5KNCA 4DUZQ 1WORA 4PC6A 4IUUA 2VNIA 1N9WA 1WJJA 1RDPD 3ZBUA 3CXCB 2F0HA 4A3EH 5M5YH 3SEBA 3AU7A 2JN9A 2QA4B 2B63G 5TY0A 2KBNA 5DNFA 3EJIA 5CV7A 1K83B 3NWTA 4EGVA 3CP8A 3C1EA 2VNHA 2EIXA 2HDLA 4E6IA 3K5LA 1UD3A 3OZWA 2R7ZB 1CQXA 4KHVA 1SE4A 4R71A 4J0QA 4C3HH 2F03A 3H3VH 1GVHA 5IGGA 4WZLA 4Q5VA 4BY7G 2WAQB 3UI2A 3KF8B 3ULLA 3TREA 1YITA 1I4PA 1VQKA 1VQLA 4HSVA 1LV9A 2TSSA 3UDFA 5LHY1 3ERSX 3I4NB 2KCCA 3J7A5 2ID0A 4UP8A 1WTHA 2UXCL 1L1OA 1D2EA 4K1XA 4JMQA 2ZITA 1ZKOA 3Q0AA 1G7TA 1BX1A 2O2LD 3SK4A 1AIPA 1E3PA 4YCWA 3TP7A 2DY1A 3QOLA 5C3EB 4JI3Q 4OL7A 2F43A 2PYKA 1DG1G 5FIUA 4QFMA 2OK8A 1TXYA 1B50A 4LF9Q 5ELEA 1I4RA 2M5SA 1JOOA 2FXQA 2XSCA 5DN6A 3GTOB 3ULPA 3CESA 3ZBTA 2KA7A 2GK7A 3GTKH 3QIAA 5FO1A 2DNCA 1WTHD 3ONYA 1QVCA 5KYIA 1G7SA 2AQ1B 2H1EA 4J6HA 3SLDA 1N07A 2KCNA 3FKIB 1IL2A 5IYWA 3HOWH 2Q2IA 2Q6OA 3BVMA 2K5WA 3ZC3A 5FLXc 2NUCA 1PJ5A 3E5SA 1XPOA 3PO3H 2WINB 4FXGC 4XKVA 4GNXB 1XE1A 3OZUA 3WNDA 5HGTA 1PV4A 3GQBA 2X85A 5FLMH 3JQQA 1NNXA 2F0MA 4EQ5A 3CC7B 1RJTA 3J81k 4B4DA 2DETA 1ZEQX 1UD8A 3CMMA 4M0LA 2GREA 4Z4RA 1I6VC 2WJVA 4UY8C 3S1NB 4ID6A 2EVBA 2EYFA 2OF1A 1VQAA 2FHTA 2WACA 3MTSA 2C35B 3S17H 3HGBA 2BVNA 3R2TA 2I07B 2A74C 2HQLA 1I7PA 4TSSA 2KECA 5FO8B 4WJ4A 1ESFA 1UWVA 5ELBA 2NN6I 1IW7C 3PUYA 3HS0C 4DR1L 1PH3A 5EAYA 4YWLA 2E5LQ 4B3RL 1KLGD 2X6LA 3JQRA 4RD4A 1B7YB 1SKYB 2ENBA 3OIPA 2VBSA 1M1KD 2QTZA 4LUVA 2ZBUA 3SHLA 3AGPA 4FVMA 4QQBX 3STBC 2NZHA 4FN5A 1HNZQ 1SMYD 1AZPA 2F0VA 4NXNL 5G3LD 2V7UA 2PCFB 1QFYA 1I5FA 2R92B 2PE3A 1YEZA 4CDFC 1PKVA 3EN2A 3CTAA 2JXMB 3TZDA 2F3IA 5C4XG 3Q6RA 1A63A 3TEHB 3S2DH 2Q2HA 4ZKBB 3W1BA 3E9IA 4A3BG 4JW0A 3KF6A 2B8FA 1WYDA 3HOVG 3E6ZX 2R7ZG 4LF7L 1ZYRD 1WTRA 4BS9A 4JI4L 1HZCA 2A73B 3QE2A 4A3GG 3PA1A 1CSPA 4JI1L 2NVQH 3I4NH 4KHZA 1V1PA 4XOPA 3OTOQ 1W87A 2ALYB 5IE8A 4Y7CA 1Y69U 2PZUA 3BYYB 1YHBA 2VL6A 3SK8A 2A6HD 2FINB 4DAVA 2YU9H 1JWSD 2L55A 1FGBD 3B6YA 3G48A 4NW2A 1HTLD 1AN8A 5H5JA 2ZL6A 2OQKA 1PFNA 1S3OA 3CAMA 2X53S 2UU9L 1A3VA 3TN2A 2ICEC 3ZJYC 2Z6BA 5I9PA 4DR1Q 1SFOB 1WTOA 2K28A 4RWSC 3L9AX 1JJCB 3DM1A 4IJHA 1STNA 1F60A 1XNRQ 4P74A 2IHFA 1EQTA 1DARA 3V7AA 4C1NI 2L4NA 3W2FA 2OTLB 3JC66 4RCNA 5COYA 1HNZL 3ES9A 1G2TA 1QVGB 3PQIA 5FLMG 1Y1WB 1MKHA 1I50H 1EZ6A 2X0KA 4GKKL 1EY5A 2ZZGA 5KW9A 1CHQD 3K80C 4S3SA 1PH2A 4X6AH 3ONUA 3JU4A 3J81L 4DKAC 3CCMA 1EWHA 1QB5D 3VR4A 1BBUA 3KLRA 1ENAA 1BLIA 3OEHA 1BQQT 3WDNA 4A3FB 3S2HH 4A4IA 4B9WA 3S1RH 1VLOA 3MFYA 4R8NA 3ASPA 4PQXA 5IP9H 1ZM9A 1G6ZA 1X54A 1HTPA 4C56C 2O5JC 2B2YA 1WOOA 1JWMD 3L7ZC 1WD0A 3I56A 2E2JH 1U4PA 1AEXA 3VO2A 1I4HA 4P6VF 4C3HG 3IAYA 1LTRD 3OTOL 1KDCA 3PUNA 4Y9RA 4JOIC 1TT2A 2PZWA 4DK1A 3BJUA 3SVMA 3DDYA 3NTKA 3UDGA 1S5FD 3C3LA 2DERA 3J81E 4J1MA 4A3DH 1VQ7A 1I6HB 1QX4A 3A7AB 5C4ZA 2PW5A 1L1OC 4IPGA 1YJWB 1C48A 4XKWA 3RY8A 1K28A 4ZCIA 2WB1E 4JI6Q 2OCEA 4B3MQ 1K73D 1TKWB 2Z4HA 2EYMA 1IKLA 2L9HA 3NXWA 5C44H 3BCFA 1JCKB 4RD3A 4X3KA 1RTOA 1XXGA 3AMUA 1I8DA 1CTMA 1PLFA 2CBXA 1W0JA 3F8TA 5CR3A 1PVOA 2QTLA 4C0SA 3H91A 1E1TA 2OTJB 3K7UC 2YYZA 4MTKA 3DEPA 4K8IA 1PZID 2Z4IA 4MNOA 5M9OA 4XORA 1QG7A 4G5GA 3IFTA 4IUTA 5A2QE 4N9PA 1OXXK 1G51A 1VQ6B 3FPPA 4DR4Q 3ZZ0A 3K5NA 3PUMA 2F4IA 1OXTA 1VQBA 4UZFA 2XNDA 2D2CC 4RKLA 4A93B 3ERQA 3HKZG 4UDUC 4V190 1ENCA 4Z4WA 4A3JH 4P72A 3RUZA 2XRSD 3MXUA 2F0KA 5CBAE 1Q1EA 1GUSA 4K2KA 4R9WA 1QILA 3GVLA 2O4XA 2EJGC 4ZK9B 1TR5A 1UE6A 1QJOA 2JYOA 4H02A 3BDCA 1VLYA 2V7TA 4WWVA 4BXXH 5EPKA 3VDYA 1SSOA 5KGUA 1BO0A 4A76A 2XRQD 1SXTA 2D9RA 4B3TQ 1GM5A 4KTAA 3U50C 1D1NA 3PV0A 1FVIA 1B2TA 2HD3A 2Q8IB 1HQMC 4PMWA 3RLOA 3PIOA 1PXUA 1A2TA 4P2NA 4HJ5A 4BY7B 2VBVA 1NAPA 2K5HA 3D3RA 2P5ZX 1VQJA 2NV4A 2I5MX 5D3IB 4RDLA 2JK8A 1KZLA 5FOBB 4WFN3 2ZL5A 2K4KA 2MJ8A 2E1RA 1X3PA 5A88A 1VQNB 4QF4A 1DXMA 1MBYA 3WOEA 2RKSA 4RPDA 5FLXL 1EXMA 4P25A 1FNVA 3CPFA 3OW7A 2OTJA 4X65Q 3VR5A 1V0EA 2KUMA 5KRUA 4QVJA 1JA1A 3CCQB 1OGIA 1TQOA 4AYBG 1PFSA 3BS1A 4A75A 2KVOA 2RCNA 4OPOA 4XONA 2B2YC 5M3FG 4GKKQ 3T56B 3K7AB 4HEDA 1J8IA 3H94A 3CCSA 4NBSA 2CC2A 4RG1A 4ZUIA 3G71B 1E43A 1JA0A 1E2VA 4A93G 4RH6A 5M5YB 3F2UA 1CM9A 2QCPX 5DM73 2WKCA 1H9SB 2DEUA 2M2LA 4DAPA 3ISXA 3PIO3 4L5RC 1WSVA 3OJXA 1Z9FA 5C44B 3K5MA 2VZAA 5JEAH 2D3LA 1D5MC 1II3A 1HVXA 3HKSA 1SMYC 1X3GA 2PMDA 1G291 1NTGA 3CW2C 4TRDA 3BDOA 2ZBVA 5IP7G 1R9TH 3OEEA 3BY2A 1V9PA 1KTKA 1AH9A 1SNOA 2MFIA 4R1JA 2ZT9C 2J7KA 1Y0YA 3GV6A 1P8LA 1X3EA 4DGZA 3S1NH 1OHHA 2NPFA 5EGTA 1FDRA 1DJRD 3W2IA 3E9HA 1WVLA 1E79A 5ELNA 4LFBL 4JI6L 5K5PA 3CRKC 3GTPB 5TV2A 1SBBB 3A8KA 1SN8A 4B3GA 5IGCA 2FFKB 2OXPA 3BU2A 4ASUA 5LMNQ 5FLXE 1PA6A 2ICIA 5EMNA 2SNSA 3CQZB 2QGQA 4HE5A 3AVUA 2UUCQ 3MHBA 3PCOB 3A8JE 3BZCA 3A5UA 1EP3B 3SEJA 3OMCA 1EZ8A 3SE0A 3TSSA 1SFOH 1EQVA 1EU4A 3H0GG 1SDFA 1T6YA 3Q6QA 1VQFA 1HNXL 4H7BA 1SEBD 4IFDJ 1D5ZC 4PZ7A 2UUAL 2VUMB 2VB3X 1IB0A 4X66Q 3B8HA 1RD9D 2WV6D 2Q8TA 2G9DA 2VZLA 4HMJA 1FX0A 4IOAA 1FRQA 4A3CH 1ICFB 2PMZE 1VCIA 5JOBA 1D1IA 1KRHA 1TWFB 4JBWA 4RKBA 2A68D 5CYUA 1YBYA 1UD4A 1EIHA 1S4ZA 2EJFC 2J7ZA 3NTHA 5C3XA 3CMAA 2IPKD 2CWPA 1N06A 2TMPA 2JA7G 2VW9A 5IGBA 3RN2A 3FDTA 3CCEA 3S2DB 5CDFA 2L1BA 2C9OA 3GTGH 1JC7A 4P22A 1KLUD 2BA1A 4EQNA 1UE7A 4LFCQ 4IURA 5L46A 1EY8A 1XNQL 4FXDA 2ZJQA 1K3RA 2YTXA 1J5EL 4XLFA 2QMUA 2B2TA 1CI3M 2PW7A 2VUMG 3GTPH 3CPXA 2ZTDA 3U4VA 3H3VI 4PABA 2PIAA 2NB0A 5IYCG 2IX1A 3JAME 5LMUQ 1F9RA 3S17B 1H8EA 1EWCA 2JE6I 3CCRB 2D9UA 2JEAI 1BQEA 1MSHA 4OHJA 3MHPA 1E1RA 4B43A 1SE8A 2AUKA 5IGDA 3G4SA 2N88A 2A1AA 2B8GA 1S5DD 2FX3A 3K6OA 2Q6KA 1HR0Q 2R6GA 1LACA 5CGKA 2LMCB 4RCZA 3NTIA 3D6WA 2GQFA 3GP7A 4ZUJA 5BSXA 4DR2L 3MMPA 5M5XB 2BE5C 4IPCA 4CJ1B 4LF8L 4ZGQB 3ZYYX 4U673 4AC9A 4WORA 3G4SB 2RDGA 1R5NA 4JCVE 1FL0A 4TKOB 3J80E 1UEAB 2EQSA 3HOYH 2BH2A 3LO8A 4P12A 4Y7NH 4M4SA 5BSYA 3IFDA 2ZTCA 3T4AC 1YJNA 1EFCA 1BX0A 4AF6A 2A19A 4KD3A 4HAEA 1KABA 1SJED 4B3FX 1C9OA 3DXJC 2LXKA 1IYUA 2V7QA 4KY5A 3R8BA 3AVVA 1EY0A 4O1NA 4P2CB 3DWPA 2BMWA 1JOKA 2A5HA 3E1YE 2WKDA 5GV7A 2A69D 1XMOQ 2F0PA 2JDIA 5NUCA 3Q22A 3EFXD 1KDBA 4LJZC 4L8JA 5FJ8H 1AMOA 3ZPNA 5C6AA 3I55B 5DAUA 5C5MA 4DV6L 4OX9L 4OO1H 3NBIA 1M1KC 1IBKQ 2WR8A 4A3BB 1SLJA 4RHSA 3VYSA 1BJKA 1XPUA 2O5IC 4ZRZA 2QW7A 3FVQA 4II2A 1G2SA 3GIRA 2F0WA 3I4NG 4A3BH 1HNWL 2DJGC 3K7AH 1JJ2A 1H9MA 2KHIA 1TLLA 3QSYA 5F4OA 5CV6A 1XQBA 3WY9A 2CCZA 1GHKA 3OIQA 3QFSA 3CF5A 4ILWA 2UXBL 1ET6A 1LTTD 1FRNA 1QUQB 2I5LX 2G9HD 3HOUH 4LUZA 2AKWB 1N32Q 5KIXA 4GN4B 4A3KH 3CCVB 4V0BA 4MTNA 1ONLA 5M5XH 2EY2A 4WJ3M 4LFAQ 1YJ9A 3MVVA 4A3IH 4JK1C 2B63B 2N3SA 4OO1G 2RDHA 2E2IB 1GVPA 4DR4L 2VNKA 1A2UA 4DQLA 4ODGA 1NBMA 4TN1A 3VNUA 4XLEA 3MEFA 2N49A 3BYTB 1FR3A 2IY5B 4H9GA 2HIXA 1EY6A 3M4OB 5JPMC 3FPKA 4RCYA 4MZ9A 4GNXC 1W2BA 4QGUA 4JI4Q 2B2TC 2D74A 4GLXA 1XTCD 4JI1Q 3CCVA 4JYAQ 2XOKA 5EPJA 4EQPA 1I6HH 2NVYH 4Y9UA 3S16B 3RZDH 1HCZA 3CQZH 3HEJA 3J80i 3J7ZC 1CT1D 4RGOS 1ET9A 4DV6Q 4OX9Q 1DDIA 1L2FA 5T1GA 2JJ1A 3S14B 4TMXA 1Y1VH 1WDTA 5LMZA 3C2QA 1JJ2B 2JQOA 4GLVB 1G8ZD 3FKIG 2NVTH 3HOXG 3I4MH 4LC0A 1E24A 2EPBA 2R92H 4WZKA 4XLHA 2XWBB 4IOCA 1B70B 1SMXA 5G3LF 2XNAC 3PF5A 2R93B 3PUXA 3R3OA 2B7CA 5J22A 5I4DA 2F0SA 2IT1A 4NXML 1EFUA 2V7XA 4TSFA 4A3JG 4JPBW 4TMTA 1HR0L 4YAUA 3DEOA 3PUVA 4FYDA 2F0NA 4RD1A 1TVCA 4QUFA 2ZL7A 3MXNA 1X9NA 2LKVA 2BA0A 5I6YA 5E3FA 1WOCA 2B2UC 4X07A 2R6HA 4KY6A 1K9MD 1XMQL 2QGGA 4HMIA 5EBDA 4OPVA 2HCIA 1YI2A 1KRSA 1F9SA 3H3VC 3H09A 4L63B 3S1MB 1CQFA 2Q2UA 4XYOA 3T1HQ 3WQZA 2K50A 3J7AV 3PO2H 3FKSA 3S9WA 2C5BA 2J0TD 1W35A 2YWFA 3N52A 3QWNA 2K32A 4HJ7A 3PA2A 4B3XA 1QG0A 1NDHA 5M3MB 3KBXA 1SNMA 1VS0A 1H8HA 1BMFA 3OAAA 4FK8A 2NVYB 4OONA 5C0XJ 1R4PB 4Z4UA 1IJFA 3I4LA 3QB3A 5LMNW 3OOCA 4B3ML 1EYCA 1S5ED 1HH2P 4FWTA 4XD7A 1GHJA 4ULLA 5C0XI 1N08A 1NR2A 3NSWA 2E2DC 1ILPA 1RHPA 1F9QA 4A3LH 1PH1A 1EYGA 2XNCA 4DV7L 1CKOA 4DNIA 1WFQA 1VQ9A 5A2QL 3CCRA 5D3DA 4LAAA 1D7QA 1IJEA 2X69A 3ER0A 4CDDC 2R7ZH 3VYUA 2F0EA 2Y0SE 4KD4A 5ELCA 1WTVA 5C4HA 1XJVA 1HA3A 3FRPB 3TP8A 3RZOB 3TDQA 4C3JG 3BCDA 4XLCA 1Y8PB 2E2IH 1ICWA 5J1ZA 3M3YH 2GJKA 2NN6G 2CKZB 4DAMA 5IWAL 3LQ6A 2CVRA 3Q24A 3OW2A 1PTOF 1TWHB 4G7XA 4G57A 4EVOA 1PH6A 3A8IE 1SYEA 4ME3A 4OEMB 1X6OA 3SK5A 5JAVA 4YXWA 4DR2Q 3A3BA 4NMZA 2E2JB 4TMVA 2F0DA 4JI2L 3FHWA 2PMZB 3NPPA 3GTMH 3GTOH 4X62Q 1E63A 4JOIA 1T6ZA 1JQYD 1O7ZA 1Y14B 2UUCL 3VO1A 1FNBA 1TY2A 4B44A 2RHSB 3OWFA 1AW7A 1Q81C 4KV6A 1IW7D 2SNMA 4Z4TA 3QG1A 1QUEA 3EA6A 1Z7TA 1GJXA 1JB9A 5IODA 4NCNA 4UAJA 1IZ6A 5CV4A 4OOSA 1Y1VB 1DZ1A 4HR7B 1JNYA 2SDFA 1QNUA 4F7XA 1J9ZA 1YJWA 4N3NA 1YNND 5JVG3 4DK6C 1QGZA 2DGYA 1P4MA 4PV1C 4XXEA 1OB2A 4PC1A 2L12A 3TQYA 4ABNA 5L37A 2R93H 1TS3A 1L1OB 3RNUA 4X8IA 1HZ9A 2EYOA 4OELB 4C3IB 4M53A 3LX0A 5HXBA 5E6TA 3WNBA 1Q3LA 2KOLA 2GVBA 4Q7JB 2ZM6Q 1PMRA 4YHBA 4JYAL 1A8PA 1HNWQ 1U0LA 2VJIA 3HOWG 4B3SQ 5A89A 4ME5A 3AFPA 3EVQA 2K7VA 1EOVA 1WD1A 1CKNA 3CP0A 2BOSA 3KK7A 1ENFA 3SXHA 4XT1B 1QFJA 4IQZA 1Q81D 1IYJB 2A69C 2B29A 3A5ZB 3LQEA 1U9RA 1YNXA 3TP5A 4M2LA 2I0QA 1SROA 1EUJA 4TVAB 1B9MA 2WYRA 2F0FA 5M3MH 1MJCA 1JJGA 1B2RA 4HIZA 2WSSA 1VF5C 2E2HH 3F1ZA 1KL9A 1SYDA 1N0UA 1VQOB 2HHHL 3RZDB 2LY7A 5IYPA 3M4QA 4CKBA 4PAAA 2Z0SA 3D4WA 5AN9A 2IWHA 3HKZB 1TWFH 3JQPA 3CCSB 3O13A 3I90A 1B1ZA 1L0WA 4U68A 2KEDA 2OBSA 3CCQA 3S1RB 4IUQA 2C5CA 4G6IA 2K52A 1HA5A 1K0RA 4OP7A 3RLFA 3J81j 5EKLA 3GTGB 2ZM6L 4BY7H 2BV3A 2F0TA 2OBTA 1QE6A 4RA8A 4Z4YA 1L0XB 3ASTA 2VQFQ 1JB7A 4A3MH 3VYTA 2ZXIA 3M3YB 3OKXA 3RD4A 4FXKC 1A3UA 1RF2D 1T5EA 4FO2A 3CPWB 4G7ZC 1SYGA 5J3OA 5HZBA 3H0GH 3BVZA 3U2QA 1JB3A 4HN7A 1LO5D 5KSWB 3I8ZA 2JN4A 2AQ3B 1H9JA 4IUNA 3S14H 1PJ7A 5IIFA 1X3QA 2HHHQ 1A6XA 4ZQ3A 2LZJA 4PZ8A 2LS01 1COWA 5JPNC 4BY1B 5TRDA 1EYDA 1IHZA 3FPUB 1DGSA 4MYUA 1N0VC 2PNHA 2F4NA 4JG2A 4X7FA 4XR6A 4ZCLA 4DUYL 1STBA 3CC2B 4KKTA 4JV5L 5JEAG 4LF9L 2V7VA 3CRZA 4Q0FA 5HURA 4A3FG 3G6EB 2B2WA 4ZLTF 4TT3A 1VQCA 2RHQB 1T5XD 2BCOA 4N8FA 1D1KA 3HG9A 1C8CA 2Z6KA 1EL0A 4DN4M 3T53B 2VQEL 2C77A 4HJ9A 3K0XA 3UE1A 1M4VA 1VQ9B 4X05A 3EIVA 4A3MB 1YHQB 1WU8A 2CHBD 3ND9A 3RN5A 2XEXA 1SJHD 2E76C 1M90D 3TP6A 1EIFA 4DV7Q 2K5VA 3NEMA 4NPSA 4PNYA 1QOHA 5IP9G 3VR6A 1LT4D 4DR3L 2FMMA 5K36G 3NE5B 3F2BA 3OMGA 1I4XA 3P7JA 1ZXTA 4GS3A 2DJFC 1LLRD 5CORA 4M1UB 4HE6A 1T9HA 2OEOA 5GAEC 4XN3A 4I7ZC 2Q6IA 2QDXA 1JE4A 3DMUA 4RM0A 4K14A 2H4OA 5IWAQ 2F0IA 3CC4B 4G7HC 2L15A 1UMKA 1RTNA 3GV3A 5AJ3Q 4BBRB 5GADC 4C3JH 2JA5H 4DR6Q 5C4XH 1DOLA 3D6CA 4QVAA 1K8MA 3GD7A 4KKUA 3SGIA 1VQ7B 1QGAA 1EWIA 2RSNA 1GOZA 4IN3A 1YZ6A 1A3TA 4ZAIA 1H9RA 2F0JA 1SNDA 2KHSA 1TWCB 3A56A 1DD2A 2VB2X 1N33Q 4C2MB 1UEBA 3WOFA 2SOBA 2Z6BD 1B3QA 3I56B 1TWGH 4FP5D 3N6RA 2C4UA 5HGQA 1WPCA 1C7YA 1W9XA 5M5WB 2GJPA 4PMBA 2JJQA 4A3GH 1I4GA 5M5WH 1HZBA 2BF4A 1MD2D 1TS5A 1W6KA 2PQEA 2WB1G 4QMGA 4POFA 2VS1A 3RR5A 2AHOB 1VQKB 1O78A 4KLKA 3CB4A 1EFWA 1FNCA 1EU3A 4N9TA 3AVXA 2QN6A 1RIPA 1W34A 2JA5G 1PZKD 4KI0A 3WNCA 2B3GA 4CDEC 1VQGA 3I91A 3GSIA 1D8TA 1QVGA 4AYBB 3IRBA 1ASZA 4G7OC 1JR0D 1VF7A 4FXUA 1HA6A 2KJXA 1QGYA 1T6XA 2QA4A 1VQ5A 3M85A 4J8QA 3CXCA 4DFAA 1CSQA 5JVH3 4WJWA 2NZ1D 1HFNA 4LF6Q 3AVTA 1Y8NB 1CKNB 2B2VA 4C3IH 1WTQA 4DA2A 1SYBA 1N36L 2F4VL 3W2EA 3QOJA 4BA2I 2HMAA 3CCUA 2AHOA 2JSOA 4C3JB 1K8AD 1V1OA 1MRZA 3KEWA 1EEFD 2Q8RE 2NVXH 1VQ8B 1O7YA 4UP9A 4LF4L 1BDOA 4ZKCB 1VQMA 1AFPA 4EH1A 3PO2G 1XFOA 4DU9A 1FNUA 4LBYA 1QNKA 2XVSA 4QIWE 1YJ9B 2JA8B 3F2DA 3Q39A 1M8AA 4DV0L 4A3DB 3Q3AA 3VNVA 3SJZA 2KCTA 4RD2A 2EY5A 3K59A 4YY3L 2R9VA 1U2RA 2VY3A 4B3RQ 3NENA 4A3GB 4JBMA 2PO4A 2DN8A 2QEXB 3I70A 4AYBE 3VYRA 1KAAA 3GO5A 1GO3E 2VYQA 3HKZE 3PUZA 1KAWA 1MJEA 3Q23A 4YCVA 3Q38A 3NELA 1PH9A 4FF3A 1G6PA 1YLOA 1AE2A 2C78A 2I1LA 5IOCA 1XB2A 1KDAA 3SK6A 1Q1BA 4RCOA 1YIJB 4JVZA 5JEAJ 4C1NK 4Y52H 4N8X1 3KJOA 2F1MA 3GVKA 5C44G 4HTHA 3DHQA 1N36Q 2F0GA 3GTJB 1EP1B 2YWEA 2CFMA 1IL8A 4DR3Q 2A68C 1K28D 3L0OA 3BQJA 4UZUA 3MA2B 4HCEA 1CFMA 3A0JA 3I1FA 1EYAA 4C2MH 3W2GA 5IT9E 1BOSA 2ASBA 3R93A 4C3IG 2AUJD 1TWCH 1K9MC 4P71A 2CNDA 4IALA 4KHPQ 4KK7A 4A3KG 4BY1G 3C46A 3M7GA 1U4LA 4GN3B 3CMEA 5BN3A 2PLFA 1NY4A 2X6XA 1SE2A 1KJZA 2NTTA 1UAPA 1I3QH 1QVFA 3NHHA 1Q9SA 2QDBA 1V0FA 3LWEA 1LABA 1BVSA 5IYDH 4QV2A 2XNJA 1ML0D 1TU2B 3K0YA 4DK0A 1KK1A 2EY1A 4YAOA 4A3EB 1BCPF 3PGZA 3OP1A 3S1QB 4BA1I 2WPDA 3LVBA 3S1QH 4LFAL 4OPSA 2EYLA 1K0SA 1RL2A 2UUBL 1F20A 5DLQE 5GAHC 2F1LA 4IO9A 1G7RA 2CW0D 1VQIA 2ATWA 1N32L 2JA6G 5HKKA 4OGQC 1LTSD 5A35A 5I9OA 3K58A 3HOVH 5H1SE 5FA6A 3STBD 4OOXA 2EFGA 3KJPA 1ESRA 2XWJB 4K5XA 1E22A 1PTOC 1VQPB 2XZPA 1LM0A 2QEXA 2EE1A 2B63H 1QCBD 1PHJA 2JA7B 4IZ8A 3CD6B 1ZM3A 3TMEA 1FNWA 4BWGB 3L3OC 3C1FA 1JORA 3MXNB 4YHHL 3CCEB 4YEJA 1F2LA 3S15H 1TTTA 3A55A 1EFRA 4LFCL 1VQDA 2MUYA 2KEEA 1KNEA 3IKJA 1WP6A 1HPCA 4JI7L 3FMCA 3V05A 1K8GA 2R7DA 1NUCA 2B39A 3J80L 4LBZA 4MIUA 4Z1MA 4WZEA 4LNQA 3MXPA 1VQEA 4K2LA 2E1BA 4L5TA 3ZZTA 1I4QA 1Q82C 1AE3A 4DPGA 2QKIC 1S0UA 2QF7A 3ZUGA 1ILQA 5IYBH 4ACAA 1HRJA 2RBMA 3D4DA 3PIPA 2E5LL 3GTLH 4F87A 3R6KA 1RQRA 1NBWA 2DUDA 3I72A 4X62L 2F3VA 2GA4B 5JJKA 1G91A 1OB5A 2VUMH 3J7YW 2J4XA 1OGJA 1SKQA 2YV5A 3AVWA 1Z6HA 1W2BB 3HOZG 2CW5A 5I2YA 5B6IA 4O2DA 3QFCA 1PFBA 2GPJA 3KL9A 2Z9HA 4QCLA 4JI3L 3UE0A 4BY1H 4B48A 4K5VA 2VNUD 5DSZA 4NXNQ 4OIKA 1QFZA 1S40A 1HJPA 3S24A 2R7FA 1NSNS 1A0IA 1KMHA 2KVMA 3MFGA 5J39A 1Y0RA 3P75A 3CU7A 1ASYA 1XMQQ 2XZOA 1KC8C 4DQKA 4ROXA 4KY7A 5FL7A 1KD1C 3S1MH 4MYTA 3ICEA 1DCZA 3NQTA 3NWSA 1Q82D 1VQ4B 2JP1A 2K5DA 4II3A 4X7EA 4OWWB 4K0KL 2X6YA 3DWAA 4NKLA 5BN5A 3K57A 4JI8L 3P1HA 4B3SL 4DV2Q 2JA8H 4OO1I 3V76A 4RJLA 2K5NA 5A8AA 3BG3A 1ZUNB 1RODA 1K73C 4G7WA 4LF4Q 4A3MG 4DAYB 4YAWA 1S5CD 3T1YQ 2UXDL 1DM0B 3WWVA 1E62A 2PQAB 3OSOA 3PO3G 2IX0A 3E0EA 1XNRL 5BR8Q 2QEJC 3HRZC 3I4MB 2NVTB 3H9NA 4WQMA 1MIUA 3H15A 2XGTA 2EYHA 2ZZEA 1KHIA 3KYHC 1BBXC 3UDXA 4X3TA 2M00A 5EKIA 4FDBA 2ZZFA 1GXDC 1TS4A 3KDFA 3RLNA 1F2MA 3EQLC 1YHQA 3BZKA 2DIEA 1CK1A 4PMCA 1K3BC 4LBWA 3PVDA 3OW2B 4UHVA 2XZLA 1YJNB 3FP9A 5F4JA 2YWHA 4X66L 3PF4A 4G4KA 4XTCS 1CUKA 1PRTC 3AVYA 4X65L 5CC4A 1GJRA 3FEWX 1UE5A 5ISRA 3BH4A 1KIXA 1S5BD 2W6JA 5KEEA 4RPBA 3VR2A 4A3CG 4DV4Q 2X8KA 2IHEA 4PC3A 1OB0A 1AP0A 4P75A 5E4WC 4IPDA 5T1IA 3GTQB 3MC0B 1MHWC 1Y1VG 1A62A 5C3EG 3J80c 3P20A 4AVZA 5FK9C 2VBUA 4ZGNB 4LK1C 1WSRA 1NJID 3M9BA 2ZXRA 4C3HB 5KNDA 2Q2TA 5TSSA 1XNQQ 2R92G 3NQIA 2X6WA 2HCCA 1J5EQ 2K5QA 2K1BA 1MI2A 5TR9A 3ND8A 5IK2A 4FNFA 4PC7A 2DY8A 5LL6S 4HSPA 4R4CA 4A3EG 4CBVA 1IBKL 5EPLA 1VHEA 1HZEA 2V31A 4PC2A 1CKMA 1NR4A 4KJOA 4N3GA 3K81C 4LF5Q 3PMFA 3HOYB 2WIIB 2F0LA 1S4MA 3KBGA 2QDLA 2JA6B 2HDNB 5IYNA 2UUBQ 1B3AA 3CMAB 5J35A 1TVXA 3TRZA 3M7NA 2NVXB 4RD0A 1SNQA 1H42A 1LTLA 1WI5A 1N8RC 2N8NA 4R4OA 1BXTA 2EDGA 2Y0SB 1LT6D 4IUPA 3ITPA 2CQOA 2DCUA 3KOJA 4YY3Q 3ASQA 1H95A 4X7CA 1FJGQ 4QJFA 2SEBD 4EQOA 2IJ0A 3NP8A 2PQAA 3BNWA 4IFDI 1V43A 2CF4A 4ZCKA 1KRTA 5FKAC 1EY9A 5I2XA 1ZM2A 2MNAA 4NB3A 3A7LA 1UD5A 1I50B 1WCMG 2NZOA 1EIYB 4BBSG 4UP7A 3W2HA 1R5OA 1HFGA 3MAQA 5M3FB 1X55A 4DV4L 3G6JB 1K83H 2BGJA 3V96A 3BZDB 3GTQH 1KQSA 1DOKA 3ASRA 2YTVA 1VHOA 2BPOA 4X06A 5IYBG 2EYJA 1YNNC 5F4MA 3SKBA 1IKMA 1RQPA 3NUCA 4YALA 2N55A 2MQHA 4RGTA 2EOTA 2GJRA 1S72A 1HQRD 5D65A 4CKEA 1NRKA 5FO7B 4GOPB 1Y8OB 4Y7NB 2OWOA 4AH6A 2NVQB 3E0JA 3PENA 1W0KA 4XMYA 2HT1A 4Z4SA 5E1FA 1TIID 1U4RA 3T1YL 4X0CA 2UXDQ 5IYQA 4JI5Q 3S15B 4A3IB 1STHA 4CKCA 2VBTA 3OE7A 4PGOA 1YVCA 3B82A 5DS0A 2D5DA 1A15A 4QL5A 2X6GA 2F0QA 5C3WA 4IUVA 4LW1A 1CA5A 1KQSB 1DYQA 5C4JH 2RC6A 4KJNA 3AEVA 3HFZB 1GUOA 2Z8LA 4IW3B 2OTLA 3V2TA 2MGSA 3A8IA 1QUQA 4RD6A 1PYWD 3TZUA 2A6ED 3T51B 2PI2E 4JV5Q 2K14A 4ACBA 3FJOA 4XM3A 4QUCA 4DUZL 1JOQA 1OO9B 2FVGA 2Y0SG 4BPRA 3NK9A 2CQAA 1DDGA 4P3IA 3WXMA 3QR8A 2JA7H 3HOUB 4R4QA 1D2BA 5HY6A 2E8GA 1EEID 1Q7YD 2F3WA 3MXGA 4XDXA 3HOVB 1STAA 3BC9A 3I4OA 3GTJH 3X3NA 3TBIB 3QO2A 2B5OA 1VMPA 1FYCA 2B2VC 3C2PA 1XYIA 2L0CA 5JJLA 5JJZA 2VQEQ 1WTPA 3Q6SA 5EBCA 1AZQA 1SE3A 4O42A 1E3ZA 1XTDA 4R4IA 5FO9B 4Z4ZA 1STGA 2OT2A 4YIJA 1B53A 3I7FA 5M3MG 4B3TL 3CD6A 3BVGA 3HOXH 1LUZA 1BR9A 1N34L 1FNMA 5BR8L 4XT3B 3Q8DA 4J15A 1JWUD 3CRLC 3OZVA 2HCJB 3LWUA 4I65A 2IW3A 3P27A 4LFBQ 3W5VA 1C0AA 5IY0A 1PH5A 4YWKA 4F88A 3W1GA 3MZ5A 1PH4A 5AFWA 4GQNA 5CMDA 5ELDA 1IBLQ 5KNLA 4XQJA 1HNXQ 1PFMA 3FKIH 1X32A 1FGUA 3I4MG 3EROA 3KFUA 5JBQA 4FF2A 1LTBD 1N33L 4TMZA 4DXGA 1SR3A 1RCVD 4YELA 5M3FH 1CHPD 3LGJA 4RDKA 3DWQA 2E74C 1Q86D 2NWGA 4UPAA 2NBFA 2RA4A 2UXBQ 5IP7H 2WB1B 3WYAA 1SYCA 4HIOA 2KCMA 1QVFB 1PRTB 1CA6A 2CK3A 1OXSC 5CBEE 1EOTA 2HDMA 4JI0Q 1PH8A 1B23P 4TQUS 4BBRH 3SDZA 2JA5B 3VA5A 4DV5Q 1YI2B 2WP8J 5C0XG 1Y1WG 2BGIA 3CC7A 4JBJA 4A93H 4X3SA 2MO0A 3HZXA 2VXWA 2JIZA 2DNEA 2JA9A 2QILA 2Z1CA 3KDFB 4IFDG 4ALPA 1C4QA 2B7BA 1WOPA 2I5HA 3CP2A 4UAIA 1GUGA 3H0GB 1WOSA 2WZNA 1G7CA 2JEBI 2GN5A 3SLNA 3ZIAA 1VMCA 1STYA 4JI8Q 2X3UA 3P26A 4XOTA 1B44D 1N34Q 1NB0A 1ZM4A 3M4OH 2W6IA 2I46A 2D3NA 5CV5A 3KLSA 1PH7A 1IBLL 1OTCA 1W6JA 2HUGA 2A6EC 1EWYA 1LTAD 2IL8A 4DAYA 1EFID 4ZYSA 1VJSA 1UD6A 1XWEA 1SM4A 3M4YA 5C0XH 1Y1WH 2HLDA 1LYLA 4X7DA 3E20A 2ZXHA 3CCJB 1Q7YC 4XQNA 2WFWA 4R4TA 2ZJPA 2RF4A 3VR3A 4XN0A 1D5XC 4A3FH 3S2HB 5LL6X 2DOGA 3T13A 3GDEA 2BH8A 5C4XB 3D31A 2HIVA 1E1QA 2UXCQ 2K04A 2ES2A 1VQMB 4CJ2C 4P6YA 1IHMA 1F9PA 5HZAA 1V1QA 5EQ0A 3UDIA 4XLAA 4CHTB 2YU9B 1X3FA 4NDXA 2YWGA 4BXXG 2K01A 2OK7A 4NNJA 5CV8A 4DV5L 1E2ZA 3A3GA 1O80A 4XQFA 1CQVA 1PJ6A 4EX5A 3I3CA 4XYQA 4RHRA 1XMOL 3WBJA 4XQQA 3GTMB 3HOZB 1S72B 1BCPB 1W3SA 1YNJC 4DK3C 2R3ZA 3F2CA 1WTXA 3W5OA 1B8AA 2B2UA 4BBRG 1EQRA 3CCJA 2V4DA 1IBMQ 3E3XA 1QWYA 2OYNA 4OXPA 4RGNA 4RAUC 1NCVA 5IYCH 2VQFL 3S16H 2Z6KC 1IYVA 2JA8G 2XTIA 2N78A 3CCLA 1X65A 2BM1A 2DY7A 2K03A 1ELOA 3G71A 1SNCA 4M1KA 1GKHA 4POGA 2ZTGA 5FO0A 2EYPA 4DR7Q 3DUZA 4K6LA 2C2WA 3I55A 1A8VA 1KTVA 2V7WA 1Q8IA 2KQ3A 5DEHA 2ZTNA 4X64Q 3J7AF 1V1PB 1NMGA 1TUIA 1H85A 2XGJA 4G1VA 3W2DA 3KLWA 3KUPA 3KLSX 1K8AC 1EY4A 1TWAB 3AB9A 1CNFA 4AQYL 4H44C 1VQNA 2UUAQ 3KF6B 3U6KA 2XIWA 1HXYD 2BSAA 1P16A 3URYA 4DNRB 1PTOB 5E7NA 2KENA 5C4JB 1HHVA 3PO2B 2AQ2B 2RSOA 3QJYA 3HOXB 3D26A 2RCFA 5BN4A 1UE1A 1X56A 4I7AA 5EKKA 3PSIA 2D0PA 4K5WA 1CNEA 4P26A 2F0OA 2OBRA 4Z9CB 1PZJD 1CZGA 3ASSA 3VMFA 4DNTB 2HQEA 3H6MA 3JAMi 2RC5A 4GKJL 3PUWA 2NYZD 3AYHB 4DR5L 4P3YA 2E2HB 1IBML 4YHHQ 1QUFA 3MWYW 4U9UA 2ZXPA 2PNRC 3R2IA 4KKSA 1QZGA 2ZXOA 1EQQA 3CW2A 4JI7Q 1H9KA 4DV1L 3TS2A 3U58A 1BCPD 4RDJA 3LNNA 3ULJA 1HUMA 4DV3L 2EZVA 2AWNA 1QZHA 4DR7L 4MN3A 3NBHB 3G6EA 2C5HA 1LTGD 1HUNA 1R4QB 2C4TA 3D4RA 3CC2A 3TS0A 1CZWA 4DV0Q 1YX2A 4GNXA 3A8JA 2AWOA 2UU9Q 1O7LA 2K6AA 3K8AA 1TWAH 1I94L 1BBWA 4F8MA 3A74A 1GUTA 3DM3A 4DF7A 3OHXC 1D6EC 2YTYA 5I6WA 2MO1A 1XPRA 2BM0A 1EFTA 1SAPA 1WCMH 4BBSH 3WBKA 3W5UA 1WCMB 4BBSB 2AMCB 2FMCA 3CHBD 2A6HC 1FNDA 1E7ZA 2EY6A 4A3IG 5K36H 2BDOA 3ZZUA 4C43A 5C3EH 1B9NA 4FF4A 5GAGC 1GO2A 4GKJQ 1NJIC 3U9OA 5FNZA 3D8GA 4XL9A 1TS2A 3W5HA 1B4OA 2OQ0A 3HOUG 4OWTB 3HP3A 3A1PA 3AGQA 4PG3A 2CW0C 1GUWA 1DONA 3AQQA 2XN9C 4ZCMA 1R5BA 2CRVA 1MSGA 2MPMA 5GQOA 3CPWA 1Q86C 3HAGA 1O7IA 1E64A 1PTOD 2LSSA 5GV8A 1GAWA 2FJ2A 3X3MA 4O0AA 4RGMA 4YCUA 5KYLA 4DV3Q 4CQJA 2PZTA 4DV1Q 2L11A 4YAFA 1BKBA 4L6TB 1VQ8A 4K6DA 4LUOA 1I3QB 2EJMA 4QIWB 1PYBA 1FD7D 1OXVA 2BDNA 1Q8KA 5AJ3L
chains in the Genus database with same CATH topology
4GZYC 3KF8A 1BUVT 2RQXA 3A54A 1JICA 1LTID 1DOMA 3G05A 2WJYA 2K05A 1U4MA 4FF1A 1F2YA 5IGFA 4MHEA 3K5OA 3GTLB 3OWEB 2BE5D 3RMHA 1H9SA 1UNSA 1WTWA 1E2WA 5DM63 2L5TA 3A35A 4A3KB 4CJ0B 2WZPP 2VJJA 1ZYRC 3IL8A 1BCPC 1Q90A 4QB4A 2M9VA 3U9SA 3JAML 2F0UA 1EY7A 1TY0A 1BPLA 3BDLA 2MP1A 4CGYB 5D14A 2GK6A 3MEHA 2NTSA 4H13C 1MABA 4HCSA 3OFNA 2E75C 1SYFA 1KNAA 1LT5D 4B9XA 4A3JB 4LMQD 1LT3D 4KN4C 1RKNA 2MHVA 3HOWB 2R61A 3SR1A 1PRTF 1SNPA 1VDZA 3CKIB 5IT9L 4K8JA 1Q12A 1OXUA 2PPBC 1BNZA 4XIGS 4KMUC 1UD2A 4KN7C 3NBHA 1E3XA 1I18A 2IX3A 1EIGA 3W3AA 1V8QA 2RVLA 2QE7A 4X3UA 1TWGB 4WRDA 1Z47A 4DXFA 3GVJA 2RDFA 4R8IA 1L0YB 4M8AA 3I73A 4RFBA 4XNFA 1K8OA 1PDQA 1YNJD 5ELFA 5IGEA 2B2WC 3ONAB 5C5LA 4E0FA 3T16A 3PO3B 1R9TB 4IFDH 1BF4A 1J9OA 1F77A 1E0BA 3G7LA 5E4XA 2D62A 1GUNA 2ZZQA 4B08A 1STEA 4NP5A 2JJ2A 5EJWA 5KNBA 1MGSA 2EXZA 1UUPA 1F2ZA 5F2DA 4H0LC 3VA7A 2K33A 3OPOA 2LFNA 3A8KE 1XX8A 2NN6H 4OIJA 3PIP3 3GTKB 1PTOH 1PRTD 5KNCA 5CV9A 4IUUA 1RDPD 2F0HA 3SEBA 3AU7A 5DNFA 3EJIA 5CV7A 1K83B 3NWTA 4EGVA 3CP8A 3C1EA 2HDLA 3K5LA 4E6IA 1UD3A 2R7ZB 4KHVA 1SE4A 2F03A 5IGGA 4Q5VA 2WAQB 3UI2A 1I4PA 4HSVA 1LV9A 2TSSA 5LHY1 3I4NB 2KCCA 2ID0A 4JMQA 1ZKOA 3Q0AA 2O2LD 3SK4A 3TP7A 3QOLA 5C3EB 4OL7A 2F43A 2PYKA 1B50A 5ELEA 1I4RA 2M5SA 1JOOA 2XSCA 5DN6A 3GTOB 3CESA 2KA7A 2GK7A 3QIAA 2DNCA 1WTHD 5KYIA 2AQ1B 2H1EA 4J6HA 2KCNA 3FKIB 3BVMA 2K5WA 2NUCA 3E5SA 2WINB 4FXGC 4XKVA 5HGTA 3GQBA 2X85A 2F0MA 1RJTA 1ZEQX 1UD8A 3CMMA 1I6VC 2WJVA 3S1NB 4ID6A 2EVBA 2EYFA 2OF1A 2FHTA 2WACA 3MTSA 3HGBA 3R2TA 2I07B 2A74C 4TSSA 2KECA 5FO8B 1ESFA 5ELBA 2NN6I 1IW7C 3PUYA 3HS0C 1KLGD 2X6LA 1SKYB 2ENBA 3OIPA 3SHLA 4FVMA 1SMYD 1AZPA 2F0VA 5G3LD 2PCFB 2R92B 1PKVA 2JXMB 3TZDA 4ZKBB 2B8FA 3E6ZX 1ZYRD 1WTRA 4BS9A 2A73B 4KHZA 1V1PA 4XOPA 1Y69U 2PZUA 3BYYB 3SK8A 2A6HD 2FINB 4DAVA 1JWSD 2L55A 1FGBD 4NW2A 1HTLD 1AN8A 1PFNA 2X53S 1A3VA 3TN2A 2ICEC 5I9PA 1SFOB 1WTOA 2K28A 4RWSC 3L9AX 3DM1A 1STNA 1EQTA 4C1NI 2L4NA 4RCNA 5COYA 1G2TA 1Y1WB 1EZ6A 1EY5A 2ZZGA 4S3SA 1CHQD 3JU4A 3J81L 1EWHA 1QB5D 3VR4A 3KLRA 1ENAA 1BLIA 3OEHA 1BQQT 3WDNA 4A3FB 4B9WA 3MFYA 4R8NA 4PQXA 1G6ZA 1HTPA 4C56C 2O5JC 2B2YA 1JWMD 3L7ZC 1WD0A 1U4PA 1AEXA 1I4HA 4C3HG 3IAYA 1LTRD 1KDCA 1TT2A 2PZWA 4DK1A 3SVMA 3DDYA 3NTKA 1S5FD 3C3LA 3J81E 4J1MA 1I6HB 3A7AB 5C4ZA 2PW5A 1C48A 4XKWA 1TKWB 2Z4HA 2EYMA 1IKLA 2L9HA 3NXWA 3BCFA 1JCKB 4X3KA 1RTOA 1XXGA 3AMUA 1I8DA 1CTMA 1PLFA 1W0JA 5CR3A 3H91A 2YYZA 3DEPA 4K8IA 1PZID 2Z4IA 5M9OA 4XORA 1QG7A 3IFTA 4IUTA 5A2QE 4N9PA 1OXXK 3FPPA 3K5NA 2F4IA 1OXTA 2XNDA 4RKLA 2D2CC 4A93B 3ERQA 4UDUC 4V190 1ENCA 3RUZA 2XRSD 3MXUA 2F0KA 5CBAE 1Q1EA 1GUSA 4K2KA 4R9WA 1QILA 3GVLA 2O4XA 2EJGC 4ZK9B 1TR5A 1QJOA 2JYOA 3BDCA 1VLYA 5EPKA 1SSOA 5KGUA 1BO0A 2XRQD 1SXTA 4KTAA 3PV0A 1B2TA 2Q8IB 1HQMC 4PMWA 1PXUA 1A2TA 4BY7B 1NAPA 3D3RA 5D3IB 1KZLA 5FOBB 4WFN3 2MJ8A 1X3PA 4QF4A 3WOEA 1DXMA 1MBYA 2RKSA 5FLXL 1FNVA 3OW7A 3VR5A 1V0EA 2KUMA 5KRUA 1TQOA 3BS1A 2KVOA 4XONA 2B2YC 3T56B 3K7AB 4HEDA 1J8IA 3H94A 4ZUIA 1E43A 1E2VA 4RH6A 5M5YB 3F2UA 1CM9A 2QCPX 5DM73 2WKCA 1H9SB 2M2LA 4DAPA 3K5MA 5C44B 5JEAH 2D3LA 1D5MC 1II3A 1HVXA 1SMYC 1G291 4TRDA 3BDOA 3OEEA 1KTKA 1SNOA 2ZT9C 3GV6A 4DGZA 1OHHA 5EGTA 1DJRD 1WVLA 1E79A 5K5PA 3CRKC 3GTPB 1SBBB 4B3GA 5IGCA 2FFKB 2OXPA 4ASUA 5FLXE 2ICIA 2SNSA 3CQZB 3MHBA 3A8JE 3OMCA 1EZ8A 3SE0A 3TSSA 1EQVA 1EU4A 1SDFA 4H7BA 1SEBD 4IFDJ 1D5ZC 2VUMB 2VB3X 1RD9D 2WV6D 2Q8TA 2G9DA 4HMJA 1FX0A 1VCIA 5JOBA 1D1IA 1TWFB 4JBWA 4RKBA 5CYUA 2A68D 1EIHA 1UD4A 1S4ZA 2EJFC 2J7ZA 3NTHA 5C3XA 2IPKD 2TMPA 5IGBA 3FDTA 3S2DB 5CDFA 2L1BA 2C9OA 1JC7A 4P22A 1KLUD 2BA1A 4EQNA 4IURA 1EY8A 4FXDA 4XLFA 2B2TA 1CI3M 2PW7A 2NB0A 2IX1A 3JAME 3S17B 1F9RA 1H8EA 1EWCA 2JE6I 2D9UA 2JEAI 1MSHA 4OHJA 1E1RA 2AUKA 5IGDA 2N88A 2B8GA 1S5DD 3K6OA 2R6GA 1LACA 5CGKA 2LMCB 3NTIA 3D6WA 3GP7A 4ZUJA 5M5XB 2BE5C 4CJ1B 3ZYYX 4U673 4WORA 2RDGA 4TKOB 3J80E 1UEAB 3IFDA 3T4AC 4KD3A 4HAEA 1KABA 1SJED 4B3FX 3DXJC 1IYUA 2V7QA 4KY5A 3R8BA 1EY0A 4O1NA 4P2CB 3DWPA 1JOKA 2A5HA 2WKDA 2A69D 2F0PA 2JDIA 5NUCA 3Q22A 3EFXD 1KDBA 4LJZC 4L8JA 3ZPNA 5C6AA 5DAUA 5C5MA 4OO1H 3NBIA 4A3BB 4RHSA 3VYSA 2O5IC 4ZRZA 3FVQA 4II2A 1G2SA 2F0WA 1H9MA 5CV6A 1GHKA 3OIQA 4ILWA 1ET6A 1LTTD 2G9HD 5KIXA 4V0BA 1ONLA 2EY2A 3MVVA 4JK1C 2B63B 4OO1G 2RDHA 2E2IB 1A2UA 4ODGA 1NBMA 4XLEA 3BYTB 1FR3A 1EY6A 3M4OB 5JPMC 2B2TC 1XTCD 2XOKA 5EPJA 4EQPA 3S16B 1HCZA 3HEJA 1CT1D 4RGOS 1ET9A 5T1GA 2JJ1A 3S14B 1G8ZD 2EPBA 4XLHA 2XWBB 5G3LF 2XNAC 2R93B 3PUXA 3R3OA 5J22A 5I4DA 2F0SA 2IT1A 4TSFA 3DEOA 3PUVA 4FYDA 2F0NA 4QUFA 3MXNA 2LKVA 2BA0A 5I6YA 5E3FA 2B2UC 4KY6A 4HMIA 5EBDA 2HCIA 3H3VC 1F9SA 3H09A 4L63B 3S1MB 1CQFA 4XYOA 3WQZA 3J7AV 3FKSA 3S9WA 2J0TD 3N52A 3QWNA 2K32A 5M3MB 3KBXA 1SNMA 1H8HA 1BMFA 3OAAA 2NVYB 5C0XJ 1R4PB 3QB3A 3I4LA 3OOCA 1EYCA 1GHJA 4XD7A 1S5ED 4ULLA 5C0XI 1NR2A 3NSWA 2E2DC 1ILPA 1F9QA 1RHPA 5A2QL 5D3DA 4LAAA 2X69A 3VYUA 2F0EA 5ELCA 4KD4A 1WTVA 5C4HA 3FRPB 3TP8A 3RZOB 3TDQA 4C3JG 3BCDA 4XLCA 1Y8PB 1ICWA 5J1ZA 2GJKA 2NN6G 2CVRA 3Q24A 1PTOF 1TWHB 4EVOA 4G57A 4G7XA 3A8IE 1SYEA 2NVQB 3SK5A 5JAVA 4YXWA 3A3BA 4NMZA 2E2JB 2F0DA 2PMZB 3NPPA 1JQYD 1O7ZA 1TY2A 3OWFA 1AW7A 4KV6A 1IW7D 2SNMA 3QG1A 3EA6A 1Z7TA 1GJXA 5IODA 5CV4A 1Y1VB 1DZ1A 4HR7B 2SDFA 1QNUA 4F7XA 1YNND 5JVG3 4PV1C 4XXEA 2L12A 4ABNA 1TS3A 4C3IB 2EYOA 3LX0A 1Q3LA 2KOLA 1PMRA 2VJIA 4ME5A 3EVQA 2K7VA 1WD1A 3KK7A 2BOSA 1ENFA 3SXHA 4XT1B 4IQZA 2A69C 1U9RA 3TP5A 1B9MA 2F0FA 4HIZA 2WSSA 1VF5C 1SYDA 3RZDB 2LY7A 4CKBA 3D4WA 2IWHA 3HKZB 3O13A 3I90A 1B1ZA 4U68A 2KEDA 3S1RB 4IUQA 2C5CA 4G6IA 1HA5A 3RLFA 5EKLA 3GTGB 2F0TA 1QE6A 4RA8A 1L0XB 3VYTA 2ZXIA 3M3YB 3RD4A 4FXKC 1A3UA 1RF2D 1T5EA 4FO2A 4G7ZC 1SYGA 3BVZA 1JB3A 4HN7A 1LO5D 3I8ZA 2AQ3B 1H9JA 4IUNA 5IIFA 1X3QA 1A6XA 4ZQ3A 2LZJA 2LS01 1COWA 5JPNC 4BY1B 1EYDA 1IHZA 3FPUB 4XR6A 1STBA 4KKTA 5JEAG 4Q0FA 5HURA 2B2WA 4ZLTF 4TT3A 1T5XD 2BCOA 1D1KA 3HG9A 1C8CA 1EL0A 4DN4M 3T53B 1M4VA 4A3MB 2CHBD 3ND9A 1SJHD 2E76C 3TP6A 4PNYA 1QOHA 3VR6A 1LT4D 2FMMA 5K36G 3NE5B 3OMGA 1I4XA 3P7JA 1ZXTA 1LLRD 5CORA 4M1UB 2OEOA 4XN3A 4I7ZC 1JE4A 3DMUA 4K14A 2H4OA 2F0IA 4G7HC 1RTNA 3GV3A 4BBRB 1DOLA 3D6CA 3GD7A 1K8MA 4KKUA 4IN3A 2RSNA 1GOZA 1A3TA 4ZAIA 1H9RA 2F0JA 1SNDA 2KHSA 1TWCB 3A56A 1DD2A 2VB2X 4C2MB 3WOFA 2SOBA 2Z6BD 4FP5D 3N6RA 1WPCA 1W9XA 5M5WB 2GJPA 4PMBA 1I4GA 1MD2D 1W6KA 1TS5A 2PQEA 4QMGA 1O78A 1EU3A 4N9TA 1PZKD 4KI0A 3I91A 4AYBB 4G7OC 1JR0D 1VF7A 4FXUA 1HA6A 2KJXA 3M85A 4J8QA 4DFAA 5JVH3 4WJWA 2NZ1D 1HFNA 1Y8NB 2B2VA 1WTQA 4DA2A 1SYBA 3QOJA 4BA2I 2JSOA 4C3JB 1V1OA 1EEFD 3KEWA 2Q8RE 1O7YA 1BDOA 4ZKCB 1AFPA 4DU9A 1FNUA 1QNKA 2XVSA 2JA8B 1M8AA 4A3DB 2EY5A 3K59A 2R9VA 4A3GB 2PO4A 2DN8A 3I70A 3VYRA 1KAAA 3GO5A 3PUZA 3Q23A 4FF3A 5IOCA 1KDAA 3SK6A 1Q1BA 4RCOA 5JEAJ 4C1NK 2F1MA 3GVKA 4HTHA 3DHQA 3GTJB 2F0GA 1IL8A 2A68C 1K28D 3MA2B 4HCEA 4UZUA 3PIO3 1CFMA 1EYAA 5IT9E 1BOSA 3R93A 4C3IG 2AUJD 4IALA 4KK7A 3C46A 3M7GA 1U4LA 5BN3A 2X6XA 1SE2A 2NTTA 1UAPA 3NHHA 2QDBA 1V0FA 3LWEA 1LABA 1ML0D 1TU2B 3K0YA 4DK0A 2EY1A 4A3EB 1BCPF 3S1QB 4BA1I 2WPDA 2EYLA 2CW0D 5HKKA 4OGQC 1LTSD 5A35A 5I9OA 3K58A 1ESRA 2XWJB 4K5XA 1PTOC 2XZPA 2EE1A 1QCBD 2JA7B 4IZ8A 3TMEA 1FNWA 4BWGB 3L3OC 3C1FA 1JORA 1F2LA 4YEJA 3A55A 1EFRA 2MUYA 2KEEA 1KNEA 3IKJA 1WP6A 1HPCA 3FMCA 3V05A 1NUCA 2B39A 3J80L 4MIUA 4Z1MA 3MXPA 4K2LA 2E1BA 1I4QA 2QKIC 2QF7A 1ILQA 1HRJA 2RBMA 3D4DA 4F87A 3I72A 2F3VA 2GA4B 1G91A 3J7YW 2J4XA 1Z6HA 5I2YA 1PFBA 4QCLA 4K5VA 2VNUD 4OIKA 1NSNS 1KMHA 2KVMA 3MFGA 5J39A 3P75A 3CU7A 2XZOA 4KY7A 5FL7A 1DCZA 3NWSA 3NQTA 2JP1A 2K5DA 4II3A 2X6YA 3DWAA 4NKLA 5BN5A 3K57A 3P1HA 4OO1I 3BG3A 1RODA 4G7WA 1S5CD 1DM0B 3OSOA 2IX0A 2QEJC 3HRZC 3I4MB 2NVTB 2EYHA 2ZZEA 1BBXC 4X3TA 2M00A 5EKIA 2ZZFA 1GXDC 1TS4A 1F2MA 3EQLC 2DIEA 1CK1A 4PMCA 2XZLA 4G4KA 4XTCS 1PRTC 5CC4A 3FEWX 5ISRA 3BH4A 1S5BD 2W6JA 5KEEA 3VR2A 2X8KA 1OB0A 1AP0A 5E4WC 3GTQB 5T1IA 3MC0B 3P20A 4AVZA 5FK9C 4LK1C 4C3HB 2ZXRA 5KNDA 5TSSA 3NQIA 2X6WA 2HCCA 2K5QA 2K1BA 1MI2A 3ND8A 5IK2A 4FNFA 2DY8A 5LL6S 4HSPA 4CBVA 5EPLA 1HZEA 2V31A 4KJOA 1NR4A 3PMFA 3HOYB 2WIIB 2F0LA 3KBGA 2JA6B 1B3AA 1TVXA 3M7NA 2NVXB 1SNQA 1BXTA 2EDGA 2Y0SB 1LT6D 4IUPA 3ITPA 2SEBD 4EQOA 2IJ0A 3NP8A 4IFDI 1V43A 5FKAC 1EY9A 5I2XA 3A7LA 1UD5A 1I50B 1HFGA 3MAQA 5M3FB 3G6JB 3V96A 3BZDB 1DOKA 2EYJA 1YNNC 1IKMA 3NUCA 2N55A 4RGTA 2EOTA 2GJRA 1HQRD 5D65A 4CKEA 1NRKA 5FO7B 1Y8OB 4Y7NB 3E0JA 1W0KA 4XMYA 5E1FA 1TIID 1U4RA 3S15B 4A3IB 1STHA 4CKCA 3OE7A 2D5DA 1A15A 2X6GA 2F0QA 5C3WA 4IUVA 1CA5A 1DYQA 4KJNA 1GUOA 2Z8LA 3V2TA 2MGSA 1PYWD 3TZUA 2A6ED 3T51B 4QUCA 4XM3A 1JOQA 1OO9B 3NK9A 2CQAA 3HOUB 1D2BA 1EEID 2F3WA 3MXGA 4XDXA 3HOVB 1STAA 3BC9A 3X3NA 3TBIB 3QO2A 1VMPA 3C2PA 1FYCA 2B2VC 1XYIA 2L0CA 5JJZA 1WTPA 3Q6SA 5EBCA 1AZQA 1SE3A 4O42A 1E3ZA 5FO9B 1STGA 2OT2A 4YIJA 1B53A 3BVGA 1BR9A 4XT3B 1JWUD 3CRLC 3LWUA 4I65A 2IW3A 4F88A 3MZ5A 5AFWA 4GQNA 5CMDA 5ELDA 5KNLA 4XQJA 1PFMA 1X32A 3EROA 4FF2A 1LTBD 4DXGA 1RCVD 4YELA 1CHPD 3DWQA 2E74C 2NWGA 2NBFA 2RA4A 2WB1B 1SYCA 1PRTB 1CA6A 2CK3A 1OXSC 5CBEE 1EOTA 2HDMA 4TQUS 2JA5B 3SDZA 3VA5A 2WP8J 5C0XG 4X3SA 3HZXA 2VXWA 2JIZA 2DNEA 2QILA 2Z1CA 4IFDG 1C4QA 3CP2A 4UAIA 1GUGA 3H0GB 2JEBI 3ZIAA 1VMCA 1STYA 4XOTA 1B44D 2W6IA 2I46A 2D3NA 5CV5A 3KLSA 1W6JA 2HUGA 2A6EC 1LTAD 2IL8A 4DAYA 1EFID 4ZYSA 1VJSA 1UD6A 1XWEA 3M4YA 5C0XH 2HLDA 2ZXHA 4XQNA 3VR3A 4XN0A 1D5XC 3S2HB 5LL6X 3T13A 5C4XB 3D31A 1E1QA 2K04A 4CJ2C 1F9PA 5EQ0A 4CHTB 4XLAA 2YU9B 4NDXA 2K01A 4NNJA 5CV8A 1E2ZA 3A3GA 1O80A 4XQFA 1CQVA 3I3CA 4XYQA 4RHRA 4XQQA 3GTMB 3HOZB 1BCPB 1YNJC 2R3ZA 1WTXA 2B2UA 2V4DA 1QWYA 4RGNA 4RAUC 1NCVA 1IYVA 2DY7A 2K03A 1SNCA 2ZTGA 2EYPA 3DUZA 4K6LA 2KQ3A 1Q8IA 5DEHA 2ZTNA 3J7AF 1V1PB 2XGJA 3W2DA 3KUPA 3KLSX 1EY4A 1TWAB 3AB9A 4H44C 2XIWA 1HXYD 3URYA 4DNRB 1PTOB 5C4JB 1HHVA 3PO2B 2AQ2B 2RSOA 3QJYA 3HOXB 5BN4A 5EKKA 4K5WA 2F0OA 4Z9CB 1PZJD 1CZGA 2HQEA 4DNTB 3H6MA 3PUWA 2NYZD 2E2HB 3MWYW 2ZXPA 2PNRC 3R2IA 4KKSA 2ZXOA 1H9KA 1BCPD 3LNNA 1HUMA 2EZVA 2AWNA 4MN3A 1LTGD 1HUNA 1R4QB 3D4RA 1CZWA 2AWOA 1O7LA 2K6AA 4F8MA 4DF7A 1GUTA 3OHXC 1D6EC 5I6WA 1SAPA 1WCMB 4BBSB 2FMCA 3CHBD 2A6HC 2EY6A 5K36H 2BDOA 4FF4A 1B9NA 3U9OA 3D8GA 4XL9A 1TS2A 1B4OA 1GUWA 3HP3A 2CW0C 1DONA 2XN9C 1MSGA 2MPMA 3HAGA 1PTOD 2FJ2A 3X3MA 4RGMA 5KYLA 2PZTA 2L11A 4L6TB 4K6DA 1I3QB 2EJMA 4QIWB 1FD7D 1OXVA 2BDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY C;  3T53 B;  1Y69 U;  2K7V A;  2D5D A;  1ZKO A;  3CRK C;  4DNR B;  1GUG A;  2A6H D;  2JEB I;  2A69 D;  4XTC S;  4IQZ A;  3ND9 A;  4LJZ C;  3MXU A;  4L8J A;  1Q1E A;  2A69 C;  2E76 C;  3QJY A;  1GUS A;  5BN4 A;  3I73 A;  1GUO A;  2EJG C;  4OO1 H;  2QF7 A;  1K8O A;  1QJO A;  2DN8 A;  3VR6 A;  3A8J E;  1B9M A;  5K36 G;  3VR2 A;  3SE0 A;  3NE5 B;  2K32 A;  2A6E C;  3PUZ A;  2O5I C;  3TZU A;  4DNT B;  3I72 A;  2A6E D;  2BE5 D;  3T51 B;  2KA7 A;  3PUW A;  3QIA A;  1VF5 C;  1H9S A;  2DNC A;  3M4Y A;  4I7Z C;  1H9M A;  5C0X H;  4RCN A;  3P20 A;  3I4L A;  4LK1 C;  1GHK A;  3OOC A;  1Q1B A;  5KND A;  1GHJ A;  1Z6H A;  4G7H C;  1E2W A;  3PV0 A;  2PNR C;  2L5T A;  4KKS A;  4IFD H;  2F1M A;  1VCI A;  3ND8 A;  1H9K A;  3VR3 A;  1ZYR C;  3GD7 A;  1K8M A;  4JBW A;  4KKU A;  2Q8I B;  1HQM C;  1EWH A;  2A68 D;  1ONL A;  1Q90 A;  2EJF C;  3VR4 A;  3KLR A;  3D31 A;  1H9R A;  3U9S A;  2A68 C;  3WDN A;  1FYC A;  3GQB A;  2D62 A;  3LNN A;  1CFM A;  1DD2 A;  1GUN A;  3MFY A;  4JK1 C;  3RLF A;  2AUJ D;  4OO1 G;  3N6R A;  1Y8P B;  1HTP A;  2O5J C;  2NN6 G;  2BA1 A;  5KNB A;  3D4R A;  5BN3 A;  1I6V C;  1DCZ A;  1DXM A;  1E2Z A;  1FR3 A;  2AWO A;  3L7Z C;  3M7N A;  1O7L A;  2EVB A;  3A8I E;  3OW7 A;  1T5E A;  1CI3 M;  1GUT A;  2EDG A;  4H0L C;  3VA7 A;  5BN5 A;  3CRL C;  2K33 A;  3HGB A;  3LWU A;  3OPO A;  4H13 C;  3VR5 A;  4G7Z C;  1YNJ C;  4DK1 A;  3A8K E;  1O78 A;  2NN6 H;  2E75 C;  1LAB A;  3BG3 A;  1TU2 B;  2JE6 I;  2JEA I;  2A6H C;  3A7A B;  2NN6 I;  1IW7 C;  3T56 B;  4DK0 A;  1V43 A;  3PUY A;  5K36 H;  4KI0 A;  2BDO A;  3H94 A;  2AUK A;  5KNC A;  1B9N A;  1IW7 D;  2V4D A;  2B8G A;  1HCZ A;  1H9J A;  4BA1 I;  3QG1 A;  3A7L A;  1TKW B;  4KN4 C;  1Z7T A;  1LAC A;  2R6G A;  2LMC B;  1E2V A;  1IYV A;  1GJX A;  1A6X A;  4G7O C;  1VF7 A;  1H9S B;  4OGQ C;  5A35 A;  1CTM A;  2CW0 C;  4HR7 B;  3M85 A;  2BE5 C;  5JEA H;  2E74 C;  2PCF B;  1SMY C;  2YYZ A;  3FMC A;  1G29 1;  4PV1 C;  1VDZ A;  1Y8N B;  1YNN C;  2JXM B;  3PUX A;  4TKO B;  1OXS C;  3BDO A;  2IT1 A;  1Q12 A;  4BA2 I;  4KKT A;  4TQU S;  1OXU A;  2B8F A;  3IFT A;  5JEA G;  2PPB C;  2ZT9 C;  3SDZ A;  3EQL C;  1OXX K;  1Y8O B;  4XIG S;  4KMU C;  3FPP A;  5C0X G;  4KN7 C;  2KCC A;  3PUV A;  1BDO A;  1PMR A;  3AB9 A;  2EJM A;  3DXJ C;  4H44 C;  1IYU A;  2BA0 A;  1OXT A;  3W3A A;  1V8Q A;  2DNE A;  4KHZ A;  1OXV A;  3IKJ A;  4IFD G;  1HPC A;  2D2C C; 
#chains in the Genus database with same CATH topology
 4GZY C;  3KF8 A;  1BUV T;  4WZT A;  4GLA C;  2RQX A;  3A54 A;  4LF5 L;  2VNJ A;  2P3M A;  1JIC A;  1LTI D;  1DOM A;  4GOP A;  2A8V A;  3G05 A;  2WJY A;  4RLZ A;  2K05 A;  1VQ5 B;  1U4M A;  4FF1 A;  1F2Y A;  5IGF A;  4MHE A;  3D0F A;  3OJW A;  1VQO A;  1GD7 A;  3K5O A;  3HOY G;  3GTL B;  3OWE B;  2BE5 D;  1KK2 A;  3RMH A;  4NXM Q;  3EBE A;  1H9S A;  4LBV A;  1YHA A;  1UNS A;  5ELO A;  4A3L G;  2EIF A;  1WTW A;  2K75 A;  2GVA A;  1E2W A;  4AQY Q;  5DM6 3;  2L5T A;  4LF8 Q;  3A35 A;  4A3K B;  4CJ0 B;  2WZP P;  2VJJ A;  1ZYR C;  3IL8 A;  1BCP C;  1Q90 A;  4QB4 A;  2M9V A;  3U9S A;  4JI0 L;  2WAQ G;  4L5Q A;  4LF7 Q;  4B47 A;  3JAM L;  1HZA A;  4CDC C;  3BY1 A;  3JAM c;  2F0U A;  1EY7 A;  1TY0 A;  1BPL A;  3BDL A;  4DR5 Q;  1NE3 A;  2MP1 A;  4CGY B;  2EXD A;  4LF6 L;  2ZTE A;  4P1V A;  3M4P A;  5D14 A;  2BN4 A;  4P73 A;  2GK6 A;  1QH0 A;  3MEH A;  4QY7 A;  2LXJ A;  2NTS A;  4JI5 L;  4A3D G;  4H13 C;  1EP2 B;  1MAB A;  4HCS A;  3OFN A;  2E75 C;  1SYF A;  3CC4 A;  1KNA A;  3HOZ H;  1LT5 D;  3R6J A;  4B9X A;  4A3J B;  1JMC A;  1NMF A;  4HJ8 A;  1VQP A;  3AFQ A;  2ZJR A;  4LMQ D;  2PI2 A;  1LT3 D;  4KN4 C;  1RKN A;  2MHV A;  1NB9 A;  3HOW B;  4DR6 L;  2R61 A;  4OOV A;  3SR1 A;  1PRT F;  5THX A;  4Z4V A;  4LWC A;  5GRO A;  1SNP A;  5J3B A;  1VDZ A;  4F7D A;  3T1H L;  1GR1 A;  1I94 Q;  1VQH A;  3CKI B;  5IT9 L;  3RZO H;  4K8J A;  1Q12 A;  2KHJ A;  1OXU A;  2PPB C;  3J81 c;  1BNZ A;  4XIG S;  4KMU C;  1FJG L;  3QFR A;  1UD2 A;  1IXR A;  3NBH A;  4KN7 C;  1E3X A;  1I18 A;  1E1O A;  1JE5 A;  3MCA A;  2V1C C;  1PYS B;  2IX3 A;  4L5S A;  1EIG A;  4P9S A;  5H59 A;  3W3A A;  3CME B;  1V8Q A;  2RVL A;  4ZV4 A;  4PZ6 A;  4YWM A;  2QE7 A;  2D0O A;  3U4Z A;  4K0K Q;  2WAQ E;  4X3U A;  1KC8 D;  1TWG B;  4WRD A;  4APV A;  1Z47 A;  1VQ6 A;  4DXF A;  3GVJ A;  4TMW A;  1M90 C;  1KD1 D;  4DV2 L;  2RDF A;  4R8I A;  1L0Y B;  4M8A A;  3L2P A;  3I73 A;  4RFB A;  4XNF A;  1K8O A;  1HR0 W;  1GAQ A;  4GOP C;  1PDQ A;  4OWX B;  1YNJ D;  5LMU L;  1JT8 A;  5ELF A;  1SRU A;  3J81 i;  1J6Q A;  1Q46 A;  5IGE A;  1YIJ A;  3U6B A;  4KHP L;  2B2W C;  3ONA B;  3OYY A;  4HIK A;  5C5L A;  1V5V A;  1KK0 A;  4E0F A;  5IYD G;  2F52 A;  3T16 A;  4JC0 A;  2F4V Q;  1R9T B;  3PO3 B;  4IFD H;  2R93 G;  1BF4 A;  2CH4 A;  4IPH A;  1J9O A;  4JI2 Q;  1F77 A;  1E0B A;  4RMF A;  3QFT A;  4QHY A;  2CH4 W;  3G7L A;  1KK3 A;  5E4X A;  2D62 A;  5LMN L;  1GUN A;  4X64 L;  2ZZQ A;  4B08 A;  2Q6L A;  2JA6 H;  4QUZ A;  1STE A;  4DUY Q;  4NP5 A;  1VQ4 A;  4HIM A;  2JJ2 A;  5EJW A;  4UZE A;  4HJA A;  1TWH H;  4GN5 A;  3I2Z A;  5KNB A;  5IT9 c;  1MGS A;  2G5D A;  2EXZ A;  1N05 A;  4HID A;  4AIM A;  1UUP A;  3B78 A;  5JJI A;  2H5X A;  1F2Z A;  1KXL A;  5F2D A;  4IJL A;  4H0L C;  1N8R D;  3VA7 A;  2K33 A;  1VQL B;  2CWA A;  3OPO A;  3CCU B;  2LFN A;  3A8K E;  5FJ8 G;  1XX8 A;  1YIT B;  2NN6 H;  5IYR A;  2DYI A;  4OIJ A;  4G1B A;  3SJP A;  3PIP 3;  3DLL A;  4AF7 A;  3CCM B;  1D8L A;  1PTO H;  1U5K A;  4JBK A;  3GTK B;  1PRT D;  3CCL B;  5CV9 A;  5KNC A;  4DUZ Q;  1WOR A;  4PC6 A;  4IUU A;  2VNI A;  1N9W A;  1WJJ A;  1RDP D;  3ZBU A;  3CXC B;  2F0H A;  4A3E H;  5M5Y H;  3SEB A;  3AU7 A;  2JN9 A;  2QA4 B;  2B63 G;  5TY0 A;  2KBN A;  5DNF A;  3EJI A;  5CV7 A;  1K83 B;  3NWT A;  4EGV A;  3CP8 A;  3C1E A;  2VNH A;  2EIX A;  2HDL A;  4E6I A;  3K5L A;  1UD3 A;  3OZW A;  2R7Z B;  1CQX A;  4KHV A;  1SE4 A;  4R71 A;  4J0Q A;  4C3H H;  2F03 A;  3H3V H;  1GVH A;  5IGG A;  4WZL A;  4Q5V A;  4BY7 G;  2WAQ B;  3UI2 A;  3KF8 B;  3ULL A;  3TRE A;  1YIT A;  1I4P A;  1VQK A;  1VQL A;  4HSV A;  1LV9 A;  2TSS A;  3UDF A;  5LHY 1;  3ERS X;  3I4N B;  2KCC A;  3J7A 5;  2ID0 A;  4UP8 A;  1WTH A;  2UXC L;  1L1O A;  1D2E A;  4K1X A;  4JMQ A;  2ZIT A;  1ZKO A;  3Q0A A;  1G7T A;  1BX1 A;  2O2L D;  3SK4 A;  1AIP A;  1E3P A;  4YCW A;  3TP7 A;  2DY1 A;  3QOL A;  5C3E B;  4JI3 Q;  4OL7 A;  2F43 A;  2PYK A;  1DG1 G;  5FIU A;  4QFM A;  2OK8 A;  1TXY A;  1B50 A;  4LF9 Q;  5ELE A;  1I4R A;  2M5S A;  1JOO A;  2FXQ A;  2XSC A;  5DN6 A;  3GTO B;  3ULP A;  3CES A;  3ZBT A;  2KA7 A;  2GK7 A;  3GTK H;  3QIA A;  5FO1 A;  2DNC A;  1WTH D;  3ONY A;  1QVC A;  5KYI A;  1G7S A;  2AQ1 B;  2H1E A;  4J6H A;  3SLD A;  1N07 A;  2KCN A;  3FKI B;  1IL2 A;  5IYW A;  3HOW H;  2Q2I A;  2Q6O A;  3BVM A;  2K5W A;  3ZC3 A;  5FLX c;  2NUC A;  1PJ5 A;  3E5S A;  1XPO A;  3PO3 H;  2WIN B;  4FXG C;  4XKV A;  4GNX B;  1XE1 A;  3OZU A;  3WND A;  5HGT A;  1PV4 A;  3GQB A;  2X85 A;  5FLM H;  3JQQ A;  1NNX A;  2F0M A;  4EQ5 A;  3CC7 B;  1RJT A;  3J81 k;  4B4D A;  2DET A;  1ZEQ X;  1UD8 A;  3CMM A;  4M0L A;  2GRE A;  4Z4R A;  1I6V C;  2WJV A;  4UY8 C;  3S1N B;  4ID6 A;  2EVB A;  2EYF A;  2OF1 A;  1VQA A;  2FHT A;  2WAC A;  3MTS A;  2C35 B;  3S17 H;  3HGB A;  2BVN A;  3R2T A;  2I07 B;  2A74 C;  2HQL A;  1I7P A;  4TSS A;  2KEC A;  5FO8 B;  4WJ4 A;  1ESF A;  1UWV A;  5ELB A;  2NN6 I;  1IW7 C;  3PUY A;  3HS0 C;  4DR1 L;  1PH3 A;  5EAY A;  4YWL A;  2E5L Q;  4B3R L;  1KLG D;  2X6L A;  3JQR A;  4RD4 A;  1B7Y B;  1SKY B;  2ENB A;  3OIP A;  2VBS A;  1M1K D;  2QTZ A;  4LUV A;  2ZBU A;  3SHL A;  3AGP A;  4FVM A;  4QQB X;  3STB C;  2NZH A;  4FN5 A;  1HNZ Q;  1SMY D;  1AZP A;  2F0V A;  4NXN L;  5G3L D;  2V7U A;  2PCF B;  1QFY A;  1I5F A;  2R92 B;  2PE3 A;  1YEZ A;  4CDF C;  1PKV A;  3EN2 A;  3CTA A;  2JXM B;  3TZD A;  2F3I A;  5C4X G;  3Q6R A;  1A63 A;  3TEH B;  3S2D H;  2Q2H A;  4ZKB B;  3W1B A;  3E9I A;  4A3B G;  4JW0 A;  3KF6 A;  2B8F A;  1WYD A;  3HOV G;  3E6Z X;  2R7Z G;  4LF7 L;  1ZYR D;  1WTR A;  4BS9 A;  4JI4 L;  1HZC A;  2A73 B;  3QE2 A;  4A3G G;  3PA1 A;  1CSP A;  4JI1 L;  2NVQ H;  3I4N H;  4KHZ A;  1V1P A;  4XOP A;  3OTO Q;  1W87 A;  2ALY B;  5IE8 A;  4Y7C A;  1Y69 U;  2PZU A;  3BYY B;  1YHB A;  2VL6 A;  3SK8 A;  2A6H D;  2FIN B;  4DAV A;  2YU9 H;  1JWS D;  2L55 A;  1FGB D;  3B6Y A;  3G48 A;  4NW2 A;  1HTL D;  1AN8 A;  5H5J A;  2ZL6 A;  2OQK A;  1PFN A;  1S3O A;  3CAM A;  2X53 S;  2UU9 L;  1A3V A;  3TN2 A;  2ICE C;  3ZJY C;  2Z6B A;  5I9P A;  4DR1 Q;  1SFO B;  1WTO A;  2K28 A;  4RWS C;  3L9A X;  1JJC B;  3DM1 A;  4IJH A;  1STN A;  1F60 A;  1XNR Q;  4P74 A;  2IHF A;  1EQT A;  1DAR A;  3V7A A;  4C1N I;  2L4N A;  3W2F A;  2OTL B;  3JC6 6;  4RCN A;  5COY A;  1HNZ L;  3ES9 A;  1G2T A;  1QVG B;  3PQI A;  5FLM G;  1Y1W B;  1MKH A;  1I50 H;  1EZ6 A;  2X0K A;  4GKK L;  1EY5 A;  2ZZG A;  5KW9 A;  1CHQ D;  3K80 C;  4S3S A;  1PH2 A;  4X6A H;  3ONU A;  3JU4 A;  3J81 L;  4DKA C;  3CCM A;  1EWH A;  1QB5 D;  3VR4 A;  1BBU A;  3KLR A;  1ENA A;  1BLI A;  3OEH A;  1BQQ T;  3WDN A;  4A3F B;  3S2H H;  4A4I A;  4B9W A;  3S1R H;  1VLO A;  3MFY A;  4R8N A;  3ASP A;  4PQX A;  5IP9 H;  1ZM9 A;  1G6Z A;  1X54 A;  1HTP A;  4C56 C;  2O5J C;  2B2Y A;  1WOO A;  1JWM D;  3L7Z C;  1WD0 A;  3I56 A;  2E2J H;  1U4P A;  1AEX A;  3VO2 A;  1I4H A;  4P6V F;  4C3H G;  3IAY A;  1LTR D;  3OTO L;  1KDC A;  3PUN A;  4Y9R A;  4JOI C;  1TT2 A;  2PZW A;  4DK1 A;  3BJU A;  3SVM A;  3DDY A;  3NTK A;  3UDG A;  1S5F D;  3C3L A;  2DER A;  3J81 E;  4J1M A;  4A3D H;  1VQ7 A;  1I6H B;  1QX4 A;  3A7A B;  5C4Z A;  2PW5 A;  1L1O C;  4IPG A;  1YJW B;  1C48 A;  4XKW A;  3RY8 A;  1K28 A;  4ZCI A;  2WB1 E;  4JI6 Q;  2OCE A;  4B3M Q;  1K73 D;  1TKW B;  2Z4H A;  2EYM A;  1IKL A;  2L9H A;  3NXW A;  5C44 H;  3BCF A;  1JCK B;  4RD3 A;  4X3K A;  1RTO A;  1XXG A;  3AMU A;  1I8D A;  1CTM A;  1PLF A;  2CBX A;  1W0J A;  3F8T A;  5CR3 A;  1PVO A;  2QTL A;  4C0S A;  3H91 A;  1E1T A;  2OTJ B;  3K7U C;  2YYZ A;  4MTK A;  3DEP A;  4K8I A;  1PZI D;  2Z4I A;  4MNO A;  5M9O A;  4XOR A;  1QG7 A;  4G5G A;  3IFT A;  4IUT A;  5A2Q E;  4N9P A;  1OXX K;  1G51 A;  1VQ6 B;  3FPP A;  4DR4 Q;  3ZZ0 A;  3K5N A;  3PUM A;  2F4I A;  1OXT A;  1VQB A;  4UZF A;  2XND A;  2D2C C;  4RKL A;  4A93 B;  3ERQ A;  3HKZ G;  4UDU C;  4V19 0;  1ENC A;  4Z4W A;  4A3J H;  4P72 A;  3RUZ A;  2XRS D;  3MXU A;  2F0K A;  5CBA E;  1Q1E A;  1GUS A;  4K2K A;  4R9W A;  1QIL A;  3GVL A;  2O4X A;  2EJG C;  4ZK9 B;  1TR5 A;  1UE6 A;  1QJO A;  2JYO A;  4H02 A;  3BDC A;  1VLY A;  2V7T A;  4WWV A;  4BXX H;  5EPK A;  3VDY A;  1SSO A;  5KGU A;  1BO0 A;  4A76 A;  2XRQ D;  1SXT A;  2D9R A;  4B3T Q;  1GM5 A;  4KTA A;  3U50 C;  1D1N A;  3PV0 A;  1FVI A;  1B2T A;  2HD3 A;  2Q8I B;  1HQM C;  4PMW A;  3RLO A;  3PIO A;  1PXU A;  1A2T A;  4P2N A;  4HJ5 A;  4BY7 B;  2VBV A;  1NAP A;  2K5H A;  3D3R A;  2P5Z X;  1VQJ A;  2NV4 A;  2I5M X;  5D3I B;  4RDL A;  2JK8 A;  1KZL A;  5FOB B;  4WFN 3;  2ZL5 A;  2K4K A;  2MJ8 A;  2E1R A;  1X3P A;  5A88 A;  1VQN B;  4QF4 A;  1DXM A;  1MBY A;  3WOE A;  2RKS A;  4RPD A;  5FLX L;  1EXM A;  4P25 A;  1FNV A;  3CPF A;  3OW7 A;  2OTJ A;  4X65 Q;  3VR5 A;  1V0E A;  2KUM A;  5KRU A;  4QVJ A;  1JA1 A;  3CCQ B;  1OGI A;  1TQO A;  4AYB G;  1PFS A;  3BS1 A;  4A75 A;  2KVO A;  2RCN A;  4OPO A;  4XON A;  2B2Y C;  5M3F G;  4GKK Q;  3T56 B;  3K7A B;  4HED A;  1J8I A;  3H94 A;  3CCS A;  4NBS A;  2CC2 A;  4RG1 A;  4ZUI A;  3G71 B;  1E43 A;  1JA0 A;  1E2V A;  4A93 G;  4RH6 A;  5M5Y B;  3F2U A;  1CM9 A;  2QCP X;  5DM7 3;  2WKC A;  1H9S B;  2DEU A;  2M2L A;  4DAP A;  3ISX A;  3PIO 3;  4L5R C;  1WSV A;  3OJX A;  1Z9F A;  5C44 B;  3K5M A;  2VZA A;  5JEA H;  2D3L A;  1D5M C;  1II3 A;  1HVX A;  3HKS A;  1SMY C;  1X3G A;  2PMD A;  1G29 1;  1NTG A;  3CW2 C;  4TRD A;  3BDO A;  2ZBV A;  5IP7 G;  1R9T H;  3OEE A;  3BY2 A;  1V9P A;  1KTK A;  1AH9 A;  1SNO A;  2MFI A;  4R1J A;  2ZT9 C;  2J7K A;  1Y0Y A;  3GV6 A;  1P8L A;  1X3E A;  4DGZ A;  3S1N H;  1OHH A;  2NPF A;  5EGT A;  1FDR A;  1DJR D;  3W2I A;  3E9H A;  1WVL A;  1E79 A;  5ELN A;  4LFB L;  4JI6 L;  5K5P A;  3CRK C;  3GTP B;  5TV2 A;  1SBB B;  3A8K A;  1SN8 A;  4B3G A;  5IGC A;  2FFK B;  2OXP A;  3BU2 A;  4ASU A;  5LMN Q;  5FLX E;  1PA6 A;  2ICI A;  5EMN A;  2SNS A;  3CQZ B;  2QGQ A;  4HE5 A;  3AVU A;  2UUC Q;  3MHB A;  3PCO B;  3A8J E;  3BZC A;  3A5U A;  1EP3 B;  3SEJ A;  3OMC A;  1EZ8 A;  3SE0 A;  3TSS A;  1SFO H;  1EQV A;  1EU4 A;  3H0G G;  1SDF A;  1T6Y A;  3Q6Q A;  1VQF A;  1HNX L;  4H7B A;  1SEB D;  4IFD J;  1D5Z C;  4PZ7 A;  2UUA L;  2VUM B;  2VB3 X;  1IB0 A;  4X66 Q;  3B8H A;  1RD9 D;  2WV6 D;  2Q8T A;  2G9D A;  2VZL A;  4HMJ A;  1FX0 A;  4IOA A;  1FRQ A;  4A3C H;  1ICF B;  2PMZ E;  1VCI A;  5JOB A;  1D1I A;  1KRH A;  1TWF B;  4JBW A;  4RKB A;  2A68 D;  5CYU A;  1YBY A;  1UD4 A;  1EIH A;  1S4Z A;  2EJF C;  2J7Z A;  3NTH A;  5C3X A;  3CMA A;  2IPK D;  2CWP A;  1N06 A;  2TMP A;  2JA7 G;  2VW9 A;  5IGB A;  3RN2 A;  3FDT A;  3CCE A;  3S2D B;  5CDF A;  2L1B A;  2C9O A;  3GTG H;  1JC7 A;  4P22 A;  1KLU D;  2BA1 A;  4EQN A;  1UE7 A;  4LFC Q;  4IUR A;  5L46 A;  1EY8 A;  1XNQ L;  4FXD A;  2ZJQ A;  1K3R A;  2YTX A;  1J5E L;  4XLF A;  2QMU A;  2B2T A;  1CI3 M;  2PW7 A;  2VUM G;  3GTP H;  3CPX A;  2ZTD A;  3U4V A;  3H3V I;  4PAB A;  2PIA A;  2NB0 A;  5IYC G;  2IX1 A;  3JAM E;  5LMU Q;  1F9R A;  3S17 B;  1H8E A;  1EWC A;  2JE6 I;  3CCR B;  2D9U A;  2JEA I;  1BQE A;  1MSH A;  4OHJ A;  3MHP A;  1E1R A;  4B43 A;  1SE8 A;  2AUK A;  5IGD A;  3G4S A;  2N88 A;  2A1A A;  2B8G A;  1S5D D;  2FX3 A;  3K6O A;  2Q6K A;  1HR0 Q;  2R6G A;  1LAC A;  5CGK A;  2LMC B;  4RCZ A;  3NTI A;  3D6W A;  2GQF A;  3GP7 A;  4ZUJ A;  5BSX A;  4DR2 L;  3MMP A;  5M5X B;  2BE5 C;  4IPC A;  4CJ1 B;  4LF8 L;  4ZGQ B;  3ZYY X;  4U67 3;  4AC9 A;  4WOR A;  3G4S B;  2RDG A;  1R5N A;  4JCV E;  1FL0 A;  4TKO B;  3J80 E;  1UEA B;  2EQS A;  3HOY H;  2BH2 A;  3LO8 A;  4P12 A;  4Y7N H;  4M4S A;  5BSY A;  3IFD A;  2ZTC A;  3T4A C;  1YJN A;  1EFC A;  1BX0 A;  4AF6 A;  2A19 A;  4KD3 A;  4HAE A;  1KAB A;  1SJE D;  4B3F X;  1C9O A;  3DXJ C;  2LXK A;  1IYU A;  2V7Q A;  4KY5 A;  3R8B A;  3AVV A;  1EY0 A;  4O1N A;  4P2C B;  3DWP A;  2BMW A;  1JOK A;  2A5H A;  3E1Y E;  2WKD A;  5GV7 A;  2A69 D;  1XMO Q;  2F0P A;  2JDI A;  5NUC A;  3Q22 A;  3EFX D;  1KDB A;  4LJZ C;  4L8J A;  5FJ8 H;  1AMO A;  3ZPN A;  5C6A A;  3I55 B;  5DAU A;  5C5M A;  4DV6 L;  4OX9 L;  4OO1 H;  3NBI A;  1M1K C;  1IBK Q;  2WR8 A;  4A3B B;  1SLJ A;  4RHS A;  3VYS A;  1BJK A;  1XPU A;  2O5I C;  4ZRZ A;  2QW7 A;  3FVQ A;  4II2 A;  1G2S A;  3GIR A;  2F0W A;  3I4N G;  4A3B H;  1HNW L;  2DJG C;  3K7A H;  1JJ2 A;  1H9M A;  2KHI A;  1TLL A;  3QSY A;  5F4O A;  5CV6 A;  1XQB A;  3WY9 A;  2CCZ A;  1GHK A;  3OIQ A;  3QFS A;  3CF5 A;  4ILW A;  2UXB L;  1ET6 A;  1LTT D;  1FRN A;  1QUQ B;  2I5L X;  2G9H D;  3HOU H;  4LUZ A;  2AKW B;  1N32 Q;  5KIX A;  4GN4 B;  4A3K H;  3CCV B;  4V0B A;  4MTN A;  1ONL A;  5M5X H;  2EY2 A;  4WJ3 M;  4LFA Q;  1YJ9 A;  3MVV A;  4A3I H;  4JK1 C;  2B63 B;  2N3S A;  4OO1 G;  2RDH A;  2E2I B;  1GVP A;  4DR4 L;  2VNK A;  1A2U A;  4DQL A;  4ODG A;  1NBM A;  4TN1 A;  3VNU A;  4XLE A;  3MEF A;  2N49 A;  3BYT B;  1FR3 A;  2IY5 B;  4H9G A;  2HIX A;  1EY6 A;  3M4O B;  5JPM C;  3FPK A;  4RCY A;  4MZ9 A;  4GNX C;  1W2B A;  4QGU A;  4JI4 Q;  2B2T C;  2D74 A;  4GLX A;  1XTC D;  4JI1 Q;  3CCV A;  4JYA Q;  2XOK A;  5EPJ A;  4EQP A;  1I6H H;  2NVY H;  4Y9U A;  3S16 B;  3RZD H;  1HCZ A;  3CQZ H;  3HEJ A;  3J80 i;  3J7Z C;  1CT1 D;  4RGO S;  1ET9 A;  4DV6 Q;  4OX9 Q;  1DDI A;  1L2F A;  5T1G A;  2JJ1 A;  3S14 B;  4TMX A;  1Y1V H;  1WDT A;  5LMZ A;  3C2Q A;  1JJ2 B;  2JQO A;  4GLV B;  1G8Z D;  3FKI G;  2NVT H;  3HOX G;  3I4M H;  4LC0 A;  1E24 A;  2EPB A;  2R92 H;  4WZK A;  4XLH A;  2XWB B;  4IOC A;  1B70 B;  1SMX A;  5G3L F;  2XNA C;  3PF5 A;  2R93 B;  3PUX A;  3R3O A;  2B7C A;  5J22 A;  5I4D A;  2F0S A;  2IT1 A;  4NXM L;  1EFU A;  2V7X A;  4TSF A;  4A3J G;  4JPB W;  4TMT A;  1HR0 L;  4YAU A;  3DEO A;  3PUV A;  4FYD A;  2F0N A;  4RD1 A;  1TVC A;  4QUF A;  2ZL7 A;  3MXN A;  1X9N A;  2LKV A;  2BA0 A;  5I6Y A;  5E3F A;  1WOC A;  2B2U C;  4X07 A;  2R6H A;  4KY6 A;  1K9M D;  1XMQ L;  2QGG A;  4HMI A;  5EBD A;  4OPV A;  2HCI A;  1YI2 A;  1KRS A;  1F9S A;  3H3V C;  3H09 A;  4L63 B;  3S1M B;  1CQF A;  2Q2U A;  4XYO A;  3T1H Q;  3WQZ A;  2K50 A;  3J7A V;  3PO2 H;  3FKS A;  3S9W A;  2C5B A;  2J0T D;  1W35 A;  2YWF A;  3N52 A;  3QWN A;  2K32 A;  4HJ7 A;  3PA2 A;  4B3X A;  1QG0 A;  1NDH A;  5M3M B;  3KBX A;  1SNM A;  1VS0 A;  1H8H A;  1BMF A;  3OAA A;  4FK8 A;  2NVY B;  4OON A;  5C0X J;  1R4P B;  4Z4U A;  1IJF A;  3I4L A;  3QB3 A;  5LMN W;  3OOC A;  4B3M L;  1EYC A;  1S5E D;  1HH2 P;  4FWT A;  4XD7 A;  1GHJ A;  4ULL A;  5C0X I;  1N08 A;  1NR2 A;  3NSW A;  2E2D C;  1ILP A;  1RHP A;  1F9Q A;  4A3L H;  1PH1 A;  1EYG A;  2XNC A;  4DV7 L;  1CKO A;  4DNI A;  1WFQ A;  1VQ9 A;  5A2Q L;  3CCR A;  5D3D A;  4LAA A;  1D7Q A;  1IJE A;  2X69 A;  3ER0 A;  4CDD C;  2R7Z H;  3VYU A;  2F0E A;  2Y0S E;  4KD4 A;  5ELC A;  1WTV A;  5C4H A;  1XJV A;  1HA3 A;  3FRP B;  3TP8 A;  3RZO B;  3TDQ A;  4C3J G;  3BCD A;  4XLC A;  1Y8P B;  2E2I H;  1ICW A;  5J1Z A;  3M3Y H;  2GJK A;  2NN6 G;  2CKZ B;  4DAM A;  5IWA L;  3LQ6 A;  2CVR A;  3Q24 A;  3OW2 A;  1PTO F;  1TWH B;  4G7X A;  4G57 A;  4EVO A;  1PH6 A;  3A8I E;  1SYE A;  4ME3 A;  4OEM B;  1X6O A;  3SK5 A;  5JAV A;  4YXW A;  4DR2 Q;  3A3B A;  4NMZ A;  2E2J B;  4TMV A;  2F0D A;  4JI2 L;  3FHW A;  2PMZ B;  3NPP A;  3GTM H;  3GTO H;  4X62 Q;  1E63 A;  4JOI A;  1T6Z A;  1JQY D;  1O7Z A;  1Y14 B;  2UUC L;  3VO1 A;  1FNB A;  1TY2 A;  4B44 A;  2RHS B;  3OWF A;  1AW7 A;  1Q81 C;  4KV6 A;  1IW7 D;  2SNM A;  4Z4T A;  3QG1 A;  1QUE A;  3EA6 A;  1Z7T A;  1GJX A;  1JB9 A;  5IOD A;  4NCN A;  4UAJ A;  1IZ6 A;  5CV4 A;  4OOS A;  1Y1V B;  1DZ1 A;  4HR7 B;  1JNY A;  2SDF A;  1QNU A;  4F7X A;  1J9Z A;  1YJW A;  4N3N A;  1YNN D;  5JVG 3;  4DK6 C;  1QGZ A;  2DGY A;  1P4M A;  4PV1 C;  4XXE A;  1OB2 A;  4PC1 A;  2L12 A;  3TQY A;  4ABN A;  5L37 A;  2R93 H;  1TS3 A;  1L1O B;  3RNU A;  4X8I A;  1HZ9 A;  2EYO A;  4OEL B;  4C3I B;  4M53 A;  3LX0 A;  5HXB A;  5E6T A;  3WNB A;  1Q3L A;  2KOL A;  2GVB A;  4Q7J B;  2ZM6 Q;  1PMR A;  4YHB A;  4JYA L;  1A8P A;  1HNW Q;  1U0L A;  2VJI A;  3HOW G;  4B3S Q;  5A89 A;  4ME5 A;  3AFP A;  3EVQ A;  2K7V A;  1EOV A;  1WD1 A;  1CKN A;  3CP0 A;  2BOS A;  3KK7 A;  1ENF A;  3SXH A;  4XT1 B;  1QFJ A;  4IQZ A;  1Q81 D;  1IYJ B;  2A69 C;  2B29 A;  3A5Z B;  3LQE A;  1U9R A;  1YNX A;  3TP5 A;  4M2L A;  2I0Q A;  1SRO A;  1EUJ A;  4TVA B;  1B9M A;  2WYR A;  2F0F A;  5M3M H;  1MJC A;  1JJG A;  1B2R A;  4HIZ A;  2WSS A;  1VF5 C;  2E2H H;  3F1Z A;  1KL9 A;  1SYD A;  1N0U A;  1VQO B;  2HHH L;  3RZD B;  2LY7 A;  5IYP A;  3M4Q A;  4CKB A;  4PAA A;  2Z0S A;  3D4W A;  5AN9 A;  2IWH A;  3HKZ B;  1TWF H;  3JQP A;  3CCS B;  3O13 A;  3I90 A;  1B1Z A;  1L0W A;  4U68 A;  2KED A;  2OBS A;  3CCQ A;  3S1R B;  4IUQ A;  2C5C A;  4G6I A;  2K52 A;  1HA5 A;  1K0R A;  4OP7 A;  3RLF A;  3J81 j;  5EKL A;  3GTG B;  2ZM6 L;  4BY7 H;  2BV3 A;  2F0T A;  2OBT A;  1QE6 A;  4RA8 A;  4Z4Y A;  1L0X B;  3AST A;  2VQF Q;  1JB7 A;  4A3M H;  3VYT A;  2ZXI A;  3M3Y B;  3OKX A;  3RD4 A;  4FXK C;  1A3U A;  1RF2 D;  1T5E A;  4FO2 A;  3CPW B;  4G7Z C;  1SYG A;  5J3O A;  5HZB A;  3H0G H;  3BVZ A;  3U2Q A;  1JB3 A;  4HN7 A;  1LO5 D;  5KSW B;  3I8Z A;  2JN4 A;  2AQ3 B;  1H9J A;  4IUN A;  3S14 H;  1PJ7 A;  5IIF A;  1X3Q A;  2HHH Q;  1A6X A;  4ZQ3 A;  2LZJ A;  4PZ8 A;  2LS0 1;  1COW A;  5JPN C;  4BY1 B;  5TRD A;  1EYD A;  1IHZ A;  3FPU B;  1DGS A;  4MYU A;  1N0V C;  2PNH A;  2F4N A;  4JG2 A;  4X7F A;  4XR6 A;  4ZCL A;  4DUY L;  1STB A;  3CC2 B;  4KKT A;  4JV5 L;  5JEA G;  4LF9 L;  2V7V A;  3CRZ A;  4Q0F A;  5HUR A;  4A3F G;  3G6E B;  2B2W A;  4ZLT F;  4TT3 A;  1VQC A;  2RHQ B;  1T5X D;  2BCO A;  4N8F A;  1D1K A;  3HG9 A;  1C8C A;  2Z6K A;  1EL0 A;  4DN4 M;  3T53 B;  2VQE L;  2C77 A;  4HJ9 A;  3K0X A;  3UE1 A;  1M4V A;  1VQ9 B;  4X05 A;  3EIV A;  4A3M B;  1YHQ B;  1WU8 A;  2CHB D;  3ND9 A;  3RN5 A;  2XEX A;  1SJH D;  2E76 C;  1M90 D;  3TP6 A;  1EIF A;  4DV7 Q;  2K5V A;  3NEM A;  4NPS A;  4PNY A;  1QOH A;  5IP9 G;  3VR6 A;  1LT4 D;  4DR3 L;  2FMM A;  5K36 G;  3NE5 B;  3F2B A;  3OMG A;  1I4X A;  3P7J A;  1ZXT A;  4GS3 A;  2DJF C;  1LLR D;  5COR A;  4M1U B;  4HE6 A;  1T9H A;  2OEO A;  5GAE C;  4XN3 A;  4I7Z C;  2Q6I A;  2QDX A;  1JE4 A;  3DMU A;  4RM0 A;  4K14 A;  2H4O A;  5IWA Q;  2F0I A;  3CC4 B;  4G7H C;  2L15 A;  1UMK A;  1RTN A;  3GV3 A;  5AJ3 Q;  4BBR B;  5GAD C;  4C3J H;  2JA5 H;  4DR6 Q;  5C4X H;  1DOL A;  3D6C A;  4QVA A;  1K8M A;  3GD7 A;  4KKU A;  3SGI A;  1VQ7 B;  1QGA A;  1EWI A;  2RSN A;  1GOZ A;  4IN3 A;  1YZ6 A;  1A3T A;  4ZAI A;  1H9R A;  2F0J A;  1SND A;  2KHS A;  1TWC B;  3A56 A;  1DD2 A;  2VB2 X;  1N33 Q;  4C2M B;  1UEB A;  3WOF A;  2SOB A;  2Z6B D;  1B3Q A;  3I56 B;  1TWG H;  4FP5 D;  3N6R A;  2C4U A;  5HGQ A;  1WPC A;  1C7Y A;  1W9X A;  5M5W B;  2GJP A;  4PMB A;  2JJQ A;  4A3G H;  1I4G A;  5M5W H;  1HZB A;  2BF4 A;  1MD2 D;  1TS5 A;  1W6K A;  2PQE A;  2WB1 G;  4QMG A;  4POF A;  2VS1 A;  3RR5 A;  2AHO B;  1VQK B;  1O78 A;  4KLK A;  3CB4 A;  1EFW A;  1FNC A;  1EU3 A;  4N9T A;  3AVX A;  2QN6 A;  1RIP A;  1W34 A;  2JA5 G;  1PZK D;  4KI0 A;  3WNC A;  2B3G A;  4CDE C;  1VQG A;  3I91 A;  3GSI A;  1D8T A;  1QVG A;  4AYB B;  3IRB A;  1ASZ A;  4G7O C;  1JR0 D;  1VF7 A;  4FXU A;  1HA6 A;  2KJX A;  1QGY A;  1T6X A;  2QA4 A;  1VQ5 A;  3M85 A;  4J8Q A;  3CXC A;  4DFA A;  1CSQ A;  5JVH 3;  4WJW A;  2NZ1 D;  1HFN A;  4LF6 Q;  3AVT A;  1Y8N B;  1CKN B;  2B2V A;  4C3I H;  1WTQ A;  4DA2 A;  1SYB A;  1N36 L;  2F4V L;  3W2E A;  3QOJ A;  4BA2 I;  2HMA A;  3CCU A;  2AHO A;  2JSO A;  4C3J B;  1K8A D;  1V1O A;  1MRZ A;  3KEW A;  1EEF D;  2Q8R E;  2NVX H;  1VQ8 B;  1O7Y A;  4UP9 A;  4LF4 L;  1BDO A;  4ZKC B;  1VQM A;  1AFP A;  4EH1 A;  3PO2 G;  1XFO A;  4DU9 A;  1FNU A;  4LBY A;  1QNK A;  2XVS A;  4QIW E;  1YJ9 B;  2JA8 B;  3F2D A;  3Q39 A;  1M8A A;  4DV0 L;  4A3D B;  3Q3A A;  3VNV A;  3SJZ A;  2KCT A;  4RD2 A;  2EY5 A;  3K59 A;  4YY3 L;  2R9V A;  1U2R A;  2VY3 A;  4B3R Q;  3NEN A;  4A3G B;  4JBM A;  2PO4 A;  2DN8 A;  2QEX B;  3I70 A;  4AYB E;  3VYR A;  1KAA A;  3GO5 A;  1GO3 E;  2VYQ A;  3HKZ E;  3PUZ A;  1KAW A;  1MJE A;  3Q23 A;  4YCV A;  3Q38 A;  3NEL A;  1PH9 A;  4FF3 A;  1G6P A;  1YLO A;  1AE2 A;  2C78 A;  2I1L A;  5IOC A;  1XB2 A;  1KDA A;  3SK6 A;  1Q1B A;  4RCO A;  1YIJ B;  4JVZ A;  5JEA J;  4C1N K;  4Y52 H;  4N8X 1;  3KJO A;  2F1M A;  3GVK A;  5C44 G;  4HTH A;  3DHQ A;  1N36 Q;  2F0G A;  3GTJ B;  1EP1 B;  2YWE A;  2CFM A;  1IL8 A;  4DR3 Q;  2A68 C;  1K28 D;  3L0O A;  3BQJ A;  4UZU A;  3MA2 B;  4HCE A;  1CFM A;  3A0J A;  3I1F A;  1EYA A;  4C2M H;  3W2G A;  5IT9 E;  1BOS A;  2ASB A;  3R93 A;  4C3I G;  2AUJ D;  1TWC H;  1K9M C;  4P71 A;  2CND A;  4IAL A;  4KHP Q;  4KK7 A;  4A3K G;  4BY1 G;  3C46 A;  3M7G A;  1U4L A;  4GN3 B;  3CME A;  5BN3 A;  2PLF A;  1NY4 A;  2X6X A;  1SE2 A;  1KJZ A;  2NTT A;  1UAP A;  1I3Q H;  1QVF A;  3NHH A;  1Q9S A;  2QDB A;  1V0F A;  3LWE A;  1LAB A;  1BVS A;  5IYD H;  4QV2 A;  2XNJ A;  1ML0 D;  1TU2 B;  3K0Y A;  4DK0 A;  1KK1 A;  2EY1 A;  4YAO A;  4A3E B;  1BCP F;  3PGZ A;  3OP1 A;  3S1Q B;  4BA1 I;  2WPD A;  3LVB A;  3S1Q H;  4LFA L;  4OPS A;  2EYL A;  1K0S A;  1RL2 A;  2UUB L;  1F20 A;  5DLQ E;  5GAH C;  2F1L A;  4IO9 A;  1G7R A;  2CW0 D;  1VQI A;  2ATW A;  1N32 L;  2JA6 G;  5HKK A;  4OGQ C;  1LTS D;  5A35 A;  5I9O A;  3K58 A;  3HOV H;  5H1S E;  5FA6 A;  3STB D;  4OOX A;  2EFG A;  3KJP A;  1ESR A;  2XWJ B;  4K5X A;  1E22 A;  1PTO C;  1VQP B;  2XZP A;  1LM0 A;  2QEX A;  2EE1 A;  2B63 H;  1QCB D;  1PHJ A;  2JA7 B;  4IZ8 A;  3CD6 B;  1ZM3 A;  3TME A;  1FNW A;  4BWG B;  3L3O C;  3C1F A;  1JOR A;  3MXN B;  4YHH L;  3CCE B;  4YEJ A;  1F2L A;  3S15 H;  1TTT A;  3A55 A;  1EFR A;  4LFC L;  1VQD A;  2MUY A;  2KEE A;  1KNE A;  3IKJ A;  1WP6 A;  1HPC A;  4JI7 L;  3FMC A;  3V05 A;  1K8G A;  2R7D A;  1NUC A;  2B39 A;  3J80 L;  4LBZ A;  4MIU A;  4Z1M A;  4WZE A;  4LNQ A;  3MXP A;  1VQE A;  4K2L A;  2E1B A;  4L5T A;  3ZZT A;  1I4Q A;  1Q82 C;  1AE3 A;  4DPG A;  2QKI C;  1S0U A;  2QF7 A;  3ZUG A;  1ILQ A;  5IYB H;  4ACA A;  1HRJ A;  2RBM A;  3D4D A;  3PIP A;  2E5L L;  3GTL H;  4F87 A;  3R6K A;  1RQR A;  1NBW A;  2DUD A;  3I72 A;  4X62 L;  2F3V A;  2GA4 B;  5JJK A;  1G91 A;  1OB5 A;  2VUM H;  3J7Y W;  2J4X A;  1OGJ A;  1SKQ A;  2YV5 A;  3AVW A;  1Z6H A;  1W2B B;  3HOZ G;  2CW5 A;  5I2Y A;  5B6I A;  4O2D A;  3QFC A;  1PFB A;  2GPJ A;  3KL9 A;  2Z9H A;  4QCL A;  4JI3 L;  3UE0 A;  4BY1 H;  4B48 A;  4K5V A;  2VNU D;  5DSZ A;  4NXN Q;  4OIK A;  1QFZ A;  1S40 A;  1HJP A;  3S24 A;  2R7F A;  1NSN S;  1A0I A;  1KMH A;  2KVM A;  3MFG A;  5J39 A;  1Y0R A;  3P75 A;  3CU7 A;  1ASY A;  1XMQ Q;  2XZO A;  1KC8 C;  4DQK A;  4ROX A;  4KY7 A;  5FL7 A;  1KD1 C;  3S1M H;  4MYT A;  3ICE A;  1DCZ A;  3NQT A;  3NWS A;  1Q82 D;  1VQ4 B;  2JP1 A;  2K5D A;  4II3 A;  4X7E A;  4OWW B;  4K0K L;  2X6Y A;  3DWA A;  4NKL A;  5BN5 A;  3K57 A;  4JI8 L;  3P1H A;  4B3S L;  4DV2 Q;  2JA8 H;  4OO1 I;  3V76 A;  4RJL A;  2K5N A;  5A8A A;  3BG3 A;  1ZUN B;  1ROD A;  1K73 C;  4G7W A;  4LF4 Q;  4A3M G;  4DAY B;  4YAW A;  1S5C D;  3T1Y Q;  2UXD L;  1DM0 B;  3WWV A;  1E62 A;  2PQA B;  3OSO A;  3PO3 G;  2IX0 A;  3E0E A;  1XNR L;  5BR8 Q;  2QEJ C;  3HRZ C;  3I4M B;  2NVT B;  3H9N A;  4WQM A;  1MIU A;  3H15 A;  2XGT A;  2EYH A;  2ZZE A;  1KHI A;  3KYH C;  1BBX C;  3UDX A;  4X3T A;  2M00 A;  5EKI A;  4FDB A;  2ZZF A;  1GXD C;  1TS4 A;  3KDF A;  3RLN A;  1F2M A;  3EQL C;  1YHQ A;  3BZK A;  2DIE A;  1CK1 A;  4PMC A;  1K3B C;  4LBW A;  3PVD A;  3OW2 B;  4UHV A;  2XZL A;  1YJN B;  3FP9 A;  5F4J A;  2YWH A;  4X66 L;  3PF4 A;  4G4K A;  4XTC S;  1CUK A;  1PRT C;  3AVY A;  4X65 L;  5CC4 A;  1GJR A;  3FEW X;  1UE5 A;  5ISR A;  3BH4 A;  1KIX A;  1S5B D;  2W6J A;  5KEE A;  4RPB A;  3VR2 A;  4A3C G;  4DV4 Q;  2X8K A;  2IHE A;  4PC3 A;  1OB0 A;  1AP0 A;  4P75 A;  5E4W C;  4IPD A;  5T1I A;  3GTQ B;  3MC0 B;  1MHW C;  1Y1V G;  1A62 A;  5C3E G;  3J80 c;  3P20 A;  4AVZ A;  5FK9 C;  2VBU A;  4ZGN B;  4LK1 C;  1WSR A;  1NJI D;  3M9B A;  2ZXR A;  4C3H B;  5KND A;  2Q2T A;  5TSS A;  1XNQ Q;  2R92 G;  3NQI A;  2X6W A;  2HCC A;  1J5E Q;  2K5Q A;  2K1B A;  1MI2 A;  5TR9 A;  3ND8 A;  5IK2 A;  4FNF A;  4PC7 A;  2DY8 A;  5LL6 S;  4HSP A;  4R4C A;  4A3E G;  4CBV A;  1IBK L;  5EPL A;  1VHE A;  1HZE A;  2V31 A;  4PC2 A;  1CKM A;  1NR4 A;  4KJO A;  4N3G A;  3K81 C;  4LF5 Q;  3PMF A;  3HOY B;  2WII B;  2F0L A;  1S4M A;  3KBG A;  2QDL A;  2JA6 B;  2HDN B;  5IYN A;  2UUB Q;  1B3A A;  3CMA B;  5J35 A;  1TVX A;  3TRZ A;  3M7N A;  2NVX B;  4RD0 A;  1SNQ A;  1H42 A;  1LTL A;  1WI5 A;  1N8R C;  2N8N A;  4R4O A;  1BXT A;  2EDG A;  2Y0S B;  1LT6 D;  4IUP A;  3ITP A;  2CQO A;  2DCU A;  3KOJ A;  4YY3 Q;  3ASQ A;  1H95 A;  4X7C A;  1FJG Q;  4QJF A;  2SEB D;  4EQO A;  2IJ0 A;  3NP8 A;  2PQA A;  3BNW A;  4IFD I;  1V43 A;  2CF4 A;  4ZCK A;  1KRT A;  5FKA C;  1EY9 A;  5I2X A;  1ZM2 A;  2MNA A;  4NB3 A;  3A7L A;  1UD5 A;  1I50 B;  1WCM G;  2NZO A;  1EIY B;  4BBS G;  4UP7 A;  3W2H A;  1R5O A;  1HFG A;  3MAQ A;  5M3F B;  1X55 A;  4DV4 L;  3G6J B;  1K83 H;  2BGJ A;  3V96 A;  3BZD B;  3GTQ H;  1KQS A;  1DOK A;  3ASR A;  2YTV A;  1VHO A;  2BPO A;  4X06 A;  5IYB G;  2EYJ A;  1YNN C;  5F4M A;  3SKB A;  1IKM A;  1RQP A;  3NUC A;  4YAL A;  2N55 A;  2MQH A;  4RGT A;  2EOT A;  2GJR A;  1S72 A;  1HQR D;  5D65 A;  4CKE A;  1NRK A;  5FO7 B;  4GOP B;  1Y8O B;  4Y7N B;  2OWO A;  4AH6 A;  2NVQ B;  3E0J A;  3PEN A;  1W0K A;  4XMY A;  2HT1 A;  4Z4S A;  5E1F A;  1TII D;  1U4R A;  3T1Y L;  4X0C A;  2UXD Q;  5IYQ A;  4JI5 Q;  3S15 B;  4A3I B;  1STH A;  4CKC A;  2VBT A;  3OE7 A;  4PGO A;  1YVC A;  3B82 A;  5DS0 A;  2D5D A;  1A15 A;  4QL5 A;  2X6G A;  2F0Q A;  5C3W A;  4IUV A;  4LW1 A;  1CA5 A;  1KQS B;  1DYQ A;  5C4J H;  2RC6 A;  4KJN A;  3AEV A;  3HFZ B;  1GUO A;  2Z8L A;  4IW3 B;  2OTL A;  3V2T A;  2MGS A;  3A8I A;  1QUQ A;  4RD6 A;  1PYW D;  3TZU A;  2A6E D;  3T51 B;  2PI2 E;  4JV5 Q;  2K14 A;  4ACB A;  3FJO A;  4XM3 A;  4QUC A;  4DUZ L;  1JOQ A;  1OO9 B;  2FVG A;  2Y0S G;  4BPR A;  3NK9 A;  2CQA A;  1DDG A;  4P3I A;  3WXM A;  3QR8 A;  2JA7 H;  3HOU B;  4R4Q A;  1D2B A;  5HY6 A;  2E8G A;  1EEI D;  1Q7Y D;  2F3W A;  3MXG A;  4XDX A;  3HOV B;  1STA A;  3BC9 A;  3I4O A;  3GTJ H;  3X3N A;  3TBI B;  3QO2 A;  2B5O A;  1VMP A;  1FYC A;  2B2V C;  3C2P A;  1XYI A;  2L0C A;  5JJL A;  5JJZ A;  2VQE Q;  1WTP A;  3Q6S A;  5EBC A;  1AZQ A;  1SE3 A;  4O42 A;  1E3Z A;  1XTD A;  4R4I A;  5FO9 B;  4Z4Z A;  1STG A;  2OT2 A;  4YIJ A;  1B53 A;  3I7F A;  5M3M G;  4B3T L;  3CD6 A;  3BVG A;  3HOX H;  1LUZ A;  1BR9 A;  1N34 L;  1FNM A;  5BR8 L;  4XT3 B;  3Q8D A;  4J15 A;  1JWU D;  3CRL C;  3OZV A;  2HCJ B;  3LWU A;  4I65 A;  2IW3 A;  3P27 A;  4LFB Q;  3W5V A;  1C0A A;  5IY0 A;  1PH5 A;  4YWK A;  4F88 A;  3W1G A;  3MZ5 A;  1PH4 A;  5AFW A;  4GQN A;  5CMD A;  5ELD A;  1IBL Q;  5KNL A;  4XQJ A;  1HNX Q;  1PFM A;  3FKI H;  1X32 A;  1FGU A;  3I4M G;  3ERO A;  3KFU A;  5JBQ A;  4FF2 A;  1LTB D;  1N33 L;  4TMZ A;  4DXG A;  1SR3 A;  1RCV D;  4YEL A;  5M3F H;  1CHP D;  3LGJ A;  4RDK A;  3DWQ A;  2E74 C;  1Q86 D;  2NWG A;  4UPA A;  2NBF A;  2RA4 A;  2UXB Q;  5IP7 H;  2WB1 B;  3WYA A;  1SYC A;  4HIO A;  2KCM A;  1QVF B;  1PRT B;  1CA6 A;  2CK3 A;  1OXS C;  5CBE E;  1EOT A;  2HDM A;  4JI0 Q;  1PH8 A;  1B23 P;  4TQU S;  4BBR H;  3SDZ A;  2JA5 B;  3VA5 A;  4DV5 Q;  1YI2 B;  2WP8 J;  5C0X G;  1Y1W G;  2BGI A;  3CC7 A;  4JBJ A;  4A93 H;  4X3S A;  2MO0 A;  3HZX A;  2VXW A;  2JIZ A;  2DNE A;  2JA9 A;  2QIL A;  2Z1C A;  3KDF B;  4IFD G;  4ALP A;  1C4Q A;  2B7B A;  1WOP A;  2I5H A;  3CP2 A;  4UAI A;  1GUG A;  3H0G B;  1WOS A;  2WZN A;  1G7C A;  2JEB I;  2GN5 A;  3SLN A;  3ZIA A;  1VMC A;  1STY A;  4JI8 Q;  2X3U A;  3P26 A;  4XOT A;  1B44 D;  1N34 Q;  1NB0 A;  1ZM4 A;  3M4O H;  2W6I A;  2I46 A;  2D3N A;  5CV5 A;  3KLS A;  1PH7 A;  1IBL L;  1OTC A;  1W6J A;  2HUG A;  2A6E C;  1EWY A;  1LTA D;  2IL8 A;  4DAY A;  1EFI D;  4ZYS A;  1VJS A;  1UD6 A;  1XWE A;  1SM4 A;  3M4Y A;  5C0X H;  1Y1W H;  2HLD A;  1LYL A;  4X7D A;  3E20 A;  2ZXH A;  3CCJ B;  1Q7Y C;  4XQN A;  2WFW A;  4R4T A;  2ZJP A;  2RF4 A;  3VR3 A;  4XN0 A;  1D5X C;  4A3F H;  3S2H B;  5LL6 X;  2DOG A;  3T13 A;  3GDE A;  2BH8 A;  5C4X B;  3D31 A;  2HIV A;  1E1Q A;  2UXC Q;  2K04 A;  2ES2 A;  1VQM B;  4CJ2 C;  4P6Y A;  1IHM A;  1F9P A;  5HZA A;  1V1Q A;  5EQ0 A;  3UDI A;  4XLA A;  4CHT B;  2YU9 B;  1X3F A;  4NDX A;  2YWG A;  4BXX G;  2K01 A;  2OK7 A;  4NNJ A;  5CV8 A;  4DV5 L;  1E2Z A;  3A3G A;  1O80 A;  4XQF A;  1CQV A;  1PJ6 A;  4EX5 A;  3I3C A;  4XYQ A;  4RHR A;  1XMO L;  3WBJ A;  4XQQ A;  3GTM B;  3HOZ B;  1S72 B;  1BCP B;  1W3S A;  1YNJ C;  4DK3 C;  2R3Z A;  3F2C A;  1WTX A;  3W5O A;  1B8A A;  2B2U A;  4BBR G;  1EQR A;  3CCJ A;  2V4D A;  1IBM Q;  3E3X A;  1QWY A;  2OYN A;  4OXP A;  4RGN A;  4RAU C;  1NCV A;  5IYC H;  2VQF L;  3S16 H;  2Z6K C;  1IYV A;  2JA8 G;  2XTI A;  2N78 A;  3CCL A;  1X65 A;  2BM1 A;  2DY7 A;  2K03 A;  1ELO A;  3G71 A;  1SNC A;  4M1K A;  1GKH A;  4POG A;  2ZTG A;  5FO0 A;  2EYP A;  4DR7 Q;  3DUZ A;  4K6L A;  2C2W A;  3I55 A;  1A8V A;  1KTV A;  2V7W A;  1Q8I A;  2KQ3 A;  5DEH A;  2ZTN A;  4X64 Q;  3J7A F;  1V1P B;  1NMG A;  1TUI A;  1H85 A;  2XGJ A;  4G1V A;  3W2D A;  3KLW A;  3KUP A;  3KLS X;  1K8A C;  1EY4 A;  1TWA B;  3AB9 A;  1CNF A;  4AQY L;  4H44 C;  1VQN A;  2UUA Q;  3KF6 B;  3U6K A;  2XIW A;  1HXY D;  2BSA A;  1P16 A;  3URY A;  4DNR B;  1PTO B;  5E7N A;  2KEN A;  5C4J B;  1HHV A;  3PO2 B;  2AQ2 B;  2RSO A;  3QJY A;  3HOX B;  3D26 A;  2RCF A;  5BN4 A;  1UE1 A;  1X56 A;  4I7A A;  5EKK A;  3PSI A;  2D0P A;  4K5W A;  1CNE A;  4P26 A;  2F0O A;  2OBR A;  4Z9C B;  1PZJ D;  1CZG A;  3ASS A;  3VMF A;  4DNT B;  2HQE A;  3H6M A;  3JAM i;  2RC5 A;  4GKJ L;  3PUW A;  2NYZ D;  3AYH B;  4DR5 L;  4P3Y A;  2E2H B;  1IBM L;  4YHH Q;  1QUF A;  3MWY W;  4U9U A;  2ZXP A;  2PNR C;  3R2I A;  4KKS A;  1QZG A;  2ZXO A;  1EQQ A;  3CW2 A;  4JI7 Q;  1H9K A;  4DV1 L;  3TS2 A;  3U58 A;  1BCP D;  4RDJ A;  3LNN A;  3ULJ A;  1HUM A;  4DV3 L;  2EZV A;  2AWN A;  1QZH A;  4DR7 L;  4MN3 A;  3NBH B;  3G6E A;  2C5H A;  1LTG D;  1HUN A;  1R4Q B;  2C4T A;  3D4R A;  3CC2 A;  3TS0 A;  1CZW A;  4DV0 Q;  1YX2 A;  4GNX A;  3A8J A;  2AWO A;  2UU9 Q;  1O7L A;  2K6A A;  3K8A A;  1TWA H;  1I94 L;  1BBW A;  4F8M A;  3A74 A;  1GUT A;  3DM3 A;  4DF7 A;  3OHX C;  1D6E C;  2YTY A;  5I6W A;  2MO1 A;  1XPR A;  2BM0 A;  1EFT A;  1SAP A;  1WCM H;  4BBS H;  3WBK A;  3W5U A;  1WCM B;  4BBS B;  2AMC B;  2FMC A;  3CHB D;  2A6H C;  1FND A;  1E7Z A;  2EY6 A;  4A3I G;  5K36 H;  2BDO A;  3ZZU A;  4C43 A;  5C3E H;  1B9N A;  4FF4 A;  5GAG C;  1GO2 A;  4GKJ Q;  1NJI C;  3U9O A;  5FNZ A;  3D8G A;  4XL9 A;  1TS2 A;  3W5H A;  1B4O A;  2OQ0 A;  3HOU G;  4OWT B;  3HP3 A;  3A1P A;  3AGQ A;  4PG3 A;  2CW0 C;  1GUW A;  1DON A;  3AQQ A;  2XN9 C;  4ZCM A;  1R5B A;  2CRV A;  1MSG A;  2MPM A;  5GQO A;  3CPW A;  1Q86 C;  3HAG A;  1O7I A;  1E64 A;  1PTO D;  2LSS A;  5GV8 A;  1GAW A;  2FJ2 A;  3X3M A;  4O0A A;  4RGM A;  4YCU A;  5KYL A;  4DV3 Q;  4CQJ A;  2PZT A;  4DV1 Q;  2L11 A;  4YAF A;  1BKB A;  4L6T B;  1VQ8 A;  4K6D A;  4LUO A;  1I3Q B;  2EJM A;  4QIW B;  1PYB A;  1FD7 D;  1OXV A;  2BDN A;  1Q8K A;  5AJ3 L; 
#chains in the Genus database with same CATH homology
 4GZY C;  3KF8 A;  1BUV T;  2RQX A;  3A54 A;  1JIC A;  1LTI D;  1DOM A;  3G05 A;  2WJY A;  2K05 A;  1U4M A;  4FF1 A;  1F2Y A;  5IGF A;  4MHE A;  3K5O A;  3GTL B;  3OWE B;  2BE5 D;  3RMH A;  1H9S A;  1UNS A;  1WTW A;  1E2W A;  5DM6 3;  2L5T A;  3A35 A;  4A3K B;  4CJ0 B;  2WZP P;  2VJJ A;  1ZYR C;  3IL8 A;  1BCP C;  1Q90 A;  4QB4 A;  2M9V A;  3U9S A;  3JAM L;  2F0U A;  1EY7 A;  1TY0 A;  1BPL A;  3BDL A;  2MP1 A;  4CGY B;  5D14 A;  2GK6 A;  3MEH A;  2NTS A;  4H13 C;  1MAB A;  4HCS A;  3OFN A;  2E75 C;  1SYF A;  1KNA A;  1LT5 D;  4B9X A;  4A3J B;  4LMQ D;  1LT3 D;  4KN4 C;  1RKN A;  2MHV A;  3HOW B;  2R61 A;  3SR1 A;  1PRT F;  1SNP A;  1VDZ A;  3CKI B;  5IT9 L;  4K8J A;  1Q12 A;  1OXU A;  2PPB C;  1BNZ A;  4XIG S;  4KMU C;  1UD2 A;  4KN7 C;  3NBH A;  1E3X A;  1I18 A;  2IX3 A;  1EIG A;  3W3A A;  1V8Q A;  2RVL A;  2QE7 A;  4X3U A;  1TWG B;  4WRD A;  1Z47 A;  4DXF A;  3GVJ A;  2RDF A;  4R8I A;  1L0Y B;  4M8A A;  3I73 A;  4RFB A;  4XNF A;  1K8O A;  1PDQ A;  1YNJ D;  5ELF A;  5IGE A;  2B2W C;  3ONA B;  5C5L A;  4E0F A;  3T16 A;  3PO3 B;  1R9T B;  4IFD H;  1BF4 A;  1J9O A;  1F77 A;  1E0B A;  3G7L A;  5E4X A;  2D62 A;  1GUN A;  2ZZQ A;  4B08 A;  1STE A;  4NP5 A;  2JJ2 A;  5EJW A;  5KNB A;  1MGS A;  2EXZ A;  1UUP A;  1F2Z A;  5F2D A;  4H0L C;  3VA7 A;  2K33 A;  3OPO A;  2LFN A;  3A8K E;  1XX8 A;  2NN6 H;  4OIJ A;  3PIP 3;  3GTK B;  1PTO H;  1PRT D;  5KNC A;  5CV9 A;  4IUU A;  1RDP D;  2F0H A;  3SEB A;  3AU7 A;  5DNF A;  3EJI A;  5CV7 A;  1K83 B;  3NWT A;  4EGV A;  3CP8 A;  3C1E A;  2HDL A;  3K5L A;  4E6I A;  1UD3 A;  2R7Z B;  4KHV A;  1SE4 A;  2F03 A;  5IGG A;  4Q5V A;  2WAQ B;  3UI2 A;  1I4P A;  4HSV A;  1LV9 A;  2TSS A;  5LHY 1;  3I4N B;  2KCC A;  2ID0 A;  4JMQ A;  1ZKO A;  3Q0A A;  2O2L D;  3SK4 A;  3TP7 A;  3QOL A;  5C3E B;  4OL7 A;  2F43 A;  2PYK A;  1B50 A;  5ELE A;  1I4R A;  2M5S A;  1JOO A;  2XSC A;  5DN6 A;  3GTO B;  3CES A;  2KA7 A;  2GK7 A;  3QIA A;  2DNC A;  1WTH D;  5KYI A;  2AQ1 B;  2H1E A;  4J6H A;  2KCN A;  3FKI B;  3BVM A;  2K5W A;  2NUC A;  3E5S A;  2WIN B;  4FXG C;  4XKV A;  5HGT A;  3GQB A;  2X85 A;  2F0M A;  1RJT A;  1ZEQ X;  1UD8 A;  3CMM A;  1I6V C;  2WJV A;  3S1N B;  4ID6 A;  2EVB A;  2EYF A;  2OF1 A;  2FHT A;  2WAC A;  3MTS A;  3HGB A;  3R2T A;  2I07 B;  2A74 C;  4TSS A;  2KEC A;  5FO8 B;  1ESF A;  5ELB A;  2NN6 I;  1IW7 C;  3PUY A;  3HS0 C;  1KLG D;  2X6L A;  1SKY B;  2ENB A;  3OIP A;  3SHL A;  4FVM A;  1SMY D;  1AZP A;  2F0V A;  5G3L D;  2PCF B;  2R92 B;  1PKV A;  2JXM B;  3TZD A;  4ZKB B;  2B8F A;  3E6Z X;  1ZYR D;  1WTR A;  4BS9 A;  2A73 B;  4KHZ A;  1V1P A;  4XOP A;  1Y69 U;  2PZU A;  3BYY B;  3SK8 A;  2A6H D;  2FIN B;  4DAV A;  1JWS D;  2L55 A;  1FGB D;  4NW2 A;  1HTL D;  1AN8 A;  1PFN A;  2X53 S;  1A3V A;  3TN2 A;  2ICE C;  5I9P A;  1SFO B;  1WTO A;  2K28 A;  4RWS C;  3L9A X;  3DM1 A;  1STN A;  1EQT A;  4C1N I;  2L4N A;  4RCN A;  5COY A;  1G2T A;  1Y1W B;  1EZ6 A;  1EY5 A;  2ZZG A;  4S3S A;  1CHQ D;  3JU4 A;  3J81 L;  1EWH A;  1QB5 D;  3VR4 A;  3KLR A;  1ENA A;  1BLI A;  3OEH A;  1BQQ T;  3WDN A;  4A3F B;  4B9W A;  3MFY A;  4R8N A;  4PQX A;  1G6Z A;  1HTP A;  4C56 C;  2O5J C;  2B2Y A;  1JWM D;  3L7Z C;  1WD0 A;  1U4P A;  1AEX A;  1I4H A;  4C3H G;  3IAY A;  1LTR D;  1KDC A;  1TT2 A;  2PZW A;  4DK1 A;  3SVM A;  3DDY A;  3NTK A;  1S5F D;  3C3L A;  3J81 E;  4J1M A;  1I6H B;  3A7A B;  5C4Z A;  2PW5 A;  1C48 A;  4XKW A;  1TKW B;  2Z4H A;  2EYM A;  1IKL A;  2L9H A;  3NXW A;  3BCF A;  1JCK B;  4X3K A;  1RTO A;  1XXG A;  3AMU A;  1I8D A;  1CTM A;  1PLF A;  1W0J A;  5CR3 A;  3H91 A;  2YYZ A;  3DEP A;  4K8I A;  1PZI D;  2Z4I A;  5M9O A;  4XOR A;  1QG7 A;  3IFT A;  4IUT A;  5A2Q E;  4N9P A;  1OXX K;  3FPP A;  3K5N A;  2F4I A;  1OXT A;  2XND A;  4RKL A;  2D2C C;  4A93 B;  3ERQ A;  4UDU C;  4V19 0;  1ENC A;  3RUZ A;  2XRS D;  3MXU A;  2F0K A;  5CBA E;  1Q1E A;  1GUS A;  4K2K A;  4R9W A;  1QIL A;  3GVL A;  2O4X A;  2EJG C;  4ZK9 B;  1TR5 A;  1QJO A;  2JYO A;  3BDC A;  1VLY A;  5EPK A;  1SSO A;  5KGU A;  1BO0 A;  2XRQ D;  1SXT A;  4KTA A;  3PV0 A;  1B2T A;  2Q8I B;  1HQM C;  4PMW A;  1PXU A;  1A2T A;  4BY7 B;  1NAP A;  3D3R A;  5D3I B;  1KZL A;  5FOB B;  4WFN 3;  2MJ8 A;  1X3P A;  4QF4 A;  3WOE A;  1DXM A;  1MBY A;  2RKS A;  5FLX L;  1FNV A;  3OW7 A;  3VR5 A;  1V0E A;  2KUM A;  5KRU A;  1TQO A;  3BS1 A;  2KVO A;  4XON A;  2B2Y C;  3T56 B;  3K7A B;  4HED A;  1J8I A;  3H94 A;  4ZUI A;  1E43 A;  1E2V A;  4RH6 A;  5M5Y B;  3F2U A;  1CM9 A;  2QCP X;  5DM7 3;  2WKC A;  1H9S B;  2M2L A;  4DAP A;  3K5M A;  5C44 B;  5JEA H;  2D3L A;  1D5M C;  1II3 A;  1HVX A;  1SMY C;  1G29 1;  4TRD A;  3BDO A;  3OEE A;  1KTK A;  1SNO A;  2ZT9 C;  3GV6 A;  4DGZ A;  1OHH A;  5EGT A;  1DJR D;  1WVL A;  1E79 A;  5K5P A;  3CRK C;  3GTP B;  1SBB B;  4B3G A;  5IGC A;  2FFK B;  2OXP A;  4ASU A;  5FLX E;  2ICI A;  2SNS A;  3CQZ B;  3MHB A;  3A8J E;  3OMC A;  1EZ8 A;  3SE0 A;  3TSS A;  1EQV A;  1EU4 A;  1SDF A;  4H7B A;  1SEB D;  4IFD J;  1D5Z C;  2VUM B;  2VB3 X;  1RD9 D;  2WV6 D;  2Q8T A;  2G9D A;  4HMJ A;  1FX0 A;  1VCI A;  5JOB A;  1D1I A;  1TWF B;  4JBW A;  4RKB A;  5CYU A;  2A68 D;  1EIH A;  1UD4 A;  1S4Z A;  2EJF C;  2J7Z A;  3NTH A;  5C3X A;  2IPK D;  2TMP A;  5IGB A;  3FDT A;  3S2D B;  5CDF A;  2L1B A;  2C9O A;  1JC7 A;  4P22 A;  1KLU D;  2BA1 A;  4EQN A;  4IUR A;  1EY8 A;  4FXD A;  4XLF A;  2B2T A;  1CI3 M;  2PW7 A;  2NB0 A;  2IX1 A;  3JAM E;  3S17 B;  1F9R A;  1H8E A;  1EWC A;  2JE6 I;  2D9U A;  2JEA I;  1MSH A;  4OHJ A;  1E1R A;  2AUK A;  5IGD A;  2N88 A;  2B8G A;  1S5D D;  3K6O A;  2R6G A;  1LAC A;  5CGK A;  2LMC B;  3NTI A;  3D6W A;  3GP7 A;  4ZUJ A;  5M5X B;  2BE5 C;  4CJ1 B;  3ZYY X;  4U67 3;  4WOR A;  2RDG A;  4TKO B;  3J80 E;  1UEA B;  3IFD A;  3T4A C;  4KD3 A;  4HAE A;  1KAB A;  1SJE D;  4B3F X;  3DXJ C;  1IYU A;  2V7Q A;  4KY5 A;  3R8B A;  1EY0 A;  4O1N A;  4P2C B;  3DWP A;  1JOK A;  2A5H A;  2WKD A;  2A69 D;  2F0P A;  2JDI A;  5NUC A;  3Q22 A;  3EFX D;  1KDB A;  4LJZ C;  4L8J A;  3ZPN A;  5C6A A;  5DAU A;  5C5M A;  4OO1 H;  3NBI A;  4A3B B;  4RHS A;  3VYS A;  2O5I C;  4ZRZ A;  3FVQ A;  4II2 A;  1G2S A;  2F0W A;  1H9M A;  5CV6 A;  1GHK A;  3OIQ A;  4ILW A;  1ET6 A;  1LTT D;  2G9H D;  5KIX A;  4V0B A;  1ONL A;  2EY2 A;  3MVV A;  4JK1 C;  2B63 B;  4OO1 G;  2RDH A;  2E2I B;  1A2U A;  4ODG A;  1NBM A;  4XLE A;  3BYT B;  1FR3 A;  1EY6 A;  3M4O B;  5JPM C;  2B2T C;  1XTC D;  2XOK A;  5EPJ A;  4EQP A;  3S16 B;  1HCZ A;  3HEJ A;  1CT1 D;  4RGO S;  1ET9 A;  5T1G A;  2JJ1 A;  3S14 B;  1G8Z D;  2EPB A;  4XLH A;  2XWB B;  5G3L F;  2XNA C;  2R93 B;  3PUX A;  3R3O A;  5J22 A;  5I4D A;  2F0S A;  2IT1 A;  4TSF A;  3DEO A;  3PUV A;  4FYD A;  2F0N A;  4QUF A;  3MXN A;  2LKV A;  2BA0 A;  5I6Y A;  5E3F A;  2B2U C;  4KY6 A;  4HMI A;  5EBD A;  2HCI A;  3H3V C;  1F9S A;  3H09 A;  4L63 B;  3S1M B;  1CQF A;  4XYO A;  3WQZ A;  3J7A V;  3FKS A;  3S9W A;  2J0T D;  3N52 A;  3QWN A;  2K32 A;  5M3M B;  3KBX A;  1SNM A;  1H8H A;  1BMF A;  3OAA A;  2NVY B;  5C0X J;  1R4P B;  3QB3 A;  3I4L A;  3OOC A;  1EYC A;  1GHJ A;  4XD7 A;  1S5E D;  4ULL A;  5C0X I;  1NR2 A;  3NSW A;  2E2D C;  1ILP A;  1F9Q A;  1RHP A;  5A2Q L;  5D3D A;  4LAA A;  2X69 A;  3VYU A;  2F0E A;  5ELC A;  4KD4 A;  1WTV A;  5C4H A;  3FRP B;  3TP8 A;  3RZO B;  3TDQ A;  4C3J G;  3BCD A;  4XLC A;  1Y8P B;  1ICW A;  5J1Z A;  2GJK A;  2NN6 G;  2CVR A;  3Q24 A;  1PTO F;  1TWH B;  4EVO A;  4G57 A;  4G7X A;  3A8I E;  1SYE A;  2NVQ B;  3SK5 A;  5JAV A;  4YXW A;  3A3B A;  4NMZ A;  2E2J B;  2F0D A;  2PMZ B;  3NPP A;  1JQY D;  1O7Z A;  1TY2 A;  3OWF A;  1AW7 A;  4KV6 A;  1IW7 D;  2SNM A;  3QG1 A;  3EA6 A;  1Z7T A;  1GJX A;  5IOD A;  5CV4 A;  1Y1V B;  1DZ1 A;  4HR7 B;  2SDF A;  1QNU A;  4F7X A;  1YNN D;  5JVG 3;  4PV1 C;  4XXE A;  2L12 A;  4ABN A;  1TS3 A;  4C3I B;  2EYO A;  3LX0 A;  1Q3L A;  2KOL A;  1PMR A;  2VJI A;  4ME5 A;  3EVQ A;  2K7V A;  1WD1 A;  3KK7 A;  2BOS A;  1ENF A;  3SXH A;  4XT1 B;  4IQZ A;  2A69 C;  1U9R A;  3TP5 A;  1B9M A;  2F0F A;  4HIZ A;  2WSS A;  1VF5 C;  1SYD A;  3RZD B;  2LY7 A;  4CKB A;  3D4W A;  2IWH A;  3HKZ B;  3O13 A;  3I90 A;  1B1Z A;  4U68 A;  2KED A;  3S1R B;  4IUQ A;  2C5C A;  4G6I A;  1HA5 A;  3RLF A;  5EKL A;  3GTG B;  2F0T A;  1QE6 A;  4RA8 A;  1L0X B;  3VYT A;  2ZXI A;  3M3Y B;  3RD4 A;  4FXK C;  1A3U A;  1RF2 D;  1T5E A;  4FO2 A;  4G7Z C;  1SYG A;  3BVZ A;  1JB3 A;  4HN7 A;  1LO5 D;  3I8Z A;  2AQ3 B;  1H9J A;  4IUN A;  5IIF A;  1X3Q A;  1A6X A;  4ZQ3 A;  2LZJ A;  2LS0 1;  1COW A;  5JPN C;  4BY1 B;  1EYD A;  1IHZ A;  3FPU B;  4XR6 A;  1STB A;  4KKT A;  5JEA G;  4Q0F A;  5HUR A;  2B2W A;  4ZLT F;  4TT3 A;  1T5X D;  2BCO A;  1D1K A;  3HG9 A;  1C8C A;  1EL0 A;  4DN4 M;  3T53 B;  1M4V A;  4A3M B;  2CHB D;  3ND9 A;  1SJH D;  2E76 C;  3TP6 A;  4PNY A;  1QOH A;  3VR6 A;  1LT4 D;  2FMM A;  5K36 G;  3NE5 B;  3OMG A;  1I4X A;  3P7J A;  1ZXT A;  1LLR D;  5COR A;  4M1U B;  2OEO A;  4XN3 A;  4I7Z C;  1JE4 A;  3DMU A;  4K14 A;  2H4O A;  2F0I A;  4G7H C;  1RTN A;  3GV3 A;  4BBR B;  1DOL A;  3D6C A;  3GD7 A;  1K8M A;  4KKU A;  4IN3 A;  2RSN A;  1GOZ A;  1A3T A;  4ZAI A;  1H9R A;  2F0J A;  1SND A;  2KHS A;  1TWC B;  3A56 A;  1DD2 A;  2VB2 X;  4C2M B;  3WOF A;  2SOB A;  2Z6B D;  4FP5 D;  3N6R A;  1WPC A;  1W9X A;  5M5W B;  2GJP A;  4PMB A;  1I4G A;  1MD2 D;  1W6K A;  1TS5 A;  2PQE A;  4QMG A;  1O78 A;  1EU3 A;  4N9T A;  1PZK D;  4KI0 A;  3I91 A;  4AYB B;  4G7O C;  1JR0 D;  1VF7 A;  4FXU A;  1HA6 A;  2KJX A;  3M85 A;  4J8Q A;  4DFA A;  5JVH 3;  4WJW A;  2NZ1 D;  1HFN A;  1Y8N B;  2B2V A;  1WTQ A;  4DA2 A;  1SYB A;  3QOJ A;  4BA2 I;  2JSO A;  4C3J B;  1V1O A;  1EEF D;  3KEW A;  2Q8R E;  1O7Y A;  1BDO A;  4ZKC B;  1AFP A;  4DU9 A;  1FNU A;  1QNK A;  2XVS A;  2JA8 B;  1M8A A;  4A3D B;  2EY5 A;  3K59 A;  2R9V A;  4A3G B;  2PO4 A;  2DN8 A;  3I70 A;  3VYR A;  1KAA A;  3GO5 A;  3PUZ A;  3Q23 A;  4FF3 A;  5IOC A;  1KDA A;  3SK6 A;  1Q1B A;  4RCO A;  5JEA J;  4C1N K;  2F1M A;  3GVK A;  4HTH A;  3DHQ A;  3GTJ B;  2F0G A;  1IL8 A;  2A68 C;  1K28 D;  3MA2 B;  4HCE A;  4UZU A;  3PIO 3;  1CFM A;  1EYA A;  5IT9 E;  1BOS A;  3R93 A;  4C3I G;  2AUJ D;  4IAL A;  4KK7 A;  3C46 A;  3M7G A;  1U4L A;  5BN3 A;  2X6X A;  1SE2 A;  2NTT A;  1UAP A;  3NHH A;  2QDB A;  1V0F A;  3LWE A;  1LAB A;  1ML0 D;  1TU2 B;  3K0Y A;  4DK0 A;  2EY1 A;  4A3E B;  1BCP F;  3S1Q B;  4BA1 I;  2WPD A;  2EYL A;  2CW0 D;  5HKK A;  4OGQ C;  1LTS D;  5A35 A;  5I9O A;  3K58 A;  1ESR A;  2XWJ B;  4K5X A;  1PTO C;  2XZP A;  2EE1 A;  1QCB D;  2JA7 B;  4IZ8 A;  3TME A;  1FNW A;  4BWG B;  3L3O C;  3C1F A;  1JOR A;  1F2L A;  4YEJ A;  3A55 A;  1EFR A;  2MUY A;  2KEE A;  1KNE A;  3IKJ A;  1WP6 A;  1HPC A;  3FMC A;  3V05 A;  1NUC A;  2B39 A;  3J80 L;  4MIU A;  4Z1M A;  3MXP A;  4K2L A;  2E1B A;  1I4Q A;  2QKI C;  2QF7 A;  1ILQ A;  1HRJ A;  2RBM A;  3D4D A;  4F87 A;  3I72 A;  2F3V A;  2GA4 B;  1G91 A;  3J7Y W;  2J4X A;  1Z6H A;  5I2Y A;  1PFB A;  4QCL A;  4K5V A;  2VNU D;  4OIK A;  1NSN S;  1KMH A;  2KVM A;  3MFG A;  5J39 A;  3P75 A;  3CU7 A;  2XZO A;  4KY7 A;  5FL7 A;  1DCZ A;  3NWS A;  3NQT A;  2JP1 A;  2K5D A;  4II3 A;  2X6Y A;  3DWA A;  4NKL A;  5BN5 A;  3K57 A;  3P1H A;  4OO1 I;  3BG3 A;  1ROD A;  4G7W A;  1S5C D;  1DM0 B;  3OSO A;  2IX0 A;  2QEJ C;  3HRZ C;  3I4M B;  2NVT B;  2EYH A;  2ZZE A;  1BBX C;  4X3T A;  2M00 A;  5EKI A;  2ZZF A;  1GXD C;  1TS4 A;  1F2M A;  3EQL C;  2DIE A;  1CK1 A;  4PMC A;  2XZL A;  4G4K A;  4XTC S;  1PRT C;  5CC4 A;  3FEW X;  5ISR A;  3BH4 A;  1S5B D;  2W6J A;  5KEE A;  3VR2 A;  2X8K A;  1OB0 A;  1AP0 A;  5E4W C;  3GTQ B;  5T1I A;  3MC0 B;  3P20 A;  4AVZ A;  5FK9 C;  4LK1 C;  4C3H B;  2ZXR A;  5KND A;  5TSS A;  3NQI A;  2X6W A;  2HCC A;  2K5Q A;  2K1B A;  1MI2 A;  3ND8 A;  5IK2 A;  4FNF A;  2DY8 A;  5LL6 S;  4HSP A;  4CBV A;  5EPL A;  1HZE A;  2V31 A;  4KJO A;  1NR4 A;  3PMF A;  3HOY B;  2WII B;  2F0L A;  3KBG A;  2JA6 B;  1B3A A;  1TVX A;  3M7N A;  2NVX B;  1SNQ A;  1BXT A;  2EDG A;  2Y0S B;  1LT6 D;  4IUP A;  3ITP A;  2SEB D;  4EQO A;  2IJ0 A;  3NP8 A;  4IFD I;  1V43 A;  5FKA C;  1EY9 A;  5I2X A;  3A7L A;  1UD5 A;  1I50 B;  1HFG A;  3MAQ A;  5M3F B;  3G6J B;  3V96 A;  3BZD B;  1DOK A;  2EYJ A;  1YNN C;  1IKM A;  3NUC A;  2N55 A;  4RGT A;  2EOT A;  2GJR A;  1HQR D;  5D65 A;  4CKE A;  1NRK A;  5FO7 B;  1Y8O B;  4Y7N B;  3E0J A;  1W0K A;  4XMY A;  5E1F A;  1TII D;  1U4R A;  3S15 B;  4A3I B;  1STH A;  4CKC A;  3OE7 A;  2D5D A;  1A15 A;  2X6G A;  2F0Q A;  5C3W A;  4IUV A;  1CA5 A;  1DYQ A;  4KJN A;  1GUO A;  2Z8L A;  3V2T A;  2MGS A;  1PYW D;  3TZU A;  2A6E D;  3T51 B;  4QUC A;  4XM3 A;  1JOQ A;  1OO9 B;  3NK9 A;  2CQA A;  3HOU B;  1D2B A;  1EEI D;  2F3W A;  3MXG A;  4XDX A;  3HOV B;  1STA A;  3BC9 A;  3X3N A;  3TBI B;  3QO2 A;  1VMP A;  3C2P A;  1FYC A;  2B2V C;  1XYI A;  2L0C A;  5JJZ A;  1WTP A;  3Q6S A;  5EBC A;  1AZQ A;  1SE3 A;  4O42 A;  1E3Z A;  5FO9 B;  1STG A;  2OT2 A;  4YIJ A;  1B53 A;  3BVG A;  1BR9 A;  4XT3 B;  1JWU D;  3CRL C;  3LWU A;  4I65 A;  2IW3 A;  4F88 A;  3MZ5 A;  5AFW A;  4GQN A;  5CMD A;  5ELD A;  5KNL A;  4XQJ A;  1PFM A;  1X32 A;  3ERO A;  4FF2 A;  1LTB D;  4DXG A;  1RCV D;  4YEL A;  1CHP D;  3DWQ A;  2E74 C;  2NWG A;  2NBF A;  2RA4 A;  2WB1 B;  1SYC A;  1PRT B;  1CA6 A;  2CK3 A;  1OXS C;  5CBE E;  1EOT A;  2HDM A;  4TQU S;  2JA5 B;  3SDZ A;  3VA5 A;  2WP8 J;  5C0X G;  4X3S A;  3HZX A;  2VXW A;  2JIZ A;  2DNE A;  2QIL A;  2Z1C A;  4IFD G;  1C4Q A;  3CP2 A;  4UAI A;  1GUG A;  3H0G B;  2JEB I;  3ZIA A;  1VMC A;  1STY A;  4XOT A;  1B44 D;  2W6I A;  2I46 A;  2D3N A;  5CV5 A;  3KLS A;  1W6J A;  2HUG A;  2A6E C;  1LTA D;  2IL8 A;  4DAY A;  1EFI D;  4ZYS A;  1VJS A;  1UD6 A;  1XWE A;  3M4Y A;  5C0X H;  2HLD A;  2ZXH A;  4XQN A;  3VR3 A;  4XN0 A;  1D5X C;  3S2H B;  5LL6 X;  3T13 A;  5C4X B;  3D31 A;  1E1Q A;  2K04 A;  4CJ2 C;  1F9P A;  5EQ0 A;  4CHT B;  4XLA A;  2YU9 B;  4NDX A;  2K01 A;  4NNJ A;  5CV8 A;  1E2Z A;  3A3G A;  1O80 A;  4XQF A;  1CQV A;  3I3C A;  4XYQ A;  4RHR A;  4XQQ A;  3GTM B;  3HOZ B;  1BCP B;  1YNJ C;  2R3Z A;  1WTX A;  2B2U A;  2V4D A;  1QWY A;  4RGN A;  4RAU C;  1NCV A;  1IYV A;  2DY7 A;  2K03 A;  1SNC A;  2ZTG A;  2EYP A;  3DUZ A;  4K6L A;  2KQ3 A;  1Q8I A;  5DEH A;  2ZTN A;  3J7A F;  1V1P B;  2XGJ A;  3W2D A;  3KUP A;  3KLS X;  1EY4 A;  1TWA B;  3AB9 A;  4H44 C;  2XIW A;  1HXY D;  3URY A;  4DNR B;  1PTO B;  5C4J B;  1HHV A;  3PO2 B;  2AQ2 B;  2RSO A;  3QJY A;  3HOX B;  5BN4 A;  5EKK A;  4K5W A;  2F0O A;  4Z9C B;  1PZJ D;  1CZG A;  2HQE A;  4DNT B;  3H6M A;  3PUW A;  2NYZ D;  2E2H B;  3MWY W;  2ZXP A;  2PNR C;  3R2I A;  4KKS A;  2ZXO A;  1H9K A;  1BCP D;  3LNN A;  1HUM A;  2EZV A;  2AWN A;  4MN3 A;  1LTG D;  1HUN A;  1R4Q B;  3D4R A;  1CZW A;  2AWO A;  1O7L A;  2K6A A;  4F8M A;  4DF7 A;  1GUT A;  3OHX C;  1D6E C;  5I6W A;  1SAP A;  1WCM B;  4BBS B;  2FMC A;  3CHB D;  2A6H C;  2EY6 A;  5K36 H;  2BDO A;  4FF4 A;  1B9N A;  3U9O A;  3D8G A;  4XL9 A;  1TS2 A;  1B4O A;  1GUW A;  3HP3 A;  2CW0 C;  1DON A;  2XN9 C;  1MSG A;  2MPM A;  3HAG A;  1PTO D;  2FJ2 A;  3X3M A;  4RGM A;  5KYL A;  2PZT A;  2L11 A;  4L6T B;  4K6D A;  1I3Q B;  2EJM A;  4QIW B;  1FD7 D;  1OXV A;  2BDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...