3NE5B

Crystal structure of the cusba heavy-metal efflux complex from escherichia coli
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CusBA heavy-metal efflux complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Cation efflux system protein cusB
total genus 60
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00529 HlyD HlyD membrane-fusion protein of T1SS
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3ne5B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ne5B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3ne5B01
1FYCA 3GQBA 3P20A 1I6VC 1SMYC 3I73A 1IW7C 4GZYC 1E2ZA 3A7AB 3LWUA 1OXVA 2E76C 4XTCS 1H9JA 5BN3A 1ZKOA 2L5TA 3A8KE 1EWHA 3M7NA 1CI3M 3IFTA 2BA0A 3TZUA 1H9KA 5BN5A 1LACA 4G7OC 4DNTB 2A68D 1Q90A 1A6XA 1DXMA 3MFYA 5KNDA 2NN6H 3WDNA 3H94A 1HPCA 4KKTA 2KCCA 1GJXA 2IT1A 4DK0A 4RCNA 3W3AA 2D62A 2EJFC 3VR3A 1Q12A 4H13C 2A6EC 2EJMA 5K36H 1IYVA 1GHKA 2DNCA 1OXUA 2V4DA 3BDOA 4H0LC 2PPBC 3SDZA 3PV0A 1VF5C 3PUXA 2BA1A 2DNEA 4KKUA 5C0XH 1E2VA 2NN6I 5KNBA 4HR7B 4XIGS 1IYUA 3AB9A 2CW0C 2EVBA 4KMUC 1O78A 2AUKA 1GUOA 2A6HC 1Z7TA 1DCZA 1K8MA 4OO1G 2A6HD 3I4LA 4DK1A 4KHZA 3VR6A 1H9SA 4TKOB 3KLRA 4LJZC 5C0XG 2D5DA 3CRKC 3A8JE 1PMRA 3T56B 2AUJD 2EDGA 3EQLC 1GUGA 1Q1EA 2B8FA 1VF7A 1OXSC 4OGQC 2ZT9C 1G291 1H9RA 1T5EA 1K8OA 4KN4C 3OOCA 2D2CC 1CFMA 3CRLC 3IKJA 1IW7D 3T51B 2A6ED 2JE6I 3VA7A 1HCZA 3VR5A 1H9MA 3D31A 2QF7A 1Y69U 3OPOA 1CTMA 1HTPA 2DN8A 2YYZA 4PV1C 2JXMB 3L7ZC 2R6GA 1Y8OB 3PUVA 1OXTA 1QJOA 3U9SA 2K33A 4DNRB 4TQUS 5JEAH 1Y8PB 2O5IC 4IFDH 3SE0A 3DXJC 2F1MA 2PNRC 3ND8A 3PUYA 4G7HC 1BDOA 2A69D 4KI0A 4JK1C 1YNNC 2PCFB 3T53B 3LNNA 2JEAI 1O7LA 2O5JC 1VCIA 2JEBI 1V43A 3QJYA 3RLFA 2E74C 5JEAG 4IFDG 1GHJA 1GUTA 1V8QA 2NN6G 4L8JA 3I72A 3M4YA 5K36G 3N6RA 3D4RA 3QIAA 3HGBA 3VR2A 4I7ZC 1OXXK 2BE5D 4BA2I 3A7LA 4IQZA 4KKSA 3NE5B 1FR3A 2BDOA 2BE5C 3MXUA 3OW7A 3ND9A 1VDZA 2Q8IB 1ONLA 3M85A 4BA1I 2LMCB 5BN4A 2A68C 2B8GA 3VR4A 1B9NA 3PUZA 1H9SB 2EJGC 2AWOA 1GUNA 1Z6HA 1E2WA 3FMCA 3GD7A 1TU2B 1HQMC 2E75C 1ZYRC 2KA7A 4JBWA 1LABA 2A69C 4KN7C 1Q1BA 5KNCA 1DD2A 1B9MA 2K32A 4OO1H 4G7ZC 2K7VA 3BG3A 4H44C 3QG1A 3PUWA 3A8IE 4LK1C 1Y8NB 1YNJC 3FPPA 1GUSA 5A35A 1TKWB
chains in the Genus database with same CATH superfamily
4XM3A 1SMYC 1S72B 1E63A 3STBD 3I55A 4B48A 1I4GA 3BZKA 3S1RB 4LF7Q 1WOPA 1ZKOA 4JI5Q 4RDLA 1CI3M 2EYPA 2F43A 1D6EC 1A15A 4LUZA 5BSYA 3WNBA 5CV5A 4C3IG 4FXGC 2CF4A 4A3KG 4G7OC 2A68D 2QGGA 1A6XA 5CV6A 4PZ8A 1C9OA 1GJXA 3Q39A 3R3OA 2H5XA 2IT1A 3LQEA 1B3AA 1BF4A 3VO1A 3CCJB 3DDYA 1K8AC 2ID0A 3X3NA 4L5SA 2PI2E 1IBLL 2XNDA 4DR1Q 4QUFA 4X6AH 3BDOA 5M3MB 2VYQA 2AKWB 4GOPA 5IP7H 4TMZA 1YEZA 4K2KA 5FL7A 5T1IA 1M1KC 4LW1A 1VLOA 1DOMA 1N06A 2N78A 4OOVA 2AUKA 5I6WA 2QTLA 1N36L 1HA5A 2Q6LA 3ASQA 3VR6A 1H95A 1HA3A 3W2HA 4ZAIA 1STAA 1IBKL 1F2MA 1N32Q 1NMFA 1U5KA 1WCMB 2WIIB 2VUMH 1OXSC 1X3GA 5C3WA 1STEA 1T5EA 4YCWA 2N8NA 1EIFA 1EWYA 3SK4A 3G6EB 1SBBB 3RN5A 2DY7A 2C35B 1EFCA 1RQPA 2QEXB 1PZJD 2YV5A 3VA7A 2QEJC 2FX3A 2UU9Q 4DR4L 5IYRA 2BPOA 3H15A 1VQ8A 3L0OA 1J8IA 3HAGA 4DR3L 3HOUB 3SEJA 2DYIA 4XLEA 2EY5A 1HZAA 2YU9H 5CDFA 4EVOA 1KC8D 1T6XA 2RSOA 4N9TA 1YHAA 2NZOA 2OK8A 1EFTA 3MMPA 5IYBH 4XN0A 2KHIA 2XWBB 2OBRA 3PUYA 4YWKA 5LMNQ 4UP8A 1VQOB 4P3IA 2K50A 4BY7G 4XYQA 3T13A 3T53B 1QVCA 4PABA 1MKHA 5IY0A 3ZBTA 2FVGA 1A0IA 2ZTCA 4RCYA 1VQJA 3RMHA 4A3EH 3NBHA 4IPCA 3M4YA 1WP6A 3VDYA 2VY3A 5IT9c 4RJLA 2YWGA 4E0FA 3M4OH 3KBGA 4RPDA 3LO8A 1NRKA 1SYCA 4IQZA 4XDXA 2WJYA 2XSCA 2B2WC 3M85A 3UI2A 5IT9L 1SE3A 2A68C 1I3QB 3EJIA 1EOTA 2ZM6Q 1YJNB 1KTKA 5M3FB 2PIAA 4HJ5A 1Q81C 2Q6OA 1K73D 3Q6SA 2F0GA 4BBSB 2UXDQ 2JA6H 3GTQH 3NK9A 4RCOA 4LFAQ 2KHJA 4GN4B 3H3VI 1DM0B 1KXLA 3KF8B 1PFBA 5EBCA 5EJWA 1ZUNB 4QMGA 2R6HA 3CD6A 1I6VC 1KZLA 4IPHA 1LTLA 4DV2L 4XD7A 4ZK9B 2EIFA 3K7AB 4X66Q 3ERQA 3D0FA 3QOLA 1UD5A 1TWFB 1VQOA 1SKQA 1WD1A 2F0HA 3IFTA 3TSSA 4RGMA 2HDNB 1VQLA 4DV0Q 2UXCL 4XKWA 3SR1A 1Q90A 1UWVA 2B2UA 1NDHA 2J0TD 3CCRA 3F1ZA 4RAUC 1SJED 2LZJA 2EJMA 1UE6A 5K36H 4UZEA 2Z6BD 2R7DA 4Z1MA 3SDZA 1A8VA 4AF6A 4A3MG 2OT2A 2N49A 4O2DA 4C3HB 1VQIA 2KEEA 3CC7B 2VQEL 2QA4A 4XIGS 1M4VA 3CQZB 1ML0D 3G4SA 3D6WA 1FNUA 3QFRA 1PHJA 5J3BA 3MTSA 1CHPD 1Q8KA 2BOSA 1VQDA 1HH2P 4R4IA 5J35A 4EQPA 2HCIA 2QCPX 2JA6G 1WJJA 1CZWA 2EDGA 4XQJA 4DV6L 3OZUA 4GNXC 1G291 1H9RA 4KY5A 3EBEA 2WZNA 1WTOA 1PH2A 4WJ3M 2DGYA 4CJ2C 4LUOA 4DV0L 1RODA 4P74A 4MTKA 1Y1WG 4DQKA 1X3QA 1D5XC 3GP7A 2IHFA 4MHEA 4HIDA 3L7ZC 3PIPA 1Y8OB 2FMCA 5NUCA 5M5YH 4TQUS 1Y8PB 2RBMA 4XORA 1BVSA 3CCUA 4HEDA 1VQAA 5E1FA 2VBSA 4POFA 1IL8A 2NZHA 1D1NA 1E1OA 4K0KL 1KDAA 3FVQA 2R7ZB 3ZYYX 5C44B 1G2TA 1VQ7A 3M4PA 4FF3A 1I4HA 1K3BC 4XQNA 1SFOH 1WTPA 4GOPC 3M7GA 4IUQA 4PMWA 4XKVA 1G2SA 3A8IA 2VQFL 1G7TA 2RC5A 1A3VA 5DSZA 4GN3B 1JR0D 4RDJA 2CCZA 2B8GA 2OWOA 4OWWB 1F9SA 3BDCA 4A3MH 1JA1A 3RY8A 3CPWB 1E62A 1VQHA 3U6KA 4C43A 5CV4A 3FJOA 1KAWA 2IX1A 4YALA 1B9MA 5IYDH 1V0EA 1Q7YD 3H0GG 4FF1A 5AJ3L 3DUZA 2XTIA 1TVCA 1FNMA 1S72A 3JQRA 2KECA 1CKNA 1ELOA 2K03A 5CV7A 4JI8L 1UD8A 4P71A 5M3FG 2NVXH 4C3IH 1TS3A 2PZWA 1I6HH 5FO7B 3GTGH 4O0AA 1K0RA 4P2NA 1EEFD 3JAML 2OXPA 1FVIA 4P2CB 2ICIA 4A3CH 3AGPA 3U6BA 2UUAL 4YHBA 1BKBA 2ZXIA 3OJXA 3H94A 4I65A 3PGZA 3WOFA 1JJCB 4XN3A 1B53A 3HOWH 2J7KA 1AMOA 1GVPA 5HKKA 3HS0C 5H59A 4B43A 5I6YA 4LAAA 3HOXG 4YAUA 3BU2A 2QEXA 1N36Q 4A3GG 3I4MB 2XNJA 5IYWA 1TT2A 4TMXA 3K0XA 3K7UC 4QB4A 3D4WA 4GOPB 4A3DH 1WDTA 1PZID 3FPUB 1K83H 1JCKB 3IFDA 3GTOH 2D0PA 1JA0A 1KTVA 1K9MC 2XGJA 2VUMG 3FPKA 3S17B 1RKNA 4DR1L 4EGVA 3OKXA 2ZXPA 2ZZFA 4IPDA 1UE1A 3ICEA 1D2BA 2AUJD 1FNCA 3WY9A 1IKLA 2HQEA 3PO3H 2XGTA 4GKJL 4PC7A 4B08A 4HAEA 4HSPA 4Y7NH 1MGSA 1I94Q 3BY2A 1NCVA 2L11A 1B3QA 4XLFA 3BCFA 2F4VQ 1FRNA 4DFAA 5I2XA 3ULLA 4C1NK 4JYAL 5E4XA 1FL0A 4CBVA 1CSQA 1C4QA 1LYLA 2EXZA 2KBNA 2QGQA 2C5HA 2XRSD 3PUVA 3SLNA 4KLKA 3VYSA 5IWAQ 3GTPB 1WTXA 4X8IA 4G4KA 2XNCA 2Q6IA 3CTAA 2L4NA 4RD6A 1RJTA 3IRBA 4POGA 2MPMA 2NVYH 3P1HA 1UD3A 2PCFB 4H7BA 1XMQQ 4A3DB 2VNKA 5JEAG 4ZUIA 1X3FA 2J4XA 5IGGA 4R4CA 4Z4RA 4QVAA 5J22A 4L8JA 1VQKB 5DM63 2WAQB 2WV6D 4X7DA 2WKDA 3A56A 3CC7A 1EXMA 3MXUA 4KD4A 3TEHB 4A3EB 4OEMB 4PG3A 4CKBA 4DXFA 3HOXH 2LMCB 2O4XA 3GTLB 3PUZA 3MC0B 4A3FB 2ES2A 3T4AC 5FLXL 2CQOA 2JA5H 1SROA 4ZKBB 3KUPA 1PKVA 1JORA 4TSSA 1KL9A 3BG3A 3OYYA 1NB0A 1GR1A 2AQ3B 1PYWD 3F2UA 2OBTA 1QILA 4LK1C 1LTGD 5E6TA 2JA6B 2EY6A 3HKZG 3VMFA 1KJZA 1FRQA 1A2TA 5IWAL 1PH1A 4R4TA 3A1PA 1WTWA 1E3ZA 4RHSA 1V9PA 4DNIA 1XNQL 5M5XH 4Z9CB 1L1OB 2BA0A 1FGBD 3S16H 5IYQA 2XZPA 2V1CC 3DWQA 3CMEA 2K28A 1A3TA 4A93G 3C2QA 5C3EG 2X6XA 4DV6Q 3GV3A 1FJGL 2NN6H 1Q9SA 5TY0A 2WINB 5EKKA 3AFPA 5ELNA 4FK8A 3HKZE 3MEHA 3S24A 4LMQD 4KD3A 4A3IH 1HR0W 2F4NA 2PLFA 1I4XA 2PPBC 1QOHA 1TWGB 3NPPA 4R71A 1PRTF 4FWTA 4NP5A 2Q2IA 2CC2A 1GO2A 5F4JA 4Z4VA 3E5SA 3FKIG 5A2QE 4A3IB 4YEJA 4KMUC 3ZJYC 1BBXC 1FGUA 4QIWE 2PMZB 4WRDA 4II3A 5JBQA 1BBUA 2DCUA 1N9WA 1I6HB 4NDXA 1KK2A 3PQIA 4BBRG 4DF7A 3S1MB 4QY7A 3I91A 1LTSD 2WP8J 3HOVH 5CC4A 4DK6C 1PTOD 3I4NH 1A63A 1XNRL 3TN2A 3KDFA 1R5BA 4GLVB 1T6ZA 5I4DA 4DGZA 2DN8A 2KVOA 4DUZQ 3B78A 5KYIA 2YWFA 4LBWA 5IGCA 2PMDA 5TRDA 3U9SA 2QW7A 2VJJA 5J3OA 1W6JA 2BN4A 4CDCC 1X56A 1KNAA 1SNMA 4A3JH 2ATWA 3G7LA 1YIJB 2O5JC 5IYCH 2D3LA 4JOIA 2HHHQ 1NR4A 4LUVA 1V8QA 1B2TA 2HD3A 2LXJA 1N33Q 4XLHA 1IB0A 3QB3A 2F0TA 3HGBA 4X07A 3A7LA 1OTCA 1OB2A 1QUQA 5F2DA 1K0SA 3EIVA 2Q8TA 2GK6A 1F2YA 1G6ZA 1PH3A 3VNVA 1ASYA 5KNLA 4DR5L 4HJ7A 5EMNA 4RPBA 2VQFQ 1V0FA 3H0GH 2L1BA 2E75C 3JQQA 1GJRA 3BCDA 4P25A 3VYRA 4B3SL 1BBWA 4LF4Q 5KNCA 2A5HA 1S40A 1IJFA 4IOAA 2KHSA 1PXUA 3PA2A 4H9GA 3K6OA 4C0SA 4L6TB 4JYAQ 1OB0A 5JAVA 3MEFA 2QN6A 4B3FX 1SKYB 1F2ZA 1QH0A 3A8IE 4JBMA 1HFNA 3A8JA 5CGKA 1BLIA 1Q82D 2D9UA 1WORA 5C5LA 2FJ2A 4KY7A 4F88A 2NUCA 1SE8A 2HMAA 2ZTEA 1UE7A 4NXNQ 1PH5A 5G3LF 3C1EA 3SEBA 2JIZA 3K5MA 3U58A 3A8KE 1TWAB 3U50C 1W0JA 1VLYA 3I2ZA 1TS2A 2OCEA 4G6IA 2F3IA 1W34A 1HZ9A 3ZC3A 1LACA 1E0BA 4M1KA 4X7FA 1YLOA 2HUGA 2CWAA 2Q6KA 1V1QA 1FX0A 4I7AA 3BZCA 4DU9A 1W3SA 4GLAC 3GTOB 2XNAC 1EP2B 5EQ0A 1WU8A 4JG2A 5FO1A 2ZBUA 5C4JB 1PH8A 1YJ9B 1EZ8A 3TP8A 2B2TA 2Z9HA 4K8IA 3JU4A 4ACAA 1B8AA 4Z4WA 2R9VA 1U4RA 4YAFA 1QVFB 5C0XG 1K28D 1C48A 2KCTA 5AN9A 5JEAJ 4JOIC 2VNJA 3J7AF 3QFTA 2K5HA 3HFZB 1VHEA 4K5XA 4C3JB 3F2BA 1WVLA 4NMZA 4Q0FA 1H42A 1DOKA 4XLCA 1N34L 3S2DH 3NQIA 1SEBD 2ZTDA 2ZL6A 2VS1A 2LFNA 1TVXA 3E9IA 1WCMH 1IYJB 3CF5A 3VYTA 1HUNA 4X66L 1NJID 3A5UA 5FIUA 2JXMB 2WFWA 5FJ8H 2VW9A 5JEAH 1S0UA 4LC0A 4P26A 5IE8A 3CRZA 2KENA 1YX2A 4YXWA 1Q46A 3CCJA 1ENCA 4XONA 4LBYA 2K05A 3OMGA 1EWIA 5FKAC 5IYBG 2E74C 1STYA 2A19A 3DWAA 3ONUA 2BCOA 1EYGA 5ELOA 2QTZA 2VB3X 4A93B 5K36G 2MO1A 2FFKB 1E43A 1B4OA 4JV5L 4IFDI 2OTJB 4JPBW 4I7ZC 4GNXB 3HOYG 1OHHA 1N0VC 1LT3D 2DY1A 3I4OA 5JVG3 4P6YA 5GV8A 1V1OA 1I18A 1VMCA 1Z6HA 5TSSA 1UMKA 1CKOA 4CKEA 3BH4A 1F20A 2GPJA 1CKMA 5LMUL 2TMPA 1EIHA 3GTKH 1VQ4B 4DV1Q 4OO1H 4G7ZC 3S1RH 2XZLA 1XPRA 2E2IH 3P26A 1DG1G 2NVXB 2WACA 3J80i 2ZXHA 1O7IA 2E2JB 1YJWB 1KD1D 1LTBD 1PVOA 1W9XA 1EL0A 1TS4A 4UHVA 4C2MB 5A35A 4OX9Q 5M5XB 5AJ3Q 4HMJA 3BY1A 1IW7C 2F0QA 2PYKA 1QCBD 2RDFA 4QL5A 3LWEA 1EOVA 3E6ZX 4CKCA 2Z6BA 5EBDA 2F0LA 4WFN3 3M7NA 4PGOA 4PZ7A 5FO0A 2RHQB 2F0UA 2KEDA 4O42A 4EX5A 1L1OA 5FJ8G 1LTTD 1QG0A 1ZEQX 1E79A 2IW3A 1W0KA 2SOBA 1G7SA 3HZXA 1ZM3A 3TDQA 5JVH3 1TWGH 1M8AA 1UEBA 3H09A 1CA5A 4XT3B 4YCVA 4OONA 2D62A 1PRTD 5C4HA 4CJ1B 4P72A 2CK3A 3J81k 1JB3A 1M1KD 4H0LC 2RKSA 4WZLA 1NUCA 4V190 5ELFA 1XWEA 3RZDH 5C4ZA 3OAAA 3ZZ0A 1BCPC 4K14A 3AB9A 1QX4A 3KF6A 3CCEA 4MZ9A 5D14A 1DCZA 3J80L 4LF9L 3GV6A 4X62L 4RG1A 3CCSA 1EUJA 5IOCA 1EQTA 3CP2A 2J7ZA 4A3FG 4FDBA 1QUEA 3NWSA 2F3WA 2FXQA 1CFMA 1L0YB 1B50A 2JA9A 1DYQA 4RFBA 4XT1B 2DERA 3D31A 1T9HA 3V2TA 3OPOA 4FXKC 5K5PA 4PV1C 1NBWA 3HKZB 5D3IB 1E1QA 1WTHD 3OSOA 1ICFB 3TP6A 2K5QA 5J1ZA 5H5JA 3SE0A 4A3GB 4F87A 2PQAA 3S9WA 1BDOA 2ENBA 1EY9A 2I1LA 2B2UC 2B39A 3KL9A 2Z0SA 3SJPA 1NNXA 1ICWA 1YNNC 3ISXA 1VCIA 3QJYA 1V43A 4QV2A 4RMFA 3WNDA 1PYBA 4C3HH 4DR2L 3CB4A 4H02A 3J7ZC 4F7XA 1LV9A 4A3GH 3NTHA 2ZJPA 4JVZA 3AU7A 1J5EQ 3GTPH 4OPVA 1SNCA 1GAWA 4WWVA 5FO9B 2HHHL 3G4SB 1E1RA 1VDZA 4B47A 3FDTA 3D6CA 3Q0AA 5J39A 2JA7B 1Q7YC 2EJGC 3TP5A 1BQEA 1A3UA 1GUNA 1EFUA 3FMCA 3OIQA 2Y0SE 4AC9A 5EGTA 3GVJA 1X32A 3JQPA 4HMIA 4ZYSA 2K4KA 2CFMA 4RWSC 1WPCA 2F0MA 4DV2Q 2WB1E 1WTQA 1KC8C 5LL6S 5IYPA 4Z4TA 1YNJC 4UPAA 1GUSA 1JWUD 1PJ5A 4Y9RA 5IYDG 4LF9Q 2E2HH 4BBRB 1N0UA 4A3BH 1DOLA 1XTDA 3D26A 3GTJB 1F9RA 3LWUA 2R92B 3NELA 1XFOA 4UZFA 4B3TQ 4KY6A 2UUCQ 2QDBA 1CQXA 1Y1VB 1G8ZD 1M90C 3LQ6A 4DPGA 2B63H 2ICEC 1AEXA 5C0XJ 3FKIB 4BBSG 3S2HB 1H9KA 4BS9A 1I4RA 3WBJA 2HIXA 1X55A 5A88A 1UAPA 3OJWA 1BOSA 3DM3A 3S1NB 1XJVA 2BMWA 3O13A 1L2FA 1E1TA 4A3JB 3W3AA 1N33L 2VL6A 3VR3A 1AE3A 1YJ9A 3GIRA 3PV0A 3GTMH 3HOWG 5C0XH 3U9OA 4FF2A 3R6KA 1UD2A 1BX0A 4IZ8A 4U9UA 3I4NB 1MJCA 4P3YA 3BYTB 1PFNA 1VQ9A 3CCEB 3KF6B 4OX9L 3TMEA 4C3JH 1NE3A 4IURA 4X06A 1U0LA 4OWXB 5JJLA 4KTAA 2CH4A 1BCPF 4UP9A 2UXBL 1TIID 4FO2A 3WXMA 2RHSB 1VF7A 1I7PA 3WQZA 2CVRA 4X62Q 3MXGA 4DV3Q 3CRLC 3F8TA 2ALYB 3A8KA 4B4DA 3T51B 2A6ED 1PDQA 3L2PA 1UUPA 4BY1B 4JI2Q 2ZL7A 1JE4A 2QF7A 1N32L 3T1YL 2K5DA 1HTPA 5C0XI 4RDKA 4JI6Q 2W6IA 1Z9FA 2OQ0A 2PZUA 1TWHH 2FHTA 2I5MX 2F0VA 3CMAA 4PC3A 3S14B 1K9MD 3DXJC 4A93H 4FVMA 2K5NA 3BJUA 4KI0A 1FNBA 1D5MC 4FP5D 4OIJA 2DETA 2QDLA 4AVZA 4P1VA 1SYDA 1TWCH 3CXCB 2JEBI 5A89A 3CCMA 1GUTA 4RH6A 2BV3A 4EQNA 4YHHQ 4A3IG 1HNWL 1O7YA 3GO5A 3PF5A 1MHWC 5M3MG 1FNDA 3VR2A 5HGQA 5CYUA 1EY7A 2JDIA 3NWTA 1Y1WB 2ZM6L 1TWCB 1ONLA 2AHOA 1S4ZA 1SMYD 2R7ZH 5D3DA 2NTTA 2K14A 4M8AA 1KK1A 2GA4B 3PA1A 1QFZA 5IGEA 1MRZA 4RD1A 3Q3AA 1VQLB 1LABA 1Q81D 1N34Q 4LF5L 2EY2A 2R92H 1SNQA 4JC0A 1X3PA 3CAMA 2KVMA 3PF4A 3Q38A 1KRHA 1Y14B 2EYLA 2B2YA 1CK1A 2JA5G 3ZZUA 3I1FA 2LY7A 5IP9H 2GVBA 2JA5B 1KHIA 1JOQA 4CDDC 2JA7G 3IL8A 4GKJQ 3CMAB 1JB7A 4FF4A 4AH6A 1W35A 2PW5A 5BN3A 4EQOA 3S1MH 3KBXA 3QFSA 2NTSA 1F9PA 5GV7A 3J7YW 2SEBD 4KJOA 1P8LA 2CWPA 3KJPA 4JBJA 3PO2G 4AQYL 2K1BA 5M5WB 3ER0A 5LHY1 2OYNA 1BJKA 4Z4UA 1X3EA 2V7XA 2YWEA 1GUWA 5CV9A 4J6HA 2H4OA 5CR3A 1HR0L 2OBSA 1EYAA 4YY3Q 2EYMA 2F0PA 3FEWX 3RUZA 3I55B 2ZZQA 5CV8A 3ZIAA 4H13C 5CBEE 3EA6A 4GN5A 1IBMQ 3OEHA 1YI2A 4NNJA 3HOZH 1WSVA 1I50H 4DV7Q 4ZGNB 1C8CA 5HXBA 2WAQG 3KLWA 4M4SA 4NXNL 4ME5A 2EVBA 3TP7A 1GUOA 1ILPA 1AFPA 1TWAH 2X6WA 1A8PA 3BDLA 4KHZA 5EPLA 1VQ5A 3KLSA 2QILA 4GLXA 4UAIA 1QZHA 2C5BA 3G05A 1BCPB 3H9NA 2VNIA 1IXRA 5DN6A 3VNUA 3JAMi 1G7CA 4DK3C 1VQ4A 1PFMA 4WJWA 1ZXTA 4TMVA 3TREA 1VQNA 1VQKA 1E24A 3QO2A 3W5OA 5M3FH 3KK7A 5EAYA 5FNZA 1EY5A 2WAQE 4JI7L 1E22A 4XXEA 1QGZA 5L46A 1XB2A 4S3SA 1II3A 2EXDA 4ID6A 2MGSA 4R4QA 3BNWA 3CPWA 2E2DC 4G7HC 3ND8A 1W2BA 1EFRA 1UNSA 3PO2H 1NMGA 2KUMA 3HOWB 1Y0RA 4WZKA 4RD4A 3AVWA 2C2WA 1HR0Q 4NPSA 4IFDG 5D65A 4PC2A 2XZOA 3K59A 3I72A 5GQOA 5JJZA 1AN8A 1SYBA 4G1VA 5H1SE 1YZ6A 2MHVA 4X65Q 5TR9A 4A3MB 5TV2A 4ZRZA 4QIWB 4DAYA 4EQ5A 1RQRA 3C1FA 1PRTB 3KFUA 1DONA 1VQGA 1SFOB 4BY1H 1IZ6A 1S3OA 1SRUA 4BY7B 1XMOQ 2R93H 1XYIA 4A3LH 1TWHB 3DHQA 4GKKQ 1EY6A 1B23P 1PH7A 2RA4A 3PUWA 2UXBQ 4BXXH 1QUQB 1TLLA 2EY1A 2K52A 5THXA 2K04A 2RF4A 1XTCD 3D3RA 2JYOA 2AMCB 2GREA 1JNYA 2VBUA 3PSIA 4A3CG 4PQXA 4UY8C 1WSRA 2X53S 1EQVA 2Y0SG 3W2GA 4DAVA 3QFCA 4HE5A 4ACBA 5C5MA 2R3ZA 4K2LA 4OL7A 1EFWA 2V7QA 5ISRA 3TZUA 5GAEC 1VQ9B 2SNSA 4A3KB 4JI4Q 1X6OA 1X9NA 1BO0A 3I56B 3J80E 1HNWQ 4L63B 5C4XB 3B8HA 4DNTB 4X3KA 2L0CA 4ULLA 5ELEA 4KKTA 2G9DA 5CBAE 2DUDA 5DLQE 2BM0A 4DAYB 5IP7G 4JBKA 4OHJA 2NPFA 4A3KH 1H85A 4V0BA 1RTNA 2N88A 3QE2A 1SE4A 3EROA 5M5WH 4FYDA 3ZBUA 2X6LA 5C44H 1VF5C 3PUXA 2BA1A 3NUCA 1CHQD 4C3JG 2NN6I 2IWHA 2JA8H 2F0DA 4X0CA 1HNZL 4IJLA 1G51A 3C46A 4DV3L 4IPGA 1JQYD 2F4IA 3AFQA 1YITA 5I9OA 2RCFA 1OGJA 3KLRA 4LJZC 4KV6A 4C1NI 1PMRA 1VMPA 2GK7A 4HE6A 2OQKA 4DAPA 1M90D 4WORA 4DV4Q 4A3LG 4OGQC 1ENAA 5BR8Q 5E4WC 1KIXA 2OTLA 2HT1A 3AMUA 5KRUA 4IJHA 4F7DA 2Z4HA 3UDFA 4NW2A 3W2DA 1VQNB 1BX1A 4KHPQ 3J81j 5IT9E 1EIYB 2C77A 2EYJA 1JOKA 3EN2A 5FOBB 1CZGA 1YNJD 2YTYA 1EY0A 1U4LA 1GXDC 5IYNA 5KSWB 4TN1A 2R93B 4DN4M 1JJ2B 5DAUA 1PYSB 1LTRD 2A73B 4YAWA 1RTOA 1YJNA 1JT8A 4RGNA 3CQZH 2AQ1B 3RD4A 3ULPA 2NYZD 4AYBG 1QGYA 2NVTH 3ULJA 1KK3A 1YIJA 1NR2A 3HOXB 3W2FA 2EYFA 1VQMA 3OZWA 4IN3A 1KLUD 2FINB 4M53A 2GQFA 3K58A 4RM0A 1CSPA 3OFNA 3UDIA 3J81i 1FR3A 2BDOA 1PH6A 3QOJA 4ZUJA 3JC66 1U9RA 1Z47A 4G1BA 2R7FA 4DUYL 1XQBA 1B9NA 1QVGB 3CCUB 1JOOA 4A3DG 2NVQB 1SYEA 3BZDB 1YNND 1I5FA 1WTHA 3NP8A 1J9ZA 1NAPA 4APVA 3MWYW 5HZBA 1RCVD 2RQXA 4B3GA 2CHBD 4MNOA 2ZJQA 3OWEB 3W2EA 3E3XA 3GQBA 3CCRB 5KEEA 1S5BD 1NJIC 1S5DD 2RVLA 4N3GA 3I8ZA 3I7FA 3RLOA 3UE0A 2L5TA 1N8RD 4NKLA 3I4MG 3WWVA 1GVHA 2WSSA 3BC9A 3SK6A 2X0KA 2V7WA 2QA4B 2F0SA 4II2A 3Q8DA 4G7WA 3KLSX 1BUVT 1NTGA 1COWA 3P7JA 2K5WA 3MFYA 3PIOA 4JI7Q 2CNDA 3M4QA 4LF8L 4RLZA 2N3SA 4UZUA 3WYAA 2UUAQ 3X3MA 1EEID 5F4MA 3NXWA 3G6EA 2A6EC 1DGSA 1HUMA 1GHKA 3FKIH 3H6MA 2VNUD 1X65A 2B3GA 2GVAA 1PRTC 4KKUA 5FLMG 1SN8A 2F52A 1O80A 1IYUA 1KDCA 3CU7A 1L0WA 4JI8Q 3MHPA 2C78A 2RDHA 1I94L 1B2RA 1Z7TA 3HOVG 3E1YE 1BR9A 2A74C 3I90A 3CCLA 2F0WA 2XIWA 1QWYA 2Z1CA 3GTGB 4RA8A 4IFDJ 3JAMc 3T56B 2JN9A 4LF8Q 1Q1EA 3DEPA 2UU9L 4DR4Q 5LMNW 4PC1A 2WZPP 1NSNS 4L5RC 4KN4C 1WFQA 2K5VA 1O7ZA 3M3YH 2VZLA 2F0IA 1KQSB 2BH2A 4WZTA 1IW7D 3PIO3 4XL9A 4OPSA 1R9TB 3P75A 1Q3LA 2VUMB 1PTOB 3SXHA 1LT5D 4BBSH 2X6GA 1HJPA 2JJ1A 4RGOS 1E64A 4ZV4A 1K8GA 2O5IC 5HY6A 1QNKA 5E3FA 3TQYA 5HURA 4N8X1 2A69D 1BMFA 3NQTA 4UAJA 4DR6Q 1Q86C 3RLFA 4C3IB 2NN6G 1HZEA 4ZCLA 4QHYA 3N6RA 3S15B 3E9HA 1KNEA 3RNUA 1FNVA 3CD6B 3K5LA 3ZZTA 3ITPA 1ET6A 4B3XA 1KRTA 4IO9A 4FXDA 1KMHA 2DJGC 5C6AA 2H1EA 4LF5Q 2PQAB 4OIKA 1OB5A 5FLMH 2KCNA 1PJ6A 1HQMC 3AGQA 1BPLA 4UP7A 5JOBA 1DD2A 4RCZA 4DQLA 4JCVE 1EYDA 4DR5Q 2YU9B 1GOZA 2WPDA 4DV5L 2JQOA 4K5WA 3FRPB 2PQEA 4YELA 3OW2B 2X69A 4DR7Q 4YHHL 1D8TA 3BYYB 4QUCA 4CDEC 2IX3A 3CCQB 2K75A 1K28A 4LFBL 5IGDA 5IGBA 4TVAB 1BQQT 1R5NA 4A3BG 1UEAB 4HIKA 1TY2A 3OIPA 4X3UA 1DJRD 1X54A 2ZTGA 3HOYB 1SNDA 1Y1VH 3ASRA 3AYHB 5M3MH 2B2VA 3PUMA 4OP7A 2QE7A 1AW7A 1PFSA 3PENA 1Q8IA 1HNXL 1IYVA 1K73C 1B7YB 4MYUA 1HTLD 5FA6A 2DEUA 5AFWA 2RDGA 1VHOA 1OO9B 2F3VA 4PMBA 4XR6A 1QE6A 4IUPA 1JC7A 3A0JA 2F0NA 5KNBA 2XEXA 2EFGA 1T6YA 3W2IA 2WB1B 1HNZQ 1G7RA 1YITB 2A6HC 4QGUA 4OO1G 1HZBA 3K7AH 1G91A 1WOSA 3A8JE 5EKLA 2NWGA 3AVUA 3W1BA 3QR8A 2XWJB 4NXMQ 4TRDA 1WI5A 1FD7D 4KHVA 5FK9C 3J7AV 3ASTA 4E6IA 3MVVA 3OOCA 4QJFA 4LFAL 5DS0A 5A2QL 3TRZA 5F4OA 3RZOH 2MP1A 2ZXOA 4LF4L 1IJEA 3J81L 3QSYA 1F77A 2KQ3A 1GM5A 1KABA 4LFCL 4LFBQ 3PO3G 4B3ML 3A3GA 5COYA 4TMTA 2GJKA 4LNQA 3WBKA 3RZOB 3VO2A 2GN5A 4DAMA 3PCOB 2BGJA 2WR8A 1CQFA 4B3TL 2SNMA 1PV4A 1MI2A 1QFJA 2D74A 2RSNA 1GHJA 2QDXA 2ZXRA 3NTKA 1Y1VG 2NBFA 1AZQA 1CA6A 1D1KA 4QVJA 5I2YA 1MD2D 5LMNL 5C4XG 4MTNA 3MA2B 4K8JA 4DV1L 3ZPNA 5BN4A 1HHVA 3VR4A 1TR5A 3CESA 1SAPA 2HDLA 2IX0A 1SXTA 1JE5A 2CW5A 4C56C 1XNRQ 1Q1BA 4AYBE 4G7XA 1PTOH 5LL6X 2YTXA 2JJ2A 1HQRD 3EFXD 3C3LA 1VJSA 1SLJA 4J1MA 3CMEB 3UDXA 1B44D 2P3MA 4YIJA 1V1PB 4JV5Q 4X05A 1TQOA 1TKWB 1EY8A 1FYCA 3P20A 5ELBA 3Q23A 2MQHA 3H3VC 4GS3A 3N52A 4OELB 5DEHA 3MXNA 2CBXA 4M2LA 4P6VF 1STNA 4XTCS 4HIMA 4ROXA 5CORA 3CCQA 4CGYB 2M2LA 5DNFA 4HTHA 4B9XA 4YWMA 1ESRA 3LX0A 4C3HG 2C9OA 2NV4A 2NB0A 2V7TA 3MXPA 2KCCA 1DARA 2RCNA 2G5DA 4XOTA 2C5CA 2XVSA 4ME3A 4RCNA 3GVLA 4A3EG 2RC6A 2EJFC 3U4VA 4J8QA 4ZLTF 4TMWA 3TS0A 2A8VA 1OXUA 4X7CA 4RD3A 1ESFA 3I70A 3SK8A 4DUZL 3KDFB 4AF7A 3FKSA 1TXYA 1D7QA 5DM73 4HR7B 4BBRH 2F1LA 1ILQA 1HZCA 1AP0A 3W5VA 4NCNA 1O78A 4IUTA 3OTOQ 5T1GA 1KK0A 4DXGA 1H8HA 4JMQA 2D5DA 3CHBD 1QGAA 3LVBA 4RKLA 1LT4D 4HJ8A 1QUFA 2Z8LA 1IBML 2Q2UA 3GTKB 2IY5B 2D3NA 2BDNA 2EYHA 4A76A 2X6YA 2O2LD 3K57A 2EPBA 3SHLA 4BWGB 1LUZA 3CW2A 3TBIB 2YYZA 4K6LA 3V96A 2MNAA 4AQYQ 1KLGD 2YTVA 3BVZA 2XOKA 1OXTA 2B29A 4PMCA 2V7VA 1VQCA 3KOJA 2F1MA 4OPOA 1ENFA 4ZKCB 1DDGA 1F2LA 2F03A 2I5LX 4J15A 1LO5D 3W5HA 4HIZA 3OWFA 2WB1G 4CQJA 1E7ZA 3PVDA 4DV5Q 5C44G 3A55A 2ZL5A 1OXXK 4K1XA 5GADC 5FO8B 4KKSA 5IYCG 1SMXA 1VQFA 4X64L 2P5ZX 2Q8IB 4BA1I 3R2IA 5M9OA 3U2QA 1H9SB 4U673 5LMUQ 3F2CA 3W1GA 1SYGA 3S1QB 2IPKD 4KK7A 1DDIA 1U4MA 2LKVA 5GAHC 3CC4B 4IUNA 3V05A 3E0JA 3PO3B 2K32A 1CT1D 3NBHB 4BY1G 3J80c 4H44C 1VS0A 2BM1A 3CC2A 4A3BB 3CCLB 3QG1A 1UE5A 1YBYA 2KJXA 3V7AA 1I50B 3AVVA 4JI0L 1V1PA 4Z4YA 1PH4A 3AEVA 4XOPA 2A1AA 1F60A 4F8MA 1KD1C 1SJHD 3MFGA 1LTAD 4ALPA 1EFID 1H9JA 3RN2A 1YI2B 1I8DA 1J9OA 2VJIA 2NVYB 3SLDA 4RD0A 4JI3Q 4B9WA 2HLDA 3DM1A 3C2PA 3GDEA 4EH1A 1K8AD 3GTLH 3GVKA 3A54A 5JPNC 5EPJA 5GAGC 5KNDA 1WTVA 4IUVA 5C4JH 1VQ5B 1MJEA 1EU3A 1N08A 3OTOL 3ES9A 4ASUA 2JSOA 2QMUA 2OEOA 3BVGA 1QG7A 1VQEA 3KEWA 4PNYA 2R7ZG 3CP8A 4Y7CA 1IHZA 3CCVA 4QQBX 2ZTNA 1IHMA 2NVTB 2M5SA 2DNEA 4NBSA 2FMMA 2KOLA 4MIUA 1HA6A 2F4VL 3STBC 2CW0C 1F9QA 3I3CA 1XPUA 4ABNA 1SE2A 3I4LA 1BNZA 1TWFH 4ZCMA 1AH9A 2JA8G 3SKBA 3CRKC 1PTOF 1XE1A 1JWMD 4N3NA 4P75A 2JA8B 1I3QH 4Y9UA 3L3OC 4DR7L 2V7UA 3T1HL 2D2CC 1D8LA 2JE6I 1L0XB 1GO3E 3AQQA 4NXML 1HCZA 1N8RC 2E2IB 2WJVA 2LS01 2UUCL 2HIVA 4XQQA 4HN7A 4A75A 4HCSA 1QJOA 3FHWA 3CCSB 2K01A 2CW0D 3HP3A 4OWTB 1T5XD 2VNHA 1KRSA 2OTLB 2V31A 3LNNA 2KCMA 1O7LA 2HQLA 1CNFA 1RD9D 2QKIC 3K81C 1LLRD 3NBIA 2F0FA 2NZ1D 3WNCA 4R1JA 4RGTA 3HOZB 4NB3A 3D4RA 4RKBA 3QIAA 1YVCA 3HOZG 5M5YB 1YJWA 4R9WA 3ND9A 4ZQ3A 3K5OA 1JMCA 2WYRA 3NTIA 5A8AA 5KW9A 2PMZE 3ASPA 3HOYH 2AWOA 1PZKD 1R9TH 3FP9A 2X8KA 1SNPA 3GD7A 1BCPD 1TU2B 2I07B 1S4MA 4L5TA 2KA7A 2A69C 1MIUA 3U4ZA 3WOEA 1QNUA 2MFIA 1N05A 1W6KA 5KIXA 1ZM9A 2BVNA 3Q22A 3J7A5 1QB5D 4GQNA 4GNXA 3GTMB 1Y8NB 3FPPA 3VYUA 4Z4SA 2EIXA 4Q5VA 3CW2C 3DMUA 3J81c 2W6JA 1SM4A 4IUUA 1JJ2A 1QVGA 3S17H 2B2YC 3A7AB 1DZ1A 1VQ6B 2E76C 2JJQA 1WYDA 1EWHA 4N8FA 4CJ0B 2PW7A 1JWSD 2LXKA 1PH9A 3PIP3 2E1BA 5EPKA 1EZ6A 2Z6KA 4KHPL 5GROA 3CPXA 1Q86D 4XYOA 4YCUA 1MABA 1I4PA 1XX8A 1D2EA 1PJ7A 2PE3A 1SSOA 1SYFA 2M9VA 4MN3A 5IGFA 1YHQA 1DXMA 4K0KQ 1UD4A 3OMCA 4IALA 1PA6A 2VZAA 1RF2D 1A2UA 5LMZA 1R5OA 2UXCQ 2YWHA 4Z4ZA 1YHBA 4FN5A 2V4DA 2K6AA 4PC6A 1EU4A 2F0JA 4L5QA 3Q24A 4DR6L 2VBTA 3PUNA 3CPFA 4Y52H 4M1UB 1NBMA 1GAQA 4DV7L 1HVXA 4XLAA 1XPOA 3IAYA 5C3XA 3CMMA 2TSSA 3G6JB 2CQAA 4P9SA 4LBVA 3HG9A 4O1NA 2DY8A 1HNXQ 3S2DB 4R4OA 2A6HD 3P27A 4TKOB 1V5VA 4YY3L 4HJAA 1VQPA 4N9PA 5JJKA 3BVMA 2B5OA 5EKIA 2N55A 4OO1I 2B8FA 4FNFA 2GJPA 2EOTA 2Z4IA 4ZCKA 1K8OA 2EYOA 1STGA 2BSAA 2E8GA 2F0KA 4ZCIA 1ASZA 1PTOC 2OTJA 1VQMB 4A3FH 3OEEA 3E0EA 3T16A 4FXUA 1CTMA 1Y69U 3M9BA 1JB9A 1WOCA 3HKSA 1FJGQ 3J81E 3I4NG 1C0AA 3G71B 2R6GA 3GTQB 3M4OB 4DKAC 3H3VH 3TS2A 4B3RQ 1XNQQ 4JK1C 2Q2HA 1STHA 2JEAI 2I0QA 2BGIA 3OZVA 1B70B 1LTID 3CKIB 3CCVB 2MJ8A 1G6PA 2C4TA 1QFYA 2AQ2B 3LGJA 3RLNA 4B3RL 5C3EB 1P16A 1NY4A 3NE5B 2E1RA 2JK8A 4TSFA 3MHBA 4Y7NB 3EVQA 3HOUG 2B2TC 1EYCA 2B7CA 2F0OA 3S1NH 1AE2A 2CRVA 2VB2X 3E20A 4K5VA 4JI3L 5IK2A 2L12A 4KN7C 4JI1Q 1CM9A 1FNWA 2L15A 2B2VC 2K7VA 3CCMB 3CXCA 3F2DA 1ZM4A 3TZDA 1W87A 1VQ8B 4U68A 2DOGA 2OF1A 2IJ0A 1HXYD 5ELCA 3URYA 1EQRA 1SNOA 3I73A 3SK5A 4DA2A 5I9PA 3HOVB 3AVXA 3SGIA 2AHOB 2GJRA 1ET9A 1OXVA 1TUIA 1XMQL 5B6IA 3NSWA 4JI2L 3RR5A 1EIGA 3B82A 2DIEA 5BSXA 2JP1A 2MO0A 2ZZGA 2ZZEA 1IBLQ 4WZEA 1U2RA 2XRQD 3RZDB 3W5UA 3OP1A 1KAAA 3WDNA 4X64Q 2ZJRA 1D1IA 4A3JG 2MUYA 4QF4A 3UE1A 1Q82C 2ZBVA 4DK0A 5HZAA 2LSSA 3K0YA 1K3RA 3S14H 3B6YA 3ASSA 4HJ9A 2L55A 3A35A 2ZITA 2JN4A 1JICA 3A3BA 4DR3Q 1STBA 3PO2B 4IW3B 4LF7L 3ZUGA 4RD2A 1GKHA 4OOXA 1LT6D 1K8MA 4PZ6A 4X3SA 4DK1A 3G48A 1H9SA 2E5LL 1XXGA 3KF8A 3GTJH 1YNXA 1EWCA 2X85A 4ZGQB 3R6JA 3EQLC 5FLXc 4CDFC 3CC4A 5G3LD 1R4PB 3IKJA 1PLFA 3KYHC 4XMYA 4PAAA 1HFGA 1R4QB 3GSIA 3CC2B 2PO4A 4M0LA 4DV4L 1B1ZA 3H0GB 1H9MA 1KQSA 1TTTA 5KGUA 1S5ED 2AWNA 3A74A 3HEJA 3SVMA 2L9HA 4CHTB 4BPRA 1TY0A 2BH8A 1VQBA 2Z6KC 2I46A 4UDUC 3M3YB 4YAOA 1IKMA 1WD0A 1NB9A 3ONAB 4LF6L 1TS5A 4MYTA 5JPMC 4J0QA 4HCEA 4R8IA 1D5ZC 4K6DA 4IOCA 3OE7A 2I5HA 3K80C 4BY7H 1OGIA 2G9HD 4BA2I 2BE5D 4B3SQ 1MSHA 3OW2A 4P12A 3OW7A 3CP0A 3K8AA 2B63B 4DUYQ 4YWLA 5L37A 4JI4L 2R92G 5C4XH 3MAQA 4G57A 2D9RA 2Q8RE 1CNEA 2E2HB 1J5EL 1ZYRC 1W2BB 2B2WA 4JBWA 3R8BA 4C2MH 5IP9G 3T1HQ 3R2TA 4A4IA 1YHQB 1Y0YA 4HSVA 4QFMA 2JA7H 4LFCQ 3V76A 2D0OA 1WTRA 4XQFA 3KJOA 3G71A 1VQ6A 4GZYC 1E2ZA 2E2JH 4GKKL 1L1OC 2ASBA 5E7NA 5IODA 2HDMA 1EQQA 4JI6L 1WCMG 4LF6Q 4P73A 2F0EA 3R93A 5C3EH 5CMDA 3T1YQ 2PZTA 4AIMA 3ERSX 3BQJA 3K5NA 1FDRA 5BN5A 5BR8L 3BS1A 3SJZA 5KYLA 3NENA 3PMFA 2VBVA 3AVYA 1RHPA 1HRJA 1HPCA 1RDPD 4G5GA 1S5CD 3DWPA 2C4UA 1MSGA 1MBYA 2XN9C 1RL2A 2VXWA 3A5ZB 1Q12A 2CKZB 1H8EA 3S2HH 2DNCA 1EP3B 2Y0SB 1IBKQ 3VA5A 1E2VA 3QWNA 3Q6QA 3DEOA 2E5LQ 3D4DA 3I56A 1KDBA 1EP1B 1UD6A 4JW0A 2EE1A 1S5FD 2VQEQ 3L9AX 2IHEA 4B3MQ 1J6QA 5ELDA 2PI2A 1GUGA 1QZGA 4HIOA 5FLXE 3H91A 1CKNB 2ZT9C 1E3PA 2R61A 3S1QH 2M00A 3MCAA 1LM0A 1AZPA 2NVQH 4XNFA 4WJ4A 3ONYA 1E3XA 3VR5A 4QUZA 2B63G 3NHHA 2OK7A 2HCCA 4KJNA 4X3TA 4ODGA 4QCLA 4X7EA 1RIPA 2X3UA 3I4MH 2K33A 4DNRB 1N07A 4IFDH 1Y1WH 2WKCA 2DJFC 1C7YA 2PNRC 2EQSA 4JI5L 3S15H 4OOSA 4Q7JB 1CQVA 3AVTA 1K83B 3JAME 4TT3A 4LWCA 1AIPA 3HOUH 1U4PA 2PNHA 2UUBQ 2HCJB 4WQMA 1VQ7B 1XMOL 1BXTA 4B44A 4OXPA 2BE5C 3DLLA 1P4MA 2SDFA 1WOOA 1SR3A 1EY4A 1I4QA 3D8GA 1SDFA 5IIFA 4P22A 1GD7A 1IL2A 3S16B 2Q2TA 2UXDL 3MXNB 3OHXC 4JI1L 5HGTA 1A62A 4LBZA 1CUKA 1E2WA 2EZVA 4X65L 4JI0Q 2B7BA 3UDGA 4AYBB 4ILWA 4BXXG 4R8NA 1ZM2A 5JJIA 3HRZC 4DR2Q 1ZYRD 3NEMA 1QVFA 2BF4A 3Q6RA 1VQPB 2CH4W 2R93G 2IL8A 4RHRA 1JJGA 3MZ5A 2UUBL
chains in the Genus database with same CATH topology
4XM3A 1SMYC 1I4GA 3S1RB 1ZKOA 1CI3M 2EYPA 2F43A 1D6EC 1A15A 5CV5A 4C3IG 4FXGC 4G7OC 2A68D 1A6XA 5CV6A 1GJXA 3R3OA 2IT1A 1B3AA 1BF4A 3DDYA 2ID0A 3X3NA 2XNDA 4QUFA 3BDOA 5M3MB 4K2KA 5FL7A 5T1IA 1DOMA 2AUKA 5I6WA 1HA5A 3VR6A 4ZAIA 1STAA 1F2MA 1WCMB 2WIIB 1OXSC 5C3WA 1STEA 1T5EA 3SK4A 1SBBB 2DY7A 1PZJD 3VA7A 2QEJC 1J8IA 3HAGA 3HOUB 2EY5A 4XLEA 5CDFA 4EVOA 2RSOA 4N9TA 4XN0A 2XWBB 3PUYA 4XYQA 3T13A 3T53B 3RMHA 3NBHA 3M4YA 1WP6A 4E0FA 3KBGA 4IQZA 1NRKA 1SYCA 4XDXA 2WJYA 2XSCA 2B2WC 3M85A 3UI2A 5IT9L 1SE3A 2A68C 1I3QB 3EJIA 1EOTA 1KTKA 5M3FB 3Q6SA 4BBSB 2F0GA 3NK9A 4RCOA 1DM0B 1PFBA 5EBCA 5EJWA 4QMGA 1I6VC 1KZLA 4XD7A 4ZK9B 3K7AB 3ERQA 3QOLA 1UD5A 1TWFB 1WD1A 2F0HA 3IFTA 3TSSA 4RGMA 4XKWA 3SR1A 1Q90A 2B2UA 2J0TD 4RAUC 1SJED 2LZJA 2EJMA 5K36H 2Z6BD 4Z1MA 3SDZA 2OT2A 4C3HB 2KEEA 4XIGS 1M4VA 3CQZB 1ML0D 3D6WA 1FNUA 3MTSA 1CHPD 4EQPA 2BOSA 2HCIA 2QCPX 2EDGA 1CZWA 4XQJA 1G291 1H9RA 4KY5A 1WTOA 4CJ2C 1RODA 1X3QA 1D5XC 3GP7A 4MHEA 3L7ZC 1Y8OB 2FMCA 5NUCA 4TQUS 1Y8PB 2RBMA 4XORA 4HEDA 5E1FA 1IL8A 1KDAA 3FVQA 2R7ZB 3ZYYX 5C44B 1G2TA 4FF3A 1I4HA 4XQNA 1WTPA 3M7GA 4IUQA 4PMWA 4XKVA 1G2SA 1A3VA 1JR0D 2B8GA 1F9SA 3BDCA 5CV4A 2IX1A 1B9MA 1V0EA 4FF1A 3DUZA 2KECA 2K03A 5CV7A 1UD8A 1TS3A 2PZWA 5FO7B 1EEFD 3JAML 2OXPA 4P2CB 2ICIA 2ZXIA 4I65A 3H94A 3WOFA 4XN3A 1B53A 3HS0C 5HKKA 5I6YA 4LAAA 3I4MB 1TT2A 4QB4A 3D4WA 1PZID 3FPUB 1JCKB 3IFDA 3S17B 2XGJA 1RKNA 4EGVA 2ZXPA 2ZZFA 1D2BA 2AUJD 1IKLA 2HQEA 4B08A 4HAEA 4HSPA 1MGSA 1NCVA 2L11A 4XLFA 3BCFA 4DFAA 5I2XA 4C1NK 5E4XA 4CBVA 1C4QA 2EXZA 2XRSD 3VYSA 3PUVA 3GTPB 1WTXA 4G4KA 2L4NA 1RJTA 2MPMA 3P1HA 1UD3A 2PCFB 4H7BA 4A3DB 5JEAG 4ZUIA 2J4XA 5IGGA 5J22A 4L8JA 5DM63 2WAQB 2WV6D 2WKDA 3A56A 3MXUA 4KD4A 4A3EB 4DXFA 4CKBA 2LMCB 2O4XA 3GTLB 3PUZA 3MC0B 4A3FB 3T4AC 5FLXL 4ZKBB 3KUPA 1PKVA 1JORA 4TSSA 3BG3A 2AQ3B 1PYWD 3F2UA 1QILA 4LK1C 1LTGD 2JA6B 2EY6A 1A2TA 1WTWA 1E3ZA 4RHSA 4Z9CB 2BA0A 1FGBD 2XZPA 3DWQA 2K28A 1A3TA 2X6XA 3GV3A 2NN6H 2WINB 5EKKA 3MEHA 4LMQD 4KD3A 1I4XA 2PPBC 1QOHA 1TWGB 3NPPA 1PRTF 4NP5A 3E5SA 5A2QE 4A3IB 4YEJA 4KMUC 1BBXC 2PMZB 4WRDA 4II3A 1I6HB 4NDXA 4DF7A 3S1MB 3I91A 1LTSD 2WP8J 5CC4A 1PTOD 3TN2A 5I4DA 4DGZA 2DN8A 2KVOA 5KYIA 5IGCA 3U9SA 2VJJA 1W6JA 1KNAA 1SNMA 3G7LA 2O5JC 2D3LA 1NR4A 1B2TA 1V8QA 4XLHA 3QB3A 2F0TA 3HGBA 3A7LA 5F2DA 2Q8TA 2GK6A 1F2YA 1G6ZA 5KNLA 1V0FA 2L1BA 2E75C 3BCDA 3VYRA 5KNCA 2A5HA 2KHSA 1PXUA 3K6OA 4L6TB 1OB0A 5JAVA 4B3FX 1SKYB 1F2ZA 3A8IE 1HFNA 5CGKA 1BLIA 2D9UA 5C5LA 2FJ2A 4KY7A 4F88A 2NUCA 5G3LF 3C1EA 3SEBA 2JIZA 3K5MA 3A8KE 1TWAB 1W0JA 1VLYA 1TS2A 4G6IA 1LACA 1E0BA 2HUGA 1FX0A 4DU9A 3GTOB 2XNAC 5EQ0A 5C4JB 1EZ8A 3TP8A 2B2TA 4K8IA 3JU4A 2R9VA 1U4RA 5C0XG 1K28D 1C48A 5JEAJ 3J7AF 4K5XA 4C3JB 1WVLA 4NMZA 4Q0FA 1DOKA 4XLCA 3NQIA 1SEBD 2LFNA 1TVXA 3VYTA 1HUNA 2JXMB 5JEAH 4YXWA 1ENCA 4XONA 2K05A 3OMGA 5FKAC 2E74C 1STYA 3DWAA 2BCOA 5K36G 2VB3X 4A93B 2FFKB 1E43A 1B4OA 4IFDI 4I7ZC 1OHHA 1LT3D 5JVG3 1V1OA 1I18A 1VMCA 1Z6HA 5TSSA 4CKEA 3BH4A 2TMPA 1EIHA 4OO1H 4G7ZC 2XZLA 2NVXB 2WACA 2ZXHA 2E2JB 1LTBD 1W9XA 1EL0A 1TS4A 4C2MB 5A35A 5M5XB 4HMJA 1IW7C 2F0QA 2PYKA 1QCBD 2RDFA 4CKCA 3LWEA 3E6ZX 5EBDA 2F0LA 4WFN3 3M7NA 2F0UA 2KEDA 4O42A 1LTTD 1ZEQX 1E79A 2IW3A 1W0KA 2SOBA 3HZXA 3TDQA 5JVH3 1M8AA 3H09A 1CA5A 4XT3B 2D62A 1PRTD 5C4HA 4CJ1B 2CK3A 1JB3A 4H0LC 2RKSA 4V190 1NUCA 5ELFA 1XWEA 5C4ZA 3OAAA 1BCPC 4K14A 3AB9A 5D14A 1DCZA 3J80L 3GV6A 5IOCA 1EQTA 3CP2A 2J7ZA 3NWSA 2F3WA 1CFMA 1L0YB 1B50A 1DYQA 4RFBA 4XT1B 3D31A 3V2TA 3OPOA 4FXKC 5K5PA 4PV1C 3HKZB 5D3IB 1E1QA 1WTHD 3OSOA 3TP6A 2K5QA 5J1ZA 3SE0A 4A3GB 4F87A 3S9WA 1BDOA 2ENBA 1EY9A 2B2UC 2B39A 1ICWA 1YNNC 1VCIA 3QJYA 1V43A 4F7XA 1LV9A 3NTHA 3AU7A 1SNCA 5FO9B 1VDZA 1E1RA 3FDTA 3D6CA 3Q0AA 5J39A 2JA7B 2EJGC 3TP5A 1A3UA 1GUNA 3FMCA 3OIQA 5EGTA 3GVJA 1X32A 4HMIA 4ZYSA 4RWSC 1WPCA 2F0MA 1WTQA 5LL6S 1YNJC 1GUSA 1JWUD 4BBRB 1DOLA 3GTJB 1F9RA 3LWUA 2R92B 4KY6A 2QDBA 1Y1VB 1G8ZD 2ICEC 1AEXA 5C0XJ 3FKIB 3S2HB 1H9KA 4BS9A 1I4RA 1UAPA 1BOSA 3S1NB 3O13A 4A3JB 3W3AA 3VR3A 3PV0A 5C0XH 3U9OA 4FF2A 1UD2A 4IZ8A 3I4NB 3BYTB 1PFNA 3TMEA 4IURA 4KTAA 1BCPF 1TIID 4FO2A 1VF7A 3WQZA 2CVRA 3MXGA 3CRLC 3T51B 2A6ED 1PDQA 4BY1B 1UUPA 1JE4A 2QF7A 2K5DA 1HTPA 5C0XI 2W6IA 2PZUA 2FHTA 2F0VA 3S14B 3DXJC 4FVMA 4KI0A 4OIJA 1D5MC 4FP5D 4AVZA 1SYDA 2JEBI 1GUTA 4RH6A 4EQNA 1O7YA 3GO5A 3VR2A 1Y1WB 5CYUA 1EY7A 2JDIA 3NWTA 1TWCB 1ONLA 1S4ZA 1SMYD 5D3DA 2NTTA 4M8AA 2GA4B 5IGEA 1LABA 2EY2A 1SNQA 1X3PA 2KVMA 2EYLA 2B2YA 1CK1A 2LY7A 2JA5B 1JOQA 3IL8A 4FF4A 5BN3A 2PW5A 4EQOA 3KBXA 2NTSA 1F9PA 3J7YW 2SEBD 4KJOA 2K1BA 5M5WB 5LHY1 1GUWA 5CV9A 4J6HA 2H4OA 5CR3A 1EYAA 2EYMA 2F0PA 3FEWX 3RUZA 5CV8A 2ZZQA 5CBEE 3ZIAA 4H13C 3EA6A 3OEHA 4NNJA 1C8CA 4ME5A 2EVBA 3TP7A 1GUOA 1ILPA 1AFPA 2X6WA 3BDLA 4KHZA 5EPLA 3KLSA 2QILA 4UAIA 3G05A 1BCPB 5DN6A 1PFMA 4WJWA 1ZXTA 3QO2A 3KK7A 1EY5A 4XXEA 4S3SA 1II3A 4ID6A 2MGSA 2E2DC 4G7HC 3ND8A 1EFRA 1UNSA 2KUMA 3HOWB 4IFDG 5D65A 2XZOA 3K59A 3I72A 5JJZA 1AN8A 1SYBA 2MHVA 4A3MB 4ZRZA 4QIWB 4DAYA 3C1FA 1PRTB 1DONA 1SFOB 4BY7B 1XYIA 1TWHB 3DHQA 1EY6A 2RA4A 3PUWA 2EY1A 2K04A 1XTCD 3D3RA 2JYOA 4PQXA 2X53S 1EQVA 4DAVA 5C5MA 2R3ZA 4K2LA 4OL7A 2V7QA 5ISRA 3TZUA 2SNSA 4A3KB 1BO0A 3J80E 4L63B 5C4XB 4X3KA 4DNTB 2L0CA 4ULLA 5ELEA 4KKTA 2G9DA 5CBAE 4OHJA 4V0BA 1RTNA 2N88A 1SE4A 3EROA 4FYDA 2X6LA 1VF5C 3PUXA 2BA1A 3NUCA 1CHQD 4C3JG 2NN6I 2IWHA 2F0DA 3C46A 1JQYD 2F4IA 5I9OA 3KLRA 4LJZC 4C1NI 4KV6A 1PMRA 1VMPA 2GK7A 4DAPA 4WORA 4OGQC 1ENAA 3AMUA 5E4WC 5KRUA 2Z4HA 4NW2A 3W2DA 5IT9E 2EYJA 1JOKA 5FOBB 1CZGA 1YNJD 1EY0A 1U4LA 1GXDC 2R93B 4DN4M 5DAUA 1LTRD 2A73B 1RTOA 4RGNA 2AQ1B 3RD4A 2NYZD 1NR2A 3HOXB 2EYFA 4IN3A 1KLUD 2FINB 3K58A 3OFNA 1FR3A 2BDOA 3QOJA 4ZUJA 1U9RA 1Z47A 1B9NA 1JOOA 2NVQB 1SYEA 3BZDB 1YNND 3NP8A 1NAPA 3MWYW 1RCVD 2RQXA 4B3GA 2CHBD 3OWEB 3GQBA 5KEEA 1S5BD 1S5DD 2RVLA 3I8ZA 2L5TA 4NKLA 2WSSA 3BC9A 3SK6A 2F0SA 4II2A 4G7WA 3KLSX 1BUVT 1COWA 3P7JA 2K5WA 3MFYA 4UZUA 3X3MA 1EEID 3NXWA 2A6EC 1HUMA 1GHKA 3H6MA 2VNUD 1PRTC 4KKUA 1O80A 1IYUA 1KDCA 3CU7A 2RDHA 1Z7TA 2A74C 1BR9A 3I90A 2F0WA 2XIWA 1QWYA 2Z1CA 3GTGB 4RA8A 4IFDJ 3T56B 1Q1EA 3DEPA 2WZPP 1NSNS 4KN4C 1O7ZA 2F0IA 1IW7D 3PIO3 4XL9A 1R9TB 3P75A 1Q3LA 2VUMB 1PTOB 3SXHA 1LT5D 2X6GA 2JJ1A 4RGOS 2O5IC 1QNKA 5E3FA 5HURA 2A69D 1BMFA 3NQTA 3RLFA 4C3IB 2NN6G 1HZEA 3N6RA 3S15B 1KNEA 1FNVA 3K5LA 3ITPA 1ET6A 4FXDA 1KMHA 5C6AA 2H1EA 4OIKA 2KCNA 1HQMC 1BPLA 5JOBA 1DD2A 2YU9B 1EYDA 1GOZA 2WPDA 4K5WA 3FRPB 2PQEA 4YELA 2X69A 3BYYB 4QUCA 2IX3A 5IGDA 5IGBA 1BQQT 1UEAB 1TY2A 3OIPA 4X3UA 1DJRD 2ZTGA 3HOYB 1SNDA 2B2VA 2QE7A 1AW7A 1Q8IA 1IYVA 1HTLD 5AFWA 2RDGA 1OO9B 2F3VA 4PMBA 4XR6A 1QE6A 4IUPA 1JC7A 2F0NA 5KNBA 2WB1B 2A6HC 4OO1G 1G91A 3A8JE 5EKLA 2NWGA 2XWJB 4TRDA 1FD7D 4KHVA 5FK9C 3J7AV 4E6IA 3MVVA 3OOCA 5A2QL 2MP1A 2ZXOA 3J81L 1F77A 2KQ3A 1KABA 3A3GA 5COYA 2GJKA 3RZOB 1CQFA 2SNMA 1MI2A 2RSNA 1GHJA 2ZXRA 3NTKA 2NBFA 1AZQA 1CA6A 1D1KA 5I2YA 1MD2D 3MA2B 4K8JA 3ZPNA 5BN4A 1HHVA 3VR4A 1TR5A 3CESA 1SAPA 2HDLA 2IX0A 1SXTA 4C56C 1Q1BA 4G7XA 1PTOH 5LL6X 2JJ2A 1HQRD 3EFXD 3C3LA 1VJSA 4J1MA 1B44D 4YIJA 1V1PB 1TQOA 1TKWB 1EY8A 1FYCA 3P20A 5ELBA 3Q23A 3H3VC 3N52A 5DEHA 3MXNA 1STNA 4XTCS 5CORA 4CGYB 2M2LA 5DNFA 4HTHA 4B9XA 1ESRA 3LX0A 4C3HG 2C9OA 2NB0A 3MXPA 2KCCA 4XOTA 2C5CA 2XVSA 4RCNA 3GVLA 2EJFC 4J8QA 4ZLTF 1OXUA 1ESFA 3I70A 3SK8A 3FKSA 5DM73 4HR7B 1ILQA 1AP0A 1O78A 4IUTA 5T1GA 4DXGA 1H8HA 4JMQA 2D5DA 3CHBD 4RKLA 1LT4D 2Z8LA 3GTKB 2D3NA 2BDNA 2EYHA 2X6YA 2O2LD 3K57A 2EPBA 3SHLA 4BWGB 3TBIB 2YYZA 4K6LA 3V96A 1KLGD 3BVZA 2XOKA 1OXTA 4PMCA 2F1MA 1ENFA 4ZKCB 1F2LA 2F03A 1LO5D 4HIZA 3OWFA 3A55A 1OXXK 5FO8B 4KKSA 2Q8IB 4BA1I 3R2IA 5M9OA 1H9SB 4U673 1SYGA 3S1QB 2IPKD 4KK7A 2LKVA 1U4MA 4IUNA 3V05A 3E0JA 3PO3B 2K32A 1CT1D 4H44C 4A3BB 3QG1A 2KJXA 1I50B 1V1PA 4XOPA 4F8MA 1SJHD 3MFGA 1LTAD 1EFID 1H9JA 1I8DA 1J9OA 2VJIA 2NVYB 4B9WA 2HLDA 3DM1A 3C2PA 3GVKA 3A54A 5JPNC 5EPJA 5KNDA 1WTVA 4IUVA 1EU3A 4ASUA 2JSOA 2OEOA 3BVGA 1QG7A 3KEWA 4PNYA 3CP8A 1IHZA 2ZTNA 2NVTB 2M5SA 2DNEA 2FMMA 2KOLA 1HA6A 4MIUA 2CW0C 1F9QA 3I3CA 4ABNA 1SE2A 3I4LA 1BNZA 3CRKC 1PTOF 1JWMD 2JA8B 3L3OC 2D2CC 2JE6I 1L0XB 1HCZA 2E2IB 2WJVA 2LS01 4XQQA 4HN7A 4HCSA 1QJOA 2K01A 2CW0D 3HP3A 1T5XD 2V31A 3LNNA 1O7LA 1RD9D 2QKIC 3NBIA 1LLRD 2F0FA 2NZ1D 4RGTA 3HOZB 3D4RA 4RKBA 3QIAA 5M5YB 4R9WA 3ND9A 4ZQ3A 3K5OA 3NTIA 2AWOA 1PZKD 2X8KA 1SNPA 3GD7A 1BCPD 1TU2B 2I07B 2KA7A 2A69C 3WOEA 1QNUA 1W6KA 5KIXA 3Q22A 1QB5D 4GQNA 3GTMB 1Y8NB 3FPPA 3VYUA 4Q5VA 3DMUA 2W6JA 4IUUA 2B2YC 3A7AB 1DZ1A 2E76C 1EWHA 4CJ0B 2PW7A 1JWSD 3PIP3 2E1BA 5EPKA 1EZ6A 4XYOA 1MABA 1I4PA 1XX8A 1SSOA 2M9VA 4MN3A 5IGFA 1SYFA 1DXMA 1UD4A 3OMCA 4IALA 1RF2D 1A2UA 2V4DA 2K6AA 1EU4A 2F0JA 3Q24A 4M1UB 1NBMA 1HVXA 4XLAA 3IAYA 5C3XA 3CMMA 2TSSA 3G6JB 2CQAA 3S2DB 4O1NA 3HG9A 2DY8A 2A6HD 4TKOB 4N9PA 3BVMA 5EKIA 2N55A 4OO1I 2B8FA 4FNFA 2GJPA 2EOTA 2Z4IA 1K8OA 2EYOA 1STGA 2F0KA 1PTOC 3OEEA 3T16A 4FXUA 1CTMA 1Y69U 3J81E 2R6GA 3GTQB 3M4OB 4JK1C 1STHA 2JEAI 1LTID 3CKIB 2MJ8A 2AQ2B 5C3EB 3NE5B 3MHBA 4TSFA 4Y7NB 3EVQA 2B2TC 1EYCA 2F0OA 2VB2X 4K5VA 5IK2A 2L12A 4KN7C 1CM9A 1FNWA 2B2VC 2K7VA 3TZDA 4U68A 2OF1A 2IJ0A 1HXYD 5ELCA 3URYA 4DA2A 1SNOA 3I73A 3SK5A 5I9PA 3HOVB 2GJRA 1ET9A 1OXVA 3NSWA 1EIGA 2DIEA 2JP1A 2ZZGA 2ZZEA 2XRQD 3RZDB 1KAAA 3WDNA 1D1IA 2MUYA 4QF4A 4DK0A 3K0YA 2L55A 3A35A 1JICA 3A3BA 1STBA 3PO2B 1LT6D 1K8MA 4X3SA 4DK1A 1H9SA 1XXGA 3KF8A 1EWCA 2X85A 3EQLC 5G3LD 1R4PB 3IKJA 1PLFA 4XMYA 1HFGA 1R4QB 2PO4A 1B1ZA 3H0GB 1H9MA 5KGUA 1S5ED 2AWNA 3HEJA 3SVMA 2L9HA 4CHTB 1TY0A 4UDUC 3M3YB 2I46A 1IKMA 1WD0A 3ONAB 1TS5A 5JPMC 4HCEA 4R8IA 1D5ZC 4K6DA 3OE7A 2G9HD 4BA2I 2BE5D 1MSHA 3OW7A 2B63B 3MAQA 4G57A 2Q8RE 2E2HB 1ZYRC 4JBWA 2B2WA 3R8BA 3R2TA 4HSVA 1WTRA 4XQFA 4GZYC 1E2ZA 5IODA 2HDMA 2F0EA 3R93A 5CMDA 2PZTA 3K5NA 5BN5A 3BS1A 5KYLA 3PMFA 1HRJA 1RHPA 1HPCA 1RDPD 1S5CD 3DWPA 1MSGA 1MBYA 2XN9C 2VXWA 1Q12A 1H8EA 2DNCA 2Y0SB 3VA5A 1E2VA 3QWNA 3DEOA 3D4DA 1KDBA 1UD6A 2EE1A 1S5FD 3L9AX 5ELDA 1GUGA 5FLXE 3H91A 2ZT9C 2R61A 2M00A 1AZPA 4XNFA 1E3XA 3VR5A 3NHHA 2HCCA 4X3TA 4KJNA 4QCLA 4ODGA 2K33A 4DNRB 4IFDH 2WKCA 2PNRC 1CQVA 1K83B 3JAME 4TT3A 1U4PA 1BXTA 2BE5C 2SDFA 1EY4A 1I4QA 3D8GA 1SDFA 5IIFA 4P22A 3S16B 3OHXC 5HGTA 1E2WA 2EZVA 4AYBB 4ILWA 4R8NA 3HRZC 1ZYRD 2IL8A 4RHRA 3MZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYC A;  3GQB A;  3P20 A;  1I6V C;  1SMY C;  3I73 A;  1IW7 C;  4GZY C;  1E2Z A;  3A7A B;  3LWU A;  1OXV A;  2E76 C;  4XTC S;  1H9J A;  5BN3 A;  1ZKO A;  2L5T A;  3A8K E;  1EWH A;  3M7N A;  1CI3 M;  3IFT A;  2BA0 A;  3TZU A;  1H9K A;  5BN5 A;  1LAC A;  4G7O C;  4DNT B;  2A68 D;  1Q90 A;  1A6X A;  1DXM A;  3MFY A;  5KND A;  2NN6 H;  3WDN A;  3H94 A;  1HPC A;  4KKT A;  2KCC A;  1GJX A;  2IT1 A;  4DK0 A;  4RCN A;  3W3A A;  2D62 A;  2EJF C;  3VR3 A;  1Q12 A;  4H13 C;  2A6E C;  2EJM A;  5K36 H;  1IYV A;  1GHK A;  2DNC A;  1OXU A;  2V4D A;  3BDO A;  4H0L C;  2PPB C;  3SDZ A;  3PV0 A;  1VF5 C;  3PUX A;  2BA1 A;  2DNE A;  4KKU A;  5C0X H;  1E2V A;  2NN6 I;  5KNB A;  4HR7 B;  4XIG S;  1IYU A;  3AB9 A;  2CW0 C;  2EVB A;  4KMU C;  1O78 A;  2AUK A;  1GUO A;  2A6H C;  1Z7T A;  1DCZ A;  1K8M A;  4OO1 G;  2A6H D;  3I4L A;  4DK1 A;  4KHZ A;  3VR6 A;  1H9S A;  4TKO B;  3KLR A;  4LJZ C;  5C0X G;  2D5D A;  3CRK C;  3A8J E;  1PMR A;  3T56 B;  2AUJ D;  2EDG A;  3EQL C;  1GUG A;  1Q1E A;  2B8F A;  1VF7 A;  1OXS C;  4OGQ C;  2ZT9 C;  1G29 1;  1H9R A;  1T5E A;  1K8O A;  4KN4 C;  3OOC A;  2D2C C;  1CFM A;  3CRL C;  3IKJ A;  1IW7 D;  3T51 B;  2A6E D;  2JE6 I;  3VA7 A;  1HCZ A;  3VR5 A;  1H9M A;  3D31 A;  2QF7 A;  1Y69 U;  3OPO A;  1CTM A;  1HTP A;  2DN8 A;  2YYZ A;  4PV1 C;  2JXM B;  3L7Z C;  2R6G A;  1Y8O B;  3PUV A;  1OXT A;  1QJO A;  3U9S A;  2K33 A;  4DNR B;  4TQU S;  5JEA H;  1Y8P B;  2O5I C;  4IFD H;  3SE0 A;  3DXJ C;  2F1M A;  2PNR C;  3ND8 A;  3PUY A;  4G7H C;  1BDO A;  2A69 D;  4KI0 A;  4JK1 C;  1YNN C;  2PCF B;  3T53 B;  3LNN A;  2JEA I;  1O7L A;  2O5J C;  1VCI A;  2JEB I;  1V43 A;  3QJY A;  3RLF A;  2E74 C;  5JEA G;  4IFD G;  1GHJ A;  1GUT A;  1V8Q A;  2NN6 G;  4L8J A;  3I72 A;  3M4Y A;  5K36 G;  3N6R A;  3D4R A;  3QIA A;  3HGB A;  3VR2 A;  4I7Z C;  1OXX K;  2BE5 D;  4BA2 I;  3A7L A;  4IQZ A;  4KKS A;  3NE5 B;  1FR3 A;  2BDO A;  2BE5 C;  3MXU A;  3OW7 A;  3ND9 A;  1VDZ A;  2Q8I B;  1ONL A;  3M85 A;  4BA1 I;  2LMC B;  5BN4 A;  2A68 C;  2B8G A;  3VR4 A;  1B9N A;  3PUZ A;  1H9S B;  2EJG C;  2AWO A;  1GUN A;  1Z6H A;  1E2W A;  3FMC A;  3GD7 A;  1TU2 B;  1HQM C;  2E75 C;  1ZYR C;  2KA7 A;  4JBW A;  1LAB A;  2A69 C;  4KN7 C;  1Q1B A;  5KNC A;  1DD2 A;  1B9M A;  2K32 A;  4OO1 H;  4G7Z C;  2K7V A;  3BG3 A;  4H44 C;  3QG1 A;  3PUW A;  3A8I E;  4LK1 C;  1Y8N B;  1YNJ C;  3FPP A;  1GUS A;  5A35 A;  1TKW B; 
#chains in the Genus database with same CATH topology
 4XM3 A;  1SMY C;  1S72 B;  1E63 A;  3STB D;  3I55 A;  4B48 A;  1I4G A;  3BZK A;  3S1R B;  4LF7 Q;  1WOP A;  1ZKO A;  4JI5 Q;  4RDL A;  1CI3 M;  2EYP A;  2F43 A;  1D6E C;  1A15 A;  4LUZ A;  5BSY A;  3WNB A;  5CV5 A;  4C3I G;  4FXG C;  2CF4 A;  4A3K G;  4G7O C;  2A68 D;  2QGG A;  1A6X A;  5CV6 A;  4PZ8 A;  1C9O A;  1GJX A;  3Q39 A;  3R3O A;  2H5X A;  2IT1 A;  3LQE A;  1B3A A;  1BF4 A;  3VO1 A;  3CCJ B;  3DDY A;  1K8A C;  2ID0 A;  3X3N A;  4L5S A;  2PI2 E;  1IBL L;  2XND A;  4DR1 Q;  4QUF A;  4X6A H;  3BDO A;  5M3M B;  2VYQ A;  2AKW B;  4GOP A;  5IP7 H;  4TMZ A;  1YEZ A;  4K2K A;  5FL7 A;  5T1I A;  1M1K C;  4LW1 A;  1VLO A;  1DOM A;  1N06 A;  2N78 A;  4OOV A;  2AUK A;  5I6W A;  2QTL A;  1N36 L;  1HA5 A;  2Q6L A;  3ASQ A;  3VR6 A;  1H95 A;  1HA3 A;  3W2H A;  4ZAI A;  1STA A;  1IBK L;  1F2M A;  1N32 Q;  1NMF A;  1U5K A;  1WCM B;  2WII B;  2VUM H;  1OXS C;  1X3G A;  5C3W A;  1STE A;  1T5E A;  4YCW A;  2N8N A;  1EIF A;  1EWY A;  3SK4 A;  3G6E B;  1SBB B;  3RN5 A;  2DY7 A;  2C35 B;  1EFC A;  1RQP A;  2QEX B;  1PZJ D;  2YV5 A;  3VA7 A;  2QEJ C;  2FX3 A;  2UU9 Q;  4DR4 L;  5IYR A;  2BPO A;  3H15 A;  1VQ8 A;  3L0O A;  1J8I A;  3HAG A;  4DR3 L;  3HOU B;  3SEJ A;  2DYI A;  4XLE A;  2EY5 A;  1HZA A;  2YU9 H;  5CDF A;  4EVO A;  1KC8 D;  1T6X A;  2RSO A;  4N9T A;  1YHA A;  2NZO A;  2OK8 A;  1EFT A;  3MMP A;  5IYB H;  4XN0 A;  2KHI A;  2XWB B;  2OBR A;  3PUY A;  4YWK A;  5LMN Q;  4UP8 A;  1VQO B;  4P3I A;  2K50 A;  4BY7 G;  4XYQ A;  3T13 A;  3T53 B;  1QVC A;  4PAB A;  1MKH A;  5IY0 A;  3ZBT A;  2FVG A;  1A0I A;  2ZTC A;  4RCY A;  1VQJ A;  3RMH A;  4A3E H;  3NBH A;  4IPC A;  3M4Y A;  1WP6 A;  3VDY A;  2VY3 A;  5IT9 c;  4RJL A;  2YWG A;  4E0F A;  3M4O H;  3KBG A;  4RPD A;  3LO8 A;  1NRK A;  1SYC A;  4IQZ A;  4XDX A;  2WJY A;  2XSC A;  2B2W C;  3M85 A;  3UI2 A;  5IT9 L;  1SE3 A;  2A68 C;  1I3Q B;  3EJI A;  1EOT A;  2ZM6 Q;  1YJN B;  1KTK A;  5M3F B;  2PIA A;  4HJ5 A;  1Q81 C;  2Q6O A;  1K73 D;  3Q6S A;  2F0G A;  4BBS B;  2UXD Q;  2JA6 H;  3GTQ H;  3NK9 A;  4RCO A;  4LFA Q;  2KHJ A;  4GN4 B;  3H3V I;  1DM0 B;  1KXL A;  3KF8 B;  1PFB A;  5EBC A;  5EJW A;  1ZUN B;  4QMG A;  2R6H A;  3CD6 A;  1I6V C;  1KZL A;  4IPH A;  1LTL A;  4DV2 L;  4XD7 A;  4ZK9 B;  2EIF A;  3K7A B;  4X66 Q;  3ERQ A;  3D0F A;  3QOL A;  1UD5 A;  1TWF B;  1VQO A;  1SKQ A;  1WD1 A;  2F0H A;  3IFT A;  3TSS A;  4RGM A;  2HDN B;  1VQL A;  4DV0 Q;  2UXC L;  4XKW A;  3SR1 A;  1Q90 A;  1UWV A;  2B2U A;  1NDH A;  2J0T D;  3CCR A;  3F1Z A;  4RAU C;  1SJE D;  2LZJ A;  2EJM A;  1UE6 A;  5K36 H;  4UZE A;  2Z6B D;  2R7D A;  4Z1M A;  3SDZ A;  1A8V A;  4AF6 A;  4A3M G;  2OT2 A;  2N49 A;  4O2D A;  4C3H B;  1VQI A;  2KEE A;  3CC7 B;  2VQE L;  2QA4 A;  4XIG S;  1M4V A;  3CQZ B;  1ML0 D;  3G4S A;  3D6W A;  1FNU A;  3QFR A;  1PHJ A;  5J3B A;  3MTS A;  1CHP D;  1Q8K A;  2BOS A;  1VQD A;  1HH2 P;  4R4I A;  5J35 A;  4EQP A;  2HCI A;  2QCP X;  2JA6 G;  1WJJ A;  1CZW A;  2EDG A;  4XQJ A;  4DV6 L;  3OZU A;  4GNX C;  1G29 1;  1H9R A;  4KY5 A;  3EBE A;  2WZN A;  1WTO A;  1PH2 A;  4WJ3 M;  2DGY A;  4CJ2 C;  4LUO A;  4DV0 L;  1ROD A;  4P74 A;  4MTK A;  1Y1W G;  4DQK A;  1X3Q A;  1D5X C;  3GP7 A;  2IHF A;  4MHE A;  4HID A;  3L7Z C;  3PIP A;  1Y8O B;  2FMC A;  5NUC A;  5M5Y H;  4TQU S;  1Y8P B;  2RBM A;  4XOR A;  1BVS A;  3CCU A;  4HED A;  1VQA A;  5E1F A;  2VBS A;  4POF A;  1IL8 A;  2NZH A;  1D1N A;  1E1O A;  4K0K L;  1KDA A;  3FVQ A;  2R7Z B;  3ZYY X;  5C44 B;  1G2T A;  1VQ7 A;  3M4P A;  4FF3 A;  1I4H A;  1K3B C;  4XQN A;  1SFO H;  1WTP A;  4GOP C;  3M7G A;  4IUQ A;  4PMW A;  4XKV A;  1G2S A;  3A8I A;  2VQF L;  1G7T A;  2RC5 A;  1A3V A;  5DSZ A;  4GN3 B;  1JR0 D;  4RDJ A;  2CCZ A;  2B8G A;  2OWO A;  4OWW B;  1F9S A;  3BDC A;  4A3M H;  1JA1 A;  3RY8 A;  3CPW B;  1E62 A;  1VQH A;  3U6K A;  4C43 A;  5CV4 A;  3FJO A;  1KAW A;  2IX1 A;  4YAL A;  1B9M A;  5IYD H;  1V0E A;  1Q7Y D;  3H0G G;  4FF1 A;  5AJ3 L;  3DUZ A;  2XTI A;  1TVC A;  1FNM A;  1S72 A;  3JQR A;  2KEC A;  1CKN A;  1ELO A;  2K03 A;  5CV7 A;  4JI8 L;  1UD8 A;  4P71 A;  5M3F G;  2NVX H;  4C3I H;  1TS3 A;  2PZW A;  1I6H H;  5FO7 B;  3GTG H;  4O0A A;  1K0R A;  4P2N A;  1EEF D;  3JAM L;  2OXP A;  1FVI A;  4P2C B;  2ICI A;  4A3C H;  3AGP A;  3U6B A;  2UUA L;  4YHB A;  1BKB A;  2ZXI A;  3OJX A;  3H94 A;  4I65 A;  3PGZ A;  3WOF A;  1JJC B;  4XN3 A;  1B53 A;  3HOW H;  2J7K A;  1AMO A;  1GVP A;  5HKK A;  3HS0 C;  5H59 A;  4B43 A;  5I6Y A;  4LAA A;  3HOX G;  4YAU A;  3BU2 A;  2QEX A;  1N36 Q;  4A3G G;  3I4M B;  2XNJ A;  5IYW A;  1TT2 A;  4TMX A;  3K0X A;  3K7U C;  4QB4 A;  3D4W A;  4GOP B;  4A3D H;  1WDT A;  1PZI D;  3FPU B;  1K83 H;  1JCK B;  3IFD A;  3GTO H;  2D0P A;  1JA0 A;  1KTV A;  1K9M C;  2XGJ A;  2VUM G;  3FPK A;  3S17 B;  1RKN A;  4DR1 L;  4EGV A;  3OKX A;  2ZXP A;  2ZZF A;  4IPD A;  1UE1 A;  3ICE A;  1D2B A;  2AUJ D;  1FNC A;  3WY9 A;  1IKL A;  2HQE A;  3PO3 H;  2XGT A;  4GKJ L;  4PC7 A;  4B08 A;  4HAE A;  4HSP A;  4Y7N H;  1MGS A;  1I94 Q;  3BY2 A;  1NCV A;  2L11 A;  1B3Q A;  4XLF A;  3BCF A;  2F4V Q;  1FRN A;  4DFA A;  5I2X A;  3ULL A;  4C1N K;  4JYA L;  5E4X A;  1FL0 A;  4CBV A;  1CSQ A;  1C4Q A;  1LYL A;  2EXZ A;  2KBN A;  2QGQ A;  2C5H A;  2XRS D;  3PUV A;  3SLN A;  4KLK A;  3VYS A;  5IWA Q;  3GTP B;  1WTX A;  4X8I A;  4G4K A;  2XNC A;  2Q6I A;  3CTA A;  2L4N A;  4RD6 A;  1RJT A;  3IRB A;  4POG A;  2MPM A;  2NVY H;  3P1H A;  1UD3 A;  2PCF B;  4H7B A;  1XMQ Q;  4A3D B;  2VNK A;  5JEA G;  4ZUI A;  1X3F A;  2J4X A;  5IGG A;  4R4C A;  4Z4R A;  4QVA A;  5J22 A;  4L8J A;  1VQK B;  5DM6 3;  2WAQ B;  2WV6 D;  4X7D A;  2WKD A;  3A56 A;  3CC7 A;  1EXM A;  3MXU A;  4KD4 A;  3TEH B;  4A3E B;  4OEM B;  4PG3 A;  4CKB A;  4DXF A;  3HOX H;  2LMC B;  2O4X A;  3GTL B;  3PUZ A;  3MC0 B;  4A3F B;  2ES2 A;  3T4A C;  5FLX L;  2CQO A;  2JA5 H;  1SRO A;  4ZKB B;  3KUP A;  1PKV A;  1JOR A;  4TSS A;  1KL9 A;  3BG3 A;  3OYY A;  1NB0 A;  1GR1 A;  2AQ3 B;  1PYW D;  3F2U A;  2OBT A;  1QIL A;  4LK1 C;  1LTG D;  5E6T A;  2JA6 B;  2EY6 A;  3HKZ G;  3VMF A;  1KJZ A;  1FRQ A;  1A2T A;  5IWA L;  1PH1 A;  4R4T A;  3A1P A;  1WTW A;  1E3Z A;  4RHS A;  1V9P A;  4DNI A;  1XNQ L;  5M5X H;  4Z9C B;  1L1O B;  2BA0 A;  1FGB D;  3S16 H;  5IYQ A;  2XZP A;  2V1C C;  3DWQ A;  3CME A;  2K28 A;  1A3T A;  4A93 G;  3C2Q A;  5C3E G;  2X6X A;  4DV6 Q;  3GV3 A;  1FJG L;  2NN6 H;  1Q9S A;  5TY0 A;  2WIN B;  5EKK A;  3AFP A;  5ELN A;  4FK8 A;  3HKZ E;  3MEH A;  3S24 A;  4LMQ D;  4KD3 A;  4A3I H;  1HR0 W;  2F4N A;  2PLF A;  1I4X A;  2PPB C;  1QOH A;  1TWG B;  3NPP A;  4R71 A;  1PRT F;  4FWT A;  4NP5 A;  2Q2I A;  2CC2 A;  1GO2 A;  5F4J A;  4Z4V A;  3E5S A;  3FKI G;  5A2Q E;  4A3I B;  4YEJ A;  4KMU C;  3ZJY C;  1BBX C;  1FGU A;  4QIW E;  2PMZ B;  4WRD A;  4II3 A;  5JBQ A;  1BBU A;  2DCU A;  1N9W A;  1I6H B;  4NDX A;  1KK2 A;  3PQI A;  4BBR G;  4DF7 A;  3S1M B;  4QY7 A;  3I91 A;  1LTS D;  2WP8 J;  3HOV H;  5CC4 A;  4DK6 C;  1PTO D;  3I4N H;  1A63 A;  1XNR L;  3TN2 A;  3KDF A;  1R5B A;  4GLV B;  1T6Z A;  5I4D A;  4DGZ A;  2DN8 A;  2KVO A;  4DUZ Q;  3B78 A;  5KYI A;  2YWF A;  4LBW A;  5IGC A;  2PMD A;  5TRD A;  3U9S A;  2QW7 A;  2VJJ A;  5J3O A;  1W6J A;  2BN4 A;  4CDC C;  1X56 A;  1KNA A;  1SNM A;  4A3J H;  2ATW A;  3G7L A;  1YIJ B;  2O5J C;  5IYC H;  2D3L A;  4JOI A;  2HHH Q;  1NR4 A;  4LUV A;  1V8Q A;  1B2T A;  2HD3 A;  2LXJ A;  1N33 Q;  4XLH A;  1IB0 A;  3QB3 A;  2F0T A;  3HGB A;  4X07 A;  3A7L A;  1OTC A;  1OB2 A;  1QUQ A;  5F2D A;  1K0S A;  3EIV A;  2Q8T A;  2GK6 A;  1F2Y A;  1G6Z A;  1PH3 A;  3VNV A;  1ASY A;  5KNL A;  4DR5 L;  4HJ7 A;  5EMN A;  4RPB A;  2VQF Q;  1V0F A;  3H0G H;  2L1B A;  2E75 C;  3JQQ A;  1GJR A;  3BCD A;  4P25 A;  3VYR A;  4B3S L;  1BBW A;  4LF4 Q;  5KNC A;  2A5H A;  1S40 A;  1IJF A;  4IOA A;  2KHS A;  1PXU A;  3PA2 A;  4H9G A;  3K6O A;  4C0S A;  4L6T B;  4JYA Q;  1OB0 A;  5JAV A;  3MEF A;  2QN6 A;  4B3F X;  1SKY B;  1F2Z A;  1QH0 A;  3A8I E;  4JBM A;  1HFN A;  3A8J A;  5CGK A;  1BLI A;  1Q82 D;  2D9U A;  1WOR A;  5C5L A;  2FJ2 A;  4KY7 A;  4F88 A;  2NUC A;  1SE8 A;  2HMA A;  2ZTE A;  1UE7 A;  4NXN Q;  1PH5 A;  5G3L F;  3C1E A;  3SEB A;  2JIZ A;  3K5M A;  3U58 A;  3A8K E;  1TWA B;  3U50 C;  1W0J A;  1VLY A;  3I2Z A;  1TS2 A;  2OCE A;  4G6I A;  2F3I A;  1W34 A;  1HZ9 A;  3ZC3 A;  1LAC A;  1E0B A;  4M1K A;  4X7F A;  1YLO A;  2HUG A;  2CWA A;  2Q6K A;  1V1Q A;  1FX0 A;  4I7A A;  3BZC A;  4DU9 A;  1W3S A;  4GLA C;  3GTO B;  2XNA C;  1EP2 B;  5EQ0 A;  1WU8 A;  4JG2 A;  5FO1 A;  2ZBU A;  5C4J B;  1PH8 A;  1YJ9 B;  1EZ8 A;  3TP8 A;  2B2T A;  2Z9H A;  4K8I A;  3JU4 A;  4ACA A;  1B8A A;  4Z4W A;  2R9V A;  1U4R A;  4YAF A;  1QVF B;  5C0X G;  1K28 D;  1C48 A;  2KCT A;  5AN9 A;  5JEA J;  4JOI C;  2VNJ A;  3J7A F;  3QFT A;  2K5H A;  3HFZ B;  1VHE A;  4K5X A;  4C3J B;  3F2B A;  1WVL A;  4NMZ A;  4Q0F A;  1H42 A;  1DOK A;  4XLC A;  1N34 L;  3S2D H;  3NQI A;  1SEB D;  2ZTD A;  2ZL6 A;  2VS1 A;  2LFN A;  1TVX A;  3E9I A;  1WCM H;  1IYJ B;  3CF5 A;  3VYT A;  1HUN A;  4X66 L;  1NJI D;  3A5U A;  5FIU A;  2JXM B;  2WFW A;  5FJ8 H;  2VW9 A;  5JEA H;  1S0U A;  4LC0 A;  4P26 A;  5IE8 A;  3CRZ A;  2KEN A;  1YX2 A;  4YXW A;  1Q46 A;  3CCJ A;  1ENC A;  4XON A;  4LBY A;  2K05 A;  3OMG A;  1EWI A;  5FKA C;  5IYB G;  2E74 C;  1STY A;  2A19 A;  3DWA A;  3ONU A;  2BCO A;  1EYG A;  5ELO A;  2QTZ A;  2VB3 X;  4A93 B;  5K36 G;  2MO1 A;  2FFK B;  1E43 A;  1B4O A;  4JV5 L;  4IFD I;  2OTJ B;  4JPB W;  4I7Z C;  4GNX B;  3HOY G;  1OHH A;  1N0V C;  1LT3 D;  2DY1 A;  3I4O A;  5JVG 3;  4P6Y A;  5GV8 A;  1V1O A;  1I18 A;  1VMC A;  1Z6H A;  5TSS A;  1UMK A;  1CKO A;  4CKE A;  3BH4 A;  1F20 A;  2GPJ A;  1CKM A;  5LMU L;  2TMP A;  1EIH A;  3GTK H;  1VQ4 B;  4DV1 Q;  4OO1 H;  4G7Z C;  3S1R H;  2XZL A;  1XPR A;  2E2I H;  3P26 A;  1DG1 G;  2NVX B;  2WAC A;  3J80 i;  2ZXH A;  1O7I A;  2E2J B;  1YJW B;  1KD1 D;  1LTB D;  1PVO A;  1W9X A;  1EL0 A;  1TS4 A;  4UHV A;  4C2M B;  5A35 A;  4OX9 Q;  5M5X B;  5AJ3 Q;  4HMJ A;  3BY1 A;  1IW7 C;  2F0Q A;  2PYK A;  1QCB D;  2RDF A;  4QL5 A;  3LWE A;  1EOV A;  3E6Z X;  4CKC A;  2Z6B A;  5EBD A;  2F0L A;  4WFN 3;  3M7N A;  4PGO A;  4PZ7 A;  5FO0 A;  2RHQ B;  2F0U A;  2KED A;  4O42 A;  4EX5 A;  1L1O A;  5FJ8 G;  1LTT D;  1QG0 A;  1ZEQ X;  1E79 A;  2IW3 A;  1W0K A;  2SOB A;  1G7S A;  3HZX A;  1ZM3 A;  3TDQ A;  5JVH 3;  1TWG H;  1M8A A;  1UEB A;  3H09 A;  1CA5 A;  4XT3 B;  4YCV A;  4OON A;  2D62 A;  1PRT D;  5C4H A;  4CJ1 B;  4P72 A;  2CK3 A;  3J81 k;  1JB3 A;  1M1K D;  4H0L C;  2RKS A;  4WZL A;  1NUC A;  4V19 0;  5ELF A;  1XWE A;  3RZD H;  5C4Z A;  3OAA A;  3ZZ0 A;  1BCP C;  4K14 A;  3AB9 A;  1QX4 A;  3KF6 A;  3CCE A;  4MZ9 A;  5D14 A;  1DCZ A;  3J80 L;  4LF9 L;  3GV6 A;  4X62 L;  4RG1 A;  3CCS A;  1EUJ A;  5IOC A;  1EQT A;  3CP2 A;  2J7Z A;  4A3F G;  4FDB A;  1QUE A;  3NWS A;  2F3W A;  2FXQ A;  1CFM A;  1L0Y B;  1B50 A;  2JA9 A;  1DYQ A;  4RFB A;  4XT1 B;  2DER A;  3D31 A;  1T9H A;  3V2T A;  3OPO A;  4FXK C;  5K5P A;  4PV1 C;  1NBW A;  3HKZ B;  5D3I B;  1E1Q A;  1WTH D;  3OSO A;  1ICF B;  3TP6 A;  2K5Q A;  5J1Z A;  5H5J A;  3SE0 A;  4A3G B;  4F87 A;  2PQA A;  3S9W A;  1BDO A;  2ENB A;  1EY9 A;  2I1L A;  2B2U C;  2B39 A;  3KL9 A;  2Z0S A;  3SJP A;  1NNX A;  1ICW A;  1YNN C;  3ISX A;  1VCI A;  3QJY A;  1V43 A;  4QV2 A;  4RMF A;  3WND A;  1PYB A;  4C3H H;  4DR2 L;  3CB4 A;  4H02 A;  3J7Z C;  4F7X A;  1LV9 A;  4A3G H;  3NTH A;  2ZJP A;  4JVZ A;  3AU7 A;  1J5E Q;  3GTP H;  4OPV A;  1SNC A;  1GAW A;  4WWV A;  5FO9 B;  2HHH L;  3G4S B;  1E1R A;  1VDZ A;  4B47 A;  3FDT A;  3D6C A;  3Q0A A;  5J39 A;  2JA7 B;  1Q7Y C;  2EJG C;  3TP5 A;  1BQE A;  1A3U A;  1GUN A;  1EFU A;  3FMC A;  3OIQ A;  2Y0S E;  4AC9 A;  5EGT A;  3GVJ A;  1X32 A;  3JQP A;  4HMI A;  4ZYS A;  2K4K A;  2CFM A;  4RWS C;  1WPC A;  2F0M A;  4DV2 Q;  2WB1 E;  1WTQ A;  1KC8 C;  5LL6 S;  5IYP A;  4Z4T A;  1YNJ C;  4UPA A;  1GUS A;  1JWU D;  1PJ5 A;  4Y9R A;  5IYD G;  4LF9 Q;  2E2H H;  4BBR B;  1N0U A;  4A3B H;  1DOL A;  1XTD A;  3D26 A;  3GTJ B;  1F9R A;  3LWU A;  2R92 B;  3NEL A;  1XFO A;  4UZF A;  4B3T Q;  4KY6 A;  2UUC Q;  2QDB A;  1CQX A;  1Y1V B;  1G8Z D;  1M90 C;  3LQ6 A;  4DPG A;  2B63 H;  2ICE C;  1AEX A;  5C0X J;  3FKI B;  4BBS G;  3S2H B;  1H9K A;  4BS9 A;  1I4R A;  3WBJ A;  2HIX A;  1X55 A;  5A88 A;  1UAP A;  3OJW A;  1BOS A;  3DM3 A;  3S1N B;  1XJV A;  2BMW A;  3O13 A;  1L2F A;  1E1T A;  4A3J B;  3W3A A;  1N33 L;  2VL6 A;  3VR3 A;  1AE3 A;  1YJ9 A;  3GIR A;  3PV0 A;  3GTM H;  3HOW G;  5C0X H;  3U9O A;  4FF2 A;  3R6K A;  1UD2 A;  1BX0 A;  4IZ8 A;  4U9U A;  3I4N B;  1MJC A;  4P3Y A;  3BYT B;  1PFN A;  1VQ9 A;  3CCE B;  3KF6 B;  4OX9 L;  3TME A;  4C3J H;  1NE3 A;  4IUR A;  4X06 A;  1U0L A;  4OWX B;  5JJL A;  4KTA A;  2CH4 A;  1BCP F;  4UP9 A;  2UXB L;  1TII D;  4FO2 A;  3WXM A;  2RHS B;  1VF7 A;  1I7P A;  3WQZ A;  2CVR A;  4X62 Q;  3MXG A;  4DV3 Q;  3CRL C;  3F8T A;  2ALY B;  3A8K A;  4B4D A;  3T51 B;  2A6E D;  1PDQ A;  3L2P A;  1UUP A;  4BY1 B;  4JI2 Q;  2ZL7 A;  1JE4 A;  2QF7 A;  1N32 L;  3T1Y L;  2K5D A;  1HTP A;  5C0X I;  4RDK A;  4JI6 Q;  2W6I A;  1Z9F A;  2OQ0 A;  2PZU A;  1TWH H;  2FHT A;  2I5M X;  2F0V A;  3CMA A;  4PC3 A;  3S14 B;  1K9M D;  3DXJ C;  4A93 H;  4FVM A;  2K5N A;  3BJU A;  4KI0 A;  1FNB A;  1D5M C;  4FP5 D;  4OIJ A;  2DET A;  2QDL A;  4AVZ A;  4P1V A;  1SYD A;  1TWC H;  3CXC B;  2JEB I;  5A89 A;  3CCM A;  1GUT A;  4RH6 A;  2BV3 A;  4EQN A;  4YHH Q;  4A3I G;  1HNW L;  1O7Y A;  3GO5 A;  3PF5 A;  1MHW C;  5M3M G;  1FND A;  3VR2 A;  5HGQ A;  5CYU A;  1EY7 A;  2JDI A;  3NWT A;  1Y1W B;  2ZM6 L;  1TWC B;  1ONL A;  2AHO A;  1S4Z A;  1SMY D;  2R7Z H;  5D3D A;  2NTT A;  2K14 A;  4M8A A;  1KK1 A;  2GA4 B;  3PA1 A;  1QFZ A;  5IGE A;  1MRZ A;  4RD1 A;  3Q3A A;  1VQL B;  1LAB A;  1Q81 D;  1N34 Q;  4LF5 L;  2EY2 A;  2R92 H;  1SNQ A;  4JC0 A;  1X3P A;  3CAM A;  2KVM A;  3PF4 A;  3Q38 A;  1KRH A;  1Y14 B;  2EYL A;  2B2Y A;  1CK1 A;  2JA5 G;  3ZZU A;  3I1F A;  2LY7 A;  5IP9 H;  2GVB A;  2JA5 B;  1KHI A;  1JOQ A;  4CDD C;  2JA7 G;  3IL8 A;  4GKJ Q;  3CMA B;  1JB7 A;  4FF4 A;  4AH6 A;  1W35 A;  2PW5 A;  5BN3 A;  4EQO A;  3S1M H;  3KBX A;  3QFS A;  2NTS A;  1F9P A;  5GV7 A;  3J7Y W;  2SEB D;  4KJO A;  1P8L A;  2CWP A;  3KJP A;  4JBJ A;  3PO2 G;  4AQY L;  2K1B A;  5M5W B;  3ER0 A;  5LHY 1;  2OYN A;  1BJK A;  4Z4U A;  1X3E A;  2V7X A;  2YWE A;  1GUW A;  5CV9 A;  4J6H A;  2H4O A;  5CR3 A;  1HR0 L;  2OBS A;  1EYA A;  4YY3 Q;  2EYM A;  2F0P A;  3FEW X;  3RUZ A;  3I55 B;  2ZZQ A;  5CV8 A;  3ZIA A;  4H13 C;  5CBE E;  3EA6 A;  4GN5 A;  1IBM Q;  3OEH A;  1YI2 A;  4NNJ A;  3HOZ H;  1WSV A;  1I50 H;  4DV7 Q;  4ZGN B;  1C8C A;  5HXB A;  2WAQ G;  3KLW A;  4M4S A;  4NXN L;  4ME5 A;  2EVB A;  3TP7 A;  1GUO A;  1ILP A;  1AFP A;  1TWA H;  2X6W A;  1A8P A;  3BDL A;  4KHZ A;  5EPL A;  1VQ5 A;  3KLS A;  2QIL A;  4GLX A;  4UAI A;  1QZH A;  2C5B A;  3G05 A;  1BCP B;  3H9N A;  2VNI A;  1IXR A;  5DN6 A;  3VNU A;  3JAM i;  1G7C A;  4DK3 C;  1VQ4 A;  1PFM A;  4WJW A;  1ZXT A;  4TMV A;  3TRE A;  1VQN A;  1VQK A;  1E24 A;  3QO2 A;  3W5O A;  5M3F H;  3KK7 A;  5EAY A;  5FNZ A;  1EY5 A;  2WAQ E;  4JI7 L;  1E22 A;  4XXE A;  1QGZ A;  5L46 A;  1XB2 A;  4S3S A;  1II3 A;  2EXD A;  4ID6 A;  2MGS A;  4R4Q A;  3BNW A;  3CPW A;  2E2D C;  4G7H C;  3ND8 A;  1W2B A;  1EFR A;  1UNS A;  3PO2 H;  1NMG A;  2KUM A;  3HOW B;  1Y0R A;  4WZK A;  4RD4 A;  3AVW A;  2C2W A;  1HR0 Q;  4NPS A;  4IFD G;  5D65 A;  4PC2 A;  2XZO A;  3K59 A;  3I72 A;  5GQO A;  5JJZ A;  1AN8 A;  1SYB A;  4G1V A;  5H1S E;  1YZ6 A;  2MHV A;  4X65 Q;  5TR9 A;  4A3M B;  5TV2 A;  4ZRZ A;  4QIW B;  4DAY A;  4EQ5 A;  1RQR A;  3C1F A;  1PRT B;  3KFU A;  1DON A;  1VQG A;  1SFO B;  4BY1 H;  1IZ6 A;  1S3O A;  1SRU A;  4BY7 B;  1XMO Q;  2R93 H;  1XYI A;  4A3L H;  1TWH B;  3DHQ A;  4GKK Q;  1EY6 A;  1B23 P;  1PH7 A;  2RA4 A;  3PUW A;  2UXB Q;  4BXX H;  1QUQ B;  1TLL A;  2EY1 A;  2K52 A;  5THX A;  2K04 A;  2RF4 A;  1XTC D;  3D3R A;  2JYO A;  2AMC B;  2GRE A;  1JNY A;  2VBU A;  3PSI A;  4A3C G;  4PQX A;  4UY8 C;  1WSR A;  2X53 S;  1EQV A;  2Y0S G;  3W2G A;  4DAV A;  3QFC A;  4HE5 A;  4ACB A;  5C5M A;  2R3Z A;  4K2L A;  4OL7 A;  1EFW A;  2V7Q A;  5ISR A;  3TZU A;  5GAE C;  1VQ9 B;  2SNS A;  4A3K B;  4JI4 Q;  1X6O A;  1X9N A;  1BO0 A;  3I56 B;  3J80 E;  1HNW Q;  4L63 B;  5C4X B;  3B8H A;  4DNT B;  4X3K A;  2L0C A;  4ULL A;  5ELE A;  4KKT A;  2G9D A;  5CBA E;  2DUD A;  5DLQ E;  2BM0 A;  4DAY B;  5IP7 G;  4JBK A;  4OHJ A;  2NPF A;  4A3K H;  1H85 A;  4V0B A;  1RTN A;  2N88 A;  3QE2 A;  1SE4 A;  3ERO A;  5M5W H;  4FYD A;  3ZBU A;  2X6L A;  5C44 H;  1VF5 C;  3PUX A;  2BA1 A;  3NUC A;  1CHQ D;  4C3J G;  2NN6 I;  2IWH A;  2JA8 H;  2F0D A;  4X0C A;  1HNZ L;  4IJL A;  1G51 A;  3C46 A;  4DV3 L;  4IPG A;  1JQY D;  2F4I A;  3AFQ A;  1YIT A;  5I9O A;  2RCF A;  1OGJ A;  3KLR A;  4LJZ C;  4KV6 A;  4C1N I;  1PMR A;  1VMP A;  2GK7 A;  4HE6 A;  2OQK A;  4DAP A;  1M90 D;  4WOR A;  4DV4 Q;  4A3L G;  4OGQ C;  1ENA A;  5BR8 Q;  5E4W C;  1KIX A;  2OTL A;  2HT1 A;  3AMU A;  5KRU A;  4IJH A;  4F7D A;  2Z4H A;  3UDF A;  4NW2 A;  3W2D A;  1VQN B;  1BX1 A;  4KHP Q;  3J81 j;  5IT9 E;  1EIY B;  2C77 A;  2EYJ A;  1JOK A;  3EN2 A;  5FOB B;  1CZG A;  1YNJ D;  2YTY A;  1EY0 A;  1U4L A;  1GXD C;  5IYN A;  5KSW B;  4TN1 A;  2R93 B;  4DN4 M;  1JJ2 B;  5DAU A;  1PYS B;  1LTR D;  2A73 B;  4YAW A;  1RTO A;  1YJN A;  1JT8 A;  4RGN A;  3CQZ H;  2AQ1 B;  3RD4 A;  3ULP A;  2NYZ D;  4AYB G;  1QGY A;  2NVT H;  3ULJ A;  1KK3 A;  1YIJ A;  1NR2 A;  3HOX B;  3W2F A;  2EYF A;  1VQM A;  3OZW A;  4IN3 A;  1KLU D;  2FIN B;  4M53 A;  2GQF A;  3K58 A;  4RM0 A;  1CSP A;  3OFN A;  3UDI A;  3J81 i;  1FR3 A;  2BDO A;  1PH6 A;  3QOJ A;  4ZUJ A;  3JC6 6;  1U9R A;  1Z47 A;  4G1B A;  2R7F A;  4DUY L;  1XQB A;  1B9N A;  1QVG B;  3CCU B;  1JOO A;  4A3D G;  2NVQ B;  1SYE A;  3BZD B;  1YNN D;  1I5F A;  1WTH A;  3NP8 A;  1J9Z A;  1NAP A;  4APV A;  3MWY W;  5HZB A;  1RCV D;  2RQX A;  4B3G A;  2CHB D;  4MNO A;  2ZJQ A;  3OWE B;  3W2E A;  3E3X A;  3GQB A;  3CCR B;  5KEE A;  1S5B D;  1NJI C;  1S5D D;  2RVL A;  4N3G A;  3I8Z A;  3I7F A;  3RLO A;  3UE0 A;  2L5T A;  1N8R D;  4NKL A;  3I4M G;  3WWV A;  1GVH A;  2WSS A;  3BC9 A;  3SK6 A;  2X0K A;  2V7W A;  2QA4 B;  2F0S A;  4II2 A;  3Q8D A;  4G7W A;  3KLS X;  1BUV T;  1NTG A;  1COW A;  3P7J A;  2K5W A;  3MFY A;  3PIO A;  4JI7 Q;  2CND A;  3M4Q A;  4LF8 L;  4RLZ A;  2N3S A;  4UZU A;  3WYA A;  2UUA Q;  3X3M A;  1EEI D;  5F4M A;  3NXW A;  3G6E A;  2A6E C;  1DGS A;  1HUM A;  1GHK A;  3FKI H;  3H6M A;  2VNU D;  1X65 A;  2B3G A;  2GVA A;  1PRT C;  4KKU A;  5FLM G;  1SN8 A;  2F52 A;  1O80 A;  1IYU A;  1KDC A;  3CU7 A;  1L0W A;  4JI8 Q;  3MHP A;  2C78 A;  2RDH A;  1I94 L;  1B2R A;  1Z7T A;  3HOV G;  3E1Y E;  1BR9 A;  2A74 C;  3I90 A;  3CCL A;  2F0W A;  2XIW A;  1QWY A;  2Z1C A;  3GTG B;  4RA8 A;  4IFD J;  3JAM c;  3T56 B;  2JN9 A;  4LF8 Q;  1Q1E A;  3DEP A;  2UU9 L;  4DR4 Q;  5LMN W;  4PC1 A;  2WZP P;  1NSN S;  4L5R C;  4KN4 C;  1WFQ A;  2K5V A;  1O7Z A;  3M3Y H;  2VZL A;  2F0I A;  1KQS B;  2BH2 A;  4WZT A;  1IW7 D;  3PIO 3;  4XL9 A;  4OPS A;  1R9T B;  3P75 A;  1Q3L A;  2VUM B;  1PTO B;  3SXH A;  1LT5 D;  4BBS H;  2X6G A;  1HJP A;  2JJ1 A;  4RGO S;  1E64 A;  4ZV4 A;  1K8G A;  2O5I C;  5HY6 A;  1QNK A;  5E3F A;  3TQY A;  5HUR A;  4N8X 1;  2A69 D;  1BMF A;  3NQT A;  4UAJ A;  4DR6 Q;  1Q86 C;  3RLF A;  4C3I B;  2NN6 G;  1HZE A;  4ZCL A;  4QHY A;  3N6R A;  3S15 B;  3E9H A;  1KNE A;  3RNU A;  1FNV A;  3CD6 B;  3K5L A;  3ZZT A;  3ITP A;  1ET6 A;  4B3X A;  1KRT A;  4IO9 A;  4FXD A;  1KMH A;  2DJG C;  5C6A A;  2H1E A;  4LF5 Q;  2PQA B;  4OIK A;  1OB5 A;  5FLM H;  2KCN A;  1PJ6 A;  1HQM C;  3AGQ A;  1BPL A;  4UP7 A;  5JOB A;  1DD2 A;  4RCZ A;  4DQL A;  4JCV E;  1EYD A;  4DR5 Q;  2YU9 B;  1GOZ A;  2WPD A;  4DV5 L;  2JQO A;  4K5W A;  3FRP B;  2PQE A;  4YEL A;  3OW2 B;  2X69 A;  4DR7 Q;  4YHH L;  1D8T A;  3BYY B;  4QUC A;  4CDE C;  2IX3 A;  3CCQ B;  2K75 A;  1K28 A;  4LFB L;  5IGD A;  5IGB A;  4TVA B;  1BQQ T;  1R5N A;  4A3B G;  1UEA B;  4HIK A;  1TY2 A;  3OIP A;  4X3U A;  1DJR D;  1X54 A;  2ZTG A;  3HOY B;  1SND A;  1Y1V H;  3ASR A;  3AYH B;  5M3M H;  2B2V A;  3PUM A;  4OP7 A;  2QE7 A;  1AW7 A;  1PFS A;  3PEN A;  1Q8I A;  1HNX L;  1IYV A;  1K73 C;  1B7Y B;  4MYU A;  1HTL D;  5FA6 A;  2DEU A;  5AFW A;  2RDG A;  1VHO A;  1OO9 B;  2F3V A;  4PMB A;  4XR6 A;  1QE6 A;  4IUP A;  1JC7 A;  3A0J A;  2F0N A;  5KNB A;  2XEX A;  2EFG A;  1T6Y A;  3W2I A;  2WB1 B;  1HNZ Q;  1G7R A;  1YIT B;  2A6H C;  4QGU A;  4OO1 G;  1HZB A;  3K7A H;  1G91 A;  1WOS A;  3A8J E;  5EKL A;  2NWG A;  3AVU A;  3W1B A;  3QR8 A;  2XWJ B;  4NXM Q;  4TRD A;  1WI5 A;  1FD7 D;  4KHV A;  5FK9 C;  3J7A V;  3AST A;  4E6I A;  3MVV A;  3OOC A;  4QJF A;  4LFA L;  5DS0 A;  5A2Q L;  3TRZ A;  5F4O A;  3RZO H;  2MP1 A;  2ZXO A;  4LF4 L;  1IJE A;  3J81 L;  3QSY A;  1F77 A;  2KQ3 A;  1GM5 A;  1KAB A;  4LFC L;  4LFB Q;  3PO3 G;  4B3M L;  3A3G A;  5COY A;  4TMT A;  2GJK A;  4LNQ A;  3WBK A;  3RZO B;  3VO2 A;  2GN5 A;  4DAM A;  3PCO B;  2BGJ A;  2WR8 A;  1CQF A;  4B3T L;  2SNM A;  1PV4 A;  1MI2 A;  1QFJ A;  2D74 A;  2RSN A;  1GHJ A;  2QDX A;  2ZXR A;  3NTK A;  1Y1V G;  2NBF A;  1AZQ A;  1CA6 A;  1D1K A;  4QVJ A;  5I2Y A;  1MD2 D;  5LMN L;  5C4X G;  4MTN A;  3MA2 B;  4K8J A;  4DV1 L;  3ZPN A;  5BN4 A;  1HHV A;  3VR4 A;  1TR5 A;  3CES A;  1SAP A;  2HDL A;  2IX0 A;  1SXT A;  1JE5 A;  2CW5 A;  4C56 C;  1XNR Q;  1Q1B A;  4AYB E;  4G7X A;  1PTO H;  5LL6 X;  2YTX A;  2JJ2 A;  1HQR D;  3EFX D;  3C3L A;  1VJS A;  1SLJ A;  4J1M A;  3CME B;  3UDX A;  1B44 D;  2P3M A;  4YIJ A;  1V1P B;  4JV5 Q;  4X05 A;  1TQO A;  1TKW B;  1EY8 A;  1FYC A;  3P20 A;  5ELB A;  3Q23 A;  2MQH A;  3H3V C;  4GS3 A;  3N52 A;  4OEL B;  5DEH A;  3MXN A;  2CBX A;  4M2L A;  4P6V F;  1STN A;  4XTC S;  4HIM A;  4ROX A;  5COR A;  3CCQ A;  4CGY B;  2M2L A;  5DNF A;  4HTH A;  4B9X A;  4YWM A;  1ESR A;  3LX0 A;  4C3H G;  2C9O A;  2NV4 A;  2NB0 A;  2V7T A;  3MXP A;  2KCC A;  1DAR A;  2RCN A;  2G5D A;  4XOT A;  2C5C A;  2XVS A;  4ME3 A;  4RCN A;  3GVL A;  4A3E G;  2RC6 A;  2EJF C;  3U4V A;  4J8Q A;  4ZLT F;  4TMW A;  3TS0 A;  2A8V A;  1OXU A;  4X7C A;  4RD3 A;  1ESF A;  3I70 A;  3SK8 A;  4DUZ L;  3KDF B;  4AF7 A;  3FKS A;  1TXY A;  1D7Q A;  5DM7 3;  4HR7 B;  4BBR H;  2F1L A;  1ILQ A;  1HZC A;  1AP0 A;  3W5V A;  4NCN A;  1O78 A;  4IUT A;  3OTO Q;  5T1G A;  1KK0 A;  4DXG A;  1H8H A;  4JMQ A;  2D5D A;  3CHB D;  1QGA A;  3LVB A;  4RKL A;  1LT4 D;  4HJ8 A;  1QUF A;  2Z8L A;  1IBM L;  2Q2U A;  3GTK B;  2IY5 B;  2D3N A;  2BDN A;  2EYH A;  4A76 A;  2X6Y A;  2O2L D;  3K57 A;  2EPB A;  3SHL A;  4BWG B;  1LUZ A;  3CW2 A;  3TBI B;  2YYZ A;  4K6L A;  3V96 A;  2MNA A;  4AQY Q;  1KLG D;  2YTV A;  3BVZ A;  2XOK A;  1OXT A;  2B29 A;  4PMC A;  2V7V A;  1VQC A;  3KOJ A;  2F1M A;  4OPO A;  1ENF A;  4ZKC B;  1DDG A;  1F2L A;  2F03 A;  2I5L X;  4J15 A;  1LO5 D;  3W5H A;  4HIZ A;  3OWF A;  2WB1 G;  4CQJ A;  1E7Z A;  3PVD A;  4DV5 Q;  5C44 G;  3A55 A;  2ZL5 A;  1OXX K;  4K1X A;  5GAD C;  5FO8 B;  4KKS A;  5IYC G;  1SMX A;  1VQF A;  4X64 L;  2P5Z X;  2Q8I B;  4BA1 I;  3R2I A;  5M9O A;  3U2Q A;  1H9S B;  4U67 3;  5LMU Q;  3F2C A;  3W1G A;  1SYG A;  3S1Q B;  2IPK D;  4KK7 A;  1DDI A;  1U4M A;  2LKV A;  5GAH C;  3CC4 B;  4IUN A;  3V05 A;  3E0J A;  3PO3 B;  2K32 A;  1CT1 D;  3NBH B;  4BY1 G;  3J80 c;  4H44 C;  1VS0 A;  2BM1 A;  3CC2 A;  4A3B B;  3CCL B;  3QG1 A;  1UE5 A;  1YBY A;  2KJX A;  3V7A A;  1I50 B;  3AVV A;  4JI0 L;  1V1P A;  4Z4Y A;  1PH4 A;  3AEV A;  4XOP A;  2A1A A;  1F60 A;  4F8M A;  1KD1 C;  1SJH D;  3MFG A;  1LTA D;  4ALP A;  1EFI D;  1H9J A;  3RN2 A;  1YI2 B;  1I8D A;  1J9O A;  2VJI A;  2NVY B;  3SLD A;  4RD0 A;  4JI3 Q;  4B9W A;  2HLD A;  3DM1 A;  3C2P A;  3GDE A;  4EH1 A;  1K8A D;  3GTL H;  3GVK A;  3A54 A;  5JPN C;  5EPJ A;  5GAG C;  5KND A;  1WTV A;  4IUV A;  5C4J H;  1VQ5 B;  1MJE A;  1EU3 A;  1N08 A;  3OTO L;  3ES9 A;  4ASU A;  2JSO A;  2QMU A;  2OEO A;  3BVG A;  1QG7 A;  1VQE A;  3KEW A;  4PNY A;  2R7Z G;  3CP8 A;  4Y7C A;  1IHZ A;  3CCV A;  4QQB X;  2ZTN A;  1IHM A;  2NVT B;  2M5S A;  2DNE A;  4NBS A;  2FMM A;  2KOL A;  4MIU A;  1HA6 A;  2F4V L;  3STB C;  2CW0 C;  1F9Q A;  3I3C A;  1XPU A;  4ABN A;  1SE2 A;  3I4L A;  1BNZ A;  1TWF H;  4ZCM A;  1AH9 A;  2JA8 G;  3SKB A;  3CRK C;  1PTO F;  1XE1 A;  1JWM D;  4N3N A;  4P75 A;  2JA8 B;  1I3Q H;  4Y9U A;  3L3O C;  4DR7 L;  2V7U A;  3T1H L;  2D2C C;  1D8L A;  2JE6 I;  1L0X B;  1GO3 E;  3AQQ A;  4NXM L;  1HCZ A;  1N8R C;  2E2I B;  2WJV A;  2LS0 1;  2UUC L;  2HIV A;  4XQQ A;  4HN7 A;  4A75 A;  4HCS A;  1QJO A;  3FHW A;  3CCS B;  2K01 A;  2CW0 D;  3HP3 A;  4OWT B;  1T5X D;  2VNH A;  1KRS A;  2OTL B;  2V31 A;  3LNN A;  2KCM A;  1O7L A;  2HQL A;  1CNF A;  1RD9 D;  2QKI C;  3K81 C;  1LLR D;  3NBI A;  2F0F A;  2NZ1 D;  3WNC A;  4R1J A;  4RGT A;  3HOZ B;  4NB3 A;  3D4R A;  4RKB A;  3QIA A;  1YVC A;  3HOZ G;  5M5Y B;  1YJW A;  4R9W A;  3ND9 A;  4ZQ3 A;  3K5O A;  1JMC A;  2WYR A;  3NTI A;  5A8A A;  5KW9 A;  2PMZ E;  3ASP A;  3HOY H;  2AWO A;  1PZK D;  1R9T H;  3FP9 A;  2X8K A;  1SNP A;  3GD7 A;  1BCP D;  1TU2 B;  2I07 B;  1S4M A;  4L5T A;  2KA7 A;  2A69 C;  1MIU A;  3U4Z A;  3WOE A;  1QNU A;  2MFI A;  1N05 A;  1W6K A;  5KIX A;  1ZM9 A;  2BVN A;  3Q22 A;  3J7A 5;  1QB5 D;  4GQN A;  4GNX A;  3GTM B;  1Y8N B;  3FPP A;  3VYU A;  4Z4S A;  2EIX A;  4Q5V A;  3CW2 C;  3DMU A;  3J81 c;  2W6J A;  1SM4 A;  4IUU A;  1JJ2 A;  1QVG A;  3S17 H;  2B2Y C;  3A7A B;  1DZ1 A;  1VQ6 B;  2E76 C;  2JJQ A;  1WYD A;  1EWH A;  4N8F A;  4CJ0 B;  2PW7 A;  1JWS D;  2LXK A;  1PH9 A;  3PIP 3;  2E1B A;  5EPK A;  1EZ6 A;  2Z6K A;  4KHP L;  5GRO A;  3CPX A;  1Q86 D;  4XYO A;  4YCU A;  1MAB A;  1I4P A;  1XX8 A;  1D2E A;  1PJ7 A;  2PE3 A;  1SSO A;  1SYF A;  2M9V A;  4MN3 A;  5IGF A;  1YHQ A;  1DXM A;  4K0K Q;  1UD4 A;  3OMC A;  4IAL A;  1PA6 A;  2VZA A;  1RF2 D;  1A2U A;  5LMZ A;  1R5O A;  2UXC Q;  2YWH A;  4Z4Z A;  1YHB A;  4FN5 A;  2V4D A;  2K6A A;  4PC6 A;  1EU4 A;  2F0J A;  4L5Q A;  3Q24 A;  4DR6 L;  2VBT A;  3PUN A;  3CPF A;  4Y52 H;  4M1U B;  1NBM A;  1GAQ A;  4DV7 L;  1HVX A;  4XLA A;  1XPO A;  3IAY A;  5C3X A;  3CMM A;  2TSS A;  3G6J B;  2CQA A;  4P9S A;  4LBV A;  3HG9 A;  4O1N A;  2DY8 A;  1HNX Q;  3S2D B;  4R4O A;  2A6H D;  3P27 A;  4TKO B;  1V5V A;  4YY3 L;  4HJA A;  1VQP A;  4N9P A;  5JJK A;  3BVM A;  2B5O A;  5EKI A;  2N55 A;  4OO1 I;  2B8F A;  4FNF A;  2GJP A;  2EOT A;  2Z4I A;  4ZCK A;  1K8O A;  2EYO A;  1STG A;  2BSA A;  2E8G A;  2F0K A;  4ZCI A;  1ASZ A;  1PTO C;  2OTJ A;  1VQM B;  4A3F H;  3OEE A;  3E0E A;  3T16 A;  4FXU A;  1CTM A;  1Y69 U;  3M9B A;  1JB9 A;  1WOC A;  3HKS A;  1FJG Q;  3J81 E;  3I4N G;  1C0A A;  3G71 B;  2R6G A;  3GTQ B;  3M4O B;  4DKA C;  3H3V H;  3TS2 A;  4B3R Q;  1XNQ Q;  4JK1 C;  2Q2H A;  1STH A;  2JEA I;  2I0Q A;  2BGI A;  3OZV A;  1B70 B;  1LTI D;  3CKI B;  3CCV B;  2MJ8 A;  1G6P A;  2C4T A;  1QFY A;  2AQ2 B;  3LGJ A;  3RLN A;  4B3R L;  5C3E B;  1P16 A;  1NY4 A;  3NE5 B;  2E1R A;  2JK8 A;  4TSF A;  3MHB A;  4Y7N B;  3EVQ A;  3HOU G;  2B2T C;  1EYC A;  2B7C A;  2F0O A;  3S1N H;  1AE2 A;  2CRV A;  2VB2 X;  3E20 A;  4K5V A;  4JI3 L;  5IK2 A;  2L12 A;  4KN7 C;  4JI1 Q;  1CM9 A;  1FNW A;  2L15 A;  2B2V C;  2K7V A;  3CCM B;  3CXC A;  3F2D A;  1ZM4 A;  3TZD A;  1W87 A;  1VQ8 B;  4U68 A;  2DOG A;  2OF1 A;  2IJ0 A;  1HXY D;  5ELC A;  3URY A;  1EQR A;  1SNO A;  3I73 A;  3SK5 A;  4DA2 A;  5I9P A;  3HOV B;  3AVX A;  3SGI A;  2AHO B;  2GJR A;  1ET9 A;  1OXV A;  1TUI A;  1XMQ L;  5B6I A;  3NSW A;  4JI2 L;  3RR5 A;  1EIG A;  3B82 A;  2DIE A;  5BSX A;  2JP1 A;  2MO0 A;  2ZZG A;  2ZZE A;  1IBL Q;  4WZE A;  1U2R A;  2XRQ D;  3RZD B;  3W5U A;  3OP1 A;  1KAA A;  3WDN A;  4X64 Q;  2ZJR A;  1D1I A;  4A3J G;  2MUY A;  4QF4 A;  3UE1 A;  1Q82 C;  2ZBV A;  4DK0 A;  5HZA A;  2LSS A;  3K0Y A;  1K3R A;  3S14 H;  3B6Y A;  3ASS A;  4HJ9 A;  2L55 A;  3A35 A;  2ZIT A;  2JN4 A;  1JIC A;  3A3B A;  4DR3 Q;  1STB A;  3PO2 B;  4IW3 B;  4LF7 L;  3ZUG A;  4RD2 A;  1GKH A;  4OOX A;  1LT6 D;  1K8M A;  4PZ6 A;  4X3S A;  4DK1 A;  3G48 A;  1H9S A;  2E5L L;  1XXG A;  3KF8 A;  3GTJ H;  1YNX A;  1EWC A;  2X85 A;  4ZGQ B;  3R6J A;  3EQL C;  5FLX c;  4CDF C;  3CC4 A;  5G3L D;  1R4P B;  3IKJ A;  1PLF A;  3KYH C;  4XMY A;  4PAA A;  1HFG A;  1R4Q B;  3GSI A;  3CC2 B;  2PO4 A;  4M0L A;  4DV4 L;  1B1Z A;  3H0G B;  1H9M A;  1KQS A;  1TTT A;  5KGU A;  1S5E D;  2AWN A;  3A74 A;  3HEJ A;  3SVM A;  2L9H A;  4CHT B;  4BPR A;  1TY0 A;  2BH8 A;  1VQB A;  2Z6K C;  2I46 A;  4UDU C;  3M3Y B;  4YAO A;  1IKM A;  1WD0 A;  1NB9 A;  3ONA B;  4LF6 L;  1TS5 A;  4MYT A;  5JPM C;  4J0Q A;  4HCE A;  4R8I A;  1D5Z C;  4K6D A;  4IOC A;  3OE7 A;  2I5H A;  3K80 C;  4BY7 H;  1OGI A;  2G9H D;  4BA2 I;  2BE5 D;  4B3S Q;  1MSH A;  3OW2 A;  4P12 A;  3OW7 A;  3CP0 A;  3K8A A;  2B63 B;  4DUY Q;  4YWL A;  5L37 A;  4JI4 L;  2R92 G;  5C4X H;  3MAQ A;  4G57 A;  2D9R A;  2Q8R E;  1CNE A;  2E2H B;  1J5E L;  1ZYR C;  1W2B B;  2B2W A;  4JBW A;  3R8B A;  4C2M H;  5IP9 G;  3T1H Q;  3R2T A;  4A4I A;  1YHQ B;  1Y0Y A;  4HSV A;  4QFM A;  2JA7 H;  4LFC Q;  3V76 A;  2D0O A;  1WTR A;  4XQF A;  3KJO A;  3G71 A;  1VQ6 A;  4GZY C;  1E2Z A;  2E2J H;  4GKK L;  1L1O C;  2ASB A;  5E7N A;  5IOD A;  2HDM A;  1EQQ A;  4JI6 L;  1WCM G;  4LF6 Q;  4P73 A;  2F0E A;  3R93 A;  5C3E H;  5CMD A;  3T1Y Q;  2PZT A;  4AIM A;  3ERS X;  3BQJ A;  3K5N A;  1FDR A;  5BN5 A;  5BR8 L;  3BS1 A;  3SJZ A;  5KYL A;  3NEN A;  3PMF A;  2VBV A;  3AVY A;  1RHP A;  1HRJ A;  1HPC A;  1RDP D;  4G5G A;  1S5C D;  3DWP A;  2C4U A;  1MSG A;  1MBY A;  2XN9 C;  1RL2 A;  2VXW A;  3A5Z B;  1Q12 A;  2CKZ B;  1H8E A;  3S2H H;  2DNC A;  1EP3 B;  2Y0S B;  1IBK Q;  3VA5 A;  1E2V A;  3QWN A;  3Q6Q A;  3DEO A;  2E5L Q;  3D4D A;  3I56 A;  1KDB A;  1EP1 B;  1UD6 A;  4JW0 A;  2EE1 A;  1S5F D;  2VQE Q;  3L9A X;  2IHE A;  4B3M Q;  1J6Q A;  5ELD A;  2PI2 A;  1GUG A;  1QZG A;  4HIO A;  5FLX E;  3H91 A;  1CKN B;  2ZT9 C;  1E3P A;  2R61 A;  3S1Q H;  2M00 A;  3MCA A;  1LM0 A;  1AZP A;  2NVQ H;  4XNF A;  4WJ4 A;  3ONY A;  1E3X A;  3VR5 A;  4QUZ A;  2B63 G;  3NHH A;  2OK7 A;  2HCC A;  4KJN A;  4X3T A;  4ODG A;  4QCL A;  4X7E A;  1RIP A;  2X3U A;  3I4M H;  2K33 A;  4DNR B;  1N07 A;  4IFD H;  1Y1W H;  2WKC A;  2DJF C;  1C7Y A;  2PNR C;  2EQS A;  4JI5 L;  3S15 H;  4OOS A;  4Q7J B;  1CQV A;  3AVT A;  1K83 B;  3JAM E;  4TT3 A;  4LWC A;  1AIP A;  3HOU H;  1U4P A;  2PNH A;  2UUB Q;  2HCJ B;  4WQM A;  1VQ7 B;  1XMO L;  1BXT A;  4B44 A;  4OXP A;  2BE5 C;  3DLL A;  1P4M A;  2SDF A;  1WOO A;  1SR3 A;  1EY4 A;  1I4Q A;  3D8G A;  1SDF A;  5IIF A;  4P22 A;  1GD7 A;  1IL2 A;  3S16 B;  2Q2T A;  2UXD L;  3MXN B;  3OHX C;  4JI1 L;  5HGT A;  1A62 A;  4LBZ A;  1CUK A;  1E2W A;  2EZV A;  4X65 L;  4JI0 Q;  2B7B A;  3UDG A;  4AYB B;  4ILW A;  4BXX G;  4R8N A;  1ZM2 A;  5JJI A;  3HRZ C;  4DR2 Q;  1ZYR D;  3NEM A;  1QVF A;  2BF4 A;  3Q6R A;  1VQP B;  2CH4 W;  2R93 G;  2IL8 A;  4RHR A;  1JJG A;  3MZ5 A;  2UUB L; 
#chains in the Genus database with same CATH homology
 4XM3 A;  1SMY C;  1I4G A;  3S1R B;  1ZKO A;  1CI3 M;  2EYP A;  2F43 A;  1D6E C;  1A15 A;  5CV5 A;  4C3I G;  4FXG C;  4G7O C;  2A68 D;  1A6X A;  5CV6 A;  1GJX A;  3R3O A;  2IT1 A;  1B3A A;  1BF4 A;  3DDY A;  2ID0 A;  3X3N A;  2XND A;  4QUF A;  3BDO A;  5M3M B;  4K2K A;  5FL7 A;  5T1I A;  1DOM A;  2AUK A;  5I6W A;  1HA5 A;  3VR6 A;  4ZAI A;  1STA A;  1F2M A;  1WCM B;  2WII B;  1OXS C;  5C3W A;  1STE A;  1T5E A;  3SK4 A;  1SBB B;  2DY7 A;  1PZJ D;  3VA7 A;  2QEJ C;  1J8I A;  3HAG A;  3HOU B;  2EY5 A;  4XLE A;  5CDF A;  4EVO A;  2RSO A;  4N9T A;  4XN0 A;  2XWB B;  3PUY A;  4XYQ A;  3T13 A;  3T53 B;  3RMH A;  3NBH A;  3M4Y A;  1WP6 A;  4E0F A;  3KBG A;  4IQZ A;  1NRK A;  1SYC A;  4XDX A;  2WJY A;  2XSC A;  2B2W C;  3M85 A;  3UI2 A;  5IT9 L;  1SE3 A;  2A68 C;  1I3Q B;  3EJI A;  1EOT A;  1KTK A;  5M3F B;  3Q6S A;  4BBS B;  2F0G A;  3NK9 A;  4RCO A;  1DM0 B;  1PFB A;  5EBC A;  5EJW A;  4QMG A;  1I6V C;  1KZL A;  4XD7 A;  4ZK9 B;  3K7A B;  3ERQ A;  3QOL A;  1UD5 A;  1TWF B;  1WD1 A;  2F0H A;  3IFT A;  3TSS A;  4RGM A;  4XKW A;  3SR1 A;  1Q90 A;  2B2U A;  2J0T D;  4RAU C;  1SJE D;  2LZJ A;  2EJM A;  5K36 H;  2Z6B D;  4Z1M A;  3SDZ A;  2OT2 A;  4C3H B;  2KEE A;  4XIG S;  1M4V A;  3CQZ B;  1ML0 D;  3D6W A;  1FNU A;  3MTS A;  1CHP D;  4EQP A;  2BOS A;  2HCI A;  2QCP X;  2EDG A;  1CZW A;  4XQJ A;  1G29 1;  1H9R A;  4KY5 A;  1WTO A;  4CJ2 C;  1ROD A;  1X3Q A;  1D5X C;  3GP7 A;  4MHE A;  3L7Z C;  1Y8O B;  2FMC A;  5NUC A;  4TQU S;  1Y8P B;  2RBM A;  4XOR A;  4HED A;  5E1F A;  1IL8 A;  1KDA A;  3FVQ A;  2R7Z B;  3ZYY X;  5C44 B;  1G2T A;  4FF3 A;  1I4H A;  4XQN A;  1WTP A;  3M7G A;  4IUQ A;  4PMW A;  4XKV A;  1G2S A;  1A3V A;  1JR0 D;  2B8G A;  1F9S A;  3BDC A;  5CV4 A;  2IX1 A;  1B9M A;  1V0E A;  4FF1 A;  3DUZ A;  2KEC A;  2K03 A;  5CV7 A;  1UD8 A;  1TS3 A;  2PZW A;  5FO7 B;  1EEF D;  3JAM L;  2OXP A;  4P2C B;  2ICI A;  2ZXI A;  4I65 A;  3H94 A;  3WOF A;  4XN3 A;  1B53 A;  3HS0 C;  5HKK A;  5I6Y A;  4LAA A;  3I4M B;  1TT2 A;  4QB4 A;  3D4W A;  1PZI D;  3FPU B;  1JCK B;  3IFD A;  3S17 B;  2XGJ A;  1RKN A;  4EGV A;  2ZXP A;  2ZZF A;  1D2B A;  2AUJ D;  1IKL A;  2HQE A;  4B08 A;  4HAE A;  4HSP A;  1MGS A;  1NCV A;  2L11 A;  4XLF A;  3BCF A;  4DFA A;  5I2X A;  4C1N K;  5E4X A;  4CBV A;  1C4Q A;  2EXZ A;  2XRS D;  3VYS A;  3PUV A;  3GTP B;  1WTX A;  4G4K A;  2L4N A;  1RJT A;  2MPM A;  3P1H A;  1UD3 A;  2PCF B;  4H7B A;  4A3D B;  5JEA G;  4ZUI A;  2J4X A;  5IGG A;  5J22 A;  4L8J A;  5DM6 3;  2WAQ B;  2WV6 D;  2WKD A;  3A56 A;  3MXU A;  4KD4 A;  4A3E B;  4DXF A;  4CKB A;  2LMC B;  2O4X A;  3GTL B;  3PUZ A;  3MC0 B;  4A3F B;  3T4A C;  5FLX L;  4ZKB B;  3KUP A;  1PKV A;  1JOR A;  4TSS A;  3BG3 A;  2AQ3 B;  1PYW D;  3F2U A;  1QIL A;  4LK1 C;  1LTG D;  2JA6 B;  2EY6 A;  1A2T A;  1WTW A;  1E3Z A;  4RHS A;  4Z9C B;  2BA0 A;  1FGB D;  2XZP A;  3DWQ A;  2K28 A;  1A3T A;  2X6X A;  3GV3 A;  2NN6 H;  2WIN B;  5EKK A;  3MEH A;  4LMQ D;  4KD3 A;  1I4X A;  2PPB C;  1QOH A;  1TWG B;  3NPP A;  1PRT F;  4NP5 A;  3E5S A;  5A2Q E;  4A3I B;  4YEJ A;  4KMU C;  1BBX C;  2PMZ B;  4WRD A;  4II3 A;  1I6H B;  4NDX A;  4DF7 A;  3S1M B;  3I91 A;  1LTS D;  2WP8 J;  5CC4 A;  1PTO D;  3TN2 A;  5I4D A;  4DGZ A;  2DN8 A;  2KVO A;  5KYI A;  5IGC A;  3U9S A;  2VJJ A;  1W6J A;  1KNA A;  1SNM A;  3G7L A;  2O5J C;  2D3L A;  1NR4 A;  1B2T A;  1V8Q A;  4XLH A;  3QB3 A;  2F0T A;  3HGB A;  3A7L A;  5F2D A;  2Q8T A;  2GK6 A;  1F2Y A;  1G6Z A;  5KNL A;  1V0F A;  2L1B A;  2E75 C;  3BCD A;  3VYR A;  5KNC A;  2A5H A;  2KHS A;  1PXU A;  3K6O A;  4L6T B;  1OB0 A;  5JAV A;  4B3F X;  1SKY B;  1F2Z A;  3A8I E;  1HFN A;  5CGK A;  1BLI A;  2D9U A;  5C5L A;  2FJ2 A;  4KY7 A;  4F88 A;  2NUC A;  5G3L F;  3C1E A;  3SEB A;  2JIZ A;  3K5M A;  3A8K E;  1TWA B;  1W0J A;  1VLY A;  1TS2 A;  4G6I A;  1LAC A;  1E0B A;  2HUG A;  1FX0 A;  4DU9 A;  3GTO B;  2XNA C;  5EQ0 A;  5C4J B;  1EZ8 A;  3TP8 A;  2B2T A;  4K8I A;  3JU4 A;  2R9V A;  1U4R A;  5C0X G;  1K28 D;  1C48 A;  5JEA J;  3J7A F;  4K5X A;  4C3J B;  1WVL A;  4NMZ A;  4Q0F A;  1DOK A;  4XLC A;  3NQI A;  1SEB D;  2LFN A;  1TVX A;  3VYT A;  1HUN A;  2JXM B;  5JEA H;  4YXW A;  1ENC A;  4XON A;  2K05 A;  3OMG A;  5FKA C;  2E74 C;  1STY A;  3DWA A;  2BCO A;  5K36 G;  2VB3 X;  4A93 B;  2FFK B;  1E43 A;  1B4O A;  4IFD I;  4I7Z C;  1OHH A;  1LT3 D;  5JVG 3;  1V1O A;  1I18 A;  1VMC A;  1Z6H A;  5TSS A;  4CKE A;  3BH4 A;  2TMP A;  1EIH A;  4OO1 H;  4G7Z C;  2XZL A;  2NVX B;  2WAC A;  2ZXH A;  2E2J B;  1LTB D;  1W9X A;  1EL0 A;  1TS4 A;  4C2M B;  5A35 A;  5M5X B;  4HMJ A;  1IW7 C;  2F0Q A;  2PYK A;  1QCB D;  2RDF A;  4CKC A;  3LWE A;  3E6Z X;  5EBD A;  2F0L A;  4WFN 3;  3M7N A;  2F0U A;  2KED A;  4O42 A;  1LTT D;  1ZEQ X;  1E79 A;  2IW3 A;  1W0K A;  2SOB A;  3HZX A;  3TDQ A;  5JVH 3;  1M8A A;  3H09 A;  1CA5 A;  4XT3 B;  2D62 A;  1PRT D;  5C4H A;  4CJ1 B;  2CK3 A;  1JB3 A;  4H0L C;  2RKS A;  4V19 0;  1NUC A;  5ELF A;  1XWE A;  5C4Z A;  3OAA A;  1BCP C;  4K14 A;  3AB9 A;  5D14 A;  1DCZ A;  3J80 L;  3GV6 A;  5IOC A;  1EQT A;  3CP2 A;  2J7Z A;  3NWS A;  2F3W A;  1CFM A;  1L0Y B;  1B50 A;  1DYQ A;  4RFB A;  4XT1 B;  3D31 A;  3V2T A;  3OPO A;  4FXK C;  5K5P A;  4PV1 C;  3HKZ B;  5D3I B;  1E1Q A;  1WTH D;  3OSO A;  3TP6 A;  2K5Q A;  5J1Z A;  3SE0 A;  4A3G B;  4F87 A;  3S9W A;  1BDO A;  2ENB A;  1EY9 A;  2B2U C;  2B39 A;  1ICW A;  1YNN C;  1VCI A;  3QJY A;  1V43 A;  4F7X A;  1LV9 A;  3NTH A;  3AU7 A;  1SNC A;  5FO9 B;  1VDZ A;  1E1R A;  3FDT A;  3D6C A;  3Q0A A;  5J39 A;  2JA7 B;  2EJG C;  3TP5 A;  1A3U A;  1GUN A;  3FMC A;  3OIQ A;  5EGT A;  3GVJ A;  1X32 A;  4HMI A;  4ZYS A;  4RWS C;  1WPC A;  2F0M A;  1WTQ A;  5LL6 S;  1YNJ C;  1GUS A;  1JWU D;  4BBR B;  1DOL A;  3GTJ B;  1F9R A;  3LWU A;  2R92 B;  4KY6 A;  2QDB A;  1Y1V B;  1G8Z D;  2ICE C;  1AEX A;  5C0X J;  3FKI B;  3S2H B;  1H9K A;  4BS9 A;  1I4R A;  1UAP A;  1BOS A;  3S1N B;  3O13 A;  4A3J B;  3W3A A;  3VR3 A;  3PV0 A;  5C0X H;  3U9O A;  4FF2 A;  1UD2 A;  4IZ8 A;  3I4N B;  3BYT B;  1PFN A;  3TME A;  4IUR A;  4KTA A;  1BCP F;  1TII D;  4FO2 A;  1VF7 A;  3WQZ A;  2CVR A;  3MXG A;  3CRL C;  3T51 B;  2A6E D;  1PDQ A;  4BY1 B;  1UUP A;  1JE4 A;  2QF7 A;  2K5D A;  1HTP A;  5C0X I;  2W6I A;  2PZU A;  2FHT A;  2F0V A;  3S14 B;  3DXJ C;  4FVM A;  4KI0 A;  4OIJ A;  1D5M C;  4FP5 D;  4AVZ A;  1SYD A;  2JEB I;  1GUT A;  4RH6 A;  4EQN A;  1O7Y A;  3GO5 A;  3VR2 A;  1Y1W B;  5CYU A;  1EY7 A;  2JDI A;  3NWT A;  1TWC B;  1ONL A;  1S4Z A;  1SMY D;  5D3D A;  2NTT A;  4M8A A;  2GA4 B;  5IGE A;  1LAB A;  2EY2 A;  1SNQ A;  1X3P A;  2KVM A;  2EYL A;  2B2Y A;  1CK1 A;  2LY7 A;  2JA5 B;  1JOQ A;  3IL8 A;  4FF4 A;  5BN3 A;  2PW5 A;  4EQO A;  3KBX A;  2NTS A;  1F9P A;  3J7Y W;  2SEB D;  4KJO A;  2K1B A;  5M5W B;  5LHY 1;  1GUW A;  5CV9 A;  4J6H A;  2H4O A;  5CR3 A;  1EYA A;  2EYM A;  2F0P A;  3FEW X;  3RUZ A;  5CV8 A;  2ZZQ A;  5CBE E;  3ZIA A;  4H13 C;  3EA6 A;  3OEH A;  4NNJ A;  1C8C A;  4ME5 A;  2EVB A;  3TP7 A;  1GUO A;  1ILP A;  1AFP A;  2X6W A;  3BDL A;  4KHZ A;  5EPL A;  3KLS A;  2QIL A;  4UAI A;  3G05 A;  1BCP B;  5DN6 A;  1PFM A;  4WJW A;  1ZXT A;  3QO2 A;  3KK7 A;  1EY5 A;  4XXE A;  4S3S A;  1II3 A;  4ID6 A;  2MGS A;  2E2D C;  4G7H C;  3ND8 A;  1EFR A;  1UNS A;  2KUM A;  3HOW B;  4IFD G;  5D65 A;  2XZO A;  3K59 A;  3I72 A;  5JJZ A;  1AN8 A;  1SYB A;  2MHV A;  4A3M B;  4ZRZ A;  4QIW B;  4DAY A;  3C1F A;  1PRT B;  1DON A;  1SFO B;  4BY7 B;  1XYI A;  1TWH B;  3DHQ A;  1EY6 A;  2RA4 A;  3PUW A;  2EY1 A;  2K04 A;  1XTC D;  3D3R A;  2JYO A;  4PQX A;  2X53 S;  1EQV A;  4DAV A;  5C5M A;  2R3Z A;  4K2L A;  4OL7 A;  2V7Q A;  5ISR A;  3TZU A;  2SNS A;  4A3K B;  1BO0 A;  3J80 E;  4L63 B;  5C4X B;  4X3K A;  4DNT B;  2L0C A;  4ULL A;  5ELE A;  4KKT A;  2G9D A;  5CBA E;  4OHJ A;  4V0B A;  1RTN A;  2N88 A;  1SE4 A;  3ERO A;  4FYD A;  2X6L A;  1VF5 C;  3PUX A;  2BA1 A;  3NUC A;  1CHQ D;  4C3J G;  2NN6 I;  2IWH A;  2F0D A;  3C46 A;  1JQY D;  2F4I A;  5I9O A;  3KLR A;  4LJZ C;  4C1N I;  4KV6 A;  1PMR A;  1VMP A;  2GK7 A;  4DAP A;  4WOR A;  4OGQ C;  1ENA A;  3AMU A;  5E4W C;  5KRU A;  2Z4H A;  4NW2 A;  3W2D A;  5IT9 E;  2EYJ A;  1JOK A;  5FOB B;  1CZG A;  1YNJ D;  1EY0 A;  1U4L A;  1GXD C;  2R93 B;  4DN4 M;  5DAU A;  1LTR D;  2A73 B;  1RTO A;  4RGN A;  2AQ1 B;  3RD4 A;  2NYZ D;  1NR2 A;  3HOX B;  2EYF A;  4IN3 A;  1KLU D;  2FIN B;  3K58 A;  3OFN A;  1FR3 A;  2BDO A;  3QOJ A;  4ZUJ A;  1U9R A;  1Z47 A;  1B9N A;  1JOO A;  2NVQ B;  1SYE A;  3BZD B;  1YNN D;  3NP8 A;  1NAP A;  3MWY W;  1RCV D;  2RQX A;  4B3G A;  2CHB D;  3OWE B;  3GQB A;  5KEE A;  1S5B D;  1S5D D;  2RVL A;  3I8Z A;  2L5T A;  4NKL A;  2WSS A;  3BC9 A;  3SK6 A;  2F0S A;  4II2 A;  4G7W A;  3KLS X;  1BUV T;  1COW A;  3P7J A;  2K5W A;  3MFY A;  4UZU A;  3X3M A;  1EEI D;  3NXW A;  2A6E C;  1HUM A;  1GHK A;  3H6M A;  2VNU D;  1PRT C;  4KKU A;  1O80 A;  1IYU A;  1KDC A;  3CU7 A;  2RDH A;  1Z7T A;  2A74 C;  1BR9 A;  3I90 A;  2F0W A;  2XIW A;  1QWY A;  2Z1C A;  3GTG B;  4RA8 A;  4IFD J;  3T56 B;  1Q1E A;  3DEP A;  2WZP P;  1NSN S;  4KN4 C;  1O7Z A;  2F0I A;  1IW7 D;  3PIO 3;  4XL9 A;  1R9T B;  3P75 A;  1Q3L A;  2VUM B;  1PTO B;  3SXH A;  1LT5 D;  2X6G A;  2JJ1 A;  4RGO S;  2O5I C;  1QNK A;  5E3F A;  5HUR A;  2A69 D;  1BMF A;  3NQT A;  3RLF A;  4C3I B;  2NN6 G;  1HZE A;  3N6R A;  3S15 B;  1KNE A;  1FNV A;  3K5L A;  3ITP A;  1ET6 A;  4FXD A;  1KMH A;  5C6A A;  2H1E A;  4OIK A;  2KCN A;  1HQM C;  1BPL A;  5JOB A;  1DD2 A;  2YU9 B;  1EYD A;  1GOZ A;  2WPD A;  4K5W A;  3FRP B;  2PQE A;  4YEL A;  2X69 A;  3BYY B;  4QUC A;  2IX3 A;  5IGD A;  5IGB A;  1BQQ T;  1UEA B;  1TY2 A;  3OIP A;  4X3U A;  1DJR D;  2ZTG A;  3HOY B;  1SND A;  2B2V A;  2QE7 A;  1AW7 A;  1Q8I A;  1IYV A;  1HTL D;  5AFW A;  2RDG A;  1OO9 B;  2F3V A;  4PMB A;  4XR6 A;  1QE6 A;  4IUP A;  1JC7 A;  2F0N A;  5KNB A;  2WB1 B;  2A6H C;  4OO1 G;  1G91 A;  3A8J E;  5EKL A;  2NWG A;  2XWJ B;  4TRD A;  1FD7 D;  4KHV A;  5FK9 C;  3J7A V;  4E6I A;  3MVV A;  3OOC A;  5A2Q L;  2MP1 A;  2ZXO A;  3J81 L;  1F77 A;  2KQ3 A;  1KAB A;  3A3G A;  5COY A;  2GJK A;  3RZO B;  1CQF A;  2SNM A;  1MI2 A;  2RSN A;  1GHJ A;  2ZXR A;  3NTK A;  2NBF A;  1AZQ A;  1CA6 A;  1D1K A;  5I2Y A;  1MD2 D;  3MA2 B;  4K8J A;  3ZPN A;  5BN4 A;  1HHV A;  3VR4 A;  1TR5 A;  3CES A;  1SAP A;  2HDL A;  2IX0 A;  1SXT A;  4C56 C;  1Q1B A;  4G7X A;  1PTO H;  5LL6 X;  2JJ2 A;  1HQR D;  3EFX D;  3C3L A;  1VJS A;  4J1M A;  1B44 D;  4YIJ A;  1V1P B;  1TQO A;  1TKW B;  1EY8 A;  1FYC A;  3P20 A;  5ELB A;  3Q23 A;  3H3V C;  3N52 A;  5DEH A;  3MXN A;  1STN A;  4XTC S;  5COR A;  4CGY B;  2M2L A;  5DNF A;  4HTH A;  4B9X A;  1ESR A;  3LX0 A;  4C3H G;  2C9O A;  2NB0 A;  3MXP A;  2KCC A;  4XOT A;  2C5C A;  2XVS A;  4RCN A;  3GVL A;  2EJF C;  4J8Q A;  4ZLT F;  1OXU A;  1ESF A;  3I70 A;  3SK8 A;  3FKS A;  5DM7 3;  4HR7 B;  1ILQ A;  1AP0 A;  1O78 A;  4IUT A;  5T1G A;  4DXG A;  1H8H A;  4JMQ A;  2D5D A;  3CHB D;  4RKL A;  1LT4 D;  2Z8L A;  3GTK B;  2D3N A;  2BDN A;  2EYH A;  2X6Y A;  2O2L D;  3K57 A;  2EPB A;  3SHL A;  4BWG B;  3TBI B;  2YYZ A;  4K6L A;  3V96 A;  1KLG D;  3BVZ A;  2XOK A;  1OXT A;  4PMC A;  2F1M A;  1ENF A;  4ZKC B;  1F2L A;  2F03 A;  1LO5 D;  4HIZ A;  3OWF A;  3A55 A;  1OXX K;  5FO8 B;  4KKS A;  2Q8I B;  4BA1 I;  3R2I A;  5M9O A;  1H9S B;  4U67 3;  1SYG A;  3S1Q B;  2IPK D;  4KK7 A;  2LKV A;  1U4M A;  4IUN A;  3V05 A;  3E0J A;  3PO3 B;  2K32 A;  1CT1 D;  4H44 C;  4A3B B;  3QG1 A;  2KJX A;  1I50 B;  1V1P A;  4XOP A;  4F8M A;  1SJH D;  3MFG A;  1LTA D;  1EFI D;  1H9J A;  1I8D A;  1J9O A;  2VJI A;  2NVY B;  4B9W A;  2HLD A;  3DM1 A;  3C2P A;  3GVK A;  3A54 A;  5JPN C;  5EPJ A;  5KND A;  1WTV A;  4IUV A;  1EU3 A;  4ASU A;  2JSO A;  2OEO A;  3BVG A;  1QG7 A;  3KEW A;  4PNY A;  3CP8 A;  1IHZ A;  2ZTN A;  2NVT B;  2M5S A;  2DNE A;  2FMM A;  2KOL A;  1HA6 A;  4MIU A;  2CW0 C;  1F9Q A;  3I3C A;  4ABN A;  1SE2 A;  3I4L A;  1BNZ A;  3CRK C;  1PTO F;  1JWM D;  2JA8 B;  3L3O C;  2D2C C;  2JE6 I;  1L0X B;  1HCZ A;  2E2I B;  2WJV A;  2LS0 1;  4XQQ A;  4HN7 A;  4HCS A;  1QJO A;  2K01 A;  2CW0 D;  3HP3 A;  1T5X D;  2V31 A;  3LNN A;  1O7L A;  1RD9 D;  2QKI C;  3NBI A;  1LLR D;  2F0F A;  2NZ1 D;  4RGT A;  3HOZ B;  3D4R A;  4RKB A;  3QIA A;  5M5Y B;  4R9W A;  3ND9 A;  4ZQ3 A;  3K5O A;  3NTI A;  2AWO A;  1PZK D;  2X8K A;  1SNP A;  3GD7 A;  1BCP D;  1TU2 B;  2I07 B;  2KA7 A;  2A69 C;  3WOE A;  1QNU A;  1W6K A;  5KIX A;  3Q22 A;  1QB5 D;  4GQN A;  3GTM B;  1Y8N B;  3FPP A;  3VYU A;  4Q5V A;  3DMU A;  2W6J A;  4IUU A;  2B2Y C;  3A7A B;  1DZ1 A;  2E76 C;  1EWH A;  4CJ0 B;  2PW7 A;  1JWS D;  3PIP 3;  2E1B A;  5EPK A;  1EZ6 A;  4XYO A;  1MAB A;  1I4P A;  1XX8 A;  1SSO A;  2M9V A;  4MN3 A;  5IGF A;  1SYF A;  1DXM A;  1UD4 A;  3OMC A;  4IAL A;  1RF2 D;  1A2U A;  2V4D A;  2K6A A;  1EU4 A;  2F0J A;  3Q24 A;  4M1U B;  1NBM A;  1HVX A;  4XLA A;  3IAY A;  5C3X A;  3CMM A;  2TSS A;  3G6J B;  2CQA A;  3S2D B;  4O1N A;  3HG9 A;  2DY8 A;  2A6H D;  4TKO B;  4N9P A;  3BVM A;  5EKI A;  2N55 A;  4OO1 I;  2B8F A;  4FNF A;  2GJP A;  2EOT A;  2Z4I A;  1K8O A;  2EYO A;  1STG A;  2F0K A;  1PTO C;  3OEE A;  3T16 A;  4FXU A;  1CTM A;  1Y69 U;  3J81 E;  2R6G A;  3GTQ B;  3M4O B;  4JK1 C;  1STH A;  2JEA I;  1LTI D;  3CKI B;  2MJ8 A;  2AQ2 B;  5C3E B;  3NE5 B;  3MHB A;  4TSF A;  4Y7N B;  3EVQ A;  2B2T C;  1EYC A;  2F0O A;  2VB2 X;  4K5V A;  5IK2 A;  2L12 A;  4KN7 C;  1CM9 A;  1FNW A;  2B2V C;  2K7V A;  3TZD A;  4U68 A;  2OF1 A;  2IJ0 A;  1HXY D;  5ELC A;  3URY A;  4DA2 A;  1SNO A;  3I73 A;  3SK5 A;  5I9P A;  3HOV B;  2GJR A;  1ET9 A;  1OXV A;  3NSW A;  1EIG A;  2DIE A;  2JP1 A;  2ZZG A;  2ZZE A;  2XRQ D;  3RZD B;  1KAA A;  3WDN A;  1D1I A;  2MUY A;  4QF4 A;  4DK0 A;  3K0Y A;  2L55 A;  3A35 A;  1JIC A;  3A3B A;  1STB A;  3PO2 B;  1LT6 D;  1K8M A;  4X3S A;  4DK1 A;  1H9S A;  1XXG A;  3KF8 A;  1EWC A;  2X85 A;  3EQL C;  5G3L D;  1R4P B;  3IKJ A;  1PLF A;  4XMY A;  1HFG A;  1R4Q B;  2PO4 A;  1B1Z A;  3H0G B;  1H9M A;  5KGU A;  1S5E D;  2AWN A;  3HEJ A;  3SVM A;  2L9H A;  4CHT B;  1TY0 A;  4UDU C;  3M3Y B;  2I46 A;  1IKM A;  1WD0 A;  3ONA B;  1TS5 A;  5JPM C;  4HCE A;  4R8I A;  1D5Z C;  4K6D A;  3OE7 A;  2G9H D;  4BA2 I;  2BE5 D;  1MSH A;  3OW7 A;  2B63 B;  3MAQ A;  4G57 A;  2Q8R E;  2E2H B;  1ZYR C;  4JBW A;  2B2W A;  3R8B A;  3R2T A;  4HSV A;  1WTR A;  4XQF A;  4GZY C;  1E2Z A;  5IOD A;  2HDM A;  2F0E A;  3R93 A;  5CMD A;  2PZT A;  3K5N A;  5BN5 A;  3BS1 A;  5KYL A;  3PMF A;  1HRJ A;  1RHP A;  1HPC A;  1RDP D;  1S5C D;  3DWP A;  1MSG A;  1MBY A;  2XN9 C;  2VXW A;  1Q12 A;  1H8E A;  2DNC A;  2Y0S B;  3VA5 A;  1E2V A;  3QWN A;  3DEO A;  3D4D A;  1KDB A;  1UD6 A;  2EE1 A;  1S5F D;  3L9A X;  5ELD A;  1GUG A;  5FLX E;  3H91 A;  2ZT9 C;  2R61 A;  2M00 A;  1AZP A;  4XNF A;  1E3X A;  3VR5 A;  3NHH A;  2HCC A;  4X3T A;  4KJN A;  4QCL A;  4ODG A;  2K33 A;  4DNR B;  4IFD H;  2WKC A;  2PNR C;  1CQV A;  1K83 B;  3JAM E;  4TT3 A;  1U4P A;  1BXT A;  2BE5 C;  2SDF A;  1EY4 A;  1I4Q A;  3D8G A;  1SDF A;  5IIF A;  4P22 A;  3S16 B;  3OHX C;  5HGT A;  1E2W A;  2EZV A;  4AYB B;  4ILW A;  4R8N A;  3HRZ C;  1ZYR D;  2IL8 A;  4RHR A;  3MZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...