3NECA

Crystal structure of toxoplasma gondii profilin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inflammatory profilin
publication title Structure-based analysis of Toxoplasma gondii profilin: a parasite-specific motif is required for recognition by Toll-like receptor 11.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Actin-binding protein
total genus 46
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3necA00
1PFLA 4X1MA 4ESPA 3T1SA 3D9YA 2VK3A 1YPRA 3T1XA 1SKOA 2PRFA 2JKGA 3DAVA 5EVEA 2B95A 1FILA 1CQAA 1K0KA 3CHWP 1VEUB 1Y4OA 3L9KA 4FTXA 4QWOA 3T1QB 1D1JA 2HZ5A 3CPTA 5FEFA 1PRQA 2PAVP 5EV0A 3UB5P 3L7HA 2ZL1A 3NECA 1Z09A 4X25A 1CF0A 2JKFA 5FEGA 3U4LP 2V8FA 3KYEA 1HLUP 1CJFA 1SKOB 2V8CA 2ACGA 1VETA 3MS6A 3LGOA 2BTFP 2ZL1B 1PNEA 3T12B 3T1RA 1G5UA 4D60A 3CPTB 3MSHA 1VETB 3NULA 1J3WA 2PBDP 1AWIA 3LEQA 5FDSA 1A0KA 4FUWA 1F2KA 4X1LA 5EM1A 1ACFA 1SZVA 1VEUA 1FIKA 2E8JA 5EM0A
chains in the Genus database with same CATH superfamily
2IA2A 3T4JA 2L1MA 1SDNA 5TBMA 3UNWA 2OLVA 3IX3A 2DMWA 2W1TB 5F83A 1NLYA 1FCNA 1JNUA 4PM6A 1G6AA 1G68A 2VV6A 2PT7A 1FQGA 4A5RA 3N4IA 1YMSA 4S2OA 4X56A 5AVFA 4L9EA 1MWUA 5EV0A 1OJ5A 3FZCA 2V1AA 4BLMA 4WELA 4L9GA 1YLTA 3PR6A 4UA9A 3ZFZA 3M2KA 2HJEA 5F5YA 3A3EA 2HP5A 5HSQA 2Z2MB 3VMAA 3Q1FA 3QP2A 2WZXA 1WYBA 1MKIA 3ITAA 1SKOB 4DDYA 1VETA 2XGNA 3LGOA 5FASA 3RJUA 3MFXA 2JBFA 3PBNA 1H5XA 1GHPA 4LV0A 3JVUA 1TS8A 1DJAA 2WK0A 2XA7S 1PWGA 2Z6DA 5K5BA 3N8SA 3KX0X 2XFTA 2VX8A 2XSSA 4Y15A 2OOLA 5HWVA 3CITA 4Y17A 4OONA 4EEPA 4HHDA 2BASA 1NWZA 2ZJ9A 4WUJA 2QKPA 2ZMVA 2Y2PA 1S1YA 4KZAA 3VFHA 4KG5A 4X1MA 5CGXA 1OTIA 1FSWA 1YAXA 2PU4A 1IKGA 1FOFA 2P9VB 2ZBBA 1ONGA 3MZDA 4GDNA 3UB9A 4N1HA 3GQZA 4RVAA 4OKPA 4HP9A 4ETXA 3MXQA 1YLWA 4ZJ3A 3MQ0A 3G2YA 2JKTM 4N92A 2A2LA 3CPTA 3NBLA 3SH8A 4PPRA 1PRQA 2I72A 2HGVA 4GNUA 3EGDC 4EWFA 1K25A 3UMEA 3LFVA 4GLQA 2RCXA 4I3AA 5FQ9A 2W3GA 3E2KA 3LY4A 4CLCD 2WUQA 2LB9A 1XX2A 3H82B 4LPZA 4S2KA 3VOYA 1JVJA 5F69A 1HLUP 3ZCZA 1CJFA 4PKYG 2PYRA 3P01A 4S2NC 3LUQA 1K6RA 2OAQ1 2WAEA 1P97A 2EX6A 1IYOA 3MZFA 1FCMA 3HUMA 3K3DA 5FI2A 3OPLA 5DVAA 2HF6A 4EBLA 3LR5A 1FSYA 1UGUA 4YFMA 2K2NA 4B93A 4OOLA 1Y54A 3UE3A 2PU2A 4P6ZS 1BZAA 3O3VA 4R3BA 3NI9A 5D3OA 3BFFA 2E8IA 4X69A 4NEED 3ZHHA 1PFLA 1BYWA 4OPQA 4R23A 4PKYA 5LBRA 4F3LB 4PM7A 3MFDA 3JVVA 2B95A 3C5AA 2H5SA 5IT5A 1XA7A 4KQDA 5CXWA 2HV1A 3N8RA 3CMZA 3BFCA 5EPHA 2XROA 1K56D 5L09A 4JF6A 3OC2A 2PBYA 2ZC7A 2O9AA 3N6IA 4I3IA 5F82A 4MN5A 5F1GA 4DE1A 3PHYA 3F1OA 2HPBA 4H6JA 1PZOA 3BFEA 4IUKA 2JKFA 2ZLYA 1EWZA 1CEGA 3G6OA 3RXWA 3ZVTA 3NCKA 1PW1A 2XRNA 3DTKA 2JKRI 1PI5A 3UB6A 4JGRA 5E43A 2W1TA 3HUNA 4CJNA 4FSFA 4QD4A 5BOHA 5E2GA 2XDMA 1IYPA 3CZDA 2VEAA 1I2SA 4XT2B 2XK1A 4LCLA 1NYMA 4BD1A 1ZC2A 3WS5A 1Q2QA 4JBFA 4KZ5A 1T1BA 3VSLA 5TR7A 1NY0A 1XA1A 3LEQA 4LENA 3OLOA 5EM1A 4C75A 1ACFA 3BFDA 4ZTKA 4GCZA 2M7VA 3IX8A 1GHMA 3OPHA 4PHTA 4R38A 4EBNA 1SKOA 5J7EA 4WF0A 3FG8A 1HD8A 2J8YA 2KLIA 2ZC6B 4IBRA 4EUZA 2ZQ9A 1S4RA 3JPUA 4RX3A 2X71A 2H28A 4U0TA 5E2EA 1MC0A 4Z9QA 3UPPA 2GNXA 1KE3A 2JHEA 4EBPA 1XFQA 4KZ4A 3VP1A 3MBZA 2R9XA 2H10A 2W27A 1L0GA 4L9FA 2Y2QA 5EFWA 4HY8A 5CX7A 1L0DA 1MY8A 3PBSA 1K54C 4G3WA 3CJMA 1ZTUA 2O99A 3E4PA 4R70A 2HDSA 1W79A 1BLCA 5FEGA 2XR0A 1OTEA 1UWNX 2PYPA 4JGQA 2J80A 5EOEA 2C5WB 3GDIA 5HX9A 2P9VA 4UQIM 1XXMA 3PXPA 1BLHA 4MEZA 3C8CA 1YT4A 5FQIA 4Q0HA 4DKIA 4KQQA 3D3OA 2ZD8A 2ZC3B 1WA9A 1MPLA 2EFUA 3ZQ5A 1ZG6A 5F6AA 2O9CA 1IYQA 4OP8A 2Q9MA 3H82A 2I9VA 1PW8A 5KSHA 1K55C 2WKHA 3NOTC 4OLDA 2JC7A 4Y0TA 4NKPA 2PRFA 3DAVA 4Y3IA 4KQRA 1BUEA 3UE0A 1U60A 1JWPA 4BBUA 5CECA 5TJJA 3QP6A 5AQ7A 4R4RA 3LO7A 1JTDA 1KE0A 1NRJA 3WS4A 1DRMA 3IF6C 3SS4A 3HJKA 5FEFA 1VM1A 4S2LA 2PAVP 5I94A 3CWFA 4LGWA 4JXSA 3FKWA 3GR2A 1W8YA 5EOOA 1H8MA 3LR3A 1DJBA 5TFQA 1Z09A 2H0YA 2Z6CA 5EVIB 3HLGA 5CGWA 1Z6FA 2QMIA 5FATA 4OVDA 1T1CA 4XUXA 3ZDJA 3CAXA 4C3QA 2EA9A 1IFQA 3VP4A 4NETA 1OTAA 2IWCA 3UMDA 4KZ9A 1OMEA 2ACGA 1JTGA 4F3LA 2J3TC 3W4PA 3LR4A 4DMZA 4GJ4A 4OPZA 2BLSA 3IXHA 3UO9A 4EUVA 3MXSA 1YLYA 5DF8A 4FH2A 2ZQAA 1ES2A 3HREA 4FH4A 4MLLA 5FAOA 4OH0A 2GDNA 1AWIA 3CG5A 1A0KA 3G30A 5CHMA 3UPOA 1D7EA 2O0YA 4WL9A 5FQKA 1FIKA 4MDZA 4OQ0A 5GLBA 5GL9A 1C3BA 4KZ7A 3O86A 1FR1A 2FFFB 4MBHA 1RCJA 3QP5A 5FAQA 3EQUA 1GSVA 4LV1A 4DJ3A 3MXRA 4ARZB 1O07A 4HBTA 2UWXA 4FTXA 3LI9A 4RQ9A 1D1JA 3UN7A 1K4EA 5JYOA 4HH2A 1CK3A 1XFNA 5HPIA 1G28A 5EUAA 4EETB 4CLCB 4JKTA 4JF5A 3TJZC 2W1RA 2ZL1A 1F9IA 3NHQA 4X25A 3PBRA 2WGIA 5AQ9A 5IU1A 5DKKA 4IJGA 1E25A 1OTDA 2B02A 3LCEA 5A93A 1LSXA 2Y2OA 3A0SA 3JYIA 1ESUA 4MCWA 4UHUA 3V67A 1TDLA 4UQIS 3KSGA 4WMCA 4GOGA 1TS0A 2Q9NA 1V9ZA 1N9BA 5EVID 1TVFA 2Y2MA 1J3WA 4EESA 4S2MA 1W8QA 3W4QA 1F2KA 4MBKA 3W2ZA 4IHQA 1VEUA 3O5YA 3HJIA 1MKMA 1V9YA 1OTBA 4GD6A 4LFUA 3C30A 3F1NB 2WKIA 2ZQCA 5DTKA 3UDFA 3VSKA 2Y55A 3VP0A 4HI4A 2XD1A 2WAFA 4GS9B 1ALQA 5CEDA 2RL3A 3O88A 2OAP1 3DWZA 1S67L 4ID4A 4IBXA 1Q2PA 4KZ6A 1E3UD 4E3KA 4K91A 3A0VA 4DJ2A 3L7HA 1F98A 3UE6A 5L2FA 3S7PA 4HP4A 2Y2HA 1VHMA 3IXBA 4HIAA 2ZOHA 2XFSA 3B33A 1LSVA 4RA7A 3V3RA 3IH8A 3IQAA 1H8ZA 1QMEA 1DJCA 3ISGA 3VE4A 1ES3A 4GHIA 2WZZA 4PM8A 1OT9A 2W3HA 4Q0IA 3T12B 5KZHA 3C2WA 1BTLA 3RH8B 1P0ZA 3IXGA 3VP2A 3ZNYA 4WEJA 3GRJA 3GMWA 1RGYA 5FQJA 4YWZA 1XKZA 3BYDA 4D60A 3G31A 2Q0OA 2ZOIA 3TSGA 2WKEA 2OV5A 2JN7A 4FUWA 1XP4A 2CMNA 4PM9A 5IS1A 1OJGA 4XXRA 3P98A 3T1SA 3FV7A 4KQOA 3FKVA 2OSUA 5HDSA 3ICYA 5G4ZA 3UDXA 3A3JA 1K0KA 3WRTA 3A3DA 3G34A 3IXDA 1ES5A 5A8BA 3GVBA 1S66L 4QY5A 4BMWA 3GTCA 4KZBA 2AVXA 1EROA 3VFFA 5A90A 3W4OA 1T18A 3BW6A 2XLNA 4ZJ2A 1XGJA 1TS7A 5FQMA 4BD0A 1KGEA 3S7OA 1MBLA 4EU0A 3B3XA 3G4PA 3KYQA 1D06A 3FPWA 2Y2JA 4LV2A 4Y0UA 4B88A 4R1GA 1CI9A 2YKHA 1LLBA 2NUPC 2VA0A 3S1YA 4O8GA 5EECA 1KGFA 2PR5A 1ERMA 3BLSA 5HWTA 4X53A 1Y28A 3E2LA 3H7WB 1YQSA 5TGFA 3V39A 1O7EA 3TOIA 4OQIA 3T1RA 3PAEA 3NJAA 2A24A 4JGPA 3IBJA 4FCFA 1ZKJA 1OPXA 2WKRA 5J8XA 4KZ3A 1J9MA 2P74A 5E2FA 1L0FA 2PD7A 1BLPA 4CLCA 5FDSA 1IOUA 3BFGA 1GSWA 2QJ7A 4WEKA 1AXBA 1S6RA 2Y2LA 4MBFA 3LICA 2VGKA 1TF1A 4EEUA 4BBVA 2Y59A 5G4YA 4BENA 1KE4A 4JXWA 3LIFA 3VE3A 3D9YA 4YOFA 1TS6A 3RFBA 4HH3A 2JKTI 5E2HA 4IEDA 4BBTA 4DRTA 4K0WA 1K4FA 1YM1A 4CQHA 3IS2B 3LR0A 1W63Q 3M2JA 3GSGA 2QPNA 4HJ4A 5HL6A 1LL8A 3UB8A 3MQOA 5CTNA 2GZAA 4BJPA 4P87A 1RP5A 3HLDA 3BJNA 3EQVA 4PMAA 3E0YA 3E98A 2UV0E 1SCWA 4GD8A 1FCOA 4S2IA 4WM9A 1PWCA 5EVLA 2G7UA 5GLDA 5GHYA 3MKEA 3P09A 4E6WA 4Y7PA 1DP9A 3ZVWA 1HZOA 4WZ5A 3M6BA 1FR6A 1K56A 1KOUA 2EFXA 4NK3A 4MMNA 5HD5A 4RX2A 1LSWA 2W3EA 1L3LA 2VV7A 4KG6A 3Q07A 4P0MA 4R0QA 4QJGA 3IWQA 4R3JA 1VETB 5A91A 2Y79A 5M19A 1L2SA 2KX6A 4HEFA 1NJ4A 1T1AA 1ZHHB 5HAIA 1SZVA 5F1FA 3VOZA 3H9WA 3M6HA 2VKSA 3E4QA 2GX5A 2VK3A 2ZMAA 5CERA 5HW3A 3HBRA 3LIEA 3EGXC 4WZ5C 2GJ3A 3NDEA 3N8LA 1KDWA 2W3DA 2Y2NA 1NZUA 4QY6A 3BY9A 4DXCA 5HAPA 4O7DA 4ZBEA 1DP6A 4YINA 1LI9A 2HZ5A 4X68A 4EW7A 2ZQDA 3UY6A 4E3LA 3C38A 4R6LA 3N7WA 3NECA 2XA7M 3G32A 3OOVA 4MN7A 3HLBA 1MWRA 4U0XA 4JGOA 3U4LP 3DW0A 5AVEA 3LIAA 3UPNA 3W8KA 4E3OA 3KYEA 1E4DA 3HLCA 5EE8A 3HLFA 3D4FA 1IKIA 3BQ8A 2P7JA 4GW9A 1EW0A 4LRYC 3SH7A 5CGSA 2G2UA 2Y2IA 4I3JA 1G5UA 3ZGAB 4S2PA 1IEMA 4EQIA 3E4OA 3VP3A 2HDQA 3VV4A 4UA7A 3HVFA 4NXFA 4HNBA 5GLAA 3MSHA 2WGWB 3IX4A 4R3AA 1YKDA 4B9OA 2A49A 1K57A 3OBFA 1BSGA 3G35A 4OQGA 3QP8A 2Y8HA 2O9BA 4O0PA 5I5LA 4KENB 3IWOA 4G3KA 1RGZA 3TW8A 4IUHA 2VV8A 3BECA 4R4SA 3T1XA 4KG2A 2JKGA 2EWVA 4B4XA 4Y0OA 2L4RA 3CLOA 3UE1A 3TE8A 4FOFA 5FQQA 5GHXA 5FA7A 2K31A 4M4XA 3IF5A 2QHKA 1GA0A 3T50A 4XUZA 2OLUA 4QWOA 2D01A 4M3KA 5HDCA 3BM6A 2ZM8A 5HARA 1P9RA 2FZ0A 4E3JA 4OP5A 4ZDXA 1K57C 4HJ6A 2INWA 1XJ4A 5JYPA 4F94A 4LV3A 4MN6A 5F68A 3UDIA 4KUOA 5GLCA 4E04A 4QU3A 3V3SA 4P6BA 3DWKA 4GN2A 4XT2A 4CPKA 4P6ZM 4X55A 4MNRA 2P08A 3V50A 4PAUA 3F1OB 4H6JB 4KUKA 5L07A 1I2WA 3QP1A 1STZA 4EERA 3S4XA 5M1AA 1OT6A 5FL3A 1M40A 3T4TA 3IHAA 4JXGA 1HVBA 1XJ2A 2MJ6A 2QYBA 1TEMA 3HCYA 5J4EA 5DJTA 1P9WA 3KSIA 2J7VA 3MJQA 1BT5A 2V20A 4EV4A 1XJ3A 2PD8A 3PBOA 3K2NA 3WS2A 1PIOA 5M18A 2P04A 3MZEA 4KZ8A 3BWLA 3EOIA 3T4KA 4YNRA 3C7UA 3ULFA 2K7SA 1IELA 4BQMA 5CRFA 2C6WB 4OLGA 2EX8A 2VGLM 3DBAA 1KVMA 3NOUC 2Y91A 4DXBA 1YLZA 4Y13A 3D72A 5HDDA 1YLJA 4HOIA 2EWWA 2ZC5B 3C4PA 2EX9A 2IWDA 5KMWA 1KGGA 1GCEA 4K0XA 2OWHA 5HAQA 1XJ6A 4BL3A 3IBRA 4LRZE 3ZNTA 1NYYA 1BULA 4I5SA 4N9LA 3IT9A 1PZPA 5FI6A 2WADA 1TD5A 4OQHA 2PHYA 4C6YA 2BTFP 4NXEA 3Q7VB 3Q81A 5MC7A 1KVLA 1N9OA 2JKRM 3WS0A 3WRZA 4CLCE 3PTEA 1KDSA 4Q0JA 4ME4A 4L0LA 3VOLA 2EXAA 1LI0A 5HFOA 3U2AA 3IHBA 3V5MA 4AFIA 4S2NA 2YKFA 4NXBA 1W63M 1ODVA 4X1LA 1BLSA 4ZJ1A 4O01A 2H0TA 2Y4AA 4BL2A 3PBTA 1ONHA 3IF6B 2Y2GA 1YPRA 1LL5A 3MMHA 4IVIA 4GB7A 4UAAA 3F1PB 5DTSA 1ZG4A 4EQ1A 4H8RA 1VB6A 5A92A 1T19A 2R9WA 4DDSA 1NZOA 4QPRA 2B5RA 5DKLA 2ZM2A 5EVIA 1H3QA 1MWTA 4JPMA 3T1QB 2DCFA 2KDKA 1W7FA 1HTZA 3PYPA 5HL1A 4WYYA 5DTTA 2WGWA 2R78A 2XEPA 2W3FA 5HZHA 1XGIA 3T4OA 2JCHA 4Y5FA 2V2FF 3BRMA 4HBUA 4GDBA 2L0WA 3HUOA 1N4OA 4E3IA 1GA9A 4I38A 3SH9A 3EEHA 4K08A 2XQZA 4JLFA 2HDUA 3ZG8B 3R4KA 3LIBA 3DTEA 3A3FA 2Y2KA 3FPVA 2EXBA 3WS1A 1H8YA 3Q82A 2HJ9C 2WYXA 5EVIC 3QP4A 1E3UA 3R7WB 4QHCA 4GKUA 3RXXA 3ZG7B 4NG2A 3RTYA 2PBDP 3Q7ZA 2D02A 2VZWA 2CC1A 5FSRA 3T4QA 4G3VA 3GV9A 3ZG5A 2JE5A 3GECA 5L8MA 4ARZA 1UWPX 3A0RA 1DP8A 1WE4A 1N9LA 3CI6A 4U3TA 5EVEA 2BG1A 3KSFA 2V1BA 4JXVA 2HDRA 1ESIA 2FH5A 4JF4A 1Y4OA 5G18A 3OCNA 3S7QA 1S4SA 3LY3A 4UEYA 2QJ5A 4GZBA 2XF3A 5J3WA 3ZYTA 5CHUA 2G2WA 3B47A 2FFYA 1F5MA 2IWBA 5IHVA 2VGLS 4S2JA 3UB5P 2KOIA 3CUEA 3BEBA 5FI7A 4PM5A 5CTMA 1CI8A 3NC8A 3O87A 5TBMB 5KSCA 3BLMA 4II7A 3QNCA 1ES4A 2WKPA 3MS6A 4CLCC 2QZ6A 3KSHA 2ZL1B 1K54A 3IH9A 4I39A 1PI4A 3FYZA 1H0MA 1EI5A 1SDEA 3NOPC 3PBQA 4Z1WA 2J3TD 3PAGA 5DF9A 3K3CA 1NXYA 4Q8IA 5DF7A 3FC7A 4DE2A 2J9PA 3F1NA 1GHIA 3CUEC 5CEBA 1LT0A 2W0NA 3MQQA 4X6TA 1K6SA 1NRFA 4GS9A 5AQBA 1N9NA 3A3IA 3B42A 5U47A 3MF0A 4HESA 1JWVA 3EEAA 3TG9A 2PR6A 3NY4A 1IYSA 4RYEA 1FILA 1CQAA 3CHWP 3Q7VA 4BWIA 3SW1A 2ZQ7A 1W5DA 1VEUB 3SS3A 3WWXA 4QB8A 1GSXA 3I7JA 3DTMA 1K55A 4DE0A 2EX2A 1MZUA 3KYZA 3LIDA 2WGVA 1X0OA 3AGEA 2B18A 2V0WA 3SOIA 4WBGA 4FD8A 3AGDA 4ZAMA 5KIZA 1CF0A 4P85A 4WLAA 2XD5A 1I5QA 3QHYA 2QWSA 1G6OA 1TDGA 2XH9A 3EWKA 3IWIA 3IF6A 2HP9A 2V8CA 3F1PA 2HP6A 1PNEA 2M1CA 1LHYA 4OPRA 1CEFA 4B4ZA 2LB5A 3C7VA 4EXOA 5HPFA 5L10A 5DFXA 2M7UA 1NLZA 3SS5A 5CHJA 4LRXC 2X01A 5AQAA 3CPTB 2ZC4B 3NULA 1S0WA 2VLGA 5HD3A 1YLPA 4GHIB 4N1XA 4NXGA 2V9AA 4DE3A 2E8JA 3S7NA 2ZQ8A 4LCMA 2ZMFA 3OZHA 3SZTA 4ESPA 2VJWA 4E6XA 3S22A 5DJUA 1XPBA 5GHZA 4E3MA 4E3NA 1K38A 1MWSA 1YSQA 3LYXA 4D2OA 4Y2FA 1JWZA 3HLWA 4OOMA 3L9KA 3UB7A 2A3UA 3R7WA 3BY8A 1S1ZA 5FDHA 5HWWA 4WMCD 3LI8A 3HLEA 1SHVA 4WZ4A 3H7WA 1SKFA 5C5KA 1M6KA 1QMFA 3OCLA 4DF6A 3TRCA 2OWJA 3HL9A 4DN0A 3OPPA 4IVKA 3ITBA 2VGJA 5FAPA 2J3WA 2V8FA 1LL9A 4ETZA 1MXOA 2V1ZA 4HQAA 1WYCA 1PYYA 2DNSA 2WKQA 2NUTC 4OPYA 3LEZA 3BQAA 2PDRA 2Z2LB 4HJ3A 3T4LA 1YSPA 3KO6A 4WN5A 3NDGA 3NIAA 3MKFA 3FWLA 3C4OA 1L0EA 1DY6A 2DRWA 3ZG0A 2V0UA 3QNBA 5AJGA 3OPRA 4OOYA 3MR0A 4N9KA 3P7NA 5DFYA 4UA6A 3AGFA 4ZRRA 4LLOB 2X02A 1VQQA 3G2ZA 1ERQA 1PWDA 3T4SA 2ZM0A 3DTIA 1YMXA 2A24B 3ZG9B 3IS2A 5EM0A 2J9OA
chains in the Genus database with same CATH topology
1PFLA 4X1MA 4ESPA 3T1SA 3D9YA 2VK3A 1YPRA 3T1XA 1SKOA 2PRFA 2JKGA 3DAVA 5EVEA 2B95A 1FILA 1CQAA 1K0KA 3CHWP 1VEUB 1Y4OA 3L9KA 4FTXA 4QWOA 3T1QB 1D1JA 2HZ5A 3CPTA 5FEFA 1PRQA 2PAVP 5EV0A 3UB5P 3L7HA 2ZL1A 3NECA 1Z09A 4X25A 1CF0A 2JKFA 5FEGA 3U4LP 2V8FA 3KYEA 1HLUP 1CJFA 1SKOB 2V8CA 2ACGA 1VETA 3MS6A 3LGOA 2BTFP 2ZL1B 1PNEA 3T12B 3T1RA 1G5UA 4D60A 3CPTB 3MSHA 1VETB 3NULA 1J3WA 2PBDP 1AWIA 3LEQA 5FDSA 1A0KA 4FUWA 1F2KA 4X1LA 5EM1A 1ACFA 1SZVA 1VEUA 1FIKA 2E8JA 5EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFL A;  4X1M A;  4ESP A;  3T1S A;  3D9Y A;  2VK3 A;  1YPR A;  3T1X A;  1SKO A;  2PRF A;  2JKG A;  3DAV A;  5EVE A;  2B95 A;  1FIL A;  1CQA A;  1K0K A;  3CHW P;  1VEU B;  1Y4O A;  3L9K A;  4FTX A;  4QWO A;  3T1Q B;  1D1J A;  2HZ5 A;  3CPT A;  5FEF A;  1PRQ A;  2PAV P;  5EV0 A;  3UB5 P;  3L7H A;  2ZL1 A;  3NEC A;  1Z09 A;  4X25 A;  1CF0 A;  2JKF A;  5FEG A;  3U4L P;  2V8F A;  3KYE A;  1HLU P;  1CJF A;  1SKO B;  2V8C A;  2ACG A;  1VET A;  3MS6 A;  3LGO A;  2BTF P;  2ZL1 B;  1PNE A;  3T12 B;  3T1R A;  1G5U A;  4D60 A;  3CPT B;  3MSH A;  1VET B;  3NUL A;  1J3W A;  2PBD P;  1AWI A;  3LEQ A;  5FDS A;  1A0K A;  4FUW A;  1F2K A;  4X1L A;  5EM1 A;  1ACF A;  1SZV A;  1VEU A;  1FIK A;  2E8J A;  5EM0 A; 
#chains in the Genus database with same CATH topology
 2IA2 A;  3T4J A;  2L1M A;  1SDN A;  5TBM A;  3UNW A;  2OLV A;  3IX3 A;  2DMW A;  2W1T B;  5F83 A;  1NLY A;  1FCN A;  1JNU A;  4PM6 A;  1G6A A;  1G68 A;  2VV6 A;  2PT7 A;  1FQG A;  4A5R A;  3N4I A;  1YMS A;  4S2O A;  4X56 A;  5AVF A;  4L9E A;  1MWU A;  5EV0 A;  1OJ5 A;  3FZC A;  2V1A A;  4BLM A;  4WEL A;  4L9G A;  1YLT A;  3PR6 A;  4UA9 A;  3ZFZ A;  3M2K A;  2HJE A;  5F5Y A;  3A3E A;  2HP5 A;  5HSQ A;  2Z2M B;  3VMA A;  3Q1F A;  3QP2 A;  2WZX A;  1WYB A;  1MKI A;  3ITA A;  1SKO B;  4DDY A;  1VET A;  2XGN A;  3LGO A;  5FAS A;  3RJU A;  3MFX A;  2JBF A;  3PBN A;  1H5X A;  1GHP A;  4LV0 A;  3JVU A;  1TS8 A;  1DJA A;  2WK0 A;  2XA7 S;  1PWG A;  2Z6D A;  5K5B A;  3N8S A;  3KX0 X;  2XFT A;  2VX8 A;  2XSS A;  4Y15 A;  2OOL A;  5HWV A;  3CIT A;  4Y17 A;  4OON A;  4EEP A;  4HHD A;  2BAS A;  1NWZ A;  2ZJ9 A;  4WUJ A;  2QKP A;  2ZMV A;  2Y2P A;  1S1Y A;  4KZA A;  3VFH A;  4KG5 A;  4X1M A;  5CGX A;  1OTI A;  1FSW A;  1YAX A;  2PU4 A;  1IKG A;  1FOF A;  2P9V B;  2ZBB A;  1ONG A;  3MZD A;  4GDN A;  3UB9 A;  4N1H A;  3GQZ A;  4RVA A;  4OKP A;  4HP9 A;  4ETX A;  3MXQ A;  1YLW A;  4ZJ3 A;  3MQ0 A;  3G2Y A;  2JKT M;  4N92 A;  2A2L A;  3CPT A;  3NBL A;  3SH8 A;  4PPR A;  1PRQ A;  2I72 A;  2HGV A;  4GNU A;  3EGD C;  4EWF A;  1K25 A;  3UME A;  3LFV A;  4GLQ A;  2RCX A;  4I3A A;  5FQ9 A;  2W3G A;  3E2K A;  3LY4 A;  4CLC D;  2WUQ A;  2LB9 A;  1XX2 A;  3H82 B;  4LPZ A;  4S2K A;  3VOY A;  1JVJ A;  5F69 A;  1HLU P;  3ZCZ A;  1CJF A;  4PKY G;  2PYR A;  3P01 A;  4S2N C;  3LUQ A;  1K6R A;  2OAQ 1;  2WAE A;  1P97 A;  2EX6 A;  1IYO A;  3MZF A;  1FCM A;  3HUM A;  3K3D A;  5FI2 A;  3OPL A;  5DVA A;  2HF6 A;  4EBL A;  3LR5 A;  1FSY A;  1UGU A;  4YFM A;  2K2N A;  4B93 A;  4OOL A;  1Y54 A;  3UE3 A;  2PU2 A;  4P6Z S;  1BZA A;  3O3V A;  4R3B A;  3NI9 A;  5D3O A;  3BFF A;  2E8I A;  4X69 A;  4NEE D;  3ZHH A;  1PFL A;  1BYW A;  4OPQ A;  4R23 A;  4PKY A;  5LBR A;  4F3L B;  4PM7 A;  3MFD A;  3JVV A;  2B95 A;  3C5A A;  2H5S A;  5IT5 A;  1XA7 A;  4KQD A;  5CXW A;  2HV1 A;  3N8R A;  3CMZ A;  3BFC A;  5EPH A;  2XRO A;  1K56 D;  5L09 A;  4JF6 A;  3OC2 A;  2PBY A;  2ZC7 A;  2O9A A;  3N6I A;  4I3I A;  5F82 A;  4MN5 A;  5F1G A;  4DE1 A;  3PHY A;  3F1O A;  2HPB A;  4H6J A;  1PZO A;  3BFE A;  4IUK A;  2JKF A;  2ZLY A;  1EWZ A;  1CEG A;  3G6O A;  3RXW A;  3ZVT A;  3NCK A;  1PW1 A;  2XRN A;  3DTK A;  2JKR I;  1PI5 A;  3UB6 A;  4JGR A;  5E43 A;  2W1T A;  3HUN A;  4CJN A;  4FSF A;  4QD4 A;  5BOH A;  5E2G A;  2XDM A;  1IYP A;  3CZD A;  2VEA A;  1I2S A;  4XT2 B;  2XK1 A;  4LCL A;  1NYM A;  4BD1 A;  1ZC2 A;  3WS5 A;  1Q2Q A;  4JBF A;  4KZ5 A;  1T1B A;  3VSL A;  5TR7 A;  1NY0 A;  1XA1 A;  3LEQ A;  4LEN A;  3OLO A;  5EM1 A;  4C75 A;  1ACF A;  3BFD A;  4ZTK A;  4GCZ A;  2M7V A;  3IX8 A;  1GHM A;  3OPH A;  4PHT A;  4R38 A;  4EBN A;  1SKO A;  5J7E A;  4WF0 A;  3FG8 A;  1HD8 A;  2J8Y A;  2KLI A;  2ZC6 B;  4IBR A;  4EUZ A;  2ZQ9 A;  1S4R A;  3JPU A;  4RX3 A;  2X71 A;  2H28 A;  4U0T A;  5E2E A;  1MC0 A;  4Z9Q A;  3UPP A;  2GNX A;  1KE3 A;  2JHE A;  4EBP A;  1XFQ A;  4KZ4 A;  3VP1 A;  3MBZ A;  2R9X A;  2H10 A;  2W27 A;  1L0G A;  4L9F A;  2Y2Q A;  5EFW A;  4HY8 A;  5CX7 A;  1L0D A;  1MY8 A;  3PBS A;  1K54 C;  4G3W A;  3CJM A;  1ZTU A;  2O99 A;  3E4P A;  4R70 A;  2HDS A;  1W79 A;  1BLC A;  5FEG A;  2XR0 A;  1OTE A;  1UWN X;  2PYP A;  4JGQ A;  2J80 A;  5EOE A;  2C5W B;  3GDI A;  5HX9 A;  2P9V A;  4UQI M;  1XXM A;  3PXP A;  1BLH A;  4MEZ A;  3C8C A;  1YT4 A;  5FQI A;  4Q0H A;  4DKI A;  4KQQ A;  3D3O A;  2ZD8 A;  2ZC3 B;  1WA9 A;  1MPL A;  2EFU A;  3ZQ5 A;  1ZG6 A;  5F6A A;  2O9C A;  1IYQ A;  4OP8 A;  2Q9M A;  3H82 A;  2I9V A;  1PW8 A;  5KSH A;  1K55 C;  2WKH A;  3NOT C;  4OLD A;  2JC7 A;  4Y0T A;  4NKP A;  2PRF A;  3DAV A;  4Y3I A;  4KQR A;  1BUE A;  3UE0 A;  1U60 A;  1JWP A;  4BBU A;  5CEC A;  5TJJ A;  3QP6 A;  5AQ7 A;  4R4R A;  3LO7 A;  1JTD A;  1KE0 A;  1NRJ A;  3WS4 A;  1DRM A;  3IF6 C;  3SS4 A;  3HJK A;  5FEF A;  1VM1 A;  4S2L A;  2PAV P;  5I94 A;  3CWF A;  4LGW A;  4JXS A;  3FKW A;  3GR2 A;  1W8Y A;  5EOO A;  1H8M A;  3LR3 A;  1DJB A;  5TFQ A;  1Z09 A;  2H0Y A;  2Z6C A;  5EVI B;  3HLG A;  5CGW A;  1Z6F A;  2QMI A;  5FAT A;  4OVD A;  1T1C A;  4XUX A;  3ZDJ A;  3CAX A;  4C3Q A;  2EA9 A;  1IFQ A;  3VP4 A;  4NET A;  1OTA A;  2IWC A;  3UMD A;  4KZ9 A;  1OME A;  2ACG A;  1JTG A;  4F3L A;  2J3T C;  3W4P A;  3LR4 A;  4DMZ A;  4GJ4 A;  4OPZ A;  2BLS A;  3IXH A;  3UO9 A;  4EUV A;  3MXS A;  1YLY A;  5DF8 A;  4FH2 A;  2ZQA A;  1ES2 A;  3HRE A;  4FH4 A;  4MLL A;  5FAO A;  4OH0 A;  2GDN A;  1AWI A;  3CG5 A;  1A0K A;  3G30 A;  5CHM A;  3UPO A;  1D7E A;  2O0Y A;  4WL9 A;  5FQK A;  1FIK A;  4MDZ A;  4OQ0 A;  5GLB A;  5GL9 A;  1C3B A;  4KZ7 A;  3O86 A;  1FR1 A;  2FFF B;  4MBH A;  1RCJ A;  3QP5 A;  5FAQ A;  3EQU A;  1GSV A;  4LV1 A;  4DJ3 A;  3MXR A;  4ARZ B;  1O07 A;  4HBT A;  2UWX A;  4FTX A;  3LI9 A;  4RQ9 A;  1D1J A;  3UN7 A;  1K4E A;  5JYO A;  4HH2 A;  1CK3 A;  1XFN A;  5HPI A;  1G28 A;  5EUA A;  4EET B;  4CLC B;  4JKT A;  4JF5 A;  3TJZ C;  2W1R A;  2ZL1 A;  1F9I A;  3NHQ A;  4X25 A;  3PBR A;  2WGI A;  5AQ9 A;  5IU1 A;  5DKK A;  4IJG A;  1E25 A;  1OTD A;  2B02 A;  3LCE A;  5A93 A;  1LSX A;  2Y2O A;  3A0S A;  3JYI A;  1ESU A;  4MCW A;  4UHU A;  3V67 A;  1TDL A;  4UQI S;  3KSG A;  4WMC A;  4GOG A;  1TS0 A;  2Q9N A;  1V9Z A;  1N9B A;  5EVI D;  1TVF A;  2Y2M A;  1J3W A;  4EES A;  4S2M A;  1W8Q A;  3W4Q A;  1F2K A;  4MBK A;  3W2Z A;  4IHQ A;  1VEU A;  3O5Y A;  3HJI A;  1MKM A;  1V9Y A;  1OTB A;  4GD6 A;  4LFU A;  3C30 A;  3F1N B;  2WKI A;  2ZQC A;  5DTK A;  3UDF A;  3VSK A;  2Y55 A;  3VP0 A;  4HI4 A;  2XD1 A;  2WAF A;  4GS9 B;  1ALQ A;  5CED A;  2RL3 A;  3O88 A;  2OAP 1;  3DWZ A;  1S67 L;  4ID4 A;  4IBX A;  1Q2P A;  4KZ6 A;  1E3U D;  4E3K A;  4K91 A;  3A0V A;  4DJ2 A;  3L7H A;  1F98 A;  3UE6 A;  5L2F A;  3S7P A;  4HP4 A;  2Y2H A;  1VHM A;  3IXB A;  4HIA A;  2ZOH A;  2XFS A;  3B33 A;  1LSV A;  4RA7 A;  3V3R A;  3IH8 A;  3IQA A;  1H8Z A;  1QME A;  1DJC A;  3ISG A;  3VE4 A;  1ES3 A;  4GHI A;  2WZZ A;  4PM8 A;  1OT9 A;  2W3H A;  4Q0I A;  3T12 B;  5KZH A;  3C2W A;  1BTL A;  3RH8 B;  1P0Z A;  3IXG A;  3VP2 A;  3ZNY A;  4WEJ A;  3GRJ A;  3GMW A;  1RGY A;  5FQJ A;  4YWZ A;  1XKZ A;  3BYD A;  4D60 A;  3G31 A;  2Q0O A;  2ZOI A;  3TSG A;  2WKE A;  2OV5 A;  2JN7 A;  4FUW A;  1XP4 A;  2CMN A;  4PM9 A;  5IS1 A;  1OJG A;  4XXR A;  3P98 A;  3T1S A;  3FV7 A;  4KQO A;  3FKV A;  2OSU A;  5HDS A;  3ICY A;  5G4Z A;  3UDX A;  3A3J A;  1K0K A;  3WRT A;  3A3D A;  3G34 A;  3IXD A;  1ES5 A;  5A8B A;  3GVB A;  1S66 L;  4QY5 A;  4BMW A;  3GTC A;  4KZB A;  2AVX A;  1ERO A;  3VFF A;  5A90 A;  3W4O A;  1T18 A;  3BW6 A;  2XLN A;  4ZJ2 A;  1XGJ A;  1TS7 A;  5FQM A;  4BD0 A;  1KGE A;  3S7O A;  1MBL A;  4EU0 A;  3B3X A;  3G4P A;  3KYQ A;  1D06 A;  3FPW A;  2Y2J A;  4LV2 A;  4Y0U A;  4B88 A;  4R1G A;  1CI9 A;  2YKH A;  1LLB A;  2NUP C;  2VA0 A;  3S1Y A;  4O8G A;  5EEC A;  1KGF A;  2PR5 A;  1ERM A;  3BLS A;  5HWT A;  4X53 A;  1Y28 A;  3E2L A;  3H7W B;  1YQS A;  5TGF A;  3V39 A;  1O7E A;  3TOI A;  4OQI A;  3T1R A;  3PAE A;  3NJA A;  2A24 A;  4JGP A;  3IBJ A;  4FCF A;  1ZKJ A;  1OPX A;  2WKR A;  5J8X A;  4KZ3 A;  1J9M A;  2P74 A;  5E2F A;  1L0F A;  2PD7 A;  1BLP A;  4CLC A;  5FDS A;  1IOU A;  3BFG A;  1GSW A;  2QJ7 A;  4WEK A;  1AXB A;  1S6R A;  2Y2L A;  4MBF A;  3LIC A;  2VGK A;  1TF1 A;  4EEU A;  4BBV A;  2Y59 A;  5G4Y A;  4BEN A;  1KE4 A;  4JXW A;  3LIF A;  3VE3 A;  3D9Y A;  4YOF A;  1TS6 A;  3RFB A;  4HH3 A;  2JKT I;  5E2H A;  4IED A;  4BBT A;  4DRT A;  4K0W A;  1K4F A;  1YM1 A;  4CQH A;  3IS2 B;  3LR0 A;  1W63 Q;  3M2J A;  3GSG A;  2QPN A;  4HJ4 A;  5HL6 A;  1LL8 A;  3UB8 A;  3MQO A;  5CTN A;  2GZA A;  4BJP A;  4P87 A;  1RP5 A;  3HLD A;  3BJN A;  3EQV A;  4PMA A;  3E0Y A;  3E98 A;  2UV0 E;  1SCW A;  4GD8 A;  1FCO A;  4S2I A;  4WM9 A;  1PWC A;  5EVL A;  2G7U A;  5GLD A;  5GHY A;  3MKE A;  3P09 A;  4E6W A;  4Y7P A;  1DP9 A;  3ZVW A;  1HZO A;  4WZ5 A;  3M6B A;  1FR6 A;  1K56 A;  1KOU A;  2EFX A;  4NK3 A;  4MMN A;  5HD5 A;  4RX2 A;  1LSW A;  2W3E A;  1L3L A;  2VV7 A;  4KG6 A;  3Q07 A;  4P0M A;  4R0Q A;  4QJG A;  3IWQ A;  4R3J A;  1VET B;  5A91 A;  2Y79 A;  5M19 A;  1L2S A;  2KX6 A;  4HEF A;  1NJ4 A;  1T1A A;  1ZHH B;  5HAI A;  1SZV A;  5F1F A;  3VOZ A;  3H9W A;  3M6H A;  2VKS A;  3E4Q A;  2GX5 A;  2VK3 A;  2ZMA A;  5CER A;  5HW3 A;  3HBR A;  3LIE A;  3EGX C;  4WZ5 C;  2GJ3 A;  3NDE A;  3N8L A;  1KDW A;  2W3D A;  2Y2N A;  1NZU A;  4QY6 A;  3BY9 A;  4DXC A;  5HAP A;  4O7D A;  4ZBE A;  1DP6 A;  4YIN A;  1LI9 A;  2HZ5 A;  4X68 A;  4EW7 A;  2ZQD A;  3UY6 A;  4E3L A;  3C38 A;  4R6L A;  3N7W A;  3NEC A;  2XA7 M;  3G32 A;  3OOV A;  4MN7 A;  3HLB A;  1MWR A;  4U0X A;  4JGO A;  3U4L P;  3DW0 A;  5AVE A;  3LIA A;  3UPN A;  3W8K A;  4E3O A;  3KYE A;  1E4D A;  3HLC A;  5EE8 A;  3HLF A;  3D4F A;  1IKI A;  3BQ8 A;  2P7J A;  4GW9 A;  1EW0 A;  4LRY C;  3SH7 A;  5CGS A;  2G2U A;  2Y2I A;  4I3J A;  1G5U A;  3ZGA B;  4S2P A;  1IEM A;  4EQI A;  3E4O A;  3VP3 A;  2HDQ A;  3VV4 A;  4UA7 A;  3HVF A;  4NXF A;  4HNB A;  5GLA A;  3MSH A;  2WGW B;  3IX4 A;  4R3A A;  1YKD A;  4B9O A;  2A49 A;  1K57 A;  3OBF A;  1BSG A;  3G35 A;  4OQG A;  3QP8 A;  2Y8H A;  2O9B A;  4O0P A;  5I5L A;  4KEN B;  3IWO A;  4G3K A;  1RGZ A;  3TW8 A;  4IUH A;  2VV8 A;  3BEC A;  4R4S A;  3T1X A;  4KG2 A;  2JKG A;  2EWV A;  4B4X A;  4Y0O A;  2L4R A;  3CLO A;  3UE1 A;  3TE8 A;  4FOF A;  5FQQ A;  5GHX A;  5FA7 A;  2K31 A;  4M4X A;  3IF5 A;  2QHK A;  1GA0 A;  3T50 A;  4XUZ A;  2OLU A;  4QWO A;  2D01 A;  4M3K A;  5HDC A;  3BM6 A;  2ZM8 A;  5HAR A;  1P9R A;  2FZ0 A;  4E3J A;  4OP5 A;  4ZDX A;  1K57 C;  4HJ6 A;  2INW A;  1XJ4 A;  5JYP A;  4F94 A;  4LV3 A;  4MN6 A;  5F68 A;  3UDI A;  4KUO A;  5GLC A;  4E04 A;  4QU3 A;  3V3S A;  4P6B A;  3DWK A;  4GN2 A;  4XT2 A;  4CPK A;  4P6Z M;  4X55 A;  4MNR A;  2P08 A;  3V50 A;  4PAU A;  3F1O B;  4H6J B;  4KUK A;  5L07 A;  1I2W A;  3QP1 A;  1STZ A;  4EER A;  3S4X A;  5M1A A;  1OT6 A;  5FL3 A;  1M40 A;  3T4T A;  3IHA A;  4JXG A;  1HVB A;  1XJ2 A;  2MJ6 A;  2QYB A;  1TEM A;  3HCY A;  5J4E A;  5DJT A;  1P9W A;  3KSI A;  2J7V A;  3MJQ A;  1BT5 A;  2V20 A;  4EV4 A;  1XJ3 A;  2PD8 A;  3PBO A;  3K2N A;  3WS2 A;  1PIO A;  5M18 A;  2P04 A;  3MZE A;  4KZ8 A;  3BWL A;  3EOI A;  3T4K A;  4YNR A;  3C7U A;  3ULF A;  2K7S A;  1IEL A;  4BQM A;  5CRF A;  2C6W B;  4OLG A;  2EX8 A;  2VGL M;  3DBA A;  1KVM A;  3NOU C;  2Y91 A;  4DXB A;  1YLZ A;  4Y13 A;  3D72 A;  5HDD A;  1YLJ A;  4HOI A;  2EWW A;  2ZC5 B;  3C4P A;  2EX9 A;  2IWD A;  5KMW A;  1KGG A;  1GCE A;  4K0X A;  2OWH A;  5HAQ A;  1XJ6 A;  4BL3 A;  3IBR A;  4LRZ E;  3ZNT A;  1NYY A;  1BUL A;  4I5S A;  4N9L A;  3IT9 A;  1PZP A;  5FI6 A;  2WAD A;  1TD5 A;  4OQH A;  2PHY A;  4C6Y A;  2BTF P;  4NXE A;  3Q7V B;  3Q81 A;  5MC7 A;  1KVL A;  1N9O A;  2JKR M;  3WS0 A;  3WRZ A;  4CLC E;  3PTE A;  1KDS A;  4Q0J A;  4ME4 A;  4L0L A;  3VOL A;  2EXA A;  1LI0 A;  5HFO A;  3U2A A;  3IHB A;  3V5M A;  4AFI A;  4S2N A;  2YKF A;  4NXB A;  1W63 M;  1ODV A;  4X1L A;  1BLS A;  4ZJ1 A;  4O01 A;  2H0T A;  2Y4A A;  4BL2 A;  3PBT A;  1ONH A;  3IF6 B;  2Y2G A;  1YPR A;  1LL5 A;  3MMH A;  4IVI A;  4GB7 A;  4UAA A;  3F1P B;  5DTS A;  1ZG4 A;  4EQ1 A;  4H8R A;  1VB6 A;  5A92 A;  1T19 A;  2R9W A;  4DDS A;  1NZO A;  4QPR A;  2B5R A;  5DKL A;  2ZM2 A;  5EVI A;  1H3Q A;  1MWT A;  4JPM A;  3T1Q B;  2DCF A;  2KDK A;  1W7F A;  1HTZ A;  3PYP A;  5HL1 A;  4WYY A;  5DTT A;  2WGW A;  2R78 A;  2XEP A;  2W3F A;  5HZH A;  1XGI A;  3T4O A;  2JCH A;  4Y5F A;  2V2F F;  3BRM A;  4HBU A;  4GDB A;  2L0W A;  3HUO A;  1N4O A;  4E3I A;  1GA9 A;  4I38 A;  3SH9 A;  3EEH A;  4K08 A;  2XQZ A;  4JLF A;  2HDU A;  3ZG8 B;  3R4K A;  3LIB A;  3DTE A;  3A3F A;  2Y2K A;  3FPV A;  2EXB A;  3WS1 A;  1H8Y A;  3Q82 A;  2HJ9 C;  2WYX A;  5EVI C;  3QP4 A;  1E3U A;  3R7W B;  4QHC A;  4GKU A;  3RXX A;  3ZG7 B;  4NG2 A;  3RTY A;  2PBD P;  3Q7Z A;  2D02 A;  2VZW A;  2CC1 A;  5FSR A;  3T4Q A;  4G3V A;  3GV9 A;  3ZG5 A;  2JE5 A;  3GEC A;  5L8M A;  4ARZ A;  1UWP X;  3A0R A;  1DP8 A;  1WE4 A;  1N9L A;  3CI6 A;  4U3T A;  5EVE A;  2BG1 A;  3KSF A;  2V1B A;  4JXV A;  2HDR A;  1ESI A;  2FH5 A;  4JF4 A;  1Y4O A;  5G18 A;  3OCN A;  3S7Q A;  1S4S A;  3LY3 A;  4UEY A;  2QJ5 A;  4GZB A;  2XF3 A;  5J3W A;  3ZYT A;  5CHU A;  2G2W A;  3B47 A;  2FFY A;  1F5M A;  2IWB A;  5IHV A;  2VGL S;  4S2J A;  3UB5 P;  2KOI A;  3CUE A;  3BEB A;  5FI7 A;  4PM5 A;  5CTM A;  1CI8 A;  3NC8 A;  3O87 A;  5TBM B;  5KSC A;  3BLM A;  4II7 A;  3QNC A;  1ES4 A;  2WKP A;  3MS6 A;  4CLC C;  2QZ6 A;  3KSH A;  2ZL1 B;  1K54 A;  3IH9 A;  4I39 A;  1PI4 A;  3FYZ A;  1H0M A;  1EI5 A;  1SDE A;  3NOP C;  3PBQ A;  4Z1W A;  2J3T D;  3PAG A;  5DF9 A;  3K3C A;  1NXY A;  4Q8I A;  5DF7 A;  3FC7 A;  4DE2 A;  2J9P A;  3F1N A;  1GHI A;  3CUE C;  5CEB A;  1LT0 A;  2W0N A;  3MQQ A;  4X6T A;  1K6S A;  1NRF A;  4GS9 A;  5AQB A;  1N9N A;  3A3I A;  3B42 A;  5U47 A;  3MF0 A;  4HES A;  1JWV A;  3EEA A;  3TG9 A;  2PR6 A;  3NY4 A;  1IYS A;  4RYE A;  1FIL A;  1CQA A;  3CHW P;  3Q7V A;  4BWI A;  3SW1 A;  2ZQ7 A;  1W5D A;  1VEU B;  3SS3 A;  3WWX A;  4QB8 A;  1GSX A;  3I7J A;  3DTM A;  1K55 A;  4DE0 A;  2EX2 A;  1MZU A;  3KYZ A;  3LID A;  2WGV A;  1X0O A;  3AGE A;  2B18 A;  2V0W A;  3SOI A;  4WBG A;  4FD8 A;  3AGD A;  4ZAM A;  5KIZ A;  1CF0 A;  4P85 A;  4WLA A;  2XD5 A;  1I5Q A;  3QHY A;  2QWS A;  1G6O A;  1TDG A;  2XH9 A;  3EWK A;  3IWI A;  3IF6 A;  2HP9 A;  2V8C A;  3F1P A;  2HP6 A;  1PNE A;  2M1C A;  1LHY A;  4OPR A;  1CEF A;  4B4Z A;  2LB5 A;  3C7V A;  4EXO A;  5HPF A;  5L10 A;  5DFX A;  2M7U A;  1NLZ A;  3SS5 A;  5CHJ A;  4LRX C;  2X01 A;  5AQA A;  3CPT B;  2ZC4 B;  3NUL A;  1S0W A;  2VLG A;  5HD3 A;  1YLP A;  4GHI B;  4N1X A;  4NXG A;  2V9A A;  4DE3 A;  2E8J A;  3S7N A;  2ZQ8 A;  4LCM A;  2ZMF A;  3OZH A;  3SZT A;  4ESP A;  2VJW A;  4E6X A;  3S22 A;  5DJU A;  1XPB A;  5GHZ A;  4E3M A;  4E3N A;  1K38 A;  1MWS A;  1YSQ A;  3LYX A;  4D2O A;  4Y2F A;  1JWZ A;  3HLW A;  4OOM A;  3L9K A;  3UB7 A;  2A3U A;  3R7W A;  3BY8 A;  1S1Z A;  5FDH A;  5HWW A;  4WMC D;  3LI8 A;  3HLE A;  1SHV A;  4WZ4 A;  3H7W A;  1SKF A;  5C5K A;  1M6K A;  1QMF A;  3OCL A;  4DF6 A;  3TRC A;  2OWJ A;  3HL9 A;  4DN0 A;  3OPP A;  4IVK A;  3ITB A;  2VGJ A;  5FAP A;  2J3W A;  2V8F A;  1LL9 A;  4ETZ A;  1MXO A;  2V1Z A;  4HQA A;  1WYC A;  1PYY A;  2DNS A;  2WKQ A;  2NUT C;  4OPY A;  3LEZ A;  3BQA A;  2PDR A;  2Z2L B;  4HJ3 A;  3T4L A;  1YSP A;  3KO6 A;  4WN5 A;  3NDG A;  3NIA A;  3MKF A;  3FWL A;  3C4O A;  1L0E A;  1DY6 A;  2DRW A;  3ZG0 A;  2V0U A;  3QNB A;  5AJG A;  3OPR A;  4OOY A;  3MR0 A;  4N9K A;  3P7N A;  5DFY A;  4UA6 A;  3AGF A;  4ZRR A;  4LLO B;  2X02 A;  1VQQ A;  3G2Z A;  1ERQ A;  1PWD A;  3T4S A;  2ZM0 A;  3DTI A;  1YMX A;  2A24 B;  3ZG9 B;  3IS2 A;  5EM0 A;  2J9O A; 
#chains in the Genus database with same CATH homology
 1PFL A;  4X1M A;  4ESP A;  3T1S A;  3D9Y A;  2VK3 A;  1YPR A;  3T1X A;  1SKO A;  2PRF A;  2JKG A;  3DAV A;  5EVE A;  2B95 A;  1FIL A;  1CQA A;  1K0K A;  3CHW P;  1VEU B;  1Y4O A;  3L9K A;  4FTX A;  4QWO A;  3T1Q B;  1D1J A;  2HZ5 A;  3CPT A;  5FEF A;  1PRQ A;  2PAV P;  5EV0 A;  3UB5 P;  3L7H A;  2ZL1 A;  3NEC A;  1Z09 A;  4X25 A;  1CF0 A;  2JKF A;  5FEG A;  3U4L P;  2V8F A;  3KYE A;  1HLU P;  1CJF A;  1SKO B;  2V8C A;  2ACG A;  1VET A;  3MS6 A;  3LGO A;  2BTF P;  2ZL1 B;  1PNE A;  3T12 B;  3T1R A;  1G5U A;  4D60 A;  3CPT B;  3MSH A;  1VET B;  3NUL A;  1J3W A;  2PBD P;  1AWI A;  3LEQ A;  5FDS A;  1A0K A;  4FUW A;  1F2K A;  4X1L A;  5EM1 A;  1ACF A;  1SZV A;  1VEU A;  1FIK A;  2E8J A;  5EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...