3NF8A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf8A00
3DRPA 4H4MA 4CK1A 1TK5A 3KLIA 4CJPA 3MEEA 4E1NA 4J2BA 2VG7A 3QEXA 5HRNA 2P5OA 1TKDA 1EX4A 1CXUA 1HNVA 1RILA 4BACA 4KHYA 3I8DA 3OYJA 3QEVA 4N76A 4PQUA 1HPZA 1EP4A 3DMJA 4DS5A 1L3SA 1NK4A 2OZMA 1MU2A 1Q9XA 4CHZA 4E7LA 1DTQA 1Q9YA 2IDOA 3VQ9A 4DF4A 2DY4A 3OJSA 3KD5E 2XY7A 4J2AA 4BE2A 3KKRA 1FK9A 3IG1A 4CERA 3QEPA 5T7BA 4HUFA 4F8RA 4E19A 1XC9A 3ALYA 4DTSA 1J54A 4ICLA 3TAFA 1RBVA 1ASWA 4W5RA 4AHRA 4FLWA 4DTJA 4K8ZA 4LH5A 4FJ7A 1S1VA 1S6PA 3MXJA 3LP3A 4CGGA 3S3MA 5JS1A 5SWMA 3K57A 4KB1A 1S5JA 3MXIA 4F3OA 1NKEA 4CEOA 3MAQA 4GW6A 4ID5A 4E3SA 1RT4A 2ITGA 3NF9A 2RPIA 3P1GA 4CEBA 3KK1A 2G8KA 1RDDA 1JKHA 1LWFA 2XY8A 3B6PA 3SUPA 1CZBA 4PUOA 1WN7A 4FLXA 1S9GA 2QK9A 1WAJA 3RMDA 1X9WA 3TAEA 2OZSA 3VQCA 2RN2A 4DTMA 4DU3A 1WSHA 3ZT0A 1IH7A 2E4LA 3ZT2A 4F3TA 4O4GA 1I3AA 3K59A 1XHZA 2FBTA 1VSLA 2VG6A 4F4KA 4Z4EA 2PY5A 1RDBA 2HB5A 1HRHA 1IG9A 3V1RA 4K8XA 1FKPA 1JLFA 3L2RA 1S9EA 3DLKA 4EP4A 2QXFA 4BWMA 2D0CA 4CJTA 4M3UA 3ZSYA 3ZT4A 1TVRA 4I2PA 4B9TA 2RKIA 4FJIA 4OVLA 3IAYA 4CJFA 4HCBA 1NK5A 1VSEA 1QE1A 1YVUA 1HYZA 3HPHA 3M8PA 3MEGA 3OYGA 1UAXA 4O5BA 3M8RA 3OYHA 3AVFA 1R0AA 1U45A 4M3TA 3C95A 1EKEA 2G8IA 4M3ZA 2IS3A 4IG0A 3MXMA 4OPJA 3VN5A 3ZT1A 1DLOA 3L2VA 4OLAA 1C0MA 4CCHA 1RBRA 2P51A 4ELTA 4KI6A 4FCYA 4CIEA 3HP9A 4IFVA 1U47A 2VG5A 1VSJA 3G0ZA 1GOBA 4H4OA 5HP1A 3PX4A 1B9FA 4KO0A 4O55A 3SPYA 4FZYA 2P1JA 2R7YA 4EZ6A 5EU7A 2E6LA 3RMBA 1VSMA 1W0HA 3K5OA 2FBXA 4CJ3A 2ZE2A 2BANA 3EZ5A 4IDKA 1UA1A 1SKRA 3HL8A 3NGYA 4Z4GA 5J1EA 3QO9A 4DF8A 1RBSA 3AVGA 1D9DA 4E1MA 4B9MA 4OKEA 1ITGA 4FZZA 4CFAA 3HSTB 2XRIA 3L2WA 1BCOA 1NJWA 5FDLA 4FM2A 2B4JA 4AHSA 3SPZA 4FXDA 4O0JA 1QS4A 1C1CA 4NYNA 3VQDA 4DU1A 5HBMA 3SQ4A 1ZBIA 3ZSRA 3QNOA 2DTUA 1JXBA 3AA3A 1L3UA 5FRMA 1B9DA 4BWJA 4UQGA 4DLGA 1QSSA 1KVBA 2PYLA 4N56A 1WSFA 3SQ1A 5J2MA 4CEDA 3T1AA 4DTUA 4B9SA 5HROA 1U48A 4FLTA 4DMNA 2OPQA 3ZCMA 3S9HA 4CEAA 1ZYQA 1TGOA 1J9AA 4FJJA 4M42A 1D5AA 3V1QA 1TAQA 3CM5A 1SL2A 2B5JA 2YHBA 5KGWA 1REVA 1BIUA 4DSIA 3THVA 1KVAA 4W5OA 3KD1E 1J53A 3LAMA 4KPYA 1BHLA 3PV8A 3LWMA 2BDPA 2NUBA 1UOCA 3PY8A 4M3WA 1I39A 2OPPA 4ELUA 5J2PA 1RT1A 3O4QA 4FW1A 3LZJA 1Z25A 3VQ5A 4CF1A 3NHGA 1D8YA 3OYAA 1JLQA 3V9XA 1QSLA 4KFBA 1O1WA 3OYMA 4CIGA 2G8WA 2YHAA 3RWUA 1IKWA 1LAVA 2EHGA 3JSMA 3NGZA 1NK7A 4CE9A 4CGJA 1RBTA 3KIOA 3OJUA 3RRGA 3H08A 4O44A 5FRNA 3OYIA 4E7IA 3QEWA 3SUOA 3HO1A 4DSLA 1RBUA 2HHUA 4JRQA 3DOKA 2F8TA 4Z4CA 1Q8IA 4DQIA 4C8LA 4CJQA 4RW6A 4ZTJA 1NK9A 4C8KA 3AVNA 3PUFA 5I42A 4E0DA 4OLBA 3KTQA 3CFOA 3AO2A 3KK2A 1QHTA 4DLEA 4DFPA 3HP6A 3S3OA 1NK0A 1WNSA 2HHWA 1YTAA 3OYLA 4OKJA 3OS2A 3VQ4A 3NH1A 3SUNA 3NF8A 3QIOA 5SZTA 1XHXA 3U3GA 1UWBA 2GUIA 4DQRA 4Y1DA 3RR7A 3VQAA 1HNIA 5DMRA 4YNQA 1TAUA 2KFNA 3SI6A 3IRXA 3O4NA 2HVHA 2JLEA 3S3NA 2XY6A 5J2NA 3LP0A 4CGIA 4FLYA 4IG3A 3DRRA 1WSIA 3O3HA 1W9HA 4BDYA 2JGUA 2EX3A 3KLEA 1VSKA 3F9KA 2YKNA 4KHWA 2BGGA 1N5YA 1CZ9A 4DTXA 4CJWA 1NK6A 1LAWA 3AA2A 3VQBA 2GBZA 1NOYA 4FJGA 4JS4A 2KZMA 2HNDA 1CLQA 1VSFA 1IKXA 1LWCA 5KTQA 4M41A 2B6AA 3ZSWA 4JS5A 1T03A 4B9UA 3C6UA 1YTUA 2PZSA 4E7JA 2RF2A 4DG1A 1D9FA 4B9VA 1RT2A 4FLUA 2Z1HA 3ZSZA 4FJMA 3L3VA 4KHSA 3BGRA 3VQPA 4DSJA 4QOZB 2O4IA 1KTQA 4CFCA 4CF2A 1TV6A 3VQ8A 4DSFA 1J5OA 2G8FA 2HVIA 2IOCA 4CHYA 4HTUA 1BI4B 1BCMA 4CF0A 3TARA 1EETA 1G15A 2FBYA 3OY9A 3WNHA 5JS2A 3ZSVA 1TK8A 4NYFA 3SCXA 4CFDA 4DQPA 2KFZA 3OYKA 3V9SA 4CHQA 3NDKA 4EZ9A 3F73A 2KTQA 1KFSA 3HVRA 3I0RA 1C0UA 1F21A 1LW2A 4GVMA 4LH4A 4OGCA 1NJXA 3KLFA 5CY4A 3QETA 4IFYA 3HPOA 2IAJA 4J2DA 3NF6A 4CGFA 1BIZA 2Q3SA 2X78A 3NGIA 3OYDA 4FJ9A 4AHTA 3AVLA 2Z1IA 2ATQA 4KB0A 4RW4A 3TAMA 4Z4FA 2Y1IA 4LY7A 2ZQBA 3PX6A 4AHUA 3D45A 4Z4HA 4EP5A 3AVMA 4B3OA 3C94A 1X9MA 3LPTA 2VWKA 2DFHA 2Z1JA 3NFAA 4FJXA 3TANA 3OYEA 1NJZA 3HK2A 4HUGA 2D5RA 3AVIA 3M8QA 1Z26A 2YNFA 5J2QA 2X74A 4C8MA 4B08A 3HPGA 4CHPA 4JRPA 3SQ0A 1BGXT 4HCCA 4M3YA 4MFBA 4LD0A 3OVNA 2YKMA 5HRPA 1A5WA 1JLCA 3TR8A 3D0PA 3RRHA 1NJYA 4FZXC 3DLEA 4M45A 1C1AA 3QERA 3OS1A 1HYVA 4CESA 3TAPA 1IKVA 4BDPA 1TKZA 4CIFA 1T8EA 4E7KA 4DU4A 2F96A 4F2RA 4FJ8A 4E89A 1XI1A 3V1OA 3V4IA 4CK3A 3VQ6A 4B9NA 3KLHA 1ZBUA 3ISNC 3DYAA 3M8SA 5CZ2A 1HJRA 1KFDA 3AO4A 4XIUA 4QCLA 3HM9A 1VRTA 4CF8A 4CJLA 3K2PA 3K58A 2Y1JA 1JLGA 2Z1GA 1JLBA 4B8CA 1GOCA 3ZT3A 3AVJA 1S1UA 4IKFA 5CYQA 1QQCA 1EXQA 3WNEA 4CHOA 3SNNA 4H8KA 3VQ7A 2HHSA 3I0SA 1WLJA 1S6QA 3DLRA 1KLMA 3VA0A 4RG8A 4ZHRA 3E01A 1XWLA 3HYFA 4CJKA 3KKSA 4G1QA 5KRTA 5DK5A 3OYNA 3V81A 2WONA 3LWLA 4DTRA 1X9SA 4KHNA 4R5PA 5D3GA 1JL1A 4B8AB 3K5LA 3RMAA 1SL0A 4FJHA 3DLGA 1LWEA 4FLVA 4MQ3A 3ZSOA 3AO3A 3TABA 4AHVA 2F8SA 1WSGA 3P5JA 2YV0X 1FKOA 2KQ2A 5C25A 3U3YA 4F2SA 3EY1A 4CFBA 2A1SA 2YNIA 1ZBLA 1ZBHA 3VQQA 3NH2A 3LALA 1HQEA 2IC3A 1SV5A 4Y1CA 1S1WA 3TAQA 4CJUA 2I5JA 3HJFA 4ID1A 3CM6A 3LP1A 3SZ2A 2HHXA 2O4GA 2P5GA 1U04A 2WOMA 4KRFA 3FFIA 3NE6A 1TK0A 1WSEA 4DS4A 3C6TA 2XHBA 1JXEA 4FJNA 1GOAA 3L2QA 3RMCA 1A5VA 3KK3A 1U4BA 1C0TA 5CZ1A 2G8HA 1RTDA 1SKWA 1NK8A 2HMIA 3OYBA 4FVMA 1KCFA 2OPRA 1T7PA 1K6YA 3AO5A 1BQNA 3EYZA 4Z0UA 3HT3A 1BI4A 2OA8A 2LSNA 4CEQA 1L5UA 3NF7A 4HUEA 2FBVA 1JLEA 1RTIA 3NBPA 1L3TA 4CK2A 3LPUA 4CF9A 1SKSA 5E41A 3SYZA 1VK0A 4J2EA 4LSLA 4CJ5A 4CJ4A 4O0IA 3OYFA 4CJRA 3QLHA 3TAGA 4BE1A 3QEIA 3QIPA 3ULDA 4HHTA 4AH9A 4DQQA 2HHQA 1ZBFA 3G10A 1SUQA 4C8OA 3DI6A 3ZSQA 4AHCA 1L3VA 4KTQA 4FM0A 3L2UA 3LZIA 3T3FA 3AA5X 5CYMA 3AVCA 3HVTA 3IS9A 4OPKA 4DTPA 4OKKA 3PO5A 1TL3A 4CGHA 3AVBA 4DSKA 4I9QA 1TL1A 1RT6A 2X6NA 2E6MA 4NCAA 1VSHA 4RW9A 1ASVA 1RCHA 1NKCA 1U49A 2HHTA 3WNFA 2X6SA 5HRRA 1KRPA 2HNZA 3TI0A 4FJ5A 4GMJB 2DFFA 4PY5A 4OJRA 1WSJA 4CHNA 2YNHA 4DQSA 4L8RB 3NCIA 1IKYA 4C8NA 4LSNA 4RW7A 4E7HA 3AVHA 5HLFA 4FJKA 3DRSA 4DTOA 3CFPA 3ITHA 4M3XA 4KTZA 3A2FA 4I7FA 2G8UA 5KGXA 1RDAA 1VSDA 2ETJA 4W5QA 3AO1A 4TSXA 3OYCA 3AVKA 4FJLA 5KI6A 4I2QA 1NOZA 3NH0A 3SJJA 1UA0A 2QKBA 4CEZA 4FK0A 1RT3A 3LANA 1HMVA 3LDSA 5I3UA 3SUQA 3RTVA 4DTNA 2D0AA 3B6OA 1FXXA 3LP2A 3V9ZA 3OS0A 1QTMA 4FYDA 4JLHA 1S1XA 1WAFA 1Y97A 1YT3A 1LV5A 4ZTFA 4QAGA 4BDZA 1NKBA 2G8VA 4DWIA 3AVAA 5C42A 3RR8A 3SV4A 3K5NA 3K5MA 3P83D 4N47A 1LW0A 3CQ8A 4CJVA 4CJSA 3VA3A 4BE0A 1TKTA 4NCGA 5C24A 2HW3A 5KRSA 3DM2A 4KREA 4HVJA 4CJEA 1X1PA 1KSPA 1TKXA 1QSYA 1ASUA 1BQMA 1JLAA 3L3UA 1T05A 5FROA 4CEFA 3SV3A 3DLBA 2IGIA 3VQEA 4DFJA 4KAZA 1RTHA 1DTTA 2HHVA 3TWHA 5K14A 2OPSA 4DSEA 3MEDA 2QKKA 3CYMA 3O3GA 1BISA 3U6FA 3V9UA 4KI4A 3L8BA 2BE2A 4IBNA 2VWJA 1VRUA 2ZD1A 3KJVA 1SL1A 2KW4A 1S1TA 3ASMA 3CG7A 3PX0A 1B92A 4FK2A 3UIQA 3QINA 3SQ2A 2A1RA 1RTJA 3JYTA 1KLNA 2XO7A 3QESA 4Q5VA 3MECA 1RT7A 2PYJA 3T19A 3DOLA 4KV8A 1HYSA 2DFEA 1RT5A 4KHQA 1A5XA 3HXMA 4AILC 3ZSXA 4ELVA 3AA4A 3O3FA 2HNYA 4YFUA 1KVCA 3DLHA 4N5SA 3KLGA 3QNNA 3AV9A 4FW2A 4KHUA 3WNGA 4KTWA 5HRSA 4DFMA 1C1BA 1N6QA 4PWDA 4CEEA 1JL2A 4FLZA 4W5NA 1BL3A 2XY5A 4W5TA 2YNGA 1RNHA 4FM1A 4NCBA 1HQUA 2GV9A 1RDCA 3PO4A 4Q0BA 4FK4A 3CFRA 4B9LA 1C6VA 4M3RA 1CXQA 3LAKA 4RW8A 4WE1A 4I9LA 1VSIA 3NAEA 3V6DA 1IO2A 3BDPA 2W42A 4N41A 4CGDA 4PA1A 4DFKA 2FC0A 2D0BA 2AJQA 2KZZA 4Z4IA 3V9WA 4KKOA 4CECA 2OYQA 4OGEA
chains in the Genus database with same CATH superfamily
4CK1A 4CJPA 5FPMA 2VG7A 1HNZK 1GLLO 1TKDA 1CXUA 2UU9K 4N76A 4PQUA 1HPZA 4DS5A 2ZM6K 1DTQA 4MO5A 3KWGA 4DF4A 4BRHA 1TUYA 3OBYA 3VF6A 3ATUA 3OJSA 3SMSA 1WOQA 1FK9A 5FPNA 4CERA 4E19A 4DTSA 4B3MK 4ICLA 1RBVA 4W5RA 4C1NK 4AHRA 4DTJA 3CJCA 4FJ7A 4CZJA 2E5LK 2E8AA 3CI5A 1XMOK 1VQ4N 3L4IA 4CEOA 4ID5A 1J5EK 3B6PA 2O8CA 4PUOA 3EN9A 4FLXA 1O13A 1E4FT 2GWJA 1WB9A 2BUPA 1KQSM 4DR5K 1IH7A 4F3TA 1I3AA 2NZTA 3FZLA 2GX9A 4F4KA 2HB5A 3LDNA 1HRHA 1IG9A 3DLKA 3J80O 3LDLA 4U67L 1XMQK 3ZX0A 3ENBA 4NB4A 1NK5A 3VF4A 3OYGA 3OYHA 3LM9A 4RTFD 1EKEA 4CBXA 1BO5O 3ZT1A 4JYAK 4B9QA 3S41A 2V52B 3O1BA 4IFVA 4JI0K 1HUXA 2QTDA 2O8FA 4LC9B 3PX4A 4O55A 4FZYA 3L4QA 1BUPA 1W0HA 4IDHA 4CD3A 2ZE2A 3H45C 5J1EA 3CCSN 3JS6A 4DF8A 2I7PA 4BC5A 4E1MA 4NLCA 4CFAA 3HSTB 1BCOA 5FDLA 3SPZA 4AHSA 1MWKA 2Q31A 1C1CA 4NYNA 3P31A 4M7YA 5HBMA 2D1KA 1W2BM 4JNEA 4A57A 1XNRK 3WEEB 3MWPA 4BWJA 3T1AA 4YOWA 4BRIA 4JV5K 3UKUB 4CEAA 1ZYQA 4FJJA 4M42A 3MX2A 1SL2A 2HBJA 4KPYA 3U9DA 4B1ZA 3PV8A 3LWMA 3QFPA 2QWRA 3PSIA 1GLBG 3TSQA 5C2DA 4DV6K 1Z25A 3OYAA 4WFNL 1O1WA 3MK6A 4CIGA 2VWBA 3RWUA 5AQYA 2EHGA 1NK7A 2YHXA 3OJUA 1GLDG 4EAHD 3SUOA 4DSLA 1NGGA 3VETA 5M1QA 3QB0A 2VQEK 4CJQA 3AVNA 1QHTA 3F2KA 4NLBA 4DLEA 3S3OA 2ASPA 4B1XB 4OKJA 3OS2A 3SUNA 1RDWX 1XHXA 3M5RA 2GUIA 4Y1DA 5AQFA 3S3NA 5ADXA 4FLYA 3WXKA 3DRRA 1WSIA 4BDYA 1VSKA 3F9KA 2YKNA 1NGCA 3D2FB 3GG4A 3H46O 3HM8A 1CZ9A 4DTXA 2A6AA 4H5TA 4CJWA 3CCQN 1NK6A 1LAWA 2KZMA 4FJGA 5FLXO 2QWPA 1T03A 3HBTA 2E2PA 3C6UA 2PZSA 4DG1A 1D9FA 4CD1A 4FLUA 1E4GT 3EKSA 3UKRA 4PKGA 3R9PA 1KTQA 1TV6A 3VQ8A 5EX5A 3HZ6A 1BI4B 1BCMA 4CF0A 3TARA 2ZGYA 3OY9A 3ZSVA 1YI2N 3SCXA 1EQYA 3C6AA 3VTIA 1BA0A 1RGIA 3BY5A 1KAZA 5GAEP 2KTQA 3QBXA 3CCLN 5AQRA 4B1YB 3THXB 4CZMA 3LL3A 3SMPA 4AM7A 3DAWA 2ATQA 3FGUA 2ZQBA 4FWRA 4PL8A 5F2RA 3LDPA 4EP5A 4Z4HA 3C94A 3LPTA 2DFHA 1Q7YO 1Q81O 3TANA 4HUGA 1IBLK 4B08A 3O9QA 2Q1NA 4LFAK 3TR8A 1C1AA 1IKVA 2D0PA 4KH5A 4CK3A 4B9NA 3KLHA 3HSCA 4A5AA 3K0SA 3M8SA 5AZJB 3AO4A 1KFDA 3FLCO 4H5VA 4LF4K 4QCLA 3HM9A 4CF8A 3K2PA 1N33K 4A61A 2O8EA 1JLGA 5AQOA 5CYQA 2P9UA 4DCHA 4H8KA 3I0SA 1WLJA 4K0KK 2WFBA 2A5XA 4CJKA 3V81A 2WONA 4KHNA 1VQNN 3C7NA 1W7AA 1J6ZA 4FJHA 4B8AB 3RMAA 1HKGA 4KKOA 2V51B 1LWEA 4MQ3A 2F8SA 4LF5K 1WSGA 2Q0RA 1FKOA 4DHYA 1T6CA 2OANA 3VGMA 4LFBK 2A1SA 2YNIA 1ZBHA 3MN9A 4FL9A 4HTLA 2P9KB 3J8AA 4ID1A 3CM6A 4BC2A 3SZ2A 5AQMA 2WOMA 3NE6A 4PL7A 2XHBA 5BREA 5IT9O 2NRRA 4CJ7A 4FJNA 1GOAA 3KK3A 2JWLA 1U4BA 2G8HA 1SKWA 2RE2A 3P38A 3OYBA 2HMIA 2OPRA 3CCRN 3AO5A 4Z0UA 1KC8O 1HR0K 3CJ9A 1L5UA 4HUEA 1JLEA 3VERA 4FPAA 3LPUA 4BR7A 5GADP 4JKBA 1ATRA 2BH1A 3THYA 1HPMA 3QLHA 3TAGA 4AH9A 4DQQA 1SUQA 3DI6A 4IOXA 4KTQA 4FM0A 3N4QA 3LZIA 5AQGA 1VQMN 4UY8O 2UXDK 3AVBA 4DSKA 3L6QA 1TL1A 1RT6A 1T44A 2NRWA 4RW9A 1ASVA 1NKCA 2HHTA 3MN6A 1KRPA 4GMJB 1NU0A 2YX6A 3NCIA 3MWTA 3UE5A 4C8NA 1VQ6N 3BF3A 5AQKA 4KTZA 3VEVA 1N36K 5JVGL 3AO1A 3ID8A 4TSXA 4GKJK 1NOZA 1UA0A 4CEZA 2WC9A 2JWKA 3OS0A 1WAFA 4LFCK 1DKGD 4YORA 3OA9A 4BDZA 4DWIA 4LF7K 4DV4K 3M6GA 2W6LA 5M1PA 1LW0A 4CJSA 4H03B 5C24A 3LDQA 3O8MA 1TKXA 4DQ8A 1QSYA 3EEQA 3L3UA 1T05A 5FROA 2IGIA 3VQEA 2ZGZA 4DR3K 1Q86O 1SZ2A 3TWHA 3MEDA 3CYMA 1BISA 4KI4A 2IVPA 3CCUN 1VRUA 3CG7A 3ULEA 3SQ2A 2VGNA 1XQSC 4WYBA 2XO7A 3QESA 4WQ5A 3R1XA 3T19A 4KV8A 4IO9L 1EWQA 2DFEA 1QZ5A 1RT5A 3DXKB 4EFHA 3SLCA 4KHQA 5HOOA 3ZSXA 4AILC 1SQKA 4YFUA 2HSTA 1KVCA 3PSFA 2QM1A 3WNGA 1HKCA 5HRSA 4DFMA 3SJHA 1BL3A 4W5TA 2YNGA 3PO4A 1C6VA 5JICA 2F7TA 1CXQA 3LAKA 4DR4K 1I94K 4KH4A 1IO2A 5BN9A 2W42A 4DFKA 2D0BA 3C65A 3V9WA 1NMDA 3VGKA 4OGEA 3HTVA 1TK5A 3MEEA 4E1NA 2IVOA 2AA4A 4JI1K 5HRNA 2P9UB 1E3MA 1EX4A 1HNVA 1RILA 4KHYA 3QEVA 3OYJA 3DMJA 2OZMA 3DLLL 1MU2A 2E88A 1NGBA 2H3GX 3VQ9A 4BG9A 2DY4A 5TKWA 3C7NB 4QS7A 2XY7A 1VHXA 3KKRA 2P9IB 5T7BA 2GELA 1J54A 3TAFA 1ASWA 4A5BA 4FLWA 4LH5A 4CGGA 4RWTA 3K57A 3O1WA 1GLJO 1JCEA 2ITGA 4IO8A 3P1GA 2G8KA 2HHWA 1RDDA 1JKHA 2ZWHA 2NLXA 3SUPA 4GNIA 1WAJA 3TAEA 1N32K 4CBWA 4ISGA 1QVFM 4H0XB 4IFEA 3V1RA 1JLFA 3MCAB 5E26A 1S9EA 1NG9A 4EP4A 3W3DA 1HX1A 2BTFA 3ZT4A 4FOIA 1TVRA 4BQZA 4X64K 4B9TA 2RKIA 1HNXK 4CJFA 3WQUA 1VSEA 3D2EA 3HPHA 1HYZA 5AQLA 3M8PA 2PYJA 4B9VA 4M3TA 4O5BA 3AVFA 2P9NB 2IS3A 3MXMA 4OPJA 2W40A 1DLOA 2P51A 2E20A 4X66K 4FCYA 4CIEA 3HP9A 1VQ8N 5AZIA 3N4PA 4H4OA 5HP1A 3CC7N 1YAGA 5EU7A 4EZ6A 1VSMA 2Q36A 4BR4A 2O8DA 3NGYA 4Z4GA 5BPMA 1U6ZA 1RBSA 4JK8A 2NNWA 3AVGA 1D9DA 4BRQA 4FZZA 3AAQA 5C15A 2E1ZA 4O0JA 3E9OA 4BRDA 4JKGB 3IDHA 3ZSRA 2DTUA 4X65K 1MDUB 3VF2A 1B9DA 4BR0A 1QSSA 2PYLA 1KVBA 3SQ1A 4O8UA 5HROA 4FLTA 1U48A 3ZCMA 3S9HA 1TAQA 2B5JA 5KGWA 1REVA 2HBKA 1BIUA 4H0TB 1KVAA 4W5OA 1J53A 5BRDA 2BDPA 3PY8A 4JD2B 2OPPA 5LMNK 5J2PA 1RT1A 3VQ5A 3NHGA 3ZX2A 3ZETA 4G9ZA 4M63C 3DXMA 3AGRA 4BREA 2G8WA 4NXNK 3JSMA 3DWLA 1RBTA 3H08A 4O44A 5FRNA 3QEWA 3HO1A 3CPEA 3DOKA 3QBWA 3ULEB 4B3SK 3NVKA 4DQIA 4C8LA 1NK9A 3PUFA 3KTQA 3AO2A 4O8KA 3TU5A 3O80A 1YTAA 3OYLA 1ATNA 4JEPA 4KH6A 4YOTA 3NF8A 1IBMK 4BR9A 2E1YA 5BR9A 3U3GA 1HNIA 1BU6O 5DMRA 2KFNA 3THWA 2HVHA 1EWRA 2JLEA 5J2NA 3LP0A 4FSVA 4IG3A 1NGAA 3SBGA 3VEYA 1W9HA 3KLEA 4FWNA 4KHWA 2BGGA 2P9PB 3AA2A 5LJWA 1NOYA 3C0BA 4JKCA 5KTQA 4M41A 3ZSWA 4JS5A 5LY3A 4JI4K 4E7JA 1M90O 1RT2A 2CGJA 2Z1HA 1T3VA 3ZSZA 4BY9C 4FJMA 3L3VA 2PBDA 3BGRA 3TTFA 3PLAA 2EWSA 4CF2A 4DSFA 1YIJN 4HTUA 3SAFA 1EETA 2FBYA 3G6EN 1GLCG 5JS2A 1TK8A 1H1VA 3O5BA 4CVNE 4YDUA 4ISEA 4CHQA 4PHTX 1NGDA 1KFSA 5EY4A 3HVRA 3I0RA 1C0UA 1LW2A 4GVMA 4LH4A 1NJXA 4OPHA 5CY4A 3RSEA 3QETA 2IAJA 4J2DA 4DV1K 3NGIA 3GE1A 2Z1IA 4YOXA 5GAHP 4Z4FA 4H5NA 4AHUA 3K9JA 2NRHA 3AVMA 4B3OA 4FJXA 4BQLA 1BWFO 3HK2A 1Z26A 2YNFA 5E84A 3SQ0A 3HPGA 4CHPA 2QEXN 4M3YA 4MFBA 2YKMA 1JLCA 3D0PA 4PKHA 3QERA 5AQPA 3R6MA 1TKZA 4E7KA 3WUHA 4DU4A 5LMUK 2F96A 4F2RA 1XI1A 3V4IA 5LJVA 3VQ6A 2D0OA 1VQPN 3ZEUB 3ISNC 2A42A 4XIUA 4WFAL 4XH4A 5JLHA 2KKZA 2Y1JA 4B8CA 1JLBA 1GOCA 3AVJA 1EXQA 3D2EB 4CHOA 5M1FA 3HI0A 1S6QA 1TYQA 4WQ5C 4A2AA 3HYFA 5DK5A 3LWLA 5B8HA 5AZIB 3DLGA 3AO3A 3TABA 4AHVA 3P5JA 2QWMA 3U3YA 4BGAA 4BVPA 3EY1A 5ELZA 5BN8A 4CFBA 3CF5L 1SV5A 1S1WA 3BZCA 3LP1A 5F0XA 1TK0A 3EKUA 5BRFA 1JXEA 4XH5A 1NGFA 3L2QA 4BROA 2GEMA 2AP1A 2QWOA 4BRMA 1BQNA 4IEEA 3EYZA 5FPEA 4ILHA 4LF8K 1YJWN 4CEQA 3NF7A 1U2VA 2RHKA 4MLEA 4OPAA 3WQTA 4BVOA 4JHDB 5KPRA 4DR7K 3NBPA 4CK2A 4CF9A 1SKSA 5E41A 3EL2A 4CJ5A 4O0IA 2VGMA 4H5WA 5BRHA 1ZBFA 3G10A 4K41A 2FXUA 4DR1K 1WUAA 4CI6A 3J7YP 4BRCA 3T3FA 3AA5X 3AAPA 3A5NC 3CJAA 3HVTA 5GIOA 3E66A 2FLOA 5AQHA 4HWIA 1DGKN 2J4RA 4I9QA 2E6MA 1VSHA 3O9RA 3WNFA 1NGEA 4FJ5A 1S22A 4L8RB 1IKYA 4R79A 5KPZA 5HLFA 3DRSA 4ILGB 3T1YK 1K8KA 4JI7K 4I7FA 3VENA 3MMVA 5KGXA 1VSDA 2ETJA 4JKEA 5I9EB 3NH0A 1Z05A 4JKFA 2UYTA 3LDSA 5I3UA 2CH6A 5A2QO 1KXPA 2O8CB 4DTNA 3B6OA 3LP2A 3V9ZA 1QTMA 4FYDA 1S1XA 1Y97A 1YT3A 3E9PA 1ESVA 1XNQK 3RR8A 3K5NA 4N47A 3G25A 3U4LA 4BE0A 1TKTA 4KREA 4HVJA 2HF4A 1X1PA 1KSPA 1JLAA 5GAGP 1C0FA 3SV3A 3DLBA 1DTTA 4GKKK 3VMFB 2BE2A 2CH5A 4IBNA 3RSEB 5KQDA 2VWJA 2ZD1A 3KJVA 3PX0A 3ASMA 2FSKA 1V4SA 2A1RA 1N34K 4FOEA 2F9WA 4I6MA 2CGKA 3MN5A 5AFUH 3DOLA 4IJNA 4DV5K 2O8FB 5M1NA 4MO4A 3A5LC 3HXMA 5GINA 1RDUA 4ELVA 3TTCA 2ZJRL 4FPBA 3KLGA 1IJJA 4KHUA 3AV9A 1N6QA 2OCEA 3CIPA 1HKBA 2NRZA 1MA9B 2FF6A 3VOVA 4IOAL 1HQUA 3CQYA 3CFRA 4RW8A 4WE1A 4I9LA 5AQJA 3NAEA 4PA1A 2CGLA 4GV3A 4CECA 4GV6A 4J2BA 5EVZA 2Q0UA 3CJ7A 4X62K 1TYQB 1EP4A 4AQYK 1NK4A 3KWIA 4DKWA 1Q9XA 1OH5A 3KD5E 4J2AA 3KK7A 1R59O 4WCEL 3QEPA 4F8RA 2YHYA 4HUFA 1X3NA 1XC9A 1BG3A 2P9SA 4XEIA 3LDOA 1VQ9N 1W97L 4K8ZA 3D7EO 1S1VA 1S6PA 2ZF5O 3LP3A 3S3MA 5JS1A 4CZLA 3I33A 4KB1A 1K9MO 5AQQA 4F3OA 1NKEA 3MAQA 4GW6A 2HBMA 1RT4A 3NF9A 3VEXA 2RPIA 3KK1A 4CEBA 2ASMA 4H0VB 1WN7A 1S9GA 3RMDA 1IBKK 3VQCA 2P9LA 1WSHA 3K59A 2FBTA 1VSLA 3O08A 3CCMN 4YDUC 1FKPA 3L2RA 3ENHA 2QXFA 4BWMA 2D0CA 3P39A 3TSUA 4OVLA 1YVUA 1R0AA 1U45A 4E1JA 1GLFO 4IG0A 3WXJA 3L2VA 1C0MA 5AQIA 3LM2A 3JAMO 3UKRB 1U47A 1VQ5N 1VSJA 2E2NA 1GOBA 2IVNA 1B9FA 2P1JA 2R7YA 3FR0A 4WQ4A 1HNWK 2E6LA 3CERA 4CJ3A 3EZ5A 1YJ9N 1SKRA 3HL8A 3WXLA 3QO9A 2HF3A 1ITGA 4EHTA 1NJWA 3VQDA 4DU1A 3SQ4A 2DPNA 1ZBIA 4DV3K 2F9TA 3QNOA 3AA3A 1D4XA 2HOEA 4UQGA 1WSFA 3PIPL 4CEDA 3B8AX 4B9SA 1TGOA 3V1QA 2GWKA 1OVQA 3LAMA 1WBDA 1BHLA 2NUBA 1UOCA 4BRPA 1I39A 4ELUA 3O4QA 4A2BA 3LZJA 1Q82O 1JLQA 4WFBL 4KFBA 2O8EB 3FZFA 5C2FA 4IOCL 1IKWA 1LAVA 5MLCQ 3NGZA 3OYIA 5CE3A 4K42A 1RBUA 4JRQA 2F8TA 4Z4CA 1Q8IA 4JK9A 4C8KA 4RW6A 4ZTJA 3I56N 4E0DA 3CCJN 4DFPA 1NK0A 1WNSA 3J81O 2YCHA 3NH1A 4A62A 5AQSA 4B3TK 5SZTA 3MCPA 1UWBA 3RR7A 1Z6RA 4YNQA 2XY6A 4CGIA 3O3HA 1Q18A 3H1VX 2JGUA 2OTJN 1SS6A 1V4TA 1N5YA 2GBZA 2HNDA 3P4IA 1LWCA 4F9OA 1BA1A 5AQZA 4JK7A 5KQ8A 1JCGA 2RF2A 1BOTO 1K73O 4DSJA 2G8FA 3KVGA 1J5OA 4CHYA 3L0QA 3QFUA 3HRGA 3OYKA 4L3QA 3V9SA 2NRXA 3NDKA 4EZ9A 4FVUA 4OGCA 3THYB 5EOYA 3KLFA 3HPOA 1OH8A 3NF6A 2E2QA 2Q3SA 2X78A 4FJ9A 1QHAA 3OYDA 3J7ZO 3T69A 4RW4A 2Y1IA 3D45A 3ENOA 1X9MA 4V19S 2E2OA 2VWKA 2Z1JA 3NFAA 3WEEA 1NJZA 1T6DA 1G99A 3AVIA 3M8QA 1S3XA 5J2QA 4C8MA 1BGXT 2W41A 3UKUA 5HRPA 1A5WA 3DLEA 4M45A 3WT0A 1HYVA 4BDPA 1KAYA 5ADXH 4CIFA 1T8EA 4WF9L 4BRKA 3OBWA 3G4SN 4FJ8A 5HL7L 3DYAA 1HJRA 4GY2B 1S1UA 5AQTA 4JKDA 3WNEA 3SNNA 3VQ7A 3NVMA 1KLMA 4FWLA 4RG8A 4ZHRA 1YHQN 3E01A 3AY9A 5KRTA 4O5FA 4R5PA 3QMLA 4JKHA 2YV0X 4IJAA 5C25A 3QDKA 3CCEN 3M3ZA 1ZBLA 3VQQA 1ATSA 3LALA 2IC3A 3NH2A 4FWQA 4Y1CA 3TAQA 1M1KO 2I5JA 3HJFA 4BGBA 1EO1A 2Q2RA 2IIRA 2P5GA 1U04A 3FFIA 2FSNA 4DS4A 3C6TA 4AM6A 3RMCA 2WBNA 4PKIA 4Y0WA 1RTDA 4DB3A 1KCFA 1T7PA 1LOTB 1NGHA 1BI4A 3BF1A 2OA8A 2LSNA 5CHIA 3CD6N 1VAZA 3Q7CA 1RTIA 4J2EA 5CR4A 3SYZA 4LSLA 3OYFA 1QQMA 2PFUA 2VQFK 2QXLA 4DR2K 2VYPA 4BE1A 3ULDA 4HHTA 3THXA 2HHQA 4C8OA 1XUPO 3MX5A 4CZIA 4AHCA 4FWKA 2WTUA 2F4VK 3PIOL 4FWOA 3VEZA 5JLFA 3L2UA 3AVCA 3OHRA 4DTPA 1HLUA 4OKKA 1TL3A 4CGHA 3PO5A 2X6NA 3VGLA 1U49A 2X6SA 3QICA 2HNZA 2DFFA 2KLAA 4CHNA 4QS8A 3T7ZA 4RW7A 1TUUA 3O9SA 4FJKA 2V7YA 4M3XA 3MDQA 2WUSA 2G8UA 5AZJA 3CC4N 3E9LA 4IWVA 1KAXA 3AVKA 5KI6A 4I2QA 4CZGA 3SJJA 2QKBA 2YJEA 4J8FA 1HMVA 3TTDA 4IZ9A 1MWMA 5AQWA 3SUQA 2UXBK 3SAHA 3U9ZA 1FXXA 5DM6L 4GV9A 5AQUA 1LV5A 4ZTFA 4QAGA 3AARA 1VQLN 5C42A 3H1QA 4WQ4C 1OVYA 4GVEA 3CQ8A 1GLAG 2A40A 3VA3A 5C10A 4B1VA 3DM2A 5KRSA 4CJEA 3HOSA 4JAXA 1ASUA 2KHOA 1ZC6A 4CEFA 4KAZA 3EO3A 2HHVA 3NMUA 2HBLA 2NRTA 3O3GA 3U6FA 2P9KA 3G71N 3V9UA 5JVHL 1SL1A 2KW4A 1S1TA 4FK2A 1B92A 3UIQA 1YF5L 4BC3A 1RTJA 3JYTA 1BDGA 4EIAA 1KLNA 1RT7A 1HYSA 3T1HK 2QW9A 2FF3B 3AA4A 2HNYA 3O3FA 4OX9K 3DLHA 3ATVA 4FWPA 2O8DB 3QNNA 2HMPA 4FW2A 3SK3A 4AF1A 4KTWA 1C1BA 4FLZA 4W5NA 1C0GA 1OH6A 4MDBA 1RNHA 4FM1A 1RDCA 3BZKA 4FK4A 4B9LA 4M3RA 1NBWA 3V6DA 3Q7BA 4CGDA 2NRVA 2FC0A 2AJQA 2ZJQL 3SBTA 2OYQA 3FZMA 3DRPA 4H4MA 3KLIA 2UUCK 3W0LA 3QEXA 2P5OA 4BACA 3I8DA 1L3SA 3CJBA 4CHZA 5BPNA 4E7LA 2GTDA 2IDOA 1Q9YA 1OH7A 4BE2A 4DUYK 3IG1A 5AQXA 3ALYA 3M1FA 3ZETB 3ZX3A 3HOTA 3DXMB 4H0PA 4CZEA 5F1XA 3DJCA 3EE8A 3MXJA 3CCVN 5SWMA 4YOUA 5AR0A 1S5JA 3MXIA 3CJ1A 4E3SA 4C1NI 3BEXA 4ILJA 5C0YA 1LWFA 2XY8A 1CZBA 2QWNA 3FFKB 2QK9A 2YJFA 4IXCA 1X9WA 2OZSA 3A5OC 2RN2A 2VCPA 3GBTA 4IEIA 4DTMA 2UXCK 3H3OB 4DU3A 3ZT0A 2E4LA 3ZT2A 3EE9A 3A5MC 4O4GA 3FZHA 4B1UB 1XHZA 2VG6A 4Z4EA 2PY5A 4K43A 1RDBA 4K8XA 3THWB 4DR6K 2QWQA 1NWKA 4CJTA 3KZBA 4M3UA 3E1YA 3VTHA 3ZSYA 3UB5A 4I2PA 4JN4A 4FJIA 3IAYA 4HCBA 3OTOK 1FJGK 1VQON 1QE1A 3M8RA 1DT9A 4BRNA 3MEGA 1UAXA 3C95A 3FE1A 2G8IA 1JCFA 4M3ZA 3VN5A 1RFQA 3C6HA 4OLAA 1X3MA 4CCHA 1RBRA 3CHWA 4ELTA 4KI6A 2VG5A 3G0ZA 3MN7A 2Q97A 2O8BA 3D6RA 3DXKA 4KO0A 3SPYA 3RMBA 3K5OA 2FBXA 3WXMB 2BANA 4IDKA 1UA1A 1WBBA 4B9MA 4OKEA 2XRIA 3L2WA 4FM2A 2B4JA 4FXDA 3A8YA 1QS4A 4DV0K 3BUZB 4RCHA 1JXBA 1L3UA 5FRMA 1QZ6A 2QI2A 4DLGA 4N56A 5J2MA 4DTUA 1QQOA 4JKAA 4DMNA 2OPQA 1J9AA 1D5AA 3CM5A 2YHBA 5LL6Z 4DSIA 3THVA 3KD1E 1ILYA 3IMXA 4M3WA 4CBUA 4FW1A 1D8YA 4CF1A 2P9IA 3V9XA 4KBOA 1QSLA 3OYMA 2YHAA 4CZHA 4CE9A 3KHYA 3EZWA 4CGJA 3KIOA 3RRGA 4MLHA 4E7IA 1YITN 1P8ZA 4XH1A 2HHHK 2HHUA 3GDQA 2I7NA 5I42A 3O9TA 4JI5K 3VESA 4YOYA 4OLBA 3CFOA 3KK2A 3HP6A 4JI3K 1NJIO 4M7XA 3VQ4A 3QIOA 4DQRA 3VQAA 1TAUA 3SI6A 3IRXA 3O4NA 2A3ZA 3H3NO 2EX3A 4EHUA 3H6EA 2UUBK 4YHHK 3VQBA 1CLQA 4JS4A 1VSFA 1IKXA 3A0IX 4JI2K 2B6AA 3WXIA 2ITMA 1LCUA 3O9UA 4B9UA 2P9NA 1YTUA 2GUPA 5KPTA 4KHSA 3U8XA 3VQPA 3AGKA 4QOZB 3SAGA 2O4IA 4CFCA 2HVIA 2IOCA 4FWMA 4C23A 1G15A 1U2VB 4JI6K 3WNHA 4NYFA 4DUZK 4CFDA 4DQPA 2KFZA 4FO0A 1QVGM 3F73A 5M1KA 1F21A 4A59A 4IFYA 2ZJPL 4CGFA 1BIZA 4AHTA 3AVLA 1VQKN 4KB0A 2D4WA 3TAMA 4JKGA 3FZKA 4LY7A 3PX6A 3K9KA 3OYEA 2D5RA 2X74A 4JRPA 4HCCA 4LD0A 3OVNA 3RRHA 4FZXC 1NJYA 4BRAA 1CZAN 3OS1A 4CESA 3TAPA 3GOIA 4DV7K 1OKJA 2QWLA 4E89A 1ZXOA 4JD2A 3V1OA 1K8KB 1ZBUA 5CZ2A 3O4WA 1VRTA 4CJLA 3K58A 4BRLA 1YXQA 4BG8A 2Z1GA 3ZT3A 4KHPK 1X9JA 3GL1A 4IKFA 3IUCA 1KD1O 2O8BB 1QQCA 2HHSA 1NNEA 1K8AO 3DLRA 4QS9A 3ID6A 3VA0A 1XWLA 1YVNA 3KKSA 4G1QA 3BP8A 3OYNA 1X9SA 4DTRA 5D3GA 1JL1A 3K5LA 1SL0A 4FLVA 3ZSOA 3CXCM 2KQ2A 4F2SA 4JI8K 3TPQA 2UUAK 3O6WA 1HQEA 5H1SQ 4CJUA 1YJNN 4Z94A 3ZYYX 2P9PA 3CMEN 2HHXA 2O4GA 3J7AP 3VEWA 4KRFA 4NXMK 3IKMA 3F9MA 1WSEA 3IFRA 4B3RK 4I6MB 1A5VA 5TKYA 1C0TA 5CZ1A 1SAZA 1NK8A 4FVMA 1NGJA 1K6YA 5BR8K 1JJ2M 4LF6K 3R8EA 3HT3A 5JMVA 5AJ3K 5DM7L 2FBVA 4BRGA 4K25A 1L3TA 1VK0A 3CMAN 4CJ4A 5C12A 1XC3A 4CJRA 4ISFA 4H5RA 3QEIA 3QIPA 4YOVA 3ZSQA 1L3VA 2PAVA 5CYMA 4OPKA 3IS9A 3OW2M 4CZKA 1HJOA 4NCAA 4BC4A 1RCHA 3R3LA 1N8RO 1IV0A 5AQNA 4H0OA 5AFUA 5HRRA 5FPDA 3TI0A 2ASOA 4PY5A 4OJRA 1WSJA 4DQSA 2YNHA 3F5TA 4BR2A 2YHWA 3CC2N 4LSNA 4E7HA 3AVHA 4DTOA 3CFPA 2P9SB 3ITHA 4NO7A 2W6KA 4LF9K 3JXUA 3A2FA 1VQ7N 3ZEUA 2OTLN 1RDAA 4W5QA 3OYCA 3I55N 4FJLA 5IWAK 4OO1J 4U7BA 4FK0A 1RT3A 1ZBSA 3LANA 3RTVA 2D0AA 5AQVA 4JLHA 4BRFA 3VPZA 1P90A 2P9LB 1GLEG 2FSJA 1NKBA 2G8VA 3AVAA 4H0YB 1DEJA 3SV4A 3K5MA 3P83D 3RVCA 5GIPA 4DV2K 4CJVA 3CQXA 4NCGA 2HW3A 1NMNA 3ZLJA 1BQMA 4CW7B 4DFJA 1RTHA 4FWSA 1IG8A 5EXWA 5K14A 2OPSA 4DSEA 5M1OA 2QKKA 3L8BA 4CZFA 2V7ZA 2YI1A 3QINA 1NLVA 1NGIA 1QQNA 3CETA 4Q5VA 3MECA 3VEOA 1Y64A 1NM1A 1A5XA 3CPWM 4YY3K 5BPLA 3I8BA 4N5SA 2A41A 4PWDA 4CEEA 1JL2A 2QA4N 1YUWA 2XY5A 1FW6A 4JHDA 3D2FA 4NCBA 2GV9A 4Q0BA 4B1WB 1VSIA 3TSPA 4N41A 3BDPA 1S72N 4BR5A 2KZZA 4Z4IA 4MDAA
chains in the Genus database with same CATH topology
3DRPA 4H4MA 4CK1A 1TK5A 3KLIA 4CJPA 3MEEA 4E1NA 4J2BA 2VG7A 3QEXA 5HRNA 2P5OA 1TKDA 1EX4A 1CXUA 1HNVA 1RILA 4BACA 4KHYA 3I8DA 3OYJA 3QEVA 4N76A 4PQUA 1HPZA 1EP4A 3DMJA 4DS5A 1L3SA 1NK4A 2OZMA 1MU2A 1Q9XA 4CHZA 4E7LA 1DTQA 1Q9YA 2IDOA 3VQ9A 4DF4A 2DY4A 3OJSA 3KD5E 2XY7A 4J2AA 4BE2A 3KKRA 1FK9A 3IG1A 4CERA 3QEPA 5T7BA 4HUFA 4F8RA 4E19A 1XC9A 3ALYA 4DTSA 1J54A 4ICLA 3TAFA 1RBVA 1ASWA 4W5RA 4AHRA 4FLWA 4DTJA 4K8ZA 4LH5A 4FJ7A 1S1VA 1S6PA 3MXJA 3LP3A 4CGGA 3S3MA 5JS1A 5SWMA 3K57A 4KB1A 1S5JA 3MXIA 4F3OA 1NKEA 4CEOA 3MAQA 4GW6A 4ID5A 4E3SA 1RT4A 2ITGA 3NF9A 2RPIA 3P1GA 4CEBA 3KK1A 2G8KA 1RDDA 1JKHA 1LWFA 2XY8A 3B6PA 3SUPA 1CZBA 4PUOA 1WN7A 4FLXA 1S9GA 2QK9A 1WAJA 3RMDA 1X9WA 3TAEA 2OZSA 3VQCA 2RN2A 4DTMA 4DU3A 1WSHA 3ZT0A 1IH7A 2E4LA 3ZT2A 4F3TA 4O4GA 1I3AA 3K59A 1XHZA 2FBTA 1VSLA 2VG6A 4F4KA 4Z4EA 2PY5A 1RDBA 2HB5A 1HRHA 1IG9A 3V1RA 4K8XA 1FKPA 1JLFA 3L2RA 1S9EA 3DLKA 4EP4A 2QXFA 4BWMA 2D0CA 4CJTA 4M3UA 3ZSYA 3ZT4A 1TVRA 4I2PA 4B9TA 2RKIA 4FJIA 4OVLA 3IAYA 4CJFA 4HCBA 1NK5A 1VSEA 1QE1A 1YVUA 1HYZA 3HPHA 3M8PA 3MEGA 3OYGA 1UAXA 4O5BA 3M8RA 3OYHA 3AVFA 1R0AA 1U45A 4M3TA 3C95A 1EKEA 2G8IA 4M3ZA 2IS3A 4IG0A 3MXMA 4OPJA 3VN5A 3ZT1A 1DLOA 3L2VA 4OLAA 1C0MA 4CCHA 1RBRA 2P51A 4ELTA 4KI6A 4FCYA 4CIEA 3HP9A 4IFVA 1U47A 2VG5A 1VSJA 3G0ZA 1GOBA 4H4OA 5HP1A 3PX4A 1B9FA 4KO0A 4O55A 3SPYA 4FZYA 2P1JA 2R7YA 4EZ6A 5EU7A 2E6LA 3RMBA 1VSMA 1W0HA 3K5OA 2FBXA 4CJ3A 2ZE2A 2BANA 3EZ5A 4IDKA 1UA1A 1SKRA 3HL8A 3NGYA 4Z4GA 5J1EA 3QO9A 4DF8A 1RBSA 3AVGA 1D9DA 4E1MA 4B9MA 4OKEA 1ITGA 4FZZA 4CFAA 3HSTB 2XRIA 3L2WA 1BCOA 1NJWA 5FDLA 4FM2A 2B4JA 4AHSA 3SPZA 4FXDA 4O0JA 1QS4A 1C1CA 4NYNA 3VQDA 4DU1A 5HBMA 3SQ4A 1ZBIA 3ZSRA 3QNOA 2DTUA 1JXBA 3AA3A 1L3UA 5FRMA 1B9DA 4BWJA 4UQGA 4DLGA 1QSSA 1KVBA 2PYLA 4N56A 1WSFA 3SQ1A 5J2MA 4CEDA 3T1AA 4DTUA 4B9SA 5HROA 1U48A 4FLTA 4DMNA 2OPQA 3ZCMA 3S9HA 4CEAA 1ZYQA 1TGOA 1J9AA 4FJJA 4M42A 1D5AA 3V1QA 1TAQA 3CM5A 1SL2A 2B5JA 2YHBA 5KGWA 1REVA 1BIUA 4DSIA 3THVA 1KVAA 4W5OA 3KD1E 1J53A 3LAMA 4KPYA 1BHLA 3PV8A 3LWMA 2BDPA 2NUBA 1UOCA 3PY8A 4M3WA 1I39A 2OPPA 4ELUA 5J2PA 1RT1A 3O4QA 4FW1A 3LZJA 1Z25A 3VQ5A 4CF1A 3NHGA 1D8YA 3OYAA 1JLQA 3V9XA 1QSLA 4KFBA 1O1WA 3OYMA 4CIGA 2G8WA 2YHAA 3RWUA 1IKWA 1LAVA 2EHGA 3JSMA 3NGZA 1NK7A 4CE9A 4CGJA 1RBTA 3KIOA 3OJUA 3RRGA 3H08A 4O44A 5FRNA 3OYIA 4E7IA 3QEWA 3SUOA 3HO1A 4DSLA 1RBUA 2HHUA 4JRQA 3DOKA 2F8TA 4Z4CA 1Q8IA 4DQIA 4C8LA 4CJQA 4RW6A 4ZTJA 1NK9A 4C8KA 3AVNA 3PUFA 5I42A 4E0DA 4OLBA 3KTQA 3CFOA 3AO2A 3KK2A 1QHTA 4DLEA 4DFPA 3HP6A 3S3OA 1NK0A 1WNSA 2HHWA 1YTAA 3OYLA 4OKJA 3OS2A 3VQ4A 3NH1A 3SUNA 3NF8A 3QIOA 5SZTA 1XHXA 3U3GA 1UWBA 2GUIA 4DQRA 4Y1DA 3RR7A 3VQAA 1HNIA 5DMRA 4YNQA 1TAUA 2KFNA 3SI6A 3IRXA 3O4NA 2HVHA 2JLEA 3S3NA 2XY6A 5J2NA 3LP0A 4CGIA 4FLYA 4IG3A 3DRRA 1WSIA 3O3HA 1W9HA 4BDYA 2JGUA 2EX3A 3KLEA 1VSKA 3F9KA 2YKNA 4KHWA 2BGGA 1N5YA 1CZ9A 4DTXA 4CJWA 1NK6A 1LAWA 3AA2A 3VQBA 2GBZA 1NOYA 4FJGA 4JS4A 2KZMA 2HNDA 1CLQA 1VSFA 1IKXA 1LWCA 5KTQA 4M41A 2B6AA 3ZSWA 4JS5A 1T03A 4B9UA 3C6UA 1YTUA 2PZSA 4E7JA 2RF2A 4DG1A 1D9FA 4B9VA 1RT2A 4FLUA 2Z1HA 3ZSZA 4FJMA 3L3VA 4KHSA 3BGRA 3VQPA 4DSJA 4QOZB 2O4IA 1KTQA 4CFCA 4CF2A 1TV6A 3VQ8A 4DSFA 1J5OA 2G8FA 2HVIA 2IOCA 4CHYA 4HTUA 1BI4B 1BCMA 4CF0A 3TARA 1EETA 1G15A 2FBYA 3OY9A 3WNHA 5JS2A 3ZSVA 1TK8A 4NYFA 3SCXA 4CFDA 4DQPA 2KFZA 3OYKA 3V9SA 4CHQA 3NDKA 4EZ9A 3F73A 2KTQA 1KFSA 3HVRA 3I0RA 1C0UA 1F21A 1LW2A 4GVMA 4LH4A 4OGCA 1NJXA 3KLFA 5CY4A 3QETA 4IFYA 3HPOA 2IAJA 4J2DA 3NF6A 4CGFA 1BIZA 2Q3SA 2X78A 3NGIA 3OYDA 4FJ9A 4AHTA 3AVLA 2Z1IA 2ATQA 4KB0A 4RW4A 3TAMA 4Z4FA 2Y1IA 4LY7A 2ZQBA 3PX6A 4AHUA 3D45A 4Z4HA 4EP5A 3AVMA 4B3OA 3C94A 1X9MA 3LPTA 2VWKA 2DFHA 2Z1JA 3NFAA 4FJXA 3TANA 3OYEA 1NJZA 3HK2A 4HUGA 2D5RA 3AVIA 3M8QA 1Z26A 2YNFA 5J2QA 2X74A 4C8MA 4B08A 3HPGA 4CHPA 4JRPA 3SQ0A 1BGXT 4HCCA 4M3YA 4MFBA 4LD0A 3OVNA 2YKMA 5HRPA 1A5WA 1JLCA 3TR8A 3D0PA 3RRHA 1NJYA 4FZXC 3DLEA 4M45A 1C1AA 3QERA 3OS1A 1HYVA 4CESA 3TAPA 1IKVA 4BDPA 1TKZA 4CIFA 1T8EA 4E7KA 4DU4A 2F96A 4F2RA 4FJ8A 4E89A 1XI1A 3V1OA 3V4IA 4CK3A 3VQ6A 4B9NA 3KLHA 1ZBUA 3ISNC 3DYAA 3M8SA 5CZ2A 1HJRA 1KFDA 3AO4A 4XIUA 4QCLA 3HM9A 1VRTA 4CF8A 4CJLA 3K2PA 3K58A 2Y1JA 1JLGA 2Z1GA 1JLBA 4B8CA 1GOCA 3ZT3A 3AVJA 1S1UA 4IKFA 5CYQA 1QQCA 1EXQA 3WNEA 4CHOA 3SNNA 4H8KA 3VQ7A 2HHSA 3I0SA 1WLJA 1S6QA 3DLRA 1KLMA 3VA0A 4RG8A 4ZHRA 3E01A 1XWLA 3HYFA 4CJKA 3KKSA 4G1QA 5KRTA 5DK5A 3OYNA 3V81A 2WONA 3LWLA 4DTRA 1X9SA 4KHNA 4R5PA 5D3GA 1JL1A 4B8AB 3K5LA 3RMAA 1SL0A 4FJHA 3DLGA 1LWEA 4FLVA 4MQ3A 3ZSOA 3AO3A 3TABA 4AHVA 2F8SA 1WSGA 3P5JA 2YV0X 1FKOA 2KQ2A 5C25A 3U3YA 4F2SA 3EY1A 4CFBA 2A1SA 2YNIA 1ZBLA 1ZBHA 3VQQA 3NH2A 3LALA 1HQEA 2IC3A 1SV5A 4Y1CA 1S1WA 3TAQA 4CJUA 2I5JA 3HJFA 4ID1A 3CM6A 3LP1A 3SZ2A 2HHXA 2O4GA 2P5GA 1U04A 2WOMA 4KRFA 3FFIA 3NE6A 1TK0A 1WSEA 4DS4A 3C6TA 2XHBA 1JXEA 4FJNA 1GOAA 3L2QA 3RMCA 1A5VA 3KK3A 1U4BA 1C0TA 5CZ1A 2G8HA 1RTDA 1SKWA 1NK8A 2HMIA 3OYBA 4FVMA 1KCFA 2OPRA 1T7PA 1K6YA 3AO5A 1BQNA 3EYZA 4Z0UA 3HT3A 1BI4A 2OA8A 2LSNA 4CEQA 1L5UA 3NF7A 4HUEA 2FBVA 1JLEA 1RTIA 3NBPA 1L3TA 4CK2A 3LPUA 4CF9A 1SKSA 5E41A 3SYZA 1VK0A 4J2EA 4LSLA 4CJ5A 4CJ4A 4O0IA 3OYFA 4CJRA 3QLHA 3TAGA 4BE1A 3QEIA 3QIPA 3ULDA 4HHTA 4AH9A 4DQQA 2HHQA 1ZBFA 3G10A 1SUQA 4C8OA 3DI6A 3ZSQA 4AHCA 1L3VA 4KTQA 4FM0A 3L2UA 3LZIA 3T3FA 3AA5X 5CYMA 3AVCA 3HVTA 3IS9A 4OPKA 4DTPA 4OKKA 3PO5A 1TL3A 4CGHA 3AVBA 4DSKA 4I9QA 1TL1A 1RT6A 2X6NA 2E6MA 4NCAA 1VSHA 4RW9A 1ASVA 1RCHA 1NKCA 1U49A 2HHTA 3WNFA 2X6SA 5HRRA 1KRPA 2HNZA 3TI0A 4FJ5A 4GMJB 2DFFA 4PY5A 4OJRA 1WSJA 4CHNA 2YNHA 4DQSA 4L8RB 3NCIA 1IKYA 4C8NA 4LSNA 4RW7A 4E7HA 3AVHA 5HLFA 4FJKA 3DRSA 4DTOA 3CFPA 3ITHA 4M3XA 4KTZA 3A2FA 4I7FA 2G8UA 5KGXA 1RDAA 1VSDA 2ETJA 4W5QA 3AO1A 4TSXA 3OYCA 3AVKA 4FJLA 5KI6A 4I2QA 1NOZA 3NH0A 3SJJA 1UA0A 2QKBA 4CEZA 4FK0A 1RT3A 3LANA 1HMVA 3LDSA 5I3UA 3SUQA 3RTVA 4DTNA 2D0AA 3B6OA 1FXXA 3LP2A 3V9ZA 3OS0A 1QTMA 4FYDA 4JLHA 1S1XA 1WAFA 1Y97A 1YT3A 1LV5A 4ZTFA 4QAGA 4BDZA 1NKBA 2G8VA 4DWIA 3AVAA 5C42A 3RR8A 3SV4A 3K5NA 3K5MA 3P83D 4N47A 1LW0A 3CQ8A 4CJVA 4CJSA 3VA3A 4BE0A 1TKTA 4NCGA 5C24A 2HW3A 5KRSA 3DM2A 4KREA 4HVJA 4CJEA 1X1PA 1KSPA 1TKXA 1QSYA 1ASUA 1BQMA 1JLAA 3L3UA 1T05A 5FROA 4CEFA 3SV3A 3DLBA 2IGIA 3VQEA 4DFJA 4KAZA 1RTHA 1DTTA 2HHVA 3TWHA 5K14A 2OPSA 4DSEA 3MEDA 2QKKA 3CYMA 3O3GA 1BISA 3U6FA 3V9UA 4KI4A 3L8BA 2BE2A 4IBNA 2VWJA 1VRUA 2ZD1A 3KJVA 1SL1A 2KW4A 1S1TA 3ASMA 3CG7A 3PX0A 1B92A 4FK2A 3UIQA 3QINA 3SQ2A 2A1RA 1RTJA 3JYTA 1KLNA 2XO7A 3QESA 4Q5VA 3MECA 1RT7A 2PYJA 3T19A 3DOLA 4KV8A 1HYSA 2DFEA 1RT5A 4KHQA 1A5XA 3HXMA 4AILC 3ZSXA 4ELVA 3AA4A 3O3FA 2HNYA 4YFUA 1KVCA 3DLHA 4N5SA 3KLGA 3QNNA 3AV9A 4FW2A 4KHUA 3WNGA 4KTWA 5HRSA 4DFMA 1C1BA 1N6QA 4PWDA 4CEEA 1JL2A 4FLZA 4W5NA 1BL3A 2XY5A 4W5TA 2YNGA 1RNHA 4FM1A 4NCBA 1HQUA 2GV9A 1RDCA 3PO4A 4Q0BA 4FK4A 3CFRA 4B9LA 1C6VA 4M3RA 1CXQA 3LAKA 4RW8A 4WE1A 4I9LA 1VSIA 3NAEA 3V6DA 1IO2A 3BDPA 2W42A 4N41A 4CGDA 4PA1A 4DFKA 2FC0A 2D0BA 2AJQA 2KZZA 4Z4IA 3V9WA 4KKOA 4CECA 2OYQA 4OGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRP A;  4H4M A;  4CK1 A;  1TK5 A;  3KLI A;  4CJP A;  3MEE A;  4E1N A;  4J2B A;  2VG7 A;  3QEX A;  5HRN A;  2P5O A;  1TKD A;  1EX4 A;  1CXU A;  1HNV A;  1RIL A;  4BAC A;  4KHY A;  3I8D A;  3OYJ A;  3QEV A;  4N76 A;  4PQU A;  1HPZ A;  1EP4 A;  3DMJ A;  4DS5 A;  1L3S A;  1NK4 A;  2OZM A;  1MU2 A;  1Q9X A;  4CHZ A;  4E7L A;  1DTQ A;  1Q9Y A;  2IDO A;  3VQ9 A;  4DF4 A;  2DY4 A;  3OJS A;  3KD5 E;  2XY7 A;  4J2A A;  4BE2 A;  3KKR A;  1FK9 A;  3IG1 A;  4CER A;  3QEP A;  5T7B A;  4HUF A;  4F8R A;  4E19 A;  1XC9 A;  3ALY A;  4DTS A;  1J54 A;  4ICL A;  3TAF A;  1RBV A;  1ASW A;  4W5R A;  4AHR A;  4FLW A;  4DTJ A;  4K8Z A;  4LH5 A;  4FJ7 A;  1S1V A;  1S6P A;  3MXJ A;  3LP3 A;  4CGG A;  3S3M A;  5JS1 A;  5SWM A;  3K57 A;  4KB1 A;  1S5J A;  3MXI A;  4F3O A;  1NKE A;  4CEO A;  3MAQ A;  4GW6 A;  4ID5 A;  4E3S A;  1RT4 A;  2ITG A;  3NF9 A;  2RPI A;  3P1G A;  4CEB A;  3KK1 A;  2G8K A;  1RDD A;  1JKH A;  1LWF A;  2XY8 A;  3B6P A;  3SUP A;  1CZB A;  4PUO A;  1WN7 A;  4FLX A;  1S9G A;  2QK9 A;  1WAJ A;  3RMD A;  1X9W A;  3TAE A;  2OZS A;  3VQC A;  2RN2 A;  4DTM A;  4DU3 A;  1WSH A;  3ZT0 A;  1IH7 A;  2E4L A;  3ZT2 A;  4F3T A;  4O4G A;  1I3A A;  3K59 A;  1XHZ A;  2FBT A;  1VSL A;  2VG6 A;  4F4K A;  4Z4E A;  2PY5 A;  1RDB A;  2HB5 A;  1HRH A;  1IG9 A;  3V1R A;  4K8X A;  1FKP A;  1JLF A;  3L2R A;  1S9E A;  3DLK A;  4EP4 A;  2QXF A;  4BWM A;  2D0C A;  4CJT A;  4M3U A;  3ZSY A;  3ZT4 A;  1TVR A;  4I2P A;  4B9T A;  2RKI A;  4FJI A;  4OVL A;  3IAY A;  4CJF A;  4HCB A;  1NK5 A;  1VSE A;  1QE1 A;  1YVU A;  1HYZ A;  3HPH A;  3M8P A;  3MEG A;  3OYG A;  1UAX A;  4O5B A;  3M8R A;  3OYH A;  3AVF A;  1R0A A;  1U45 A;  4M3T A;  3C95 A;  1EKE A;  2G8I A;  4M3Z A;  2IS3 A;  4IG0 A;  3MXM A;  4OPJ A;  3VN5 A;  3ZT1 A;  1DLO A;  3L2V A;  4OLA A;  1C0M A;  4CCH A;  1RBR A;  2P51 A;  4ELT A;  4KI6 A;  4FCY A;  4CIE A;  3HP9 A;  4IFV A;  1U47 A;  2VG5 A;  1VSJ A;  3G0Z A;  1GOB A;  4H4O A;  5HP1 A;  3PX4 A;  1B9F A;  4KO0 A;  4O55 A;  3SPY A;  4FZY A;  2P1J A;  2R7Y A;  4EZ6 A;  5EU7 A;  2E6L A;  3RMB A;  1VSM A;  1W0H A;  3K5O A;  2FBX A;  4CJ3 A;  2ZE2 A;  2BAN A;  3EZ5 A;  4IDK A;  1UA1 A;  1SKR A;  3HL8 A;  3NGY A;  4Z4G A;  5J1E A;  3QO9 A;  4DF8 A;  1RBS A;  3AVG A;  1D9D A;  4E1M A;  4B9M A;  4OKE A;  1ITG A;  4FZZ A;  4CFA A;  3HST B;  2XRI A;  3L2W A;  1BCO A;  1NJW A;  5FDL A;  4FM2 A;  2B4J A;  4AHS A;  3SPZ A;  4FXD A;  4O0J A;  1QS4 A;  1C1C A;  4NYN A;  3VQD A;  4DU1 A;  5HBM A;  3SQ4 A;  1ZBI A;  3ZSR A;  3QNO A;  2DTU A;  1JXB A;  3AA3 A;  1L3U A;  5FRM A;  1B9D A;  4BWJ A;  4UQG A;  4DLG A;  1QSS A;  1KVB A;  2PYL A;  4N56 A;  1WSF A;  3SQ1 A;  5J2M A;  4CED A;  3T1A A;  4DTU A;  4B9S A;  5HRO A;  1U48 A;  4FLT A;  4DMN A;  2OPQ A;  3ZCM A;  3S9H A;  4CEA A;  1ZYQ A;  1TGO A;  1J9A A;  4FJJ A;  4M42 A;  1D5A A;  3V1Q A;  1TAQ A;  3CM5 A;  1SL2 A;  2B5J A;  2YHB A;  5KGW A;  1REV A;  1BIU A;  4DSI A;  3THV A;  1KVA A;  4W5O A;  3KD1 E;  1J53 A;  3LAM A;  4KPY A;  1BHL A;  3PV8 A;  3LWM A;  2BDP A;  2NUB A;  1UOC A;  3PY8 A;  4M3W A;  1I39 A;  2OPP A;  4ELU A;  5J2P A;  1RT1 A;  3O4Q A;  4FW1 A;  3LZJ A;  1Z25 A;  3VQ5 A;  4CF1 A;  3NHG A;  1D8Y A;  3OYA A;  1JLQ A;  3V9X A;  1QSL A;  4KFB A;  1O1W A;  3OYM A;  4CIG A;  2G8W A;  2YHA A;  3RWU A;  1IKW A;  1LAV A;  2EHG A;  3JSM A;  3NGZ A;  1NK7 A;  4CE9 A;  4CGJ A;  1RBT A;  3KIO A;  3OJU A;  3RRG A;  3H08 A;  4O44 A;  5FRN A;  3OYI A;  4E7I A;  3QEW A;  3SUO A;  3HO1 A;  4DSL A;  1RBU A;  2HHU A;  4JRQ A;  3DOK A;  2F8T A;  4Z4C A;  1Q8I A;  4DQI A;  4C8L A;  4CJQ A;  4RW6 A;  4ZTJ A;  1NK9 A;  4C8K A;  3AVN A;  3PUF A;  5I42 A;  4E0D A;  4OLB A;  3KTQ A;  3CFO A;  3AO2 A;  3KK2 A;  1QHT A;  4DLE A;  4DFP A;  3HP6 A;  3S3O A;  1NK0 A;  1WNS A;  2HHW A;  1YTA A;  3OYL A;  4OKJ A;  3OS2 A;  3VQ4 A;  3NH1 A;  3SUN A;  3NF8 A;  3QIO A;  5SZT A;  1XHX A;  3U3G A;  1UWB A;  2GUI A;  4DQR A;  4Y1D A;  3RR7 A;  3VQA A;  1HNI A;  5DMR A;  4YNQ A;  1TAU A;  2KFN A;  3SI6 A;  3IRX A;  3O4N A;  2HVH A;  2JLE A;  3S3N A;  2XY6 A;  5J2N A;  3LP0 A;  4CGI A;  4FLY A;  4IG3 A;  3DRR A;  1WSI A;  3O3H A;  1W9H A;  4BDY A;  2JGU A;  2EX3 A;  3KLE A;  1VSK A;  3F9K A;  2YKN A;  4KHW A;  2BGG A;  1N5Y A;  1CZ9 A;  4DTX A;  4CJW A;  1NK6 A;  1LAW A;  3AA2 A;  3VQB A;  2GBZ A;  1NOY A;  4FJG A;  4JS4 A;  2KZM A;  2HND A;  1CLQ A;  1VSF A;  1IKX A;  1LWC A;  5KTQ A;  4M41 A;  2B6A A;  3ZSW A;  4JS5 A;  1T03 A;  4B9U A;  3C6U A;  1YTU A;  2PZS A;  4E7J A;  2RF2 A;  4DG1 A;  1D9F A;  4B9V A;  1RT2 A;  4FLU A;  2Z1H A;  3ZSZ A;  4FJM A;  3L3V A;  4KHS A;  3BGR A;  3VQP A;  4DSJ A;  4QOZ B;  2O4I A;  1KTQ A;  4CFC A;  4CF2 A;  1TV6 A;  3VQ8 A;  4DSF A;  1J5O A;  2G8F A;  2HVI A;  2IOC A;  4CHY A;  4HTU A;  1BI4 B;  1BCM A;  4CF0 A;  3TAR A;  1EET A;  1G15 A;  2FBY A;  3OY9 A;  3WNH A;  5JS2 A;  3ZSV A;  1TK8 A;  4NYF A;  3SCX A;  4CFD A;  4DQP A;  2KFZ A;  3OYK A;  3V9S A;  4CHQ A;  3NDK A;  4EZ9 A;  3F73 A;  2KTQ A;  1KFS A;  3HVR A;  3I0R A;  1C0U A;  1F21 A;  1LW2 A;  4GVM A;  4LH4 A;  4OGC A;  1NJX A;  3KLF A;  5CY4 A;  3QET A;  4IFY A;  3HPO A;  2IAJ A;  4J2D A;  3NF6 A;  4CGF A;  1BIZ A;  2Q3S A;  2X78 A;  3NGI A;  3OYD A;  4FJ9 A;  4AHT A;  3AVL A;  2Z1I A;  2ATQ A;  4KB0 A;  4RW4 A;  3TAM A;  4Z4F A;  2Y1I A;  4LY7 A;  2ZQB A;  3PX6 A;  4AHU A;  3D45 A;  4Z4H A;  4EP5 A;  3AVM A;  4B3O A;  3C94 A;  1X9M A;  3LPT A;  2VWK A;  2DFH A;  2Z1J A;  3NFA A;  4FJX A;  3TAN A;  3OYE A;  1NJZ A;  3HK2 A;  4HUG A;  2D5R A;  3AVI A;  3M8Q A;  1Z26 A;  2YNF A;  5J2Q A;  2X74 A;  4C8M A;  4B08 A;  3HPG A;  4CHP A;  4JRP A;  3SQ0 A;  1BGX T;  4HCC A;  4M3Y A;  4MFB A;  4LD0 A;  3OVN A;  2YKM A;  5HRP A;  1A5W A;  1JLC A;  3TR8 A;  3D0P A;  3RRH A;  1NJY A;  4FZX C;  3DLE A;  4M45 A;  1C1A A;  3QER A;  3OS1 A;  1HYV A;  4CES A;  3TAP A;  1IKV A;  4BDP A;  1TKZ A;  4CIF A;  1T8E A;  4E7K A;  4DU4 A;  2F96 A;  4F2R A;  4FJ8 A;  4E89 A;  1XI1 A;  3V1O A;  3V4I A;  4CK3 A;  3VQ6 A;  4B9N A;  3KLH A;  1ZBU A;  3ISN C;  3DYA A;  3M8S A;  5CZ2 A;  1HJR A;  1KFD A;  3AO4 A;  4XIU A;  4QCL A;  3HM9 A;  1VRT A;  4CF8 A;  4CJL A;  3K2P A;  3K58 A;  2Y1J A;  1JLG A;  2Z1G A;  1JLB A;  4B8C A;  1GOC A;  3ZT3 A;  3AVJ A;  1S1U A;  4IKF A;  5CYQ A;  1QQC A;  1EXQ A;  3WNE A;  4CHO A;  3SNN A;  4H8K A;  3VQ7 A;  2HHS A;  3I0S A;  1WLJ A;  1S6Q A;  3DLR A;  1KLM A;  3VA0 A;  4RG8 A;  4ZHR A;  3E01 A;  1XWL A;  3HYF A;  4CJK A;  3KKS A;  4G1Q A;  5KRT A;  5DK5 A;  3OYN A;  3V81 A;  2WON A;  3LWL A;  4DTR A;  1X9S A;  4KHN A;  4R5P A;  5D3G A;  1JL1 A;  4B8A B;  3K5L A;  3RMA A;  1SL0 A;  4FJH A;  3DLG A;  1LWE A;  4FLV A;  4MQ3 A;  3ZSO A;  3AO3 A;  3TAB A;  4AHV A;  2F8S A;  1WSG A;  3P5J A;  2YV0 X;  1FKO A;  2KQ2 A;  5C25 A;  3U3Y A;  4F2S A;  3EY1 A;  4CFB A;  2A1S A;  2YNI A;  1ZBL A;  1ZBH A;  3VQQ A;  3NH2 A;  3LAL A;  1HQE A;  2IC3 A;  1SV5 A;  4Y1C A;  1S1W A;  3TAQ A;  4CJU A;  2I5J A;  3HJF A;  4ID1 A;  3CM6 A;  3LP1 A;  3SZ2 A;  2HHX A;  2O4G A;  2P5G A;  1U04 A;  2WOM A;  4KRF A;  3FFI A;  3NE6 A;  1TK0 A;  1WSE A;  4DS4 A;  3C6T A;  2XHB A;  1JXE A;  4FJN A;  1GOA A;  3L2Q A;  3RMC A;  1A5V A;  3KK3 A;  1U4B A;  1C0T A;  5CZ1 A;  2G8H A;  1RTD A;  1SKW A;  1NK8 A;  2HMI A;  3OYB A;  4FVM A;  1KCF A;  2OPR A;  1T7P A;  1K6Y A;  3AO5 A;  1BQN A;  3EYZ A;  4Z0U A;  3HT3 A;  1BI4 A;  2OA8 A;  2LSN A;  4CEQ A;  1L5U A;  3NF7 A;  4HUE A;  2FBV A;  1JLE A;  1RTI A;  3NBP A;  1L3T A;  4CK2 A;  3LPU A;  4CF9 A;  1SKS A;  5E41 A;  3SYZ A;  1VK0 A;  4J2E A;  4LSL A;  4CJ5 A;  4CJ4 A;  4O0I A;  3OYF A;  4CJR A;  3QLH A;  3TAG A;  4BE1 A;  3QEI A;  3QIP A;  3ULD A;  4HHT A;  4AH9 A;  4DQQ A;  2HHQ A;  1ZBF A;  3G10 A;  1SUQ A;  4C8O A;  3DI6 A;  3ZSQ A;  4AHC A;  1L3V A;  4KTQ A;  4FM0 A;  3L2U A;  3LZI A;  3T3F A;  3AA5 X;  5CYM A;  3AVC A;  3HVT A;  3IS9 A;  4OPK A;  4DTP A;  4OKK A;  3PO5 A;  1TL3 A;  4CGH A;  3AVB A;  4DSK A;  4I9Q A;  1TL1 A;  1RT6 A;  2X6N A;  2E6M A;  4NCA A;  1VSH A;  4RW9 A;  1ASV A;  1RCH A;  1NKC A;  1U49 A;  2HHT A;  3WNF A;  2X6S A;  5HRR A;  1KRP A;  2HNZ A;  3TI0 A;  4FJ5 A;  4GMJ B;  2DFF A;  4PY5 A;  4OJR A;  1WSJ A;  4CHN A;  2YNH A;  4DQS A;  4L8R B;  3NCI A;  1IKY A;  4C8N A;  4LSN A;  4RW7 A;  4E7H A;  3AVH A;  5HLF A;  4FJK A;  3DRS A;  4DTO A;  3CFP A;  3ITH A;  4M3X A;  4KTZ A;  3A2F A;  4I7F A;  2G8U A;  5KGX A;  1RDA A;  1VSD A;  2ETJ A;  4W5Q A;  3AO1 A;  4TSX A;  3OYC A;  3AVK A;  4FJL A;  5KI6 A;  4I2Q A;  1NOZ A;  3NH0 A;  3SJJ A;  1UA0 A;  2QKB A;  4CEZ A;  4FK0 A;  1RT3 A;  3LAN A;  1HMV A;  3LDS A;  5I3U A;  3SUQ A;  3RTV A;  4DTN A;  2D0A A;  3B6O A;  1FXX A;  3LP2 A;  3V9Z A;  3OS0 A;  1QTM A;  4FYD A;  4JLH A;  1S1X A;  1WAF A;  1Y97 A;  1YT3 A;  1LV5 A;  4ZTF A;  4QAG A;  4BDZ A;  1NKB A;  2G8V A;  4DWI A;  3AVA A;  5C42 A;  3RR8 A;  3SV4 A;  3K5N A;  3K5M A;  3P83 D;  4N47 A;  1LW0 A;  3CQ8 A;  4CJV A;  4CJS A;  3VA3 A;  4BE0 A;  1TKT A;  4NCG A;  5C24 A;  2HW3 A;  5KRS A;  3DM2 A;  4KRE A;  4HVJ A;  4CJE A;  1X1P A;  1KSP A;  1TKX A;  1QSY A;  1ASU A;  1BQM A;  1JLA A;  3L3U A;  1T05 A;  5FRO A;  4CEF A;  3SV3 A;  3DLB A;  2IGI A;  3VQE A;  4DFJ A;  4KAZ A;  1RTH A;  1DTT A;  2HHV A;  3TWH A;  5K14 A;  2OPS A;  4DSE A;  3MED A;  2QKK A;  3CYM A;  3O3G A;  1BIS A;  3U6F A;  3V9U A;  4KI4 A;  3L8B A;  2BE2 A;  4IBN A;  2VWJ A;  1VRU A;  2ZD1 A;  3KJV A;  1SL1 A;  2KW4 A;  1S1T A;  3ASM A;  3CG7 A;  3PX0 A;  1B92 A;  4FK2 A;  3UIQ A;  3QIN A;  3SQ2 A;  2A1R A;  1RTJ A;  3JYT A;  1KLN A;  2XO7 A;  3QES A;  4Q5V A;  3MEC A;  1RT7 A;  2PYJ A;  3T19 A;  3DOL A;  4KV8 A;  1HYS A;  2DFE A;  1RT5 A;  4KHQ A;  1A5X A;  3HXM A;  4AIL C;  3ZSX A;  4ELV A;  3AA4 A;  3O3F A;  2HNY A;  4YFU A;  1KVC A;  3DLH A;  4N5S A;  3KLG A;  3QNN A;  3AV9 A;  4FW2 A;  4KHU A;  3WNG A;  4KTW A;  5HRS A;  4DFM A;  1C1B A;  1N6Q A;  4PWD A;  4CEE A;  1JL2 A;  4FLZ A;  4W5N A;  1BL3 A;  2XY5 A;  4W5T A;  2YNG A;  1RNH A;  4FM1 A;  4NCB A;  1HQU A;  2GV9 A;  1RDC A;  3PO4 A;  4Q0B A;  4FK4 A;  3CFR A;  4B9L A;  1C6V A;  4M3R A;  1CXQ A;  3LAK A;  4RW8 A;  4WE1 A;  4I9L A;  1VSI A;  3NAE A;  3V6D A;  1IO2 A;  3BDP A;  2W42 A;  4N41 A;  4CGD A;  4PA1 A;  4DFK A;  2FC0 A;  2D0B A;  2AJQ A;  2KZZ A;  4Z4I A;  3V9W A;  4KKO A;  4CEC A;  2OYQ A;  4OGE A; 
#chains in the Genus database with same CATH topology
 4CK1 A;  4CJP A;  5FPM A;  2VG7 A;  1HNZ K;  1GLL O;  1TKD A;  1CXU A;  2UU9 K;  4N76 A;  4PQU A;  1HPZ A;  4DS5 A;  2ZM6 K;  1DTQ A;  4MO5 A;  3KWG A;  4DF4 A;  4BRH A;  1TUY A;  3OBY A;  3VF6 A;  3ATU A;  3OJS A;  3SMS A;  1WOQ A;  1FK9 A;  5FPN A;  4CER A;  4E19 A;  4DTS A;  4B3M K;  4ICL A;  1RBV A;  4W5R A;  4C1N K;  4AHR A;  4DTJ A;  3CJC A;  4FJ7 A;  4CZJ A;  2E5L K;  2E8A A;  3CI5 A;  1XMO K;  1VQ4 N;  3L4I A;  4CEO A;  4ID5 A;  1J5E K;  3B6P A;  2O8C A;  4PUO A;  3EN9 A;  4FLX A;  1O13 A;  1E4F T;  2GWJ A;  1WB9 A;  2BUP A;  1KQS M;  4DR5 K;  1IH7 A;  4F3T A;  1I3A A;  2NZT A;  3FZL A;  2GX9 A;  4F4K A;  2HB5 A;  3LDN A;  1HRH A;  1IG9 A;  3DLK A;  3J80 O;  3LDL A;  4U67 L;  1XMQ K;  3ZX0 A;  3ENB A;  4NB4 A;  1NK5 A;  3VF4 A;  3OYG A;  3OYH A;  3LM9 A;  4RTF D;  1EKE A;  4CBX A;  1BO5 O;  3ZT1 A;  4JYA K;  4B9Q A;  3S41 A;  2V52 B;  3O1B A;  4IFV A;  4JI0 K;  1HUX A;  2QTD A;  2O8F A;  4LC9 B;  3PX4 A;  4O55 A;  4FZY A;  3L4Q A;  1BUP A;  1W0H A;  4IDH A;  4CD3 A;  2ZE2 A;  3H45 C;  5J1E A;  3CCS N;  3JS6 A;  4DF8 A;  2I7P A;  4BC5 A;  4E1M A;  4NLC A;  4CFA A;  3HST B;  1BCO A;  5FDL A;  3SPZ A;  4AHS A;  1MWK A;  2Q31 A;  1C1C A;  4NYN A;  3P31 A;  4M7Y A;  5HBM A;  2D1K A;  1W2B M;  4JNE A;  4A57 A;  1XNR K;  3WEE B;  3MWP A;  4BWJ A;  3T1A A;  4YOW A;  4BRI A;  4JV5 K;  3UKU B;  4CEA A;  1ZYQ A;  4FJJ A;  4M42 A;  3MX2 A;  1SL2 A;  2HBJ A;  4KPY A;  3U9D A;  4B1Z A;  3PV8 A;  3LWM A;  3QFP A;  2QWR A;  3PSI A;  1GLB G;  3TSQ A;  5C2D A;  4DV6 K;  1Z25 A;  3OYA A;  4WFN L;  1O1W A;  3MK6 A;  4CIG A;  2VWB A;  3RWU A;  5AQY A;  2EHG A;  1NK7 A;  2YHX A;  3OJU A;  1GLD G;  4EAH D;  3SUO A;  4DSL A;  1NGG A;  3VET A;  5M1Q A;  3QB0 A;  2VQE K;  4CJQ A;  3AVN A;  1QHT A;  3F2K A;  4NLB A;  4DLE A;  3S3O A;  2ASP A;  4B1X B;  4OKJ A;  3OS2 A;  3SUN A;  1RDW X;  1XHX A;  3M5R A;  2GUI A;  4Y1D A;  5AQF A;  3S3N A;  5ADX A;  4FLY A;  3WXK A;  3DRR A;  1WSI A;  4BDY A;  1VSK A;  3F9K A;  2YKN A;  1NGC A;  3D2F B;  3GG4 A;  3H46 O;  3HM8 A;  1CZ9 A;  4DTX A;  2A6A A;  4H5T A;  4CJW A;  3CCQ N;  1NK6 A;  1LAW A;  2KZM A;  4FJG A;  5FLX O;  2QWP A;  1T03 A;  3HBT A;  2E2P A;  3C6U A;  2PZS A;  4DG1 A;  1D9F A;  4CD1 A;  4FLU A;  1E4G T;  3EKS A;  3UKR A;  4PKG A;  3R9P A;  1KTQ A;  1TV6 A;  3VQ8 A;  5EX5 A;  3HZ6 A;  1BI4 B;  1BCM A;  4CF0 A;  3TAR A;  2ZGY A;  3OY9 A;  3ZSV A;  1YI2 N;  3SCX A;  1EQY A;  3C6A A;  3VTI A;  1BA0 A;  1RGI A;  3BY5 A;  1KAZ A;  5GAE P;  2KTQ A;  3QBX A;  3CCL N;  5AQR A;  4B1Y B;  3THX B;  4CZM A;  3LL3 A;  3SMP A;  4AM7 A;  3DAW A;  2ATQ A;  3FGU A;  2ZQB A;  4FWR A;  4PL8 A;  5F2R A;  3LDP A;  4EP5 A;  4Z4H A;  3C94 A;  3LPT A;  2DFH A;  1Q7Y O;  1Q81 O;  3TAN A;  4HUG A;  1IBL K;  4B08 A;  3O9Q A;  2Q1N A;  4LFA K;  3TR8 A;  1C1A A;  1IKV A;  2D0P A;  4KH5 A;  4CK3 A;  4B9N A;  3KLH A;  3HSC A;  4A5A A;  3K0S A;  3M8S A;  5AZJ B;  3AO4 A;  1KFD A;  3FLC O;  4H5V A;  4LF4 K;  4QCL A;  3HM9 A;  4CF8 A;  3K2P A;  1N33 K;  4A61 A;  2O8E A;  1JLG A;  5AQO A;  5CYQ A;  2P9U A;  4DCH A;  4H8K A;  3I0S A;  1WLJ A;  4K0K K;  2WFB A;  2A5X A;  4CJK A;  3V81 A;  2WON A;  4KHN A;  1VQN N;  3C7N A;  1W7A A;  1J6Z A;  4FJH A;  4B8A B;  3RMA A;  1HKG A;  4KKO A;  2V51 B;  1LWE A;  4MQ3 A;  2F8S A;  4LF5 K;  1WSG A;  2Q0R A;  1FKO A;  4DHY A;  1T6C A;  2OAN A;  3VGM A;  4LFB K;  2A1S A;  2YNI A;  1ZBH A;  3MN9 A;  4FL9 A;  4HTL A;  2P9K B;  3J8A A;  4ID1 A;  3CM6 A;  4BC2 A;  3SZ2 A;  5AQM A;  2WOM A;  3NE6 A;  4PL7 A;  2XHB A;  5BRE A;  5IT9 O;  2NRR A;  4CJ7 A;  4FJN A;  1GOA A;  3KK3 A;  2JWL A;  1U4B A;  2G8H A;  1SKW A;  2RE2 A;  3P38 A;  3OYB A;  2HMI A;  2OPR A;  3CCR N;  3AO5 A;  4Z0U A;  1KC8 O;  1HR0 K;  3CJ9 A;  1L5U A;  4HUE A;  1JLE A;  3VER A;  4FPA A;  3LPU A;  4BR7 A;  5GAD P;  4JKB A;  1ATR A;  2BH1 A;  3THY A;  1HPM A;  3QLH A;  3TAG A;  4AH9 A;  4DQQ A;  1SUQ A;  3DI6 A;  4IOX A;  4KTQ A;  4FM0 A;  3N4Q A;  3LZI A;  5AQG A;  1VQM N;  4UY8 O;  2UXD K;  3AVB A;  4DSK A;  3L6Q A;  1TL1 A;  1RT6 A;  1T44 A;  2NRW A;  4RW9 A;  1ASV A;  1NKC A;  2HHT A;  3MN6 A;  1KRP A;  4GMJ B;  1NU0 A;  2YX6 A;  3NCI A;  3MWT A;  3UE5 A;  4C8N A;  1VQ6 N;  3BF3 A;  5AQK A;  4KTZ A;  3VEV A;  1N36 K;  5JVG L;  3AO1 A;  3ID8 A;  4TSX A;  4GKJ K;  1NOZ A;  1UA0 A;  4CEZ A;  2WC9 A;  2JWK A;  3OS0 A;  1WAF A;  4LFC K;  1DKG D;  4YOR A;  3OA9 A;  4BDZ A;  4DWI A;  4LF7 K;  4DV4 K;  3M6G A;  2W6L A;  5M1P A;  1LW0 A;  4CJS A;  4H03 B;  5C24 A;  3LDQ A;  3O8M A;  1TKX A;  4DQ8 A;  1QSY A;  3EEQ A;  3L3U A;  1T05 A;  5FRO A;  2IGI A;  3VQE A;  2ZGZ A;  4DR3 K;  1Q86 O;  1SZ2 A;  3TWH A;  3MED A;  3CYM A;  1BIS A;  4KI4 A;  2IVP A;  3CCU N;  1VRU A;  3CG7 A;  3ULE A;  3SQ2 A;  2VGN A;  1XQS C;  4WYB A;  2XO7 A;  3QES A;  4WQ5 A;  3R1X A;  3T19 A;  4KV8 A;  4IO9 L;  1EWQ A;  2DFE A;  1QZ5 A;  1RT5 A;  3DXK B;  4EFH A;  3SLC A;  4KHQ A;  5HOO A;  3ZSX A;  4AIL C;  1SQK A;  4YFU A;  2HST A;  1KVC A;  3PSF A;  2QM1 A;  3WNG A;  1HKC A;  5HRS A;  4DFM A;  3SJH A;  1BL3 A;  4W5T A;  2YNG A;  3PO4 A;  1C6V A;  5JIC A;  2F7T A;  1CXQ A;  3LAK A;  4DR4 K;  1I94 K;  4KH4 A;  1IO2 A;  5BN9 A;  2W42 A;  4DFK A;  2D0B A;  3C65 A;  3V9W A;  1NMD A;  3VGK A;  4OGE A;  3HTV A;  1TK5 A;  3MEE A;  4E1N A;  2IVO A;  2AA4 A;  4JI1 K;  5HRN A;  2P9U B;  1E3M A;  1EX4 A;  1HNV A;  1RIL A;  4KHY A;  3QEV A;  3OYJ A;  3DMJ A;  2OZM A;  3DLL L;  1MU2 A;  2E88 A;  1NGB A;  2H3G X;  3VQ9 A;  4BG9 A;  2DY4 A;  5TKW A;  3C7N B;  4QS7 A;  2XY7 A;  1VHX A;  3KKR A;  2P9I B;  5T7B A;  2GEL A;  1J54 A;  3TAF A;  1ASW A;  4A5B A;  4FLW A;  4LH5 A;  4CGG A;  4RWT A;  3K57 A;  3O1W A;  1GLJ O;  1JCE A;  2ITG A;  4IO8 A;  3P1G A;  2G8K A;  2HHW A;  1RDD A;  1JKH A;  2ZWH A;  2NLX A;  3SUP A;  4GNI A;  1WAJ A;  3TAE A;  1N32 K;  4CBW A;  4ISG A;  1QVF M;  4H0X B;  4IFE A;  3V1R A;  1JLF A;  3MCA B;  5E26 A;  1S9E A;  1NG9 A;  4EP4 A;  3W3D A;  1HX1 A;  2BTF A;  3ZT4 A;  4FOI A;  1TVR A;  4BQZ A;  4X64 K;  4B9T A;  2RKI A;  1HNX K;  4CJF A;  3WQU A;  1VSE A;  3D2E A;  3HPH A;  1HYZ A;  5AQL A;  3M8P A;  2PYJ A;  4B9V A;  4M3T A;  4O5B A;  3AVF A;  2P9N B;  2IS3 A;  3MXM A;  4OPJ A;  2W40 A;  1DLO A;  2P51 A;  2E20 A;  4X66 K;  4FCY A;  4CIE A;  3HP9 A;  1VQ8 N;  5AZI A;  3N4P A;  4H4O A;  5HP1 A;  3CC7 N;  1YAG A;  5EU7 A;  4EZ6 A;  1VSM A;  2Q36 A;  4BR4 A;  2O8D A;  3NGY A;  4Z4G A;  5BPM A;  1U6Z A;  1RBS A;  4JK8 A;  2NNW A;  3AVG A;  1D9D A;  4BRQ A;  4FZZ A;  3AAQ A;  5C15 A;  2E1Z A;  4O0J A;  3E9O A;  4BRD A;  4JKG B;  3IDH A;  3ZSR A;  2DTU A;  4X65 K;  1MDU B;  3VF2 A;  1B9D A;  4BR0 A;  1QSS A;  2PYL A;  1KVB A;  3SQ1 A;  4O8U A;  5HRO A;  4FLT A;  1U48 A;  3ZCM A;  3S9H A;  1TAQ A;  2B5J A;  5KGW A;  1REV A;  2HBK A;  1BIU A;  4H0T B;  1KVA A;  4W5O A;  1J53 A;  5BRD A;  2BDP A;  3PY8 A;  4JD2 B;  2OPP A;  5LMN K;  5J2P A;  1RT1 A;  3VQ5 A;  3NHG A;  3ZX2 A;  3ZET A;  4G9Z A;  4M63 C;  3DXM A;  3AGR A;  4BRE A;  2G8W A;  4NXN K;  3JSM A;  3DWL A;  1RBT A;  3H08 A;  4O44 A;  5FRN A;  3QEW A;  3HO1 A;  3CPE A;  3DOK A;  3QBW A;  3ULE B;  4B3S K;  3NVK A;  4DQI A;  4C8L A;  1NK9 A;  3PUF A;  3KTQ A;  3AO2 A;  4O8K A;  3TU5 A;  3O80 A;  1YTA A;  3OYL A;  1ATN A;  4JEP A;  4KH6 A;  4YOT A;  3NF8 A;  1IBM K;  4BR9 A;  2E1Y A;  5BR9 A;  3U3G A;  1HNI A;  1BU6 O;  5DMR A;  2KFN A;  3THW A;  2HVH A;  1EWR A;  2JLE A;  5J2N A;  3LP0 A;  4FSV A;  4IG3 A;  1NGA A;  3SBG A;  3VEY A;  1W9H A;  3KLE A;  4FWN A;  4KHW A;  2BGG A;  2P9P B;  3AA2 A;  5LJW A;  1NOY A;  3C0B A;  4JKC A;  5KTQ A;  4M41 A;  3ZSW A;  4JS5 A;  5LY3 A;  4JI4 K;  4E7J A;  1M90 O;  1RT2 A;  2CGJ A;  2Z1H A;  1T3V A;  3ZSZ A;  4BY9 C;  4FJM A;  3L3V A;  2PBD A;  3BGR A;  3TTF A;  3PLA A;  2EWS A;  4CF2 A;  4DSF A;  1YIJ N;  4HTU A;  3SAF A;  1EET A;  2FBY A;  3G6E N;  1GLC G;  5JS2 A;  1TK8 A;  1H1V A;  3O5B A;  4CVN E;  4YDU A;  4ISE A;  4CHQ A;  4PHT X;  1NGD A;  1KFS A;  5EY4 A;  3HVR A;  3I0R A;  1C0U A;  1LW2 A;  4GVM A;  4LH4 A;  1NJX A;  4OPH A;  5CY4 A;  3RSE A;  3QET A;  2IAJ A;  4J2D A;  4DV1 K;  3NGI A;  3GE1 A;  2Z1I A;  4YOX A;  5GAH P;  4Z4F A;  4H5N A;  4AHU A;  3K9J A;  2NRH A;  3AVM A;  4B3O A;  4FJX A;  4BQL A;  1BWF O;  3HK2 A;  1Z26 A;  2YNF A;  5E84 A;  3SQ0 A;  3HPG A;  4CHP A;  2QEX N;  4M3Y A;  4MFB A;  2YKM A;  1JLC A;  3D0P A;  4PKH A;  3QER A;  5AQP A;  3R6M A;  1TKZ A;  4E7K A;  3WUH A;  4DU4 A;  5LMU K;  2F96 A;  4F2R A;  1XI1 A;  3V4I A;  5LJV A;  3VQ6 A;  2D0O A;  1VQP N;  3ZEU B;  3ISN C;  2A42 A;  4XIU A;  4WFA L;  4XH4 A;  5JLH A;  2KKZ A;  2Y1J A;  4B8C A;  1JLB A;  1GOC A;  3AVJ A;  1EXQ A;  3D2E B;  4CHO A;  5M1F A;  3HI0 A;  1S6Q A;  1TYQ A;  4WQ5 C;  4A2A A;  3HYF A;  5DK5 A;  3LWL A;  5B8H A;  5AZI B;  3DLG A;  3AO3 A;  3TAB A;  4AHV A;  3P5J A;  2QWM A;  3U3Y A;  4BGA A;  4BVP A;  3EY1 A;  5ELZ A;  5BN8 A;  4CFB A;  3CF5 L;  1SV5 A;  1S1W A;  3BZC A;  3LP1 A;  5F0X A;  1TK0 A;  3EKU A;  5BRF A;  1JXE A;  4XH5 A;  1NGF A;  3L2Q A;  4BRO A;  2GEM A;  2AP1 A;  2QWO A;  4BRM A;  1BQN A;  4IEE A;  3EYZ A;  5FPE A;  4ILH A;  4LF8 K;  1YJW N;  4CEQ A;  3NF7 A;  1U2V A;  2RHK A;  4MLE A;  4OPA A;  3WQT A;  4BVO A;  4JHD B;  5KPR A;  4DR7 K;  3NBP A;  4CK2 A;  4CF9 A;  1SKS A;  5E41 A;  3EL2 A;  4CJ5 A;  4O0I A;  2VGM A;  4H5W A;  5BRH A;  1ZBF A;  3G10 A;  4K41 A;  2FXU A;  4DR1 K;  1WUA A;  4CI6 A;  3J7Y P;  4BRC A;  3T3F A;  3AA5 X;  3AAP A;  3A5N C;  3CJA A;  3HVT A;  5GIO A;  3E66 A;  2FLO A;  5AQH A;  4HWI A;  1DGK N;  2J4R A;  4I9Q A;  2E6M A;  1VSH A;  3O9R A;  3WNF A;  1NGE A;  4FJ5 A;  1S22 A;  4L8R B;  1IKY A;  4R79 A;  5KPZ A;  5HLF A;  3DRS A;  4ILG B;  3T1Y K;  1K8K A;  4JI7 K;  4I7F A;  3VEN A;  3MMV A;  5KGX A;  1VSD A;  2ETJ A;  4JKE A;  5I9E B;  3NH0 A;  1Z05 A;  4JKF A;  2UYT A;  3LDS A;  5I3U A;  2CH6 A;  5A2Q O;  1KXP A;  2O8C B;  4DTN A;  3B6O A;  3LP2 A;  3V9Z A;  1QTM A;  4FYD A;  1S1X A;  1Y97 A;  1YT3 A;  3E9P A;  1ESV A;  1XNQ K;  3RR8 A;  3K5N A;  4N47 A;  3G25 A;  3U4L A;  4BE0 A;  1TKT A;  4KRE A;  4HVJ A;  2HF4 A;  1X1P A;  1KSP A;  1JLA A;  5GAG P;  1C0F A;  3SV3 A;  3DLB A;  1DTT A;  4GKK K;  3VMF B;  2BE2 A;  2CH5 A;  4IBN A;  3RSE B;  5KQD A;  2VWJ A;  2ZD1 A;  3KJV A;  3PX0 A;  3ASM A;  2FSK A;  1V4S A;  2A1R A;  1N34 K;  4FOE A;  2F9W A;  4I6M A;  2CGK A;  3MN5 A;  5AFU H;  3DOL A;  4IJN A;  4DV5 K;  2O8F B;  5M1N A;  4MO4 A;  3A5L C;  3HXM A;  5GIN A;  1RDU A;  4ELV A;  3TTC A;  2ZJR L;  4FPB A;  3KLG A;  1IJJ A;  4KHU A;  3AV9 A;  1N6Q A;  2OCE A;  3CIP A;  1HKB A;  2NRZ A;  1MA9 B;  2FF6 A;  3VOV A;  4IOA L;  1HQU A;  3CQY A;  3CFR A;  4RW8 A;  4WE1 A;  4I9L A;  5AQJ A;  3NAE A;  4PA1 A;  2CGL A;  4GV3 A;  4CEC A;  4GV6 A;  4J2B A;  5EVZ A;  2Q0U A;  3CJ7 A;  4X62 K;  1TYQ B;  1EP4 A;  4AQY K;  1NK4 A;  3KWI A;  4DKW A;  1Q9X A;  1OH5 A;  3KD5 E;  4J2A A;  3KK7 A;  1R59 O;  4WCE L;  3QEP A;  4F8R A;  2YHY A;  4HUF A;  1X3N A;  1XC9 A;  1BG3 A;  2P9S A;  4XEI A;  3LDO A;  1VQ9 N;  1W97 L;  4K8Z A;  3D7E O;  1S1V A;  1S6P A;  2ZF5 O;  3LP3 A;  3S3M A;  5JS1 A;  4CZL A;  3I33 A;  4KB1 A;  1K9M O;  5AQQ A;  4F3O A;  1NKE A;  3MAQ A;  4GW6 A;  2HBM A;  1RT4 A;  3NF9 A;  3VEX A;  2RPI A;  3KK1 A;  4CEB A;  2ASM A;  4H0V B;  1WN7 A;  1S9G A;  3RMD A;  1IBK K;  3VQC A;  2P9L A;  1WSH A;  3K59 A;  2FBT A;  1VSL A;  3O08 A;  3CCM N;  4YDU C;  1FKP A;  3L2R A;  3ENH A;  2QXF A;  4BWM A;  2D0C A;  3P39 A;  3TSU A;  4OVL A;  1YVU A;  1R0A A;  1U45 A;  4E1J A;  1GLF O;  4IG0 A;  3WXJ A;  3L2V A;  1C0M A;  5AQI A;  3LM2 A;  3JAM O;  3UKR B;  1U47 A;  1VQ5 N;  1VSJ A;  2E2N A;  1GOB A;  2IVN A;  1B9F A;  2P1J A;  2R7Y A;  3FR0 A;  4WQ4 A;  1HNW K;  2E6L A;  3CER A;  4CJ3 A;  3EZ5 A;  1YJ9 N;  1SKR A;  3HL8 A;  3WXL A;  3QO9 A;  2HF3 A;  1ITG A;  4EHT A;  1NJW A;  3VQD A;  4DU1 A;  3SQ4 A;  2DPN A;  1ZBI A;  4DV3 K;  2F9T A;  3QNO A;  3AA3 A;  1D4X A;  2HOE A;  4UQG A;  1WSF A;  3PIP L;  4CED A;  3B8A X;  4B9S A;  1TGO A;  3V1Q A;  2GWK A;  1OVQ A;  3LAM A;  1WBD A;  1BHL A;  2NUB A;  1UOC A;  4BRP A;  1I39 A;  4ELU A;  3O4Q A;  4A2B A;  3LZJ A;  1Q82 O;  1JLQ A;  4WFB L;  4KFB A;  2O8E B;  3FZF A;  5C2F A;  4IOC L;  1IKW A;  1LAV A;  5MLC Q;  3NGZ A;  3OYI A;  5CE3 A;  4K42 A;  1RBU A;  4JRQ A;  2F8T A;  4Z4C A;  1Q8I A;  4JK9 A;  4C8K A;  4RW6 A;  4ZTJ A;  3I56 N;  4E0D A;  3CCJ N;  4DFP A;  1NK0 A;  1WNS A;  3J81 O;  2YCH A;  3NH1 A;  4A62 A;  5AQS A;  4B3T K;  5SZT A;  3MCP A;  1UWB A;  3RR7 A;  1Z6R A;  4YNQ A;  2XY6 A;  4CGI A;  3O3H A;  1Q18 A;  3H1V X;  2JGU A;  2OTJ N;  1SS6 A;  1V4T A;  1N5Y A;  2GBZ A;  2HND A;  3P4I A;  1LWC A;  4F9O A;  1BA1 A;  5AQZ A;  4JK7 A;  5KQ8 A;  1JCG A;  2RF2 A;  1BOT O;  1K73 O;  4DSJ A;  2G8F A;  3KVG A;  1J5O A;  4CHY A;  3L0Q A;  3QFU A;  3HRG A;  3OYK A;  4L3Q A;  3V9S A;  2NRX A;  3NDK A;  4EZ9 A;  4FVU A;  4OGC A;  3THY B;  5EOY A;  3KLF A;  3HPO A;  1OH8 A;  3NF6 A;  2E2Q A;  2Q3S A;  2X78 A;  4FJ9 A;  1QHA A;  3OYD A;  3J7Z O;  3T69 A;  4RW4 A;  2Y1I A;  3D45 A;  3ENO A;  1X9M A;  4V19 S;  2E2O A;  2VWK A;  2Z1J A;  3NFA A;  3WEE A;  1NJZ A;  1T6D A;  1G99 A;  3AVI A;  3M8Q A;  1S3X A;  5J2Q A;  4C8M A;  1BGX T;  2W41 A;  3UKU A;  5HRP A;  1A5W A;  3DLE A;  4M45 A;  3WT0 A;  1HYV A;  4BDP A;  1KAY A;  5ADX H;  4CIF A;  1T8E A;  4WF9 L;  4BRK A;  3OBW A;  3G4S N;  4FJ8 A;  5HL7 L;  3DYA A;  1HJR A;  4GY2 B;  1S1U A;  5AQT A;  4JKD A;  3WNE A;  3SNN A;  3VQ7 A;  3NVM A;  1KLM A;  4FWL A;  4RG8 A;  4ZHR A;  1YHQ N;  3E01 A;  3AY9 A;  5KRT A;  4O5F A;  4R5P A;  3QML A;  4JKH A;  2YV0 X;  4IJA A;  5C25 A;  3QDK A;  3CCE N;  3M3Z A;  1ZBL A;  3VQQ A;  1ATS A;  3LAL A;  2IC3 A;  3NH2 A;  4FWQ A;  4Y1C A;  3TAQ A;  1M1K O;  2I5J A;  3HJF A;  4BGB A;  1EO1 A;  2Q2R A;  2IIR A;  2P5G A;  1U04 A;  3FFI A;  2FSN A;  4DS4 A;  3C6T A;  4AM6 A;  3RMC A;  2WBN A;  4PKI A;  4Y0W A;  1RTD A;  4DB3 A;  1KCF A;  1T7P A;  1LOT B;  1NGH A;  1BI4 A;  3BF1 A;  2OA8 A;  2LSN A;  5CHI A;  3CD6 N;  1VAZ A;  3Q7C A;  1RTI A;  4J2E A;  5CR4 A;  3SYZ A;  4LSL A;  3OYF A;  1QQM A;  2PFU A;  2VQF K;  2QXL A;  4DR2 K;  2VYP A;  4BE1 A;  3ULD A;  4HHT A;  3THX A;  2HHQ A;  4C8O A;  1XUP O;  3MX5 A;  4CZI A;  4AHC A;  4FWK A;  2WTU A;  2F4V K;  3PIO L;  4FWO A;  3VEZ A;  5JLF A;  3L2U A;  3AVC A;  3OHR A;  4DTP A;  1HLU A;  4OKK A;  1TL3 A;  4CGH A;  3PO5 A;  2X6N A;  3VGL A;  1U49 A;  2X6S A;  3QIC A;  2HNZ A;  2DFF A;  2KLA A;  4CHN A;  4QS8 A;  3T7Z A;  4RW7 A;  1TUU A;  3O9S A;  4FJK A;  2V7Y A;  4M3X A;  3MDQ A;  2WUS A;  2G8U A;  5AZJ A;  3CC4 N;  3E9L A;  4IWV A;  1KAX A;  3AVK A;  5KI6 A;  4I2Q A;  4CZG A;  3SJJ A;  2QKB A;  2YJE A;  4J8F A;  1HMV A;  3TTD A;  4IZ9 A;  1MWM A;  5AQW A;  3SUQ A;  2UXB K;  3SAH A;  3U9Z A;  1FXX A;  5DM6 L;  4GV9 A;  5AQU A;  1LV5 A;  4ZTF A;  4QAG A;  3AAR A;  1VQL N;  5C42 A;  3H1Q A;  4WQ4 C;  1OVY A;  4GVE A;  3CQ8 A;  1GLA G;  2A40 A;  3VA3 A;  5C10 A;  4B1V A;  3DM2 A;  5KRS A;  4CJE A;  3HOS A;  4JAX A;  1ASU A;  2KHO A;  1ZC6 A;  4CEF A;  4KAZ A;  3EO3 A;  2HHV A;  3NMU A;  2HBL A;  2NRT A;  3O3G A;  3U6F A;  2P9K A;  3G71 N;  3V9U A;  5JVH L;  1SL1 A;  2KW4 A;  1S1T A;  4FK2 A;  1B92 A;  3UIQ A;  1YF5 L;  4BC3 A;  1RTJ A;  3JYT A;  1BDG A;  4EIA A;  1KLN A;  1RT7 A;  1HYS A;  3T1H K;  2QW9 A;  2FF3 B;  3AA4 A;  2HNY A;  3O3F A;  4OX9 K;  3DLH A;  3ATV A;  4FWP A;  2O8D B;  3QNN A;  2HMP A;  4FW2 A;  3SK3 A;  4AF1 A;  4KTW A;  1C1B A;  4FLZ A;  4W5N A;  1C0G A;  1OH6 A;  4MDB A;  1RNH A;  4FM1 A;  1RDC A;  3BZK A;  4FK4 A;  4B9L A;  4M3R A;  1NBW A;  3V6D A;  3Q7B A;  4CGD A;  2NRV A;  2FC0 A;  2AJQ A;  2ZJQ L;  3SBT A;  2OYQ A;  3FZM A;  3DRP A;  4H4M A;  3KLI A;  2UUC K;  3W0L A;  3QEX A;  2P5O A;  4BAC A;  3I8D A;  1L3S A;  3CJB A;  4CHZ A;  5BPN A;  4E7L A;  2GTD A;  2IDO A;  1Q9Y A;  1OH7 A;  4BE2 A;  4DUY K;  3IG1 A;  5AQX A;  3ALY A;  3M1F A;  3ZET B;  3ZX3 A;  3HOT A;  3DXM B;  4H0P A;  4CZE A;  5F1X A;  3DJC A;  3EE8 A;  3MXJ A;  3CCV N;  5SWM A;  4YOU A;  5AR0 A;  1S5J A;  3MXI A;  3CJ1 A;  4E3S A;  4C1N I;  3BEX A;  4ILJ A;  5C0Y A;  1LWF A;  2XY8 A;  1CZB A;  2QWN A;  3FFK B;  2QK9 A;  2YJF A;  4IXC A;  1X9W A;  2OZS A;  3A5O C;  2RN2 A;  2VCP A;  3GBT A;  4IEI A;  4DTM A;  2UXC K;  3H3O B;  4DU3 A;  3ZT0 A;  2E4L A;  3ZT2 A;  3EE9 A;  3A5M C;  4O4G A;  3FZH A;  4B1U B;  1XHZ A;  2VG6 A;  4Z4E A;  2PY5 A;  4K43 A;  1RDB A;  4K8X A;  3THW B;  4DR6 K;  2QWQ A;  1NWK A;  4CJT A;  3KZB A;  4M3U A;  3E1Y A;  3VTH A;  3ZSY A;  3UB5 A;  4I2P A;  4JN4 A;  4FJI A;  3IAY A;  4HCB A;  3OTO K;  1FJG K;  1VQO N;  1QE1 A;  3M8R A;  1DT9 A;  4BRN A;  3MEG A;  1UAX A;  3C95 A;  3FE1 A;  2G8I A;  1JCF A;  4M3Z A;  3VN5 A;  1RFQ A;  3C6H A;  4OLA A;  1X3M A;  4CCH A;  1RBR A;  3CHW A;  4ELT A;  4KI6 A;  2VG5 A;  3G0Z A;  3MN7 A;  2Q97 A;  2O8B A;  3D6R A;  3DXK A;  4KO0 A;  3SPY A;  3RMB A;  3K5O A;  2FBX A;  3WXM B;  2BAN A;  4IDK A;  1UA1 A;  1WBB A;  4B9M A;  4OKE A;  2XRI A;  3L2W A;  4FM2 A;  2B4J A;  4FXD A;  3A8Y A;  1QS4 A;  4DV0 K;  3BUZ B;  4RCH A;  1JXB A;  1L3U A;  5FRM A;  1QZ6 A;  2QI2 A;  4DLG A;  4N56 A;  5J2M A;  4DTU A;  1QQO A;  4JKA A;  4DMN A;  2OPQ A;  1J9A A;  1D5A A;  3CM5 A;  2YHB A;  5LL6 Z;  4DSI A;  3THV A;  3KD1 E;  1ILY A;  3IMX A;  4M3W A;  4CBU A;  4FW1 A;  1D8Y A;  4CF1 A;  2P9I A;  3V9X A;  4KBO A;  1QSL A;  3OYM A;  2YHA A;  4CZH A;  4CE9 A;  3KHY A;  3EZW A;  4CGJ A;  3KIO A;  3RRG A;  4MLH A;  4E7I A;  1YIT N;  1P8Z A;  4XH1 A;  2HHH K;  2HHU A;  3GDQ A;  2I7N A;  5I42 A;  3O9T A;  4JI5 K;  3VES A;  4YOY A;  4OLB A;  3CFO A;  3KK2 A;  3HP6 A;  4JI3 K;  1NJI O;  4M7X A;  3VQ4 A;  3QIO A;  4DQR A;  3VQA A;  1TAU A;  3SI6 A;  3IRX A;  3O4N A;  2A3Z A;  3H3N O;  2EX3 A;  4EHU A;  3H6E A;  2UUB K;  4YHH K;  3VQB A;  1CLQ A;  4JS4 A;  1VSF A;  1IKX A;  3A0I X;  4JI2 K;  2B6A A;  3WXI A;  2ITM A;  1LCU A;  3O9U A;  4B9U A;  2P9N A;  1YTU A;  2GUP A;  5KPT A;  4KHS A;  3U8X A;  3VQP A;  3AGK A;  4QOZ B;  3SAG A;  2O4I A;  4CFC A;  2HVI A;  2IOC A;  4FWM A;  4C23 A;  1G15 A;  1U2V B;  4JI6 K;  3WNH A;  4NYF A;  4DUZ K;  4CFD A;  4DQP A;  2KFZ A;  4FO0 A;  1QVG M;  3F73 A;  5M1K A;  1F21 A;  4A59 A;  4IFY A;  2ZJP L;  4CGF A;  1BIZ A;  4AHT A;  3AVL A;  1VQK N;  4KB0 A;  2D4W A;  3TAM A;  4JKG A;  3FZK A;  4LY7 A;  3PX6 A;  3K9K A;  3OYE A;  2D5R A;  2X74 A;  4JRP A;  4HCC A;  4LD0 A;  3OVN A;  3RRH A;  4FZX C;  1NJY A;  4BRA A;  1CZA N;  3OS1 A;  4CES A;  3TAP A;  3GOI A;  4DV7 K;  1OKJ A;  2QWL A;  4E89 A;  1ZXO A;  4JD2 A;  3V1O A;  1K8K B;  1ZBU A;  5CZ2 A;  3O4W A;  1VRT A;  4CJL A;  3K58 A;  4BRL A;  1YXQ A;  4BG8 A;  2Z1G A;  3ZT3 A;  4KHP K;  1X9J A;  3GL1 A;  4IKF A;  3IUC A;  1KD1 O;  2O8B B;  1QQC A;  2HHS A;  1NNE A;  1K8A O;  3DLR A;  4QS9 A;  3ID6 A;  3VA0 A;  1XWL A;  1YVN A;  3KKS A;  4G1Q A;  3BP8 A;  3OYN A;  1X9S A;  4DTR A;  5D3G A;  1JL1 A;  3K5L A;  1SL0 A;  4FLV A;  3ZSO A;  3CXC M;  2KQ2 A;  4F2S A;  4JI8 K;  3TPQ A;  2UUA K;  3O6W A;  1HQE A;  5H1S Q;  4CJU A;  1YJN N;  4Z94 A;  3ZYY X;  2P9P A;  3CME N;  2HHX A;  2O4G A;  3J7A P;  3VEW A;  4KRF A;  4NXM K;  3IKM A;  3F9M A;  1WSE A;  3IFR A;  4B3R K;  4I6M B;  1A5V A;  5TKY A;  1C0T A;  5CZ1 A;  1SAZ A;  1NK8 A;  4FVM A;  1NGJ A;  1K6Y A;  5BR8 K;  1JJ2 M;  4LF6 K;  3R8E A;  3HT3 A;  5JMV A;  5AJ3 K;  5DM7 L;  2FBV A;  4BRG A;  4K25 A;  1L3T A;  1VK0 A;  3CMA N;  4CJ4 A;  5C12 A;  1XC3 A;  4CJR A;  4ISF A;  4H5R A;  3QEI A;  3QIP A;  4YOV A;  3ZSQ A;  1L3V A;  2PAV A;  5CYM A;  4OPK A;  3IS9 A;  3OW2 M;  4CZK A;  1HJO A;  4NCA A;  4BC4 A;  1RCH A;  3R3L A;  1N8R O;  1IV0 A;  5AQN A;  4H0O A;  5AFU A;  5HRR A;  5FPD A;  3TI0 A;  2ASO A;  4PY5 A;  4OJR A;  1WSJ A;  4DQS A;  2YNH A;  3F5T A;  4BR2 A;  2YHW A;  3CC2 N;  4LSN A;  4E7H A;  3AVH A;  4DTO A;  3CFP A;  2P9S B;  3ITH A;  4NO7 A;  2W6K A;  4LF9 K;  3JXU A;  3A2F A;  1VQ7 N;  3ZEU A;  2OTL N;  1RDA A;  4W5Q A;  3OYC A;  3I55 N;  4FJL A;  5IWA K;  4OO1 J;  4U7B A;  4FK0 A;  1RT3 A;  1ZBS A;  3LAN A;  3RTV A;  2D0A A;  5AQV A;  4JLH A;  4BRF A;  3VPZ A;  1P90 A;  2P9L B;  1GLE G;  2FSJ A;  1NKB A;  2G8V A;  3AVA A;  4H0Y B;  1DEJ A;  3SV4 A;  3K5M A;  3P83 D;  3RVC A;  5GIP A;  4DV2 K;  4CJV A;  3CQX A;  4NCG A;  2HW3 A;  1NMN A;  3ZLJ A;  1BQM A;  4CW7 B;  4DFJ A;  1RTH A;  4FWS A;  1IG8 A;  5EXW A;  5K14 A;  2OPS A;  4DSE A;  5M1O A;  2QKK A;  3L8B A;  4CZF A;  2V7Z A;  2YI1 A;  3QIN A;  1NLV A;  1NGI A;  1QQN A;  3CET A;  4Q5V A;  3MEC A;  3VEO A;  1Y64 A;  1NM1 A;  1A5X A;  3CPW M;  4YY3 K;  5BPL A;  3I8B A;  4N5S A;  2A41 A;  4PWD A;  4CEE A;  1JL2 A;  2QA4 N;  1YUW A;  2XY5 A;  1FW6 A;  4JHD A;  3D2F A;  4NCB A;  2GV9 A;  4Q0B A;  4B1W B;  1VSI A;  3TSP A;  4N41 A;  3BDP A;  1S72 N;  4BR5 A;  2KZZ A;  4Z4I A;  4MDA A; 
#chains in the Genus database with same CATH homology
 3DRP A;  4H4M A;  4CK1 A;  1TK5 A;  3KLI A;  4CJP A;  3MEE A;  4E1N A;  4J2B A;  2VG7 A;  3QEX A;  5HRN A;  2P5O A;  1TKD A;  1EX4 A;  1CXU A;  1HNV A;  1RIL A;  4BAC A;  4KHY A;  3I8D A;  3OYJ A;  3QEV A;  4N76 A;  4PQU A;  1HPZ A;  1EP4 A;  3DMJ A;  4DS5 A;  1L3S A;  1NK4 A;  2OZM A;  1MU2 A;  1Q9X A;  4CHZ A;  4E7L A;  1DTQ A;  1Q9Y A;  2IDO A;  3VQ9 A;  4DF4 A;  2DY4 A;  3OJS A;  3KD5 E;  2XY7 A;  4J2A A;  4BE2 A;  3KKR A;  1FK9 A;  3IG1 A;  4CER A;  3QEP A;  5T7B A;  4HUF A;  4F8R A;  4E19 A;  1XC9 A;  3ALY A;  4DTS A;  1J54 A;  4ICL A;  3TAF A;  1RBV A;  1ASW A;  4W5R A;  4AHR A;  4FLW A;  4DTJ A;  4K8Z A;  4LH5 A;  4FJ7 A;  1S1V A;  1S6P A;  3MXJ A;  3LP3 A;  4CGG A;  3S3M A;  5JS1 A;  5SWM A;  3K57 A;  4KB1 A;  1S5J A;  3MXI A;  4F3O A;  1NKE A;  4CEO A;  3MAQ A;  4GW6 A;  4ID5 A;  4E3S A;  1RT4 A;  2ITG A;  3NF9 A;  2RPI A;  3P1G A;  4CEB A;  3KK1 A;  2G8K A;  1RDD A;  1JKH A;  1LWF A;  2XY8 A;  3B6P A;  3SUP A;  1CZB A;  4PUO A;  1WN7 A;  4FLX A;  1S9G A;  2QK9 A;  1WAJ A;  3RMD A;  1X9W A;  3TAE A;  2OZS A;  3VQC A;  2RN2 A;  4DTM A;  4DU3 A;  1WSH A;  3ZT0 A;  1IH7 A;  2E4L A;  3ZT2 A;  4F3T A;  4O4G A;  1I3A A;  3K59 A;  1XHZ A;  2FBT A;  1VSL A;  2VG6 A;  4F4K A;  4Z4E A;  2PY5 A;  1RDB A;  2HB5 A;  1HRH A;  1IG9 A;  3V1R A;  4K8X A;  1FKP A;  1JLF A;  3L2R A;  1S9E A;  3DLK A;  4EP4 A;  2QXF A;  4BWM A;  2D0C A;  4CJT A;  4M3U A;  3ZSY A;  3ZT4 A;  1TVR A;  4I2P A;  4B9T A;  2RKI A;  4FJI A;  4OVL A;  3IAY A;  4CJF A;  4HCB A;  1NK5 A;  1VSE A;  1QE1 A;  1YVU A;  1HYZ A;  3HPH A;  3M8P A;  3MEG A;  3OYG A;  1UAX A;  4O5B A;  3M8R A;  3OYH A;  3AVF A;  1R0A A;  1U45 A;  4M3T A;  3C95 A;  1EKE A;  2G8I A;  4M3Z A;  2IS3 A;  4IG0 A;  3MXM A;  4OPJ A;  3VN5 A;  3ZT1 A;  1DLO A;  3L2V A;  4OLA A;  1C0M A;  4CCH A;  1RBR A;  2P51 A;  4ELT A;  4KI6 A;  4FCY A;  4CIE A;  3HP9 A;  4IFV A;  1U47 A;  2VG5 A;  1VSJ A;  3G0Z A;  1GOB A;  4H4O A;  5HP1 A;  3PX4 A;  1B9F A;  4KO0 A;  4O55 A;  3SPY A;  4FZY A;  2P1J A;  2R7Y A;  4EZ6 A;  5EU7 A;  2E6L A;  3RMB A;  1VSM A;  1W0H A;  3K5O A;  2FBX A;  4CJ3 A;  2ZE2 A;  2BAN A;  3EZ5 A;  4IDK A;  1UA1 A;  1SKR A;  3HL8 A;  3NGY A;  4Z4G A;  5J1E A;  3QO9 A;  4DF8 A;  1RBS A;  3AVG A;  1D9D A;  4E1M A;  4B9M A;  4OKE A;  1ITG A;  4FZZ A;  4CFA A;  3HST B;  2XRI A;  3L2W A;  1BCO A;  1NJW A;  5FDL A;  4FM2 A;  2B4J A;  4AHS A;  3SPZ A;  4FXD A;  4O0J A;  1QS4 A;  1C1C A;  4NYN A;  3VQD A;  4DU1 A;  5HBM A;  3SQ4 A;  1ZBI A;  3ZSR A;  3QNO A;  2DTU A;  1JXB A;  3AA3 A;  1L3U A;  5FRM A;  1B9D A;  4BWJ A;  4UQG A;  4DLG A;  1QSS A;  1KVB A;  2PYL A;  4N56 A;  1WSF A;  3SQ1 A;  5J2M A;  4CED A;  3T1A A;  4DTU A;  4B9S A;  5HRO A;  1U48 A;  4FLT A;  4DMN A;  2OPQ A;  3ZCM A;  3S9H A;  4CEA A;  1ZYQ A;  1TGO A;  1J9A A;  4FJJ A;  4M42 A;  1D5A A;  3V1Q A;  1TAQ A;  3CM5 A;  1SL2 A;  2B5J A;  2YHB A;  5KGW A;  1REV A;  1BIU A;  4DSI A;  3THV A;  1KVA A;  4W5O A;  3KD1 E;  1J53 A;  3LAM A;  4KPY A;  1BHL A;  3PV8 A;  3LWM A;  2BDP A;  2NUB A;  1UOC A;  3PY8 A;  4M3W A;  1I39 A;  2OPP A;  4ELU A;  5J2P A;  1RT1 A;  3O4Q A;  4FW1 A;  3LZJ A;  1Z25 A;  3VQ5 A;  4CF1 A;  3NHG A;  1D8Y A;  3OYA A;  1JLQ A;  3V9X A;  1QSL A;  4KFB A;  1O1W A;  3OYM A;  4CIG A;  2G8W A;  2YHA A;  3RWU A;  1IKW A;  1LAV A;  2EHG A;  3JSM A;  3NGZ A;  1NK7 A;  4CE9 A;  4CGJ A;  1RBT A;  3KIO A;  3OJU A;  3RRG A;  3H08 A;  4O44 A;  5FRN A;  3OYI A;  4E7I A;  3QEW A;  3SUO A;  3HO1 A;  4DSL A;  1RBU A;  2HHU A;  4JRQ A;  3DOK A;  2F8T A;  4Z4C A;  1Q8I A;  4DQI A;  4C8L A;  4CJQ A;  4RW6 A;  4ZTJ A;  1NK9 A;  4C8K A;  3AVN A;  3PUF A;  5I42 A;  4E0D A;  4OLB A;  3KTQ A;  3CFO A;  3AO2 A;  3KK2 A;  1QHT A;  4DLE A;  4DFP A;  3HP6 A;  3S3O A;  1NK0 A;  1WNS A;  2HHW A;  1YTA A;  3OYL A;  4OKJ A;  3OS2 A;  3VQ4 A;  3NH1 A;  3SUN A;  3NF8 A;  3QIO A;  5SZT A;  1XHX A;  3U3G A;  1UWB A;  2GUI A;  4DQR A;  4Y1D A;  3RR7 A;  3VQA A;  1HNI A;  5DMR A;  4YNQ A;  1TAU A;  2KFN A;  3SI6 A;  3IRX A;  3O4N A;  2HVH A;  2JLE A;  3S3N A;  2XY6 A;  5J2N A;  3LP0 A;  4CGI A;  4FLY A;  4IG3 A;  3DRR A;  1WSI A;  3O3H A;  1W9H A;  4BDY A;  2JGU A;  2EX3 A;  3KLE A;  1VSK A;  3F9K A;  2YKN A;  4KHW A;  2BGG A;  1N5Y A;  1CZ9 A;  4DTX A;  4CJW A;  1NK6 A;  1LAW A;  3AA2 A;  3VQB A;  2GBZ A;  1NOY A;  4FJG A;  4JS4 A;  2KZM A;  2HND A;  1CLQ A;  1VSF A;  1IKX A;  1LWC A;  5KTQ A;  4M41 A;  2B6A A;  3ZSW A;  4JS5 A;  1T03 A;  4B9U A;  3C6U A;  1YTU A;  2PZS A;  4E7J A;  2RF2 A;  4DG1 A;  1D9F A;  4B9V A;  1RT2 A;  4FLU A;  2Z1H A;  3ZSZ A;  4FJM A;  3L3V A;  4KHS A;  3BGR A;  3VQP A;  4DSJ A;  4QOZ B;  2O4I A;  1KTQ A;  4CFC A;  4CF2 A;  1TV6 A;  3VQ8 A;  4DSF A;  1J5O A;  2G8F A;  2HVI A;  2IOC A;  4CHY A;  4HTU A;  1BI4 B;  1BCM A;  4CF0 A;  3TAR A;  1EET A;  1G15 A;  2FBY A;  3OY9 A;  3WNH A;  5JS2 A;  3ZSV A;  1TK8 A;  4NYF A;  3SCX A;  4CFD A;  4DQP A;  2KFZ A;  3OYK A;  3V9S A;  4CHQ A;  3NDK A;  4EZ9 A;  3F73 A;  2KTQ A;  1KFS A;  3HVR A;  3I0R A;  1C0U A;  1F21 A;  1LW2 A;  4GVM A;  4LH4 A;  4OGC A;  1NJX A;  3KLF A;  5CY4 A;  3QET A;  4IFY A;  3HPO A;  2IAJ A;  4J2D A;  3NF6 A;  4CGF A;  1BIZ A;  2Q3S A;  2X78 A;  3NGI A;  3OYD A;  4FJ9 A;  4AHT A;  3AVL A;  2Z1I A;  2ATQ A;  4KB0 A;  4RW4 A;  3TAM A;  4Z4F A;  2Y1I A;  4LY7 A;  2ZQB A;  3PX6 A;  4AHU A;  3D45 A;  4Z4H A;  4EP5 A;  3AVM A;  4B3O A;  3C94 A;  1X9M A;  3LPT A;  2VWK A;  2DFH A;  2Z1J A;  3NFA A;  4FJX A;  3TAN A;  3OYE A;  1NJZ A;  3HK2 A;  4HUG A;  2D5R A;  3AVI A;  3M8Q A;  1Z26 A;  2YNF A;  5J2Q A;  2X74 A;  4C8M A;  4B08 A;  3HPG A;  4CHP A;  4JRP A;  3SQ0 A;  1BGX T;  4HCC A;  4M3Y A;  4MFB A;  4LD0 A;  3OVN A;  2YKM A;  5HRP A;  1A5W A;  1JLC A;  3TR8 A;  3D0P A;  3RRH A;  1NJY A;  4FZX C;  3DLE A;  4M45 A;  1C1A A;  3QER A;  3OS1 A;  1HYV A;  4CES A;  3TAP A;  1IKV A;  4BDP A;  1TKZ A;  4CIF A;  1T8E A;  4E7K A;  4DU4 A;  2F96 A;  4F2R A;  4FJ8 A;  4E89 A;  1XI1 A;  3V1O A;  3V4I A;  4CK3 A;  3VQ6 A;  4B9N A;  3KLH A;  1ZBU A;  3ISN C;  3DYA A;  3M8S A;  5CZ2 A;  1HJR A;  1KFD A;  3AO4 A;  4XIU A;  4QCL A;  3HM9 A;  1VRT A;  4CF8 A;  4CJL A;  3K2P A;  3K58 A;  2Y1J A;  1JLG A;  2Z1G A;  1JLB A;  4B8C A;  1GOC A;  3ZT3 A;  3AVJ A;  1S1U A;  4IKF A;  5CYQ A;  1QQC A;  1EXQ A;  3WNE A;  4CHO A;  3SNN A;  4H8K A;  3VQ7 A;  2HHS A;  3I0S A;  1WLJ A;  1S6Q A;  3DLR A;  1KLM A;  3VA0 A;  4RG8 A;  4ZHR A;  3E01 A;  1XWL A;  3HYF A;  4CJK A;  3KKS A;  4G1Q A;  5KRT A;  5DK5 A;  3OYN A;  3V81 A;  2WON A;  3LWL A;  4DTR A;  1X9S A;  4KHN A;  4R5P A;  5D3G A;  1JL1 A;  4B8A B;  3K5L A;  3RMA A;  1SL0 A;  4FJH A;  3DLG A;  1LWE A;  4FLV A;  4MQ3 A;  3ZSO A;  3AO3 A;  3TAB A;  4AHV A;  2F8S A;  1WSG A;  3P5J A;  2YV0 X;  1FKO A;  2KQ2 A;  5C25 A;  3U3Y A;  4F2S A;  3EY1 A;  4CFB A;  2A1S A;  2YNI A;  1ZBL A;  1ZBH A;  3VQQ A;  3NH2 A;  3LAL A;  1HQE A;  2IC3 A;  1SV5 A;  4Y1C A;  1S1W A;  3TAQ A;  4CJU A;  2I5J A;  3HJF A;  4ID1 A;  3CM6 A;  3LP1 A;  3SZ2 A;  2HHX A;  2O4G A;  2P5G A;  1U04 A;  2WOM A;  4KRF A;  3FFI A;  3NE6 A;  1TK0 A;  1WSE A;  4DS4 A;  3C6T A;  2XHB A;  1JXE A;  4FJN A;  1GOA A;  3L2Q A;  3RMC A;  1A5V A;  3KK3 A;  1U4B A;  1C0T A;  5CZ1 A;  2G8H A;  1RTD A;  1SKW A;  1NK8 A;  2HMI A;  3OYB A;  4FVM A;  1KCF A;  2OPR A;  1T7P A;  1K6Y A;  3AO5 A;  1BQN A;  3EYZ A;  4Z0U A;  3HT3 A;  1BI4 A;  2OA8 A;  2LSN A;  4CEQ A;  1L5U A;  3NF7 A;  4HUE A;  2FBV A;  1JLE A;  1RTI A;  3NBP A;  1L3T A;  4CK2 A;  3LPU A;  4CF9 A;  1SKS A;  5E41 A;  3SYZ A;  1VK0 A;  4J2E A;  4LSL A;  4CJ5 A;  4CJ4 A;  4O0I A;  3OYF A;  4CJR A;  3QLH A;  3TAG A;  4BE1 A;  3QEI A;  3QIP A;  3ULD A;  4HHT A;  4AH9 A;  4DQQ A;  2HHQ A;  1ZBF A;  3G10 A;  1SUQ A;  4C8O A;  3DI6 A;  3ZSQ A;  4AHC A;  1L3V A;  4KTQ A;  4FM0 A;  3L2U A;  3LZI A;  3T3F A;  3AA5 X;  5CYM A;  3AVC A;  3HVT A;  3IS9 A;  4OPK A;  4DTP A;  4OKK A;  3PO5 A;  1TL3 A;  4CGH A;  3AVB A;  4DSK A;  4I9Q A;  1TL1 A;  1RT6 A;  2X6N A;  2E6M A;  4NCA A;  1VSH A;  4RW9 A;  1ASV A;  1RCH A;  1NKC A;  1U49 A;  2HHT A;  3WNF A;  2X6S A;  5HRR A;  1KRP A;  2HNZ A;  3TI0 A;  4FJ5 A;  4GMJ B;  2DFF A;  4PY5 A;  4OJR A;  1WSJ A;  4CHN A;  2YNH A;  4DQS A;  4L8R B;  3NCI A;  1IKY A;  4C8N A;  4LSN A;  4RW7 A;  4E7H A;  3AVH A;  5HLF A;  4FJK A;  3DRS A;  4DTO A;  3CFP A;  3ITH A;  4M3X A;  4KTZ A;  3A2F A;  4I7F A;  2G8U A;  5KGX A;  1RDA A;  1VSD A;  2ETJ A;  4W5Q A;  3AO1 A;  4TSX A;  3OYC A;  3AVK A;  4FJL A;  5KI6 A;  4I2Q A;  1NOZ A;  3NH0 A;  3SJJ A;  1UA0 A;  2QKB A;  4CEZ A;  4FK0 A;  1RT3 A;  3LAN A;  1HMV A;  3LDS A;  5I3U A;  3SUQ A;  3RTV A;  4DTN A;  2D0A A;  3B6O A;  1FXX A;  3LP2 A;  3V9Z A;  3OS0 A;  1QTM A;  4FYD A;  4JLH A;  1S1X A;  1WAF A;  1Y97 A;  1YT3 A;  1LV5 A;  4ZTF A;  4QAG A;  4BDZ A;  1NKB A;  2G8V A;  4DWI A;  3AVA A;  5C42 A;  3RR8 A;  3SV4 A;  3K5N A;  3K5M A;  3P83 D;  4N47 A;  1LW0 A;  3CQ8 A;  4CJV A;  4CJS A;  3VA3 A;  4BE0 A;  1TKT A;  4NCG A;  5C24 A;  2HW3 A;  5KRS A;  3DM2 A;  4KRE A;  4HVJ A;  4CJE A;  1X1P A;  1KSP A;  1TKX A;  1QSY A;  1ASU A;  1BQM A;  1JLA A;  3L3U A;  1T05 A;  5FRO A;  4CEF A;  3SV3 A;  3DLB A;  2IGI A;  3VQE A;  4DFJ A;  4KAZ A;  1RTH A;  1DTT A;  2HHV A;  3TWH A;  5K14 A;  2OPS A;  4DSE A;  3MED A;  2QKK A;  3CYM A;  3O3G A;  1BIS A;  3U6F A;  3V9U A;  4KI4 A;  3L8B A;  2BE2 A;  4IBN A;  2VWJ A;  1VRU A;  2ZD1 A;  3KJV A;  1SL1 A;  2KW4 A;  1S1T A;  3ASM A;  3CG7 A;  3PX0 A;  1B92 A;  4FK2 A;  3UIQ A;  3QIN A;  3SQ2 A;  2A1R A;  1RTJ A;  3JYT A;  1KLN A;  2XO7 A;  3QES A;  4Q5V A;  3MEC A;  1RT7 A;  2PYJ A;  3T19 A;  3DOL A;  4KV8 A;  1HYS A;  2DFE A;  1RT5 A;  4KHQ A;  1A5X A;  3HXM A;  4AIL C;  3ZSX A;  4ELV A;  3AA4 A;  3O3F A;  2HNY A;  4YFU A;  1KVC A;  3DLH A;  4N5S A;  3KLG A;  3QNN A;  3AV9 A;  4FW2 A;  4KHU A;  3WNG A;  4KTW A;  5HRS A;  4DFM A;  1C1B A;  1N6Q A;  4PWD A;  4CEE A;  1JL2 A;  4FLZ A;  4W5N A;  1BL3 A;  2XY5 A;  4W5T A;  2YNG A;  1RNH A;  4FM1 A;  4NCB A;  1HQU A;  2GV9 A;  1RDC A;  3PO4 A;  4Q0B A;  4FK4 A;  3CFR A;  4B9L A;  1C6V A;  4M3R A;  1CXQ A;  3LAK A;  4RW8 A;  4WE1 A;  4I9L A;  1VSI A;  3NAE A;  3V6D A;  1IO2 A;  3BDP A;  2W42 A;  4N41 A;  4CGD A;  4PA1 A;  4DFK A;  2FC0 A;  2D0B A;  2AJQ A;  2KZZ A;  4Z4I A;  3V9W A;  4KKO A;  4CEC A;  2OYQ A;  4OGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...