3NF9A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Integrase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf9A00
1B9FA 1RBVA 3RTVA 2Z1HA 1JLFA 3AVIA 4HTUA 2DTUA 3OY9A 3NH0A 4CHPA 4CEOA 3DI6A 3V1QA 4CJKA 1WNSA 1SKWA 4CEQA 4KHQA 4UQGA 4E19A 4BDZA 4N41A 4ELVA 1CXUA 5KI6A 4EP5A 3V1RA 3EY1A 4DFKA 4Z4IA 3TABA 2ITGA 4DTNA 2WOMA 3V9XA 3MXJA 3B6OA 3HVRA 1Q9XA 5FDLA 1U48A 3OYGA 1D9FA 1RTHA 1EXQA 3AO5A 3F9KA 2E6LA 1TK0A 3AVKA 5FRNA 4LH4A 4NYNA 4IFVA 4W5NA 3LWLA 4M45A 1TAUA 3OVNA 1HQEA 4M3RA 4B9LA 3HM9A 4GMJB 3PX6A 2HVHA 1T8EA 3ITHA 4B3OA 4FJJA 4FCYA 3V81A 5KTQA 2Y1IA 4E7HA 1L3TA 2Q3SA 5E41A 1VSMA 5HRSA 4N47A 3ZT0A 4FK0A 1TL1A 1TKZA 1LV5A 4NCAA 1RDAA 3QIPA 4FLWA 3NF8A 1F21A 1Q8IA 3BGRA 3DRRA 2VG7A 1J54A 1RT6A 1K6YA 1UAXA 1VSFA 3HPOA 1CXQA 5CZ1A 3SUNA 1BI4A 1JL2A 1QS4A 1YTAA 1S6QA 3WNFA 1BI4B 3ZSRA 4OKEA 4KPYA 3KKSA 4DLEA 4DTXA 3QNOA 2KW4A 4NYFA 1BQNA 3KLEA 4AHSA 1ZBHA 4LY7A 3JYTA 4BE1A 3H08A 1S9GA 4CEZA 4CIEA 3SQ0A 5D3GA 3HO1A 3VQ4A 2XRIA 1SKSA 3UIQA 3VQ6A 1NJWA 2FBXA 3V9WA 1ZBLA 2GV9A 3HXMA 2HHTA 3OYFA 3SCXA 1G15A 4M3ZA 3NCIA 1NOYA 4DSLA 1HYZA 4M41A 1BL3A 3WNEA 1VSKA 3KKRA 4KTZA 3LDSA 4FJNA 4FZZA 1KCFA 4LH5A 1ZBIA 4CJ5A 3AVBA 4I2PA 5HROA 2X74A 2KTQA 1VSHA 3KK2A 3L3VA 1TAQA 3V9ZA 3QEPA 3QETA 2E6MA 4FZXC 1Z26A 3LP0A 4M3TA 4ZHRA 4CJ4A 1JLBA 5DK5A 4J2EA 3ZT4A 1N5YA 1D9DA 3NF6A 1S1TA 1C6VA 3LWMA 4Q5VA 1WSJA 1REVA 4FZYA 4BE0A 3QEVA 1FKOA 2G8HA 3ZSZA 2HW3A 1XC9A 3OYCA 4M3WA 4W5RA 1RDBA 4DSIA 3DLHA 4CCHA 1X9WA 2RN2A 4CECA 1RT5A 2XY7A 4DQSA 1X9SA 4KAZA 4HUEA 2W42A 2DFEA 4CJFA 1TK5A 1JLGA 4ZTFA 4HUFA 2AJQA 2BE2A 3B6PA 3AVAA 4DU1A 4IKFA 1ASUA 3DOKA 4KRFA 3M8QA 1MU2A 5K14A 4DWIA 2QKBA 1EETA 2QKKA 3PX0A 2PYJA 1NOZA 4DTRA 2IOCA 3ZSVA 3KK3A 4FJ9A 2NUBA 2ZE2A 2XHBA 3P5JA 4FK2A 1RCHA 3SPYA 4LSNA 1RTDA 4K8ZA 1YTUA 1JXBA 3ZSYA 4B9NA 2PYLA 3OYJA 3CQ8A 4F3OA 3OYDA 4I2QA 2HNZA 1JXEA 3D45A 3FFIA 3V9UA 3PUFA 3TAEA 1QTMA 1JL1A 3NH2A 4CK3A 3VA0A 1VSDA 2GBZA 4DFPA 4KHYA 4QCLA 1S1XA 3S3OA 3RRGA 2GUIA 4I7FA 4AHCA 2IC3A 5T7BA 4Y1CA 4RG8A 3ZCMA 1L3UA 4H4OA 4Z0UA 4OPKA 4DSEA 2D0CA 2IAJA 1IG9A 1S6PA 3TAQA 4F2RA 1CZBA 4KHWA 4NCBA 3AA4A 1I39A 5HRRA 1XWLA 3OYIA 3NHGA 4HCBA 5HRPA 4FJXA 1RBRA 1A5XA 4C8LA 3E01A 1BCOA 1JKHA 1S1VA 3L2UA 2Y1JA 4ZTJA 1RILA 2G8UA 2DFFA 1J9AA 3LP3A 1QSSA 3P1GA 3PO4A 1VRTA 4I9LA 4CK2A 1WSFA 2YNGA 2JLEA 4Z4HA 3AVGA 5J2MA 3SI6A 3K58A 1S9EA 3SQ4A 3RR7A 1CZ9A 4DTJA 4DF8A 1A5WA 4AH9A 1IO2A 3SJJA 1TKTA 5HBMA 2F8TA 5JS1A 3RMAA 3O3GA 3K5MA 1J5OA 2HHVA 2G8VA 4RW7A 4B8AB 3HSTB 1Z25A 3DLGA 4I9QA 3VQEA 1DLOA 2G8IA 1CLQA 3CYMA 3QIOA 4CHQA 4O55A 2OPSA 4MQ3A 1TKXA 4CHZA 4FM1A 3KK1A 1KLMA 1HNVA 3L2QA 3THVA 2Z1GA 4C8KA 2Z1JA 3O4NA 4CJEA 3LZIA 2HVIA 1U04A 3QNNA 4IG0A 4RW4A 3C6TA 4LD0A 2EHGA 2OZMA 4DSJA 1KVBA 4R5PA 4AHUA 2O4GA 3TAGA 1NJXA 3QEIA 2OZSA 4ID5A 4E7KA 4H4MA 4B9SA 1D5AA 4DQRA 3ZSOA 3WNHA 1WAFA 5J2QA 1LWEA 1U45A 2YV0X 3KD1E 3VQ8A 4CEDA 4CHYA 4FJIA 2RF2A 3AO2A 3QO9A 1LAWA 4JRQA 4CJVA 2HMIA 1FXXA 3NGIA 3CFPA 1SL0A 1L3VA 5FRMA 4FLUA 1KVCA 1C1CA 3D0PA 3RMCA 3KD5E 2KZMA 3ZT2A 2D0AA 4FJKA 4FM2A 3LANA 3VQ9A 2KFZA 2YKNA 4J2DA 3VQQA 1NKEA 4KKOA 4CJPA 1NJZA 2JGUA 4FLXA 3KLGA 1ASVA 3HJFA 3QINA 3AO1A 3TAMA 5JS2A 4FXDA 4PWDA 3AVHA 4IG3A 4KTQA 3ZT1A 3OYLA 3C94A 2IGIA 1NK6A 1HJRA 2QXFA 4CE9A 1EKEA 3K59A 3PV8A 1ZBFA 4MFBA 1L5UA 4RW6A 4N5SA 3SV3A 3ISNC 1ASWA 1JLQA 1W9HA 4QAGA 1NK0A 1LAVA 5C42A 3DMJA 4LSLA 1SV5A 2FBVA 4EP4A 3HP6A 3ASMA 4H8KA 2B6AA 4CF8A 3DLEA 2I5JA 5KRTA 2KZZA 3SZ2A 2KFNA 3HL8A 1X1PA 2HHWA 3A2FA 3KTQA 2YHAA 4GVMA 1B92A 3KJVA 4XIUA 3AVJA 4O0JA 3CG7A 3S9HA 4OGEA 4RW9A 2FBTA 5CZ2A 1BISA 1XI1A 3AVLA 1SL2A 2G8KA 3S3NA 1RT1A 1HYVA 4HUGA 4B9MA 3VQ7A 4DTSA 4CGHA 2HNDA 1L3SA 2XO7A 4DTPA 5J1EA 3MECA 4OKKA 4KREA 4CF9A 1VSIA 4E1MA 4HHTA 4PQUA 4OVLA 4CJSA 1TKDA 4C8NA 4DSKA 3ZT3A 2DFHA 1NJYA 1RTJA 4O4GA 4HVJA 3VQBA 4DQPA 2A1SA 5CYMA 4CEEA 1C0UA 4DG1A 3IAYA 4Z4FA 1LW2A 3P83D 3OYHA 3NBPA 2IS3A 1KVAA 4Y1DA 1XHXA 1EP4A 5KGWA 2VWKA 2OA8A 4CF2A 1U47A 4E0DA 4KFBA 1IKWA 1T03A 3CFOA 3L3UA 4CHNA 1FK9A 5I3UA 1WSEA 2ATQA 4ID1A 2P5GA 4TSXA 4WE1A 4IFYA 4W5TA 4B9UA 3SV4A 4BWMA 4CGFA 4DU3A 4CFAA 3AA2A 3AV9A 3HPGA 3LPUA 3MEGA 4CESA 3BDPA 1YT3A 3AVFA 3C6UA 1RT7A 3LALA 4GW6A 4FLYA 4F2SA 3TAPA 4FW1A 3VQAA 4DSFA 3TR8A 4FLTA 3EYZA 3SNNA 2EX3A 3DLKA 4PA1A 2E4LA 4RW8A 4AILC 1JLCA 3RMBA 4AHVA 1C0MA 3LPTA 3C95A 2X6SA 4DFJA 2RPIA 3QLHA 3V1OA 4DTUA 1KLNA 4J2AA 4KV8A 4OGCA 3M8PA 1BHLA 3SUPA 1RBSA 5HP1A 4Z4GA 3OYKA 3CM5A 1B9DA 1IH7A 2IDOA 1XHZA 3L2VA 3NF9A 4N56A 4FLVA 1VSJA 1VRUA 1ITGA 1RNHA 3SQ1A 3DRSA 4E1NA 1BQMA 4C8MA 1ZBUA 4OJRA 4FK4A 4FJGA 4KHSA 3RWUA 2VG5A 3AVCA 3O4QA 3QEXA 3V9SA 1QSYA 2OPPA 3VQDA 4CGGA 3TI0A 2F8SA 4CJ3A 3K2PA 1HMVA 4DU4A 4ELTA 2ZQBA 4JLHA 4CFDA 3KLHA 4BDYA 4DFMA 3DRPA 3OS1A 3PX4A 1NK7A 3ZSWA 1GOAA 1RT3A 4OLBA 2HB5A 1HQUA 1TGOA 1WLJA 2A1RA 2XY8A 3IRXA 4CEFA 1QQCA 1EX4A 3VN5A 3O3FA 4O44A 5C25A 1X9MA 4FYDA 5SWMA 2BGGA 2RKIA 1BGXT 3HT3A 3DLBA 1VK0A 2R7YA 4FJMA 1QHTA 3T19A 2PY5A 4E7JA 4DS4A 3LP1A 4CK1A 1SUQA 3VQCA 3MAQA 1NKBA 3CFRA 3TARA 1IKYA 2P1JA 3L2RA 1I3AA 3DLRA 2X6NA 2OPRA 3SYZA 4W5OA 3SUOA 3ALYA 4L8RB 5C24A 2G8FA 2KQ2A 4HCCA 4KB1A 1LWCA 3VQPA 2VG6A 4F4KA 1UOCA 1NK9A 3QERA 5I42A 3I8DA 4OLAA 4DTOA 3OYBA 5CYQA 3MXMA 1WN7A 1WSGA 3LAMA 3T1AA 3ZSQA 5CY4A 3M8SA 1R0AA 3LAKA 3NAEA 5J2PA 2ZD1A 1QE1A 4FW2A 3EZ5A 1TV6A 4ICLA 4FVMA 1NKCA 3G10A 4JS4A 5J2NA 4BE2A 3SQ2A 3WNGA 5KRSA 5FROA 5SZTA 3PO5A 4Z4EA 4DMNA 1NK8A 2P51A 4OKJA 4KI6A 4FJHA 4DQIA 1C1BA 1J53A 3TANA 1RBUA 2Z1IA 3U3GA 4CIGA 4EZ9A 1DTTA 3PY8A 1WSIA 3LZJA 1IKXA 2YKMA 1HNIA 3I0RA 3NH1A 4JS5A 5HLFA 1KFSA 2OYQA 2D0BA 2FBYA 3AA3A 4K8XA 3OYEA 1DTQA 3AVNA 3T3FA 2HHQA 2F96A 2HHSA 1JLAA 4FJ5A 1RDCA 4DQQA 3SUQA 3QESA 2OPQA 1HYSA 4KI4A 1IKVA 2B4JA 1FKPA 1S1UA 4IDKA 3DOLA 4CFBA 1Q9YA 2HNYA 3I0SA 3G0ZA 1VSEA 4NCGA 4CJLA 4CJUA 4JRPA 3RRHA 1QSLA 1KRPA 1A5VA 1KTQA 4CERA 3V6DA 2FC0A 4PUOA 1RT2A 4DLGA 1LW0A 3HPHA 2PZSA 3CM6A 5HRNA 3S3MA 4AHRA 3KLIA 3AVMA 4CGIA 3HYFA 1RTIA 3TAFA 4C8OA 3OYMA 3QEWA 4CFCA 4CGJA 4G1QA 1C0TA 1BIUA 4B9TA 4Q0BA 4CIFA 1BIZA 4DTMA 4CJWA 1T05A 1O1WA 3KIOA 2WONA 1KFDA 3NGYA 1LWFA 3M8RA 3OYNA 1SL1A 1WAJA 3K57A 3IS9A 4KO0A 3VA3A 4YNQA 3U6FA 1UA1A 1BCMA 4M3XA 1HPZA 3OJSA 3MXIA 1YVUA 4OPJA 3AO4A 2YNHA 4CEBA 4IBNA 4DF4A 4FLZA 3SPZA 3ZSXA 4CF0A 1SKRA 1WSHA 3L2WA 1UWBA 3OJUA 3AO3A 4BWJA 5KGXA 3K5NA 2P5OA 4N76A 3K5LA 4M3YA 4BDPA 3AA5X 3NF7A 4FM0A 3ULDA 4E89A 4BACA 4M42A 1S5JA 4B9VA 4J2BA 2XY5A 1GOBA 4YFUA 4ELUA 4FJ8A 3OS0A 3HK2A 2HHUA 4AHTA 1VSLA 1TL3A 1UA0A 2YHBA 3JSMA 4KTWA 4DS5A 1W0HA 1ZYQA 2D5RA 5EU7A 2DY4A 1U4BA 4CHOA 3NDKA 4CEAA 4CJRA 2YNFA 3RMDA 1U49A 2BDPA 1C1AA 3IG1A 5DMRA 2VWJA 2XY6A 4E7IA 4B8CA 1N6QA 3RR8A 4FJ7A 1NK4A 2HHXA 4KHUA 3NE6A 2QK9A 1D8YA 1HRHA 3OYAA 3DYAA 3DM2A 3MEDA 1GOCA 4CJQA 3OS2A 2ETJA 4B08A 4M3UA 2BANA 4CJTA 4KHNA 4F3TA 4F8RA 1JLEA 1Y97A 4O5BA 2G8WA 3LP2A 4QOZB 4Z4CA 4PY5A 3F73A 3V4IA 1KSPA 2YNIA 4E3SA 1RT4A 4FJLA 1TVRA 1RDDA 3NFAA 4W5QA 3O3HA 3TWHA 2O4IA 1TK8A 1RBTA 4CGDA 2LSNA 3HVTA 2X78A 3KLFA 4KB0A 3NGZA 1S1WA 3K5OA 3VQ5A 3MEEA 1T7PA 3U3YA 4CF1A 4E7LA 1NK5A 3HP9A 4EZ6A 4O0IA 3L8BA 2B5JA
chains in the Genus database with same CATH superfamily
4NO7A 3RTVA 3AVIA 2GUPA 4QS9A 4HTUA 3NH0A 4JI8K 2DTUA 4CHPA 3DI6A 1BA1A 4CJKA 1WNSA 4CZMA 5C10A 4CEQA 3DXKA 3DLLL 4UQGA 2ASPA 4N41A 5KI6A 1VQ5N 2P9LA 1Q81O 2A3ZA 2P9KA 4DTNA 3TSUA 4KHUA 1U48A 5LMNK 5AQHA 1TK0A 5AQNA 3CPEA 5LL6Z 4LH4A 4X64K 4B9LA 1ZC6A 3ITHA 4CI6A 4B3OA 5BPNA 4JKHA 1L3TA 2Q3SA 5AQOA 5HRSA 4FK0A 4C1NI 1TKZA 1LV5A 4NCAA 3VPZA 2QWRA 1F21A 2E88A 3BGRA 2QEXN 1J54A 4GVEA 1UAXA 1MA9B 1CXQA 1EQYA 4FOIA 2VWBA 5CZ1A 3WNFA 1S6QA 4I6MA 3ZSRA 4DLEA 4DTXA 3QNOA 4AHSA 4CEZA 3SQ0A 3RVCA 3U9DA 4FWRA 3VQ4A 1XNRK 4FWNA 2YHXA 5GAGP 3V9WA 4JNEA 5AZJA 3CD6N 3G25A 4DR5K 2NRZA 1NOYA 3LDSA 4KTZA 1U2VB 4I2PA 3CC4N 2O8CA 3C6AA 3L3VA 1YUWA 4CJ4A 2ZGZA 1S1TA 2VQEK 5AQFA 3M5RA 4B1XB 2OTLN 1REVA 1FKOA 4PKGA 4CVNE 4DSIA 1K8KB 1YI2N 4NLCA 2W42A 5DM7L 2DFEA 2BE2A 3P39A 4JK9A 2ASOA 3SBGA 1QVFM 4KRFA 4J8FA 3M8QA 4DWIA 1SS6A 3FGUA 3PX0A 1LOTB 4BY9C 4DTRA 2XHBA 4FK2A 3T69A 3S41A 1RTDA 3CJAA 3ZSYA 4F3OA 3OYDA 3VF4A 1JXEA 3EKSA 3PUFA 3WUHA 3VA0A 3LM2A 3S3OA 4AHCA 5T7BA 5EVZA 1XQSC 5AQUA 1L3UA 4H4OA 4Z0UA 2E5LK 1S6PA 3C6HA 3F5TA 4KHWA 5HRRA 4HCBA 1RBRA 1A5XA 5AZIA 1GLJO 3VF2A 1X3MA 1S1VA 3L2UA 2Y1JA 4ZTJA 1T44A 2DFFA 1NJIO 4EFHA 4M7YA 3PO4A 4I9LA 4CK2A 4BC2A 3BP8A 4Z4HA 5J2MA 3SI6A 3SQ4A 5LJVA 4DF8A 4DTJA 1ATRA 4AH9A 3SJJA 2FSKA 3PSFA 1GLLO 4JD2B 3CQXA 5JS1A 5JLHA 3O3GA 2HHVA 4DR3K 3DLGA 5AR0A 4I9QA 2G8IA 3J7YP 4CHQA 5AJ3K 1EWQA 3KK1A 1KLMA 3L2QA 3THVA 2Z1GA 3O4NA 5CHIA 3UKUB 2ZWHA 3C6TA 2OZMA 3BUZB 4R5PA 4AHUA 2O4GA 1NJXA 3ULEB 4ID5A 3MX5A 3ULEA 2QWQA 4H5WA 1NMNA 5AQKA 4CHYA 3AO2A 3CFPA 3M1FA 1L3VA 1QHAA 3D0PA 3RMCA 4LFAK 4FM2A 3VEZA 3LANA 4JI0K 1J6ZA 3DAWA 3DXMA 3KLGA 3C65A 1ASVA 3C7NA 2AP1A 3AO1A 3TAMA 1KD1O 3ZT1A 3H6EA 4CD3A 2O8EA 1P8ZA 4CE9A 3PV8A 3IUCA 2BUPA 4FWSA 4MFBA 1W9HA 4YOUA 4EP4A 2B6AA 3DLEA 3SZ2A 2KFNA 3HL8A 3LL3A 3A2FA 3O80A 3THWA 3QDKA 1QQOA 4K0KK 4O0JA 2VYPA 4RW9A 2G8KA 1W7AA 1TUYA 4PKHA 4B9MA 3CCRN 2HNDA 1L3SA 4DTPA 2E2PA 4OKKA 1LCUA 4E1MA 4FO0A 5A2QO 4BQLA 3H1VX 3GBTA 2Q0UA 4DSKA 2DFHA 4ILGB 1NJYA 2A1SA 4X65K 1C0UA 3P83D 5KQDA 3CERA 5KGWA 3DXKB 1DGKN 4KFBA 3FR0A 4H5RA 3T1HK 1FJGK 3CFOA 1OH6A 1FK9A 2KKZA 1WSEA 1YIJN 4CBWA 4CGFA 3AV9A 3MEGA 4CESA 1YT3A 4AQYK 4GW6A 3TAPA 4FW1A 4BRFA 3VQAA 4PA1A 2HSTA 3LM9A 3L6QA 4K25A 2V51B 4KH4A 3LPTA 2BTFA 4DV2K 3V1OA 2UUCK 3O9SA 4OGCA 1BHLA 3OYKA 1WBBA 4B3TK 1IH7A 2Q2RA 4N56A 3MMVA 3SQ1A 3DRSA 3THXA 3TTCA 1ZBUA 2OTJN 4KHSA 2VG5A 4YY3K 3I55N 2OPPA 4OPAA 3K2PA 4DU4A 4LF5K 3TTDA 3OS1A 3PX4A 4FPBA 3A5LC 5JMVA 5SWMA 2DPNA 2RKIA 3HT3A 2CH6A 3AGKA 4CBUA 1QHTA 3T19A 3LP1A 4CK1A 3VQCA 3MAQA 3CFRA 2QA4N 1IKYA 3TARA 1I3AA 3CXCM 3SYZA 3SUOA 3CC2N 4W5OA 4L8RB 4KB1A 2FF6A 1JCGA 2VG6A 1UOCA 3ZX3A 1NK9A 5GAEP 1OH7A 1WSGA 3I33A 3M8SA 3SAGA 1TV6A 1NKCA 4YDUC 3CF5L 4BE2A 5KRSA 3PO5A 1TYQA 4KI6A 1J53A 3TANA 1RBUA 4EZ9A 1WSIA 3ZYYX 2YKMA 1HNIA 3BY5A 5HLFA 2OYQA 2FBYA 1T3VA 4K8XA 2HHSA 1JCEA 2HHQA 4IOXA 4KI4A 3IMXA 3BF3A 3OBYA 5BRHA 2HNYA 2P9IB 1Q86O 4NCGA 1W2BM 4PUOA 1RT2A 3E9OA 2A6AA 4AHRA 3TAFA 2Q97A 3QICA 3GE1A 3U9ZA 2P9PA 4CGJA 3QEWA 4MDBA 4WFAL 3H45C 3FZMA 5BN9A 3NGYA 1LWFA 3OYNA 3VA3A 4YOTA 1XC3A 1HPZA 1YVUA 2YNHA 2PBDA 5BPMA 3W0LA 4CF0A 1SKRA 4O8UA 3L2WA 3AO3A 4N76A 4M3YA 4BDPA 5M1FA 3O5BA 2ITMA 1S5JA 4J2BA 3CMAN 2XY5A 4ELUA 1VSLA 4KBOA 1TL3A 3JSMA 4DS5A 2V7YA 2QI2A 2O8CB 1ZXOA 5EU7A 4BRNA 1VQ8N 1O13A 3ENOA 3RMDA 5DMRA 1M90O 3NE6A 1HRHA 1X3NA 3ZEUB 1GOCA 4BR9A 3OS2A 4JD2A 2BANA 5AQGA 5M1KA 4F3TA 1Y97A 4DR2K 2G8WA 1XNQK 3K9JA 4GV3A 1KSPA 3AGRA 4E3SA 1RDDA 3NFAA 3J7AP 3KHYA 2O4IA 2LSNA 3NGZA 1S1WA 3Q7CA 3MN9A 3CCSN 3K5OA 1T7PA 4EZ6A 2O8EB 4CEOA 2JWLA 3V1QA 4B9QA 4DV6K 4KHQA 2UXCK 4JHDA 4ELVA 4JHDB 2NRTA 3EY1A 3THWB 4GNIA 4DFKA 1C0FA 4CJ7A 4Z4IA 3HM8A 2ITGA 2HF3A 2WOMA 3TABA 3V9XA 3MXJA 1Q9XA 5BPLA 1D9FA 4BR4A 1SAZA 2E6LA 3O1WA 3SAHA 5FRNA 3SBTA 4NYNA 4W5NA 2FF3B 3LWLA 3OVNA 3HM9A 4GMJB 3PX6A 2HVHA 1T8EA 4PHTX 3ZT0A 2O8BA 1TL1A 2NNWA 1RDAA 3NF8A 1Q8IA 3MWTA 2QTDA 4FWKA 4NXNK 2Q31A 3HPOA 1JL2A 3GOIA 3FFKB 4BRKA 4NYFA 1BQNA 3KLEA 1HNWK 4LY7A 3H08A 4LFBK 4NB4A 1E4GT 3HSCA 1SKSA 3RSEA 1NJWA 2FBXA 3HXMA 3R8EA 2HHTA 3OYFA 5FLXO 4DSLA 1BL3A 3KKRA 4DV4K 1KCFA 4CJ5A 2KTQA 2X74A 1VSHA 3KK2A 1HLUA 3V9ZA 3CCQN 3QETA 2E6MA 4LFCK 2ZGYA 4BC3A 1JLBA 3NF6A 3UKRB 4H0VB 4YOYA 3I8BA 5AQJA 1C6VA 4BROA 2WFBA 4CZLA 2G8HA 3ZSZA 4M3WA 4W5RA 1RDBA 4JK8A 1WBDA 1RT5A 3ZETB 2NRVA 1XMOK 4BR5A 4CJFA 5AQXA 2AJQA 3B6PA 4IKFA 1MU2A 4H0YB 1EETA 3VTHA 3ATUA 2QKBA 2QM1A 3ZSVA 3KK3A 2ZE2A 3WXMB 3SPYA 2P9SB 4JI2K 4ISEA 1JXBA 5B8HA 4B9NA 2ASMA 4DR6K 3R6MA 3MN5A 4M63C 3V9UA 4AM6A 4ILHA 4DFPA 1S1XA 2GUIA 3FZHA 4RG8A 3I56N 3CIPA 1WB9A 3WEEB 4JKAA 2ZJRL 4CZGA 4UY8O 4Z94A 4NCBA 3OYIA 1XWLA 5GINA 4FJXA 1X9JA 1JKHA 1RILA 1J9AA 4JKCA 3UE5A 4EAHD 1YXQA 4WYBA 2YNGA 2JLEA 4DKWA 4A5BA 3RR7A 1HUXA 1BUPA 2F8TA 1TKTA 5HBMA 4BRLA 5EY4A 3K5MA 4MDAA 4FWPA 4RW7A 4B8AB 1KAZA 3TSPA 3OW2M 1YJ9N 3MDQA 2IVNA 4A2AA 2E2NA 1CLQA 3CYMA 2OPSA 4MQ3A 2PAVA 2UUAK 4IG0A 2EHGA 3TAGA 5KPZA 1HNZK 5BR8K 3WNHA 4JI5K 3SLCA 1LWEA 5C2DA 1U45A 4DCHA 3KD1E 4JRQA 4JYAK 5FRMA 1SL0A 4G9ZA 5EX5A 1KVCA 1C1CA 3KD5E 5KPTA 5AQZA 2P9IA 3VQ9A 2KFZA 4YOWA 1HX1A 3VQQA 2BH1A 4XH1A 1NJZA 4OO1J 3WT0A 3QINA 1NGEA 4FXDA 4CZIA 4IG3A 3C94A 2IGIA 1NK6A 1HJRA 1EKEA 3K59A 1HPMA 1ZBFA 1L5UA 3N4QA 4QAGA 1ASWA 1LAVA 5C42A 3DMJA 4LSLA 1SV5A 2FBVA 5GIOA 2ZJQL 2I5JA 5KRTA 2KZZA 5FPMA 2HHWA 3EKUA 2HBLA 2YI1A 5ADXH 1B92A 2GTDA 4MLEA 3CG7A 3S9HA 4OGEA 1S3XA 2FBTA 5AQMA 3S3NA 2D0PA 3VQ7A 4DTSA 4CGHA 2XO7A 4KREA 2Q0RA 2VGNA 3DWLA 2VGMA 3WQTA 4PQUA 4R79A 1CZAN 3BEXA 3VQBA 4DQPA 3IAYA 2UXBK 5AQSA 3OYHA 3VGKA 2NRHA 1DKGD 2VCPA 1EP4A 2OA8A 2YJEA 4E0DA 1GLCG 1T03A 3L3UA 4KH5A 2ATQA 4ID1A 4W5TA 4DU3A 4CFAA 1Z6RA 2QWNA 3HPGA 1RGIA 3ZETA 3BDPA 3A5OC 3ENBA 4BRMA 4F2SA 4IDHA 4DSFA 2O8FA 3HZ6A 3TR8A 3A5NC 4FLTA 2EX3A 3DLKA 4BRHA 4AHVA 3WXLA 1QZ5A 3BF1A 3NVMA 4DTUA 1NGGA 3SMSA 2D0OA 1KLNA 4J2AA 2HF4A 3M8PA 3JS6A 1RBSA 4Z4GA 3EO3A 5TKYA 3WXIA 3CM5A 4BRCA 3NF9A 3U4LA 1VSJA 3D2EB 4RCHA 5BREA 1RNHA 2GWKA 4IJAA 1BQMA 3CCLN 3V9SA 4CGGA 3TI0A 1HJOA 1HMVA 4YDUA 3HBTA 3LDLA 4BDYA 2O8BB 2HB5A 1QQCA 4FSVA 3VN5A 1X9MA 5BN8A 4FJMA 3O08A 4H0XB 4E7JA 1SUQA 1S22A 2X6NA 2OPRA 3ALYA 5C24A 4JKDA 1IBLK 4WQ4C 3VQPA 1NG9A 3DXMB 3PLAA 3MXMA 3FZLA 4HTLA 1U6ZA 1WN7A 3LAMA 3ZSQA 4QS8A 3OTOK 4XH5A 1R0AA 3LAKA 5FPNA 4FW2A 1QZ6A 3EZ5A 3WQUA 4FVMA 5J2NA 3WNGA 4Z4EA 3CMEN 1HR0K 4CIGA 5AQRA 3PY8A 3NH1A 2D0BA 3AA3A 1DTQA 2F96A 1JLAA 1RDCA 1YJWN 1NGCA 1IKVA 1ESVA 1NGJA 1FKPA 1S1UA 4BRQA 1KRPA 3RSEB 2FC0A 2KHOA 2FXUA 4DLGA 1LW0A 1NBWA 3CM6A 5HRNA 3S3MA 3AVMA 3KWIA 1SZ2A 3OYMA 1H1VA 1BIUA 4BR2A 1BIZA 1T05A 4GY2B 3K57A 3U6FA 4KO0A 2W41A 1BCMA 5H1SQ 3MXIA 1VQNN 4CEBA 4FLZA 1IJJA 3JXUA 3WXJA 1BOTO 3K5NA 2QWLA 4BWJA 5D3GA 4LF6K 1ILYA 2GEMA 3K5LA 1IV0A 1EO1A 2F9WA 4BRAA 3MWPA 1G99A 1GOBA 2HHUA 4AHTA 5C12A 1S72N 2QWMA 3O1BA 2D5RA 4ILJA 2CGJA 1U49A 4LF8K 3IG1A 2HBMA 2D1KA 4B8CA 4E7IA 3RR8A 4FJ7A 2HHXA 3UKRA 2QK9A 3MCAB 4DR1K 4M3UA 1BU6O 4BC4A 1KQSM 2A42A 2GELA 3AAPA 3LP2A 4Z4CA 3GL1A 4PY5A 4BG9A 4FJLA 4C23A 3OBWA 1RBTA 1TK8A 2X78A 1I94K 3MEEA 1NK5A 3HP9A 3MK6A 4A5AA 1V4SA 4O0IA 1Z05A 1RBVA 1JLFA 3OY9A 3L4IA 4BRPA 3FE1A 4BDZA 3V1RA 1ATSA 1E3MA 3D6RA 2A40A 3B6OA 5F0XA 1NGDA 5FDLA 3OYGA 1RTHA 3TU5A 3H3NO 3QBWA 4BGAA 3VTIA 2QWOA 4DV5K 4M3RA 4GV9A 3CJ7A 3V81A 4FJJA 2O8DA 2V52B 4N47A 4JI7K 3O8MA 4BRDA 2ZJPL 2NRXA 1BI4A 1BI4B 4JKEA 4OKEA 4WQ4A 4KPYA 2A41A 1ZBHA 3JYTA 4YHHK 1KAYA 2W6KA 3K9KA 1M1KO 2XRIA 1C0GA 5HL7L 4JKGB 1ZBLA 4A2BA 2GV9A 3C7NB 2Q1NA 3CJ9A 3SCXA 1EWRA 1G15A 5AZIB 2Q36A 5M1NA 5E84A 4FJNA 4LH5A 2E2OA 1ZBIA 1TAQA 3QEPA 4FZXC 1Z26A 4M3TA 5DK5A 3ZT4A 1N5YA 1D9DA 2A5XA 3LWMA 4Q5VA 3P31A 1WSJA 4FZYA 3ZLJA 2RE2A 3QEVA 3VGLA 4XH4A 5TKWA 3OYCA 3DLHA 1Q82O 1X9WA 1BA0A 4CECA 4DQSA 4WF9L 4HUEA 1HKGA 2QXLA 1KAXA 3ID8A 4HUFA 4DR4K 3CJBA 1GLAG 4DU1A 4IOCL 4IO8A 2PYJA 3CCEN 1NOZA 4BVPA 3TPQA 4FJ9A 2NUBA 4AM7A 4K8ZA 4IWVA 2UU9K 2PYLA 2KLAA 2HNZA 4JK7A 1JL1A 4CW7B 1VSDA 2GBZA 4KHYA 2GX9A 3ID6A 4ISGA 2IC3A 4Y1CA 3ZCMA 5GIPA 3THYA 4OPKA 3FZKA 2E2QA 5IWAK 2D0CA 4A61A 4DSEA 3C0BA 3NHGA 4DV3K 4JAXA 4FWMA 2HHHK 2E1ZA 4DQ8A 3LP3A 1VRTA 4ISFA 5AQPA 5I9EB 3AVGA 3K58A 4BR7A 5JICA 1CZ9A 1A5WA 1IO2A 1YHQN 3EL2A 2G8VA 3VMFB 3OA9A 3THXB 1DLOA 3QIOA 4O55A 3MN6A 1TKXA 4CHZA 4C8KA 1HNVA 4DV1K 2Z1JA 3VESA 3QNNA 4RW4A 1KVBA 4RTFD 4E7KA 4H4MA 3NVKA 1D5AA 3H3OB 3ZSOA 4K42A 4FOEA 3CHWA 2YV0X 3AARA 2QWPA 2ZF5O 3EZWA 3E1YA 4FJIA 1MDUB 2HMIA 1FXXA 1NGIA 4FLUA 4I6MB 2YHYA 2KZMA 3CCMN 3ZT2A 4FJKA 3DJCA 4EIAA 4JKBA 1T6CA 4EHTA 2YKNA 5BRDA 4KKOA 4CJPA 4FLXA 2HOEA 3W3DA 5KQ8A 3HJFA 3WEEA 5F2RA 3QFUA 4KTQA 3UB5A 3OYLA 2EWSA 3SK3A 4PL8A 4N5SA 3VOVA 1YF5L 3OHRA 3QBXA 4H8KA 4JV5K 1X1PA 1Q7YO 1N34K 2YHAA 4GVMA 5M1PA 5GADP 5CZ2A 1BISA 2WC9A 2J4RA 3AVLA 3VEWA 3MECA 4CD1A 4OVLA 4CJSA 3O9UA 5CR4A 4O4GA 4HVJA 4LF7K 4CEEA 4DG1A 3J80O 1LW2A 4A62A 4BREA 1GLEG 3NBPA 1KVAA 3A8YA 4Y1DA 1XHXA 2VWKA 1NGFA 4CF2A 1N8RO 4CBXA 1IKWA 4H5VA 1DT9A 4CHNA 4IJNA 1QVGM 3NMUA 5DM6L 2P5GA 4B3MK 5EXWA 2E20A 4IFYA 4WE1A 1WUAA 3SV4A 3AA2A 4GV6A 3MN7A 5KPRA 4FLYA 4GKKK 3J81O 3E9PA 2E4LA 5JVHL 4AILC 1JLCA 4B3SK 1RDWX 1C0MA 2P9NB 4BGBA 3C95A 3CQYA 3O9RA 2X6SA 4DFJA 2RPIA 3QLHA 4H0TB 4LC9B 3SUPA 5HP1A 1B9DA 3VERA 2IDOA 3L2VA 1BDGA 4FLVA 1GLBG 3E66A 4FWLA 4FK4A 4FJGA 3RWUA 3AVCA 1VAZA 3THYB 3VEXA 4ELTA 1KC8O 3D2FA 4DFMA 3DRPA 1NK7A 3ZSWA 1RT3A 4OLBA 3HOSA 3QMLA 3AY9A 1HQUA 1TGOA 1WLJA 3CCJN 2A1RA 2XY8A 3IRXA 1EX4A 3A0IX 4O44A 1FW6A 4FYDA 3DLBA 3BZKA 1VK0A 4X66K 3MX2A 2PY5A 3O9QA 3L2RA 3DLRA 2G8FA 2KQ2A 1LWCA 4F4KA 4DR7K 3QERA 5I42A 3I8DA 3K0SA 4DTOA 3OYBA 5CYQA 1VQKN 5CY4A 3F2KA 3Q7BA 2FSNA 4OPHA 3SJHA 5J2PA 2O8FB 2ZD1A 1QE1A 3B8AX 5ELZA 4ICLA 2D4WA 5IT9O 3G10A 4JI6K 1HKBA 4DQIA 1NMDA 3U3GA 3HRGA 1N36K 3LZJA 2ZM6K 3I0RA 5LMUK 2F7TA 1WOQA 2WUSA 3AVNA 3VEYA 4DQQA 3SUQA 1HYSA 4FVUA 2WTUA 2B4JA 3DOLA 3LDQA 1HNXK 4CJUA 1IBKK 1VSEA 1A5VA 4CERA 3R1XA 3V6DA 5AQIA 2PZSA 4FPAA 1MWMA 3KLIA 1RTIA 4OX9K 4CFCA 1QQNA 1W97L 3L4QA 4CJWA 4X62K 2WONA 4GKJK 1KFDA 1ZBSA 1VQMN 1VQ6N 5AQTA 1SL1A 1WAJA 5FPDA 3IS9A 4M3XA 3JAMO 3G6EN 4OPJA 4IBNA 3SPZA 3ZSXA 3OJUA 2P5OA 4JN4A 3HI0A 4AF1A 3AA5X 3NF7A 3LDNA 3G4SN 5AQQA 3ULDA 4E89A 4MLHA 1N32K 4M42A 4B9VA 3HK2A 3OS0A 1UA0A 4H0PA 2P9UB 1YITN 1ZYQA 2DY4A 3NDKA 3ZX2A 4CEAA 2YNFA 2BDPA 1GLDG 1N6QA 5ADXA 1D8YA 3OYAA 4BR0A 4CJQA 1BWFO 3CJCA 5BRFA 4WFBL 3ZX0A 2CGLA 4O5BA 3MCPA 4F9OA 3F73A 3V4IA 3GG4A 1TVRA 3O3HA 1HKCA 1DEJA 4DHYA 3ENHA 4PL7A 3VQ5A 1OH5A 2NRRA 4CF1A 4E7LA 3ATVA 4BRGA 4C8OA 3D7EO 1B9FA 2Z1HA 3M3ZA 1SKWA 4CZFA 3VF6A 4E19A 1CXUA 4EP5A 2YX6A 3HVRA 1EXQA 3AO5A 3F9KA 1VQLN 3AVKA 4IFVA 4XEIA 4M45A 1TAUA 1HQEA 2IVPA 1VHXA 4FL9A 3U8XA 1J5EK 1IBMK 4FCYA 5KTQA 2Y1IA 4E7HA 5E41A 1VSMA 2O8DB 2CGKA 4BQZA 4FWOA 3QIPA 4FLWA 1TYQB 2PFUA 3DRRA 4B1YB 5JLFA 2VG7A 4IOAL 1RT6A 1K6YA 1VSFA 4DV7K 1KXPA 3SUNA 1QS4A 1YTAA 3KKSA 3F9MA 2KW4A 3O6WA 4BE1A 1S9GA 4CIEA 3HO1A 3LDOA 3UIQA 3VQ6A 4CZEA 3EN9A 2YCHA 3NCIA 4M3ZA 1HYZA 4M41A 3WNEA 1VSKA 1JCFA 4FZZA 5HROA 3AVBA 3LP0A 1VQ9N 2V7ZA 4ZHRA 4KH6A 4DUZK 1SQKA 4J2EA 3GDQA 3IKMA 3HOTA 4B1ZA 4BE0A 4Y0WA 4LF9K 1VQ7N 2HW3A 1XC9A 4CCHA 4YOXA 2RN2A 4WCEL 2XY7A 1X9SA 4KHPK 3SMPA 4KAZA 4BVOA 1TK5A 1JLGA 4ZTFA 2CH5A 3PIOL 3R9PA 3AVAA 3QFPA 1ASUA 3QB0A 3DOKA 2I7PA 5K14A 2QKKA 3FZFA 3O4WA 4L3QA 3PSIA 1T6DA 2IOCA 5M1OA 4IFEA 3P5JA 1OH8A 1RCHA 2QW9A 4LSNA 4MO4A 1YTUA 2FSJA 3OYJA 3CQ8A 1K8AO 4I2QA 3D45A 3FFIA 3TAEA 1QTMA 1GLFO 3NH2A 4CK3A 4QCLA 2JWKA 3RRGA 4JKFA 5C0YA 4BRIA 4I7FA 2OCEA 4U7BA 3TTFA 4B3RK 2IAJA 4F2RA 1IG9A 3TAQA 1V4TA 1YJNN 1CZBA 1TUUA 4WQ5C 3A5MC 4A59A 3AA4A 1I39A 4H5NA 5HRPA 4C8LA 1BO5O 3E01A 1BCOA 2G8UA 1QSSA 3P1GA 1WSFA 5E26A 5FPEA 1S9EA 4DUYK 2YHWA 2F9TA 3RMAA 1J5OA 3HSTB 4B1UB 1Z25A 3VQEA 4H0OA 5AFUH 4O5FA 4FM1A 3P38A 3LZIA 4CJEA 2HVIA 1OVYA 1U04A 5AFUA 4DSJA 4LD0A 3R3LA 2OZSA 3QEIA 4B9SA 3CCVN 3H46O 4DQRA 1U2VA 1WAFA 5J2QA 5MLCQ 3VQ8A 4CEDA 2RF2A 3QO9A 1LAWA 4CJVA 3NGIA 4B1WB 1BG3A 2D0AA 3EEQA 4J2DA 1NKEA 2JGUA 1OVQA 5C2FA 4U67L 5BR9A 3KVGA 5JS2A 4PWDA 3AVHA 4HWIA 4K41A 4CZHA 2QXFA 5JVGL 4RW6A 3SV3A 3ISNC 1JLQA 3VEOA 1NK0A 3HP6A 3HTVA 3ASMA 4CF8A 1E4FT 2NRWA 3VGMA 2P9LB 3KTQA 1VQPN 3KJVA 4XIUA 3AVJA 3CCUN 1MWKA 5LY3A 3CI5A 1K9MO 1XI1A 1SL2A 4LF4K 1NGAA 1RT1A 1HYVA 2I7NA 4HUGA 4RWTA 4EHUA 3O9TA 3TSQA 5J1EA 5AQWA 1YAGA 4CF9A 1VSIA 4HHTA 2NZTA 5M1QA 2P9UA 5CE3A 1TKDA 3J7ZO 4C8NA 3ZT3A 4A57A 1RTJA 5CYMA 4Z4FA 1P90A 3T7ZA 2IS3A 4JI3K 2VQFK 2IIRA 1U47A 4K43A 2OANA 1NGHA 4B1VA 4WFNL 2H3GX 5I3UA 4TSXA 2UUBK 4B9UA 3P4IA 4BWMA 3LPUA 5AZJB 3LDPA 3AVFA 3C6UA 3LALA 1RT7A 2IVOA 2GWJA 1XUPO 3BZCA 3EYZA 3SNNA 2UXDK 5AQLA 2RHKA 3RMBA 4RW8A 4NLBA 1ATNA 1OKJA 4NXMK 5AQVA 4KV8A 5F1XA 3CPWM 1NLVA 2F4VK 3ZEUA 1XHZA 3AAQA 4YOVA 3N4PA 1VRUA 1ITGA 1K8KA 4E1NA 4C8MA 4OJRA 4DV0K 3T1YK 3O4QA 3QEXA 2E8AA 1QSYA 1YVNA 1NM1A 3VQDA 2F8SA 4JKGA 4CJ3A 5C15A 3CETA 2ZQBA 4JLHA 4CFDA 3KLHA 2HBKA 2HMPA 3J8AA 2NLXA 2P9PB 3D2FB 3L0QA 1VQ4N 1GOAA 1RDUA 3O3FA 4CEFA 5C25A 2BGGA 2P9SA 1BGXT 4YORA 1JJ2M 2R7YA 3KK7A 4DS4A 3WXKA 1NKBA 2P1JA 3CJ1A 1K73O 1NU0A 4IEIA 4HCCA 4OLAA 3T1AA 4IO9L 5GAHP 4H03B 3NAEA 3IFRA 1QQMA 2P9NA 4JS4A 5LJWA 3SQ2A 4CZKA 5FROA 5SZTA 3KZBA 4DMNA 2P51A 1NK8A 4OKJA 3EE8A 4QS7A 3VEVA 2UYTA 4BC5A 1C1BA 4FJHA 2Z1IA 1DTTA 4IXCA 3M6GA 1IKXA 3VENA 1KFSA 5EOYA 4JS5A 5HOOA 3OYEA 3T3FA 1XMQK 4E1JA 3H1QA 4FJ5A 3QESA 2OPQA 4M7XA 4IDKA 3KWGA 3G71N 4CFBA 1Q9YA 3I0SA 4CJLA 3G0ZA 3RRHA 4JRPA 2FLOA 1QSLA 1KTQA 3IDHA 3HPHA 3SAFA 3UKUA 4CGIA 3HYFA 3EE9A 4G1QA 1C0TA 4B9TA 4Q0BA 4DB3A 4CIFA 4PKIA 4DTMA 1O1WA 3KIOA 2E1YA 5AQYA 3M8RA 1UA1A 4YNQA 1N33K 2HBJA 4C1NK 4MO5A 3OJSA 1NWKA 3AO4A 1IG8A 4DF4A 3FLCO 3PIPL 2P9KB 1WSHA 1NNEA 1UWBA 2AA4A 3CC7N 5KGXA 4CZJA 4FM0A 4BACA 4JEPA 1VQON 4V19S 4FJ8A 4JI1K 4O8KA 4YFUA 1NGBA 2YHBA 4KTWA 1Y64A 4H5TA 1W0HA 4JI4K 2W40A 1U4BA 4CHOA 4CJRA 1C1AA 2VWJA 2YJFA 3VETA 2XY6A 1NK4A 1Q18A 1D4XA 1R59O 3DYAA 3DM2A 3MEDA 2ETJA 4IZ9A 4B08A 4WQ5A 4CJTA 4KHNA 4F8RA 4BG8A 1JLEA 3D2EA 4QOZB 2YNIA 1RT4A 4W5QA 2WBNA 3TWHA 4CGDA 3HVTA 3KLFA 4KB0A 4IEEA 4FWQA 3U3YA 3E9LA 1RFQA 3L8BA 2B5JA 2W6LA
chains in the Genus database with same CATH topology
1B9FA 1RBVA 3RTVA 2Z1HA 1JLFA 3AVIA 4HTUA 2DTUA 3OY9A 3NH0A 4CHPA 4CEOA 3DI6A 3V1QA 4CJKA 1WNSA 1SKWA 4CEQA 4KHQA 4UQGA 4E19A 4BDZA 4N41A 4ELVA 1CXUA 5KI6A 4EP5A 3V1RA 3EY1A 4DFKA 4Z4IA 3TABA 2ITGA 4DTNA 2WOMA 3V9XA 3MXJA 3B6OA 3HVRA 1Q9XA 5FDLA 1U48A 3OYGA 1D9FA 1RTHA 1EXQA 3AO5A 3F9KA 2E6LA 1TK0A 3AVKA 5FRNA 4LH4A 4NYNA 4IFVA 4W5NA 3LWLA 4M45A 1TAUA 3OVNA 1HQEA 4M3RA 4B9LA 3HM9A 4GMJB 3PX6A 2HVHA 1T8EA 3ITHA 4B3OA 4FJJA 4FCYA 3V81A 5KTQA 2Y1IA 4E7HA 1L3TA 2Q3SA 5E41A 1VSMA 5HRSA 4N47A 3ZT0A 4FK0A 1TL1A 1TKZA 1LV5A 4NCAA 1RDAA 3QIPA 4FLWA 3NF8A 1F21A 1Q8IA 3BGRA 3DRRA 2VG7A 1J54A 1RT6A 1K6YA 1UAXA 1VSFA 3HPOA 1CXQA 5CZ1A 3SUNA 1BI4A 1JL2A 1QS4A 1YTAA 1S6QA 3WNFA 1BI4B 3ZSRA 4OKEA 4KPYA 3KKSA 4DLEA 4DTXA 3QNOA 2KW4A 4NYFA 1BQNA 3KLEA 4AHSA 1ZBHA 4LY7A 3JYTA 4BE1A 3H08A 1S9GA 4CEZA 4CIEA 3SQ0A 5D3GA 3HO1A 3VQ4A 2XRIA 1SKSA 3UIQA 3VQ6A 1NJWA 2FBXA 3V9WA 1ZBLA 2GV9A 3HXMA 2HHTA 3OYFA 3SCXA 1G15A 4M3ZA 3NCIA 1NOYA 4DSLA 1HYZA 4M41A 1BL3A 3WNEA 1VSKA 3KKRA 4KTZA 3LDSA 4FJNA 4FZZA 1KCFA 4LH5A 1ZBIA 4CJ5A 3AVBA 4I2PA 5HROA 2X74A 2KTQA 1VSHA 3KK2A 3L3VA 1TAQA 3V9ZA 3QEPA 3QETA 2E6MA 4FZXC 1Z26A 3LP0A 4M3TA 4ZHRA 4CJ4A 1JLBA 5DK5A 4J2EA 3ZT4A 1N5YA 1D9DA 3NF6A 1S1TA 1C6VA 3LWMA 4Q5VA 1WSJA 1REVA 4FZYA 4BE0A 3QEVA 1FKOA 2G8HA 3ZSZA 2HW3A 1XC9A 3OYCA 4M3WA 4W5RA 1RDBA 4DSIA 3DLHA 4CCHA 1X9WA 2RN2A 4CECA 1RT5A 2XY7A 4DQSA 1X9SA 4KAZA 4HUEA 2W42A 2DFEA 4CJFA 1TK5A 1JLGA 4ZTFA 4HUFA 2AJQA 2BE2A 3B6PA 3AVAA 4DU1A 4IKFA 1ASUA 3DOKA 4KRFA 3M8QA 1MU2A 5K14A 4DWIA 2QKBA 1EETA 2QKKA 3PX0A 2PYJA 1NOZA 4DTRA 2IOCA 3ZSVA 3KK3A 4FJ9A 2NUBA 2ZE2A 2XHBA 3P5JA 4FK2A 1RCHA 3SPYA 4LSNA 1RTDA 4K8ZA 1YTUA 1JXBA 3ZSYA 4B9NA 2PYLA 3OYJA 3CQ8A 4F3OA 3OYDA 4I2QA 2HNZA 1JXEA 3D45A 3FFIA 3V9UA 3PUFA 3TAEA 1QTMA 1JL1A 3NH2A 4CK3A 3VA0A 1VSDA 2GBZA 4DFPA 4KHYA 4QCLA 1S1XA 3S3OA 3RRGA 2GUIA 4I7FA 4AHCA 2IC3A 5T7BA 4Y1CA 4RG8A 3ZCMA 1L3UA 4H4OA 4Z0UA 4OPKA 4DSEA 2D0CA 2IAJA 1IG9A 1S6PA 3TAQA 4F2RA 1CZBA 4KHWA 4NCBA 3AA4A 1I39A 5HRRA 1XWLA 3OYIA 3NHGA 4HCBA 5HRPA 4FJXA 1RBRA 1A5XA 4C8LA 3E01A 1BCOA 1JKHA 1S1VA 3L2UA 2Y1JA 4ZTJA 1RILA 2G8UA 2DFFA 1J9AA 3LP3A 1QSSA 3P1GA 3PO4A 1VRTA 4I9LA 4CK2A 1WSFA 2YNGA 2JLEA 4Z4HA 3AVGA 5J2MA 3SI6A 3K58A 1S9EA 3SQ4A 3RR7A 1CZ9A 4DTJA 4DF8A 1A5WA 4AH9A 1IO2A 3SJJA 1TKTA 5HBMA 2F8TA 5JS1A 3RMAA 3O3GA 3K5MA 1J5OA 2HHVA 2G8VA 4RW7A 4B8AB 3HSTB 1Z25A 3DLGA 4I9QA 3VQEA 1DLOA 2G8IA 1CLQA 3CYMA 3QIOA 4CHQA 4O55A 2OPSA 4MQ3A 1TKXA 4CHZA 4FM1A 3KK1A 1KLMA 1HNVA 3L2QA 3THVA 2Z1GA 4C8KA 2Z1JA 3O4NA 4CJEA 3LZIA 2HVIA 1U04A 3QNNA 4IG0A 4RW4A 3C6TA 4LD0A 2EHGA 2OZMA 4DSJA 1KVBA 4R5PA 4AHUA 2O4GA 3TAGA 1NJXA 3QEIA 2OZSA 4ID5A 4E7KA 4H4MA 4B9SA 1D5AA 4DQRA 3ZSOA 3WNHA 1WAFA 5J2QA 1LWEA 1U45A 2YV0X 3KD1E 3VQ8A 4CEDA 4CHYA 4FJIA 2RF2A 3AO2A 3QO9A 1LAWA 4JRQA 4CJVA 2HMIA 1FXXA 3NGIA 3CFPA 1SL0A 1L3VA 5FRMA 4FLUA 1KVCA 1C1CA 3D0PA 3RMCA 3KD5E 2KZMA 3ZT2A 2D0AA 4FJKA 4FM2A 3LANA 3VQ9A 2KFZA 2YKNA 4J2DA 3VQQA 1NKEA 4KKOA 4CJPA 1NJZA 2JGUA 4FLXA 3KLGA 1ASVA 3HJFA 3QINA 3AO1A 3TAMA 5JS2A 4FXDA 4PWDA 3AVHA 4IG3A 4KTQA 3ZT1A 3OYLA 3C94A 2IGIA 1NK6A 1HJRA 2QXFA 4CE9A 1EKEA 3K59A 3PV8A 1ZBFA 4MFBA 1L5UA 4RW6A 4N5SA 3SV3A 3ISNC 1ASWA 1JLQA 1W9HA 4QAGA 1NK0A 1LAVA 5C42A 3DMJA 4LSLA 1SV5A 2FBVA 4EP4A 3HP6A 3ASMA 4H8KA 2B6AA 4CF8A 3DLEA 2I5JA 5KRTA 2KZZA 3SZ2A 2KFNA 3HL8A 1X1PA 2HHWA 3A2FA 3KTQA 2YHAA 4GVMA 1B92A 3KJVA 4XIUA 3AVJA 4O0JA 3CG7A 3S9HA 4OGEA 4RW9A 2FBTA 5CZ2A 1BISA 1XI1A 3AVLA 1SL2A 2G8KA 3S3NA 1RT1A 1HYVA 4HUGA 4B9MA 3VQ7A 4DTSA 4CGHA 2HNDA 1L3SA 2XO7A 4DTPA 5J1EA 3MECA 4OKKA 4KREA 4CF9A 1VSIA 4E1MA 4HHTA 4PQUA 4OVLA 4CJSA 1TKDA 4C8NA 4DSKA 3ZT3A 2DFHA 1NJYA 1RTJA 4O4GA 4HVJA 3VQBA 4DQPA 2A1SA 5CYMA 4CEEA 1C0UA 4DG1A 3IAYA 4Z4FA 1LW2A 3P83D 3OYHA 3NBPA 2IS3A 1KVAA 4Y1DA 1XHXA 1EP4A 5KGWA 2VWKA 2OA8A 4CF2A 1U47A 4E0DA 4KFBA 1IKWA 1T03A 3CFOA 3L3UA 4CHNA 1FK9A 5I3UA 1WSEA 2ATQA 4ID1A 2P5GA 4TSXA 4WE1A 4IFYA 4W5TA 4B9UA 3SV4A 4BWMA 4CGFA 4DU3A 4CFAA 3AA2A 3AV9A 3HPGA 3LPUA 3MEGA 4CESA 3BDPA 1YT3A 3AVFA 3C6UA 1RT7A 3LALA 4GW6A 4FLYA 4F2SA 3TAPA 4FW1A 3VQAA 4DSFA 3TR8A 4FLTA 3EYZA 3SNNA 2EX3A 3DLKA 4PA1A 2E4LA 4RW8A 4AILC 1JLCA 3RMBA 4AHVA 1C0MA 3LPTA 3C95A 2X6SA 4DFJA 2RPIA 3QLHA 3V1OA 4DTUA 1KLNA 4J2AA 4KV8A 4OGCA 3M8PA 1BHLA 3SUPA 1RBSA 5HP1A 4Z4GA 3OYKA 3CM5A 1B9DA 1IH7A 2IDOA 1XHZA 3L2VA 3NF9A 4N56A 4FLVA 1VSJA 1VRUA 1ITGA 1RNHA 3SQ1A 3DRSA 4E1NA 1BQMA 4C8MA 1ZBUA 4OJRA 4FK4A 4FJGA 4KHSA 3RWUA 2VG5A 3AVCA 3O4QA 3QEXA 3V9SA 1QSYA 2OPPA 3VQDA 4CGGA 3TI0A 2F8SA 4CJ3A 3K2PA 1HMVA 4DU4A 4ELTA 2ZQBA 4JLHA 4CFDA 3KLHA 4BDYA 4DFMA 3DRPA 3OS1A 3PX4A 1NK7A 3ZSWA 1GOAA 1RT3A 4OLBA 2HB5A 1HQUA 1TGOA 1WLJA 2A1RA 2XY8A 3IRXA 4CEFA 1QQCA 1EX4A 3VN5A 3O3FA 4O44A 5C25A 1X9MA 4FYDA 5SWMA 2BGGA 2RKIA 1BGXT 3HT3A 3DLBA 1VK0A 2R7YA 4FJMA 1QHTA 3T19A 2PY5A 4E7JA 4DS4A 3LP1A 4CK1A 1SUQA 3VQCA 3MAQA 1NKBA 3CFRA 3TARA 1IKYA 2P1JA 3L2RA 1I3AA 3DLRA 2X6NA 2OPRA 3SYZA 4W5OA 3SUOA 3ALYA 4L8RB 5C24A 2G8FA 2KQ2A 4HCCA 4KB1A 1LWCA 3VQPA 2VG6A 4F4KA 1UOCA 1NK9A 3QERA 5I42A 3I8DA 4OLAA 4DTOA 3OYBA 5CYQA 3MXMA 1WN7A 1WSGA 3LAMA 3T1AA 3ZSQA 5CY4A 3M8SA 1R0AA 3LAKA 3NAEA 5J2PA 2ZD1A 1QE1A 4FW2A 3EZ5A 1TV6A 4ICLA 4FVMA 1NKCA 3G10A 4JS4A 5J2NA 4BE2A 3SQ2A 3WNGA 5KRSA 5FROA 5SZTA 3PO5A 4Z4EA 4DMNA 1NK8A 2P51A 4OKJA 4KI6A 4FJHA 4DQIA 1C1BA 1J53A 3TANA 1RBUA 2Z1IA 3U3GA 4CIGA 4EZ9A 1DTTA 3PY8A 1WSIA 3LZJA 1IKXA 2YKMA 1HNIA 3I0RA 3NH1A 4JS5A 5HLFA 1KFSA 2OYQA 2D0BA 2FBYA 3AA3A 4K8XA 3OYEA 1DTQA 3AVNA 3T3FA 2HHQA 2F96A 2HHSA 1JLAA 4FJ5A 1RDCA 4DQQA 3SUQA 3QESA 2OPQA 1HYSA 4KI4A 1IKVA 2B4JA 1FKPA 1S1UA 4IDKA 3DOLA 4CFBA 1Q9YA 2HNYA 3I0SA 3G0ZA 1VSEA 4NCGA 4CJLA 4CJUA 4JRPA 3RRHA 1QSLA 1KRPA 1A5VA 1KTQA 4CERA 3V6DA 2FC0A 4PUOA 1RT2A 4DLGA 1LW0A 3HPHA 2PZSA 3CM6A 5HRNA 3S3MA 4AHRA 3KLIA 3AVMA 4CGIA 3HYFA 1RTIA 3TAFA 4C8OA 3OYMA 3QEWA 4CFCA 4CGJA 4G1QA 1C0TA 1BIUA 4B9TA 4Q0BA 4CIFA 1BIZA 4DTMA 4CJWA 1T05A 1O1WA 3KIOA 2WONA 1KFDA 3NGYA 1LWFA 3M8RA 3OYNA 1SL1A 1WAJA 3K57A 3IS9A 4KO0A 3VA3A 4YNQA 3U6FA 1UA1A 1BCMA 4M3XA 1HPZA 3OJSA 3MXIA 1YVUA 4OPJA 3AO4A 2YNHA 4CEBA 4IBNA 4DF4A 4FLZA 3SPZA 3ZSXA 4CF0A 1SKRA 1WSHA 3L2WA 1UWBA 3OJUA 3AO3A 4BWJA 5KGXA 3K5NA 2P5OA 4N76A 3K5LA 4M3YA 4BDPA 3AA5X 3NF7A 4FM0A 3ULDA 4E89A 4BACA 4M42A 1S5JA 4B9VA 4J2BA 2XY5A 1GOBA 4YFUA 4ELUA 4FJ8A 3OS0A 3HK2A 2HHUA 4AHTA 1VSLA 1TL3A 1UA0A 2YHBA 3JSMA 4KTWA 4DS5A 1W0HA 1ZYQA 2D5RA 5EU7A 2DY4A 1U4BA 4CHOA 3NDKA 4CEAA 4CJRA 2YNFA 3RMDA 1U49A 2BDPA 1C1AA 3IG1A 5DMRA 2VWJA 2XY6A 4E7IA 4B8CA 1N6QA 3RR8A 4FJ7A 1NK4A 2HHXA 4KHUA 3NE6A 2QK9A 1D8YA 1HRHA 3OYAA 3DYAA 3DM2A 3MEDA 1GOCA 4CJQA 3OS2A 2ETJA 4B08A 4M3UA 2BANA 4CJTA 4KHNA 4F3TA 4F8RA 1JLEA 1Y97A 4O5BA 2G8WA 3LP2A 4QOZB 4Z4CA 4PY5A 3F73A 3V4IA 1KSPA 2YNIA 4E3SA 1RT4A 4FJLA 1TVRA 1RDDA 3NFAA 4W5QA 3O3HA 3TWHA 2O4IA 1TK8A 1RBTA 4CGDA 2LSNA 3HVTA 2X78A 3KLFA 4KB0A 3NGZA 1S1WA 3K5OA 3VQ5A 3MEEA 1T7PA 3U3YA 4CF1A 4E7LA 1NK5A 3HP9A 4EZ6A 4O0IA 3L8BA 2B5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9F A;  1RBV A;  3RTV A;  2Z1H A;  1JLF A;  3AVI A;  4HTU A;  2DTU A;  3OY9 A;  3NH0 A;  4CHP A;  4CEO A;  3DI6 A;  3V1Q A;  4CJK A;  1WNS A;  1SKW A;  4CEQ A;  4KHQ A;  4UQG A;  4E19 A;  4BDZ A;  4N41 A;  4ELV A;  1CXU A;  5KI6 A;  4EP5 A;  3V1R A;  3EY1 A;  4DFK A;  4Z4I A;  3TAB A;  2ITG A;  4DTN A;  2WOM A;  3V9X A;  3MXJ A;  3B6O A;  3HVR A;  1Q9X A;  5FDL A;  1U48 A;  3OYG A;  1D9F A;  1RTH A;  1EXQ A;  3AO5 A;  3F9K A;  2E6L A;  1TK0 A;  3AVK A;  5FRN A;  4LH4 A;  4NYN A;  4IFV A;  4W5N A;  3LWL A;  4M45 A;  1TAU A;  3OVN A;  1HQE A;  4M3R A;  4B9L A;  3HM9 A;  4GMJ B;  3PX6 A;  2HVH A;  1T8E A;  3ITH A;  4B3O A;  4FJJ A;  4FCY A;  3V81 A;  5KTQ A;  2Y1I A;  4E7H A;  1L3T A;  2Q3S A;  5E41 A;  1VSM A;  5HRS A;  4N47 A;  3ZT0 A;  4FK0 A;  1TL1 A;  1TKZ A;  1LV5 A;  4NCA A;  1RDA A;  3QIP A;  4FLW A;  3NF8 A;  1F21 A;  1Q8I A;  3BGR A;  3DRR A;  2VG7 A;  1J54 A;  1RT6 A;  1K6Y A;  1UAX A;  1VSF A;  3HPO A;  1CXQ A;  5CZ1 A;  3SUN A;  1BI4 A;  1JL2 A;  1QS4 A;  1YTA A;  1S6Q A;  3WNF A;  1BI4 B;  3ZSR A;  4OKE A;  4KPY A;  3KKS A;  4DLE A;  4DTX A;  3QNO A;  2KW4 A;  4NYF A;  1BQN A;  3KLE A;  4AHS A;  1ZBH A;  4LY7 A;  3JYT A;  4BE1 A;  3H08 A;  1S9G A;  4CEZ A;  4CIE A;  3SQ0 A;  5D3G A;  3HO1 A;  3VQ4 A;  2XRI A;  1SKS A;  3UIQ A;  3VQ6 A;  1NJW A;  2FBX A;  3V9W A;  1ZBL A;  2GV9 A;  3HXM A;  2HHT A;  3OYF A;  3SCX A;  1G15 A;  4M3Z A;  3NCI A;  1NOY A;  4DSL A;  1HYZ A;  4M41 A;  1BL3 A;  3WNE A;  1VSK A;  3KKR A;  4KTZ A;  3LDS A;  4FJN A;  4FZZ A;  1KCF A;  4LH5 A;  1ZBI A;  4CJ5 A;  3AVB A;  4I2P A;  5HRO A;  2X74 A;  2KTQ A;  1VSH A;  3KK2 A;  3L3V A;  1TAQ A;  3V9Z A;  3QEP A;  3QET A;  2E6M A;  4FZX C;  1Z26 A;  3LP0 A;  4M3T A;  4ZHR A;  4CJ4 A;  1JLB A;  5DK5 A;  4J2E A;  3ZT4 A;  1N5Y A;  1D9D A;  3NF6 A;  1S1T A;  1C6V A;  3LWM A;  4Q5V A;  1WSJ A;  1REV A;  4FZY A;  4BE0 A;  3QEV A;  1FKO A;  2G8H A;  3ZSZ A;  2HW3 A;  1XC9 A;  3OYC A;  4M3W A;  4W5R A;  1RDB A;  4DSI A;  3DLH A;  4CCH A;  1X9W A;  2RN2 A;  4CEC A;  1RT5 A;  2XY7 A;  4DQS A;  1X9S A;  4KAZ A;  4HUE A;  2W42 A;  2DFE A;  4CJF A;  1TK5 A;  1JLG A;  4ZTF A;  4HUF A;  2AJQ A;  2BE2 A;  3B6P A;  3AVA A;  4DU1 A;  4IKF A;  1ASU A;  3DOK A;  4KRF A;  3M8Q A;  1MU2 A;  5K14 A;  4DWI A;  2QKB A;  1EET A;  2QKK A;  3PX0 A;  2PYJ A;  1NOZ A;  4DTR A;  2IOC A;  3ZSV A;  3KK3 A;  4FJ9 A;  2NUB A;  2ZE2 A;  2XHB A;  3P5J A;  4FK2 A;  1RCH A;  3SPY A;  4LSN A;  1RTD A;  4K8Z A;  1YTU A;  1JXB A;  3ZSY A;  4B9N A;  2PYL A;  3OYJ A;  3CQ8 A;  4F3O A;  3OYD A;  4I2Q A;  2HNZ A;  1JXE A;  3D45 A;  3FFI A;  3V9U A;  3PUF A;  3TAE A;  1QTM A;  1JL1 A;  3NH2 A;  4CK3 A;  3VA0 A;  1VSD A;  2GBZ A;  4DFP A;  4KHY A;  4QCL A;  1S1X A;  3S3O A;  3RRG A;  2GUI A;  4I7F A;  4AHC A;  2IC3 A;  5T7B A;  4Y1C A;  4RG8 A;  3ZCM A;  1L3U A;  4H4O A;  4Z0U A;  4OPK A;  4DSE A;  2D0C A;  2IAJ A;  1IG9 A;  1S6P A;  3TAQ A;  4F2R A;  1CZB A;  4KHW A;  4NCB A;  3AA4 A;  1I39 A;  5HRR A;  1XWL A;  3OYI A;  3NHG A;  4HCB A;  5HRP A;  4FJX A;  1RBR A;  1A5X A;  4C8L A;  3E01 A;  1BCO A;  1JKH A;  1S1V A;  3L2U A;  2Y1J A;  4ZTJ A;  1RIL A;  2G8U A;  2DFF A;  1J9A A;  3LP3 A;  1QSS A;  3P1G A;  3PO4 A;  1VRT A;  4I9L A;  4CK2 A;  1WSF A;  2YNG A;  2JLE A;  4Z4H A;  3AVG A;  5J2M A;  3SI6 A;  3K58 A;  1S9E A;  3SQ4 A;  3RR7 A;  1CZ9 A;  4DTJ A;  4DF8 A;  1A5W A;  4AH9 A;  1IO2 A;  3SJJ A;  1TKT A;  5HBM A;  2F8T A;  5JS1 A;  3RMA A;  3O3G A;  3K5M A;  1J5O A;  2HHV A;  2G8V A;  4RW7 A;  4B8A B;  3HST B;  1Z25 A;  3DLG A;  4I9Q A;  3VQE A;  1DLO A;  2G8I A;  1CLQ A;  3CYM A;  3QIO A;  4CHQ A;  4O55 A;  2OPS A;  4MQ3 A;  1TKX A;  4CHZ A;  4FM1 A;  3KK1 A;  1KLM A;  1HNV A;  3L2Q A;  3THV A;  2Z1G A;  4C8K A;  2Z1J A;  3O4N A;  4CJE A;  3LZI A;  2HVI A;  1U04 A;  3QNN A;  4IG0 A;  4RW4 A;  3C6T A;  4LD0 A;  2EHG A;  2OZM A;  4DSJ A;  1KVB A;  4R5P A;  4AHU A;  2O4G A;  3TAG A;  1NJX A;  3QEI A;  2OZS A;  4ID5 A;  4E7K A;  4H4M A;  4B9S A;  1D5A A;  4DQR A;  3ZSO A;  3WNH A;  1WAF A;  5J2Q A;  1LWE A;  1U45 A;  2YV0 X;  3KD1 E;  3VQ8 A;  4CED A;  4CHY A;  4FJI A;  2RF2 A;  3AO2 A;  3QO9 A;  1LAW A;  4JRQ A;  4CJV A;  2HMI A;  1FXX A;  3NGI A;  3CFP A;  1SL0 A;  1L3V A;  5FRM A;  4FLU A;  1KVC A;  1C1C A;  3D0P A;  3RMC A;  3KD5 E;  2KZM A;  3ZT2 A;  2D0A A;  4FJK A;  4FM2 A;  3LAN A;  3VQ9 A;  2KFZ A;  2YKN A;  4J2D A;  3VQQ A;  1NKE A;  4KKO A;  4CJP A;  1NJZ A;  2JGU A;  4FLX A;  3KLG A;  1ASV A;  3HJF A;  3QIN A;  3AO1 A;  3TAM A;  5JS2 A;  4FXD A;  4PWD A;  3AVH A;  4IG3 A;  4KTQ A;  3ZT1 A;  3OYL A;  3C94 A;  2IGI A;  1NK6 A;  1HJR A;  2QXF A;  4CE9 A;  1EKE A;  3K59 A;  3PV8 A;  1ZBF A;  4MFB A;  1L5U A;  4RW6 A;  4N5S A;  3SV3 A;  3ISN C;  1ASW A;  1JLQ A;  1W9H A;  4QAG A;  1NK0 A;  1LAV A;  5C42 A;  3DMJ A;  4LSL A;  1SV5 A;  2FBV A;  4EP4 A;  3HP6 A;  3ASM A;  4H8K A;  2B6A A;  4CF8 A;  3DLE A;  2I5J A;  5KRT A;  2KZZ A;  3SZ2 A;  2KFN A;  3HL8 A;  1X1P A;  2HHW A;  3A2F A;  3KTQ A;  2YHA A;  4GVM A;  1B92 A;  3KJV A;  4XIU A;  3AVJ A;  4O0J A;  3CG7 A;  3S9H A;  4OGE A;  4RW9 A;  2FBT A;  5CZ2 A;  1BIS A;  1XI1 A;  3AVL A;  1SL2 A;  2G8K A;  3S3N A;  1RT1 A;  1HYV A;  4HUG A;  4B9M A;  3VQ7 A;  4DTS A;  4CGH A;  2HND A;  1L3S A;  2XO7 A;  4DTP A;  5J1E A;  3MEC A;  4OKK A;  4KRE A;  4CF9 A;  1VSI A;  4E1M A;  4HHT A;  4PQU A;  4OVL A;  4CJS A;  1TKD A;  4C8N A;  4DSK A;  3ZT3 A;  2DFH A;  1NJY A;  1RTJ A;  4O4G A;  4HVJ A;  3VQB A;  4DQP A;  2A1S A;  5CYM A;  4CEE A;  1C0U A;  4DG1 A;  3IAY A;  4Z4F A;  1LW2 A;  3P83 D;  3OYH A;  3NBP A;  2IS3 A;  1KVA A;  4Y1D A;  1XHX A;  1EP4 A;  5KGW A;  2VWK A;  2OA8 A;  4CF2 A;  1U47 A;  4E0D A;  4KFB A;  1IKW A;  1T03 A;  3CFO A;  3L3U A;  4CHN A;  1FK9 A;  5I3U A;  1WSE A;  2ATQ A;  4ID1 A;  2P5G A;  4TSX A;  4WE1 A;  4IFY A;  4W5T A;  4B9U A;  3SV4 A;  4BWM A;  4CGF A;  4DU3 A;  4CFA A;  3AA2 A;  3AV9 A;  3HPG A;  3LPU A;  3MEG A;  4CES A;  3BDP A;  1YT3 A;  3AVF A;  3C6U A;  1RT7 A;  3LAL A;  4GW6 A;  4FLY A;  4F2S A;  3TAP A;  4FW1 A;  3VQA A;  4DSF A;  3TR8 A;  4FLT A;  3EYZ A;  3SNN A;  2EX3 A;  3DLK A;  4PA1 A;  2E4L A;  4RW8 A;  4AIL C;  1JLC A;  3RMB A;  4AHV A;  1C0M A;  3LPT A;  3C95 A;  2X6S A;  4DFJ A;  2RPI A;  3QLH A;  3V1O A;  4DTU A;  1KLN A;  4J2A A;  4KV8 A;  4OGC A;  3M8P A;  1BHL A;  3SUP A;  1RBS A;  5HP1 A;  4Z4G A;  3OYK A;  3CM5 A;  1B9D A;  1IH7 A;  2IDO A;  1XHZ A;  3L2V A;  3NF9 A;  4N56 A;  4FLV A;  1VSJ A;  1VRU A;  1ITG A;  1RNH A;  3SQ1 A;  3DRS A;  4E1N A;  1BQM A;  4C8M A;  1ZBU A;  4OJR A;  4FK4 A;  4FJG A;  4KHS A;  3RWU A;  2VG5 A;  3AVC A;  3O4Q A;  3QEX A;  3V9S A;  1QSY A;  2OPP A;  3VQD A;  4CGG A;  3TI0 A;  2F8S A;  4CJ3 A;  3K2P A;  1HMV A;  4DU4 A;  4ELT A;  2ZQB A;  4JLH A;  4CFD A;  3KLH A;  4BDY A;  4DFM A;  3DRP A;  3OS1 A;  3PX4 A;  1NK7 A;  3ZSW A;  1GOA A;  1RT3 A;  4OLB A;  2HB5 A;  1HQU A;  1TGO A;  1WLJ A;  2A1R A;  2XY8 A;  3IRX A;  4CEF A;  1QQC A;  1EX4 A;  3VN5 A;  3O3F A;  4O44 A;  5C25 A;  1X9M A;  4FYD A;  5SWM A;  2BGG A;  2RKI A;  1BGX T;  3HT3 A;  3DLB A;  1VK0 A;  2R7Y A;  4FJM A;  1QHT A;  3T19 A;  2PY5 A;  4E7J A;  4DS4 A;  3LP1 A;  4CK1 A;  1SUQ A;  3VQC A;  3MAQ A;  1NKB A;  3CFR A;  3TAR A;  1IKY A;  2P1J A;  3L2R A;  1I3A A;  3DLR A;  2X6N A;  2OPR A;  3SYZ A;  4W5O A;  3SUO A;  3ALY A;  4L8R B;  5C24 A;  2G8F A;  2KQ2 A;  4HCC A;  4KB1 A;  1LWC A;  3VQP A;  2VG6 A;  4F4K A;  1UOC A;  1NK9 A;  3QER A;  5I42 A;  3I8D A;  4OLA A;  4DTO A;  3OYB A;  5CYQ A;  3MXM A;  1WN7 A;  1WSG A;  3LAM A;  3T1A A;  3ZSQ A;  5CY4 A;  3M8S A;  1R0A A;  3LAK A;  3NAE A;  5J2P A;  2ZD1 A;  1QE1 A;  4FW2 A;  3EZ5 A;  1TV6 A;  4ICL A;  4FVM A;  1NKC A;  3G10 A;  4JS4 A;  5J2N A;  4BE2 A;  3SQ2 A;  3WNG A;  5KRS A;  5FRO A;  5SZT A;  3PO5 A;  4Z4E A;  4DMN A;  1NK8 A;  2P51 A;  4OKJ A;  4KI6 A;  4FJH A;  4DQI A;  1C1B A;  1J53 A;  3TAN A;  1RBU A;  2Z1I A;  3U3G A;  4CIG A;  4EZ9 A;  1DTT A;  3PY8 A;  1WSI A;  3LZJ A;  1IKX A;  2YKM A;  1HNI A;  3I0R A;  3NH1 A;  4JS5 A;  5HLF A;  1KFS A;  2OYQ A;  2D0B A;  2FBY A;  3AA3 A;  4K8X A;  3OYE A;  1DTQ A;  3AVN A;  3T3F A;  2HHQ A;  2F96 A;  2HHS A;  1JLA A;  4FJ5 A;  1RDC A;  4DQQ A;  3SUQ A;  3QES A;  2OPQ A;  1HYS A;  4KI4 A;  1IKV A;  2B4J A;  1FKP A;  1S1U A;  4IDK A;  3DOL A;  4CFB A;  1Q9Y A;  2HNY A;  3I0S A;  3G0Z A;  1VSE A;  4NCG A;  4CJL A;  4CJU A;  4JRP A;  3RRH A;  1QSL A;  1KRP A;  1A5V A;  1KTQ A;  4CER A;  3V6D A;  2FC0 A;  4PUO A;  1RT2 A;  4DLG A;  1LW0 A;  3HPH A;  2PZS A;  3CM6 A;  5HRN A;  3S3M A;  4AHR A;  3KLI A;  3AVM A;  4CGI A;  3HYF A;  1RTI A;  3TAF A;  4C8O A;  3OYM A;  3QEW A;  4CFC A;  4CGJ A;  4G1Q A;  1C0T A;  1BIU A;  4B9T A;  4Q0B A;  4CIF A;  1BIZ A;  4DTM A;  4CJW A;  1T05 A;  1O1W A;  3KIO A;  2WON A;  1KFD A;  3NGY A;  1LWF A;  3M8R A;  3OYN A;  1SL1 A;  1WAJ A;  3K57 A;  3IS9 A;  4KO0 A;  3VA3 A;  4YNQ A;  3U6F A;  1UA1 A;  1BCM A;  4M3X A;  1HPZ A;  3OJS A;  3MXI A;  1YVU A;  4OPJ A;  3AO4 A;  2YNH A;  4CEB A;  4IBN A;  4DF4 A;  4FLZ A;  3SPZ A;  3ZSX A;  4CF0 A;  1SKR A;  1WSH A;  3L2W A;  1UWB A;  3OJU A;  3AO3 A;  4BWJ A;  5KGX A;  3K5N A;  2P5O A;  4N76 A;  3K5L A;  4M3Y A;  4BDP A;  3AA5 X;  3NF7 A;  4FM0 A;  3ULD A;  4E89 A;  4BAC A;  4M42 A;  1S5J A;  4B9V A;  4J2B A;  2XY5 A;  1GOB A;  4YFU A;  4ELU A;  4FJ8 A;  3OS0 A;  3HK2 A;  2HHU A;  4AHT A;  1VSL A;  1TL3 A;  1UA0 A;  2YHB A;  3JSM A;  4KTW A;  4DS5 A;  1W0H A;  1ZYQ A;  2D5R A;  5EU7 A;  2DY4 A;  1U4B A;  4CHO A;  3NDK A;  4CEA A;  4CJR A;  2YNF A;  3RMD A;  1U49 A;  2BDP A;  1C1A A;  3IG1 A;  5DMR A;  2VWJ A;  2XY6 A;  4E7I A;  4B8C A;  1N6Q A;  3RR8 A;  4FJ7 A;  1NK4 A;  2HHX A;  4KHU A;  3NE6 A;  2QK9 A;  1D8Y A;  1HRH A;  3OYA A;  3DYA A;  3DM2 A;  3MED A;  1GOC A;  4CJQ A;  3OS2 A;  2ETJ A;  4B08 A;  4M3U A;  2BAN A;  4CJT A;  4KHN A;  4F3T A;  4F8R A;  1JLE A;  1Y97 A;  4O5B A;  2G8W A;  3LP2 A;  4QOZ B;  4Z4C A;  4PY5 A;  3F73 A;  3V4I A;  1KSP A;  2YNI A;  4E3S A;  1RT4 A;  4FJL A;  1TVR A;  1RDD A;  3NFA A;  4W5Q A;  3O3H A;  3TWH A;  2O4I A;  1TK8 A;  1RBT A;  4CGD A;  2LSN A;  3HVT A;  2X78 A;  3KLF A;  4KB0 A;  3NGZ A;  1S1W A;  3K5O A;  3VQ5 A;  3MEE A;  1T7P A;  3U3Y A;  4CF1 A;  4E7L A;  1NK5 A;  3HP9 A;  4EZ6 A;  4O0I A;  3L8B A;  2B5J A; 
#chains in the Genus database with same CATH topology
 4NO7 A;  3RTV A;  3AVI A;  2GUP A;  4QS9 A;  4HTU A;  3NH0 A;  4JI8 K;  2DTU A;  4CHP A;  3DI6 A;  1BA1 A;  4CJK A;  1WNS A;  4CZM A;  5C10 A;  4CEQ A;  3DXK A;  3DLL L;  4UQG A;  2ASP A;  4N41 A;  5KI6 A;  1VQ5 N;  2P9L A;  1Q81 O;  2A3Z A;  2P9K A;  4DTN A;  3TSU A;  4KHU A;  1U48 A;  5LMN K;  5AQH A;  1TK0 A;  5AQN A;  3CPE A;  5LL6 Z;  4LH4 A;  4X64 K;  4B9L A;  1ZC6 A;  3ITH A;  4CI6 A;  4B3O A;  5BPN A;  4JKH A;  1L3T A;  2Q3S A;  5AQO A;  5HRS A;  4FK0 A;  4C1N I;  1TKZ A;  1LV5 A;  4NCA A;  3VPZ A;  2QWR A;  1F21 A;  2E88 A;  3BGR A;  2QEX N;  1J54 A;  4GVE A;  1UAX A;  1MA9 B;  1CXQ A;  1EQY A;  4FOI A;  2VWB A;  5CZ1 A;  3WNF A;  1S6Q A;  4I6M A;  3ZSR A;  4DLE A;  4DTX A;  3QNO A;  4AHS A;  4CEZ A;  3SQ0 A;  3RVC A;  3U9D A;  4FWR A;  3VQ4 A;  1XNR K;  4FWN A;  2YHX A;  5GAG P;  3V9W A;  4JNE A;  5AZJ A;  3CD6 N;  3G25 A;  4DR5 K;  2NRZ A;  1NOY A;  3LDS A;  4KTZ A;  1U2V B;  4I2P A;  3CC4 N;  2O8C A;  3C6A A;  3L3V A;  1YUW A;  4CJ4 A;  2ZGZ A;  1S1T A;  2VQE K;  5AQF A;  3M5R A;  4B1X B;  2OTL N;  1REV A;  1FKO A;  4PKG A;  4CVN E;  4DSI A;  1K8K B;  1YI2 N;  4NLC A;  2W42 A;  5DM7 L;  2DFE A;  2BE2 A;  3P39 A;  4JK9 A;  2ASO A;  3SBG A;  1QVF M;  4KRF A;  4J8F A;  3M8Q A;  4DWI A;  1SS6 A;  3FGU A;  3PX0 A;  1LOT B;  4BY9 C;  4DTR A;  2XHB A;  4FK2 A;  3T69 A;  3S41 A;  1RTD A;  3CJA A;  3ZSY A;  4F3O A;  3OYD A;  3VF4 A;  1JXE A;  3EKS A;  3PUF A;  3WUH A;  3VA0 A;  3LM2 A;  3S3O A;  4AHC A;  5T7B A;  5EVZ A;  1XQS C;  5AQU A;  1L3U A;  4H4O A;  4Z0U A;  2E5L K;  1S6P A;  3C6H A;  3F5T A;  4KHW A;  5HRR A;  4HCB A;  1RBR A;  1A5X A;  5AZI A;  1GLJ O;  3VF2 A;  1X3M A;  1S1V A;  3L2U A;  2Y1J A;  4ZTJ A;  1T44 A;  2DFF A;  1NJI O;  4EFH A;  4M7Y A;  3PO4 A;  4I9L A;  4CK2 A;  4BC2 A;  3BP8 A;  4Z4H A;  5J2M A;  3SI6 A;  3SQ4 A;  5LJV A;  4DF8 A;  4DTJ A;  1ATR A;  4AH9 A;  3SJJ A;  2FSK A;  3PSF A;  1GLL O;  4JD2 B;  3CQX A;  5JS1 A;  5JLH A;  3O3G A;  2HHV A;  4DR3 K;  3DLG A;  5AR0 A;  4I9Q A;  2G8I A;  3J7Y P;  4CHQ A;  5AJ3 K;  1EWQ A;  3KK1 A;  1KLM A;  3L2Q A;  3THV A;  2Z1G A;  3O4N A;  5CHI A;  3UKU B;  2ZWH A;  3C6T A;  2OZM A;  3BUZ B;  4R5P A;  4AHU A;  2O4G A;  1NJX A;  3ULE B;  4ID5 A;  3MX5 A;  3ULE A;  2QWQ A;  4H5W A;  1NMN A;  5AQK A;  4CHY A;  3AO2 A;  3CFP A;  3M1F A;  1L3V A;  1QHA A;  3D0P A;  3RMC A;  4LFA K;  4FM2 A;  3VEZ A;  3LAN A;  4JI0 K;  1J6Z A;  3DAW A;  3DXM A;  3KLG A;  3C65 A;  1ASV A;  3C7N A;  2AP1 A;  3AO1 A;  3TAM A;  1KD1 O;  3ZT1 A;  3H6E A;  4CD3 A;  2O8E A;  1P8Z A;  4CE9 A;  3PV8 A;  3IUC A;  2BUP A;  4FWS A;  4MFB A;  1W9H A;  4YOU A;  4EP4 A;  2B6A A;  3DLE A;  3SZ2 A;  2KFN A;  3HL8 A;  3LL3 A;  3A2F A;  3O80 A;  3THW A;  3QDK A;  1QQO A;  4K0K K;  4O0J A;  2VYP A;  4RW9 A;  2G8K A;  1W7A A;  1TUY A;  4PKH A;  4B9M A;  3CCR N;  2HND A;  1L3S A;  4DTP A;  2E2P A;  4OKK A;  1LCU A;  4E1M A;  4FO0 A;  5A2Q O;  4BQL A;  3H1V X;  3GBT A;  2Q0U A;  4DSK A;  2DFH A;  4ILG B;  1NJY A;  2A1S A;  4X65 K;  1C0U A;  3P83 D;  5KQD A;  3CER A;  5KGW A;  3DXK B;  1DGK N;  4KFB A;  3FR0 A;  4H5R A;  3T1H K;  1FJG K;  3CFO A;  1OH6 A;  1FK9 A;  2KKZ A;  1WSE A;  1YIJ N;  4CBW A;  4CGF A;  3AV9 A;  3MEG A;  4CES A;  1YT3 A;  4AQY K;  4GW6 A;  3TAP A;  4FW1 A;  4BRF A;  3VQA A;  4PA1 A;  2HST A;  3LM9 A;  3L6Q A;  4K25 A;  2V51 B;  4KH4 A;  3LPT A;  2BTF A;  4DV2 K;  3V1O A;  2UUC K;  3O9S A;  4OGC A;  1BHL A;  3OYK A;  1WBB A;  4B3T K;  1IH7 A;  2Q2R A;  4N56 A;  3MMV A;  3SQ1 A;  3DRS A;  3THX A;  3TTC A;  1ZBU A;  2OTJ N;  4KHS A;  2VG5 A;  4YY3 K;  3I55 N;  2OPP A;  4OPA A;  3K2P A;  4DU4 A;  4LF5 K;  3TTD A;  3OS1 A;  3PX4 A;  4FPB A;  3A5L C;  5JMV A;  5SWM A;  2DPN A;  2RKI A;  3HT3 A;  2CH6 A;  3AGK A;  4CBU A;  1QHT A;  3T19 A;  3LP1 A;  4CK1 A;  3VQC A;  3MAQ A;  3CFR A;  2QA4 N;  1IKY A;  3TAR A;  1I3A A;  3CXC M;  3SYZ A;  3SUO A;  3CC2 N;  4W5O A;  4L8R B;  4KB1 A;  2FF6 A;  1JCG A;  2VG6 A;  1UOC A;  3ZX3 A;  1NK9 A;  5GAE P;  1OH7 A;  1WSG A;  3I33 A;  3M8S A;  3SAG A;  1TV6 A;  1NKC A;  4YDU C;  3CF5 L;  4BE2 A;  5KRS A;  3PO5 A;  1TYQ A;  4KI6 A;  1J53 A;  3TAN A;  1RBU A;  4EZ9 A;  1WSI A;  3ZYY X;  2YKM A;  1HNI A;  3BY5 A;  5HLF A;  2OYQ A;  2FBY A;  1T3V A;  4K8X A;  2HHS A;  1JCE A;  2HHQ A;  4IOX A;  4KI4 A;  3IMX A;  3BF3 A;  3OBY A;  5BRH A;  2HNY A;  2P9I B;  1Q86 O;  4NCG A;  1W2B M;  4PUO A;  1RT2 A;  3E9O A;  2A6A A;  4AHR A;  3TAF A;  2Q97 A;  3QIC A;  3GE1 A;  3U9Z A;  2P9P A;  4CGJ A;  3QEW A;  4MDB A;  4WFA L;  3H45 C;  3FZM A;  5BN9 A;  3NGY A;  1LWF A;  3OYN A;  3VA3 A;  4YOT A;  1XC3 A;  1HPZ A;  1YVU A;  2YNH A;  2PBD A;  5BPM A;  3W0L A;  4CF0 A;  1SKR A;  4O8U A;  3L2W A;  3AO3 A;  4N76 A;  4M3Y A;  4BDP A;  5M1F A;  3O5B A;  2ITM A;  1S5J A;  4J2B A;  3CMA N;  2XY5 A;  4ELU A;  1VSL A;  4KBO A;  1TL3 A;  3JSM A;  4DS5 A;  2V7Y A;  2QI2 A;  2O8C B;  1ZXO A;  5EU7 A;  4BRN A;  1VQ8 N;  1O13 A;  3ENO A;  3RMD A;  5DMR A;  1M90 O;  3NE6 A;  1HRH A;  1X3N A;  3ZEU B;  1GOC A;  4BR9 A;  3OS2 A;  4JD2 A;  2BAN A;  5AQG A;  5M1K A;  4F3T A;  1Y97 A;  4DR2 K;  2G8W A;  1XNQ K;  3K9J A;  4GV3 A;  1KSP A;  3AGR A;  4E3S A;  1RDD A;  3NFA A;  3J7A P;  3KHY A;  2O4I A;  2LSN A;  3NGZ A;  1S1W A;  3Q7C A;  3MN9 A;  3CCS N;  3K5O A;  1T7P A;  4EZ6 A;  2O8E B;  4CEO A;  2JWL A;  3V1Q A;  4B9Q A;  4DV6 K;  4KHQ A;  2UXC K;  4JHD A;  4ELV A;  4JHD B;  2NRT A;  3EY1 A;  3THW B;  4GNI A;  4DFK A;  1C0F A;  4CJ7 A;  4Z4I A;  3HM8 A;  2ITG A;  2HF3 A;  2WOM A;  3TAB A;  3V9X A;  3MXJ A;  1Q9X A;  5BPL A;  1D9F A;  4BR4 A;  1SAZ A;  2E6L A;  3O1W A;  3SAH A;  5FRN A;  3SBT A;  4NYN A;  4W5N A;  2FF3 B;  3LWL A;  3OVN A;  3HM9 A;  4GMJ B;  3PX6 A;  2HVH A;  1T8E A;  4PHT X;  3ZT0 A;  2O8B A;  1TL1 A;  2NNW A;  1RDA A;  3NF8 A;  1Q8I A;  3MWT A;  2QTD A;  4FWK A;  4NXN K;  2Q31 A;  3HPO A;  1JL2 A;  3GOI A;  3FFK B;  4BRK A;  4NYF A;  1BQN A;  3KLE A;  1HNW K;  4LY7 A;  3H08 A;  4LFB K;  4NB4 A;  1E4G T;  3HSC A;  1SKS A;  3RSE A;  1NJW A;  2FBX A;  3HXM A;  3R8E A;  2HHT A;  3OYF A;  5FLX O;  4DSL A;  1BL3 A;  3KKR A;  4DV4 K;  1KCF A;  4CJ5 A;  2KTQ A;  2X74 A;  1VSH A;  3KK2 A;  1HLU A;  3V9Z A;  3CCQ N;  3QET A;  2E6M A;  4LFC K;  2ZGY A;  4BC3 A;  1JLB A;  3NF6 A;  3UKR B;  4H0V B;  4YOY A;  3I8B A;  5AQJ A;  1C6V A;  4BRO A;  2WFB A;  4CZL A;  2G8H A;  3ZSZ A;  4M3W A;  4W5R A;  1RDB A;  4JK8 A;  1WBD A;  1RT5 A;  3ZET B;  2NRV A;  1XMO K;  4BR5 A;  4CJF A;  5AQX A;  2AJQ A;  3B6P A;  4IKF A;  1MU2 A;  4H0Y B;  1EET A;  3VTH A;  3ATU A;  2QKB A;  2QM1 A;  3ZSV A;  3KK3 A;  2ZE2 A;  3WXM B;  3SPY A;  2P9S B;  4JI2 K;  4ISE A;  1JXB A;  5B8H A;  4B9N A;  2ASM A;  4DR6 K;  3R6M A;  3MN5 A;  4M63 C;  3V9U A;  4AM6 A;  4ILH A;  4DFP A;  1S1X A;  2GUI A;  3FZH A;  4RG8 A;  3I56 N;  3CIP A;  1WB9 A;  3WEE B;  4JKA A;  2ZJR L;  4CZG A;  4UY8 O;  4Z94 A;  4NCB A;  3OYI A;  1XWL A;  5GIN A;  4FJX A;  1X9J A;  1JKH A;  1RIL A;  1J9A A;  4JKC A;  3UE5 A;  4EAH D;  1YXQ A;  4WYB A;  2YNG A;  2JLE A;  4DKW A;  4A5B A;  3RR7 A;  1HUX A;  1BUP A;  2F8T A;  1TKT A;  5HBM A;  4BRL A;  5EY4 A;  3K5M A;  4MDA A;  4FWP A;  4RW7 A;  4B8A B;  1KAZ A;  3TSP A;  3OW2 M;  1YJ9 N;  3MDQ A;  2IVN A;  4A2A A;  2E2N A;  1CLQ A;  3CYM A;  2OPS A;  4MQ3 A;  2PAV A;  2UUA K;  4IG0 A;  2EHG A;  3TAG A;  5KPZ A;  1HNZ K;  5BR8 K;  3WNH A;  4JI5 K;  3SLC A;  1LWE A;  5C2D A;  1U45 A;  4DCH A;  3KD1 E;  4JRQ A;  4JYA K;  5FRM A;  1SL0 A;  4G9Z A;  5EX5 A;  1KVC A;  1C1C A;  3KD5 E;  5KPT A;  5AQZ A;  2P9I A;  3VQ9 A;  2KFZ A;  4YOW A;  1HX1 A;  3VQQ A;  2BH1 A;  4XH1 A;  1NJZ A;  4OO1 J;  3WT0 A;  3QIN A;  1NGE A;  4FXD A;  4CZI A;  4IG3 A;  3C94 A;  2IGI A;  1NK6 A;  1HJR A;  1EKE A;  3K59 A;  1HPM A;  1ZBF A;  1L5U A;  3N4Q A;  4QAG A;  1ASW A;  1LAV A;  5C42 A;  3DMJ A;  4LSL A;  1SV5 A;  2FBV A;  5GIO A;  2ZJQ L;  2I5J A;  5KRT A;  2KZZ A;  5FPM A;  2HHW A;  3EKU A;  2HBL A;  2YI1 A;  5ADX H;  1B92 A;  2GTD A;  4MLE A;  3CG7 A;  3S9H A;  4OGE A;  1S3X A;  2FBT A;  5AQM A;  3S3N A;  2D0P A;  3VQ7 A;  4DTS A;  4CGH A;  2XO7 A;  4KRE A;  2Q0R A;  2VGN A;  3DWL A;  2VGM A;  3WQT A;  4PQU A;  4R79 A;  1CZA N;  3BEX A;  3VQB A;  4DQP A;  3IAY A;  2UXB K;  5AQS A;  3OYH A;  3VGK A;  2NRH A;  1DKG D;  2VCP A;  1EP4 A;  2OA8 A;  2YJE A;  4E0D A;  1GLC G;  1T03 A;  3L3U A;  4KH5 A;  2ATQ A;  4ID1 A;  4W5T A;  4DU3 A;  4CFA A;  1Z6R A;  2QWN A;  3HPG A;  1RGI A;  3ZET A;  3BDP A;  3A5O C;  3ENB A;  4BRM A;  4F2S A;  4IDH A;  4DSF A;  2O8F A;  3HZ6 A;  3TR8 A;  3A5N C;  4FLT A;  2EX3 A;  3DLK A;  4BRH A;  4AHV A;  3WXL A;  1QZ5 A;  3BF1 A;  3NVM A;  4DTU A;  1NGG A;  3SMS A;  2D0O A;  1KLN A;  4J2A A;  2HF4 A;  3M8P A;  3JS6 A;  1RBS A;  4Z4G A;  3EO3 A;  5TKY A;  3WXI A;  3CM5 A;  4BRC A;  3NF9 A;  3U4L A;  1VSJ A;  3D2E B;  4RCH A;  5BRE A;  1RNH A;  2GWK A;  4IJA A;  1BQM A;  3CCL N;  3V9S A;  4CGG A;  3TI0 A;  1HJO A;  1HMV A;  4YDU A;  3HBT A;  3LDL A;  4BDY A;  2O8B B;  2HB5 A;  1QQC A;  4FSV A;  3VN5 A;  1X9M A;  5BN8 A;  4FJM A;  3O08 A;  4H0X B;  4E7J A;  1SUQ A;  1S22 A;  2X6N A;  2OPR A;  3ALY A;  5C24 A;  4JKD A;  1IBL K;  4WQ4 C;  3VQP A;  1NG9 A;  3DXM B;  3PLA A;  3MXM A;  3FZL A;  4HTL A;  1U6Z A;  1WN7 A;  3LAM A;  3ZSQ A;  4QS8 A;  3OTO K;  4XH5 A;  1R0A A;  3LAK A;  5FPN A;  4FW2 A;  1QZ6 A;  3EZ5 A;  3WQU A;  4FVM A;  5J2N A;  3WNG A;  4Z4E A;  3CME N;  1HR0 K;  4CIG A;  5AQR A;  3PY8 A;  3NH1 A;  2D0B A;  3AA3 A;  1DTQ A;  2F96 A;  1JLA A;  1RDC A;  1YJW N;  1NGC A;  1IKV A;  1ESV A;  1NGJ A;  1FKP A;  1S1U A;  4BRQ A;  1KRP A;  3RSE B;  2FC0 A;  2KHO A;  2FXU A;  4DLG A;  1LW0 A;  1NBW A;  3CM6 A;  5HRN A;  3S3M A;  3AVM A;  3KWI A;  1SZ2 A;  3OYM A;  1H1V A;  1BIU A;  4BR2 A;  1BIZ A;  1T05 A;  4GY2 B;  3K57 A;  3U6F A;  4KO0 A;  2W41 A;  1BCM A;  5H1S Q;  3MXI A;  1VQN N;  4CEB A;  4FLZ A;  1IJJ A;  3JXU A;  3WXJ A;  1BOT O;  3K5N A;  2QWL A;  4BWJ A;  5D3G A;  4LF6 K;  1ILY A;  2GEM A;  3K5L A;  1IV0 A;  1EO1 A;  2F9W A;  4BRA A;  3MWP A;  1G99 A;  1GOB A;  2HHU A;  4AHT A;  5C12 A;  1S72 N;  2QWM A;  3O1B A;  2D5R A;  4ILJ A;  2CGJ A;  1U49 A;  4LF8 K;  3IG1 A;  2HBM A;  2D1K A;  4B8C A;  4E7I A;  3RR8 A;  4FJ7 A;  2HHX A;  3UKR A;  2QK9 A;  3MCA B;  4DR1 K;  4M3U A;  1BU6 O;  4BC4 A;  1KQS M;  2A42 A;  2GEL A;  3AAP A;  3LP2 A;  4Z4C A;  3GL1 A;  4PY5 A;  4BG9 A;  4FJL A;  4C23 A;  3OBW A;  1RBT A;  1TK8 A;  2X78 A;  1I94 K;  3MEE A;  1NK5 A;  3HP9 A;  3MK6 A;  4A5A A;  1V4S A;  4O0I A;  1Z05 A;  1RBV A;  1JLF A;  3OY9 A;  3L4I A;  4BRP A;  3FE1 A;  4BDZ A;  3V1R A;  1ATS A;  1E3M A;  3D6R A;  2A40 A;  3B6O A;  5F0X A;  1NGD A;  5FDL A;  3OYG A;  1RTH A;  3TU5 A;  3H3N O;  3QBW A;  4BGA A;  3VTI A;  2QWO A;  4DV5 K;  4M3R A;  4GV9 A;  3CJ7 A;  3V81 A;  4FJJ A;  2O8D A;  2V52 B;  4N47 A;  4JI7 K;  3O8M A;  4BRD A;  2ZJP L;  2NRX A;  1BI4 A;  1BI4 B;  4JKE A;  4OKE A;  4WQ4 A;  4KPY A;  2A41 A;  1ZBH A;  3JYT A;  4YHH K;  1KAY A;  2W6K A;  3K9K A;  1M1K O;  2XRI A;  1C0G A;  5HL7 L;  4JKG B;  1ZBL A;  4A2B A;  2GV9 A;  3C7N B;  2Q1N A;  3CJ9 A;  3SCX A;  1EWR A;  1G15 A;  5AZI B;  2Q36 A;  5M1N A;  5E84 A;  4FJN A;  4LH5 A;  2E2O A;  1ZBI A;  1TAQ A;  3QEP A;  4FZX C;  1Z26 A;  4M3T A;  5DK5 A;  3ZT4 A;  1N5Y A;  1D9D A;  2A5X A;  3LWM A;  4Q5V A;  3P31 A;  1WSJ A;  4FZY A;  3ZLJ A;  2RE2 A;  3QEV A;  3VGL A;  4XH4 A;  5TKW A;  3OYC A;  3DLH A;  1Q82 O;  1X9W A;  1BA0 A;  4CEC A;  4DQS A;  4WF9 L;  4HUE A;  1HKG A;  2QXL A;  1KAX A;  3ID8 A;  4HUF A;  4DR4 K;  3CJB A;  1GLA G;  4DU1 A;  4IOC L;  4IO8 A;  2PYJ A;  3CCE N;  1NOZ A;  4BVP A;  3TPQ A;  4FJ9 A;  2NUB A;  4AM7 A;  4K8Z A;  4IWV A;  2UU9 K;  2PYL A;  2KLA A;  2HNZ A;  4JK7 A;  1JL1 A;  4CW7 B;  1VSD A;  2GBZ A;  4KHY A;  2GX9 A;  3ID6 A;  4ISG A;  2IC3 A;  4Y1C A;  3ZCM A;  5GIP A;  3THY A;  4OPK A;  3FZK A;  2E2Q A;  5IWA K;  2D0C A;  4A61 A;  4DSE A;  3C0B A;  3NHG A;  4DV3 K;  4JAX A;  4FWM A;  2HHH K;  2E1Z A;  4DQ8 A;  3LP3 A;  1VRT A;  4ISF A;  5AQP A;  5I9E B;  3AVG A;  3K58 A;  4BR7 A;  5JIC A;  1CZ9 A;  1A5W A;  1IO2 A;  1YHQ N;  3EL2 A;  2G8V A;  3VMF B;  3OA9 A;  3THX B;  1DLO A;  3QIO A;  4O55 A;  3MN6 A;  1TKX A;  4CHZ A;  4C8K A;  1HNV A;  4DV1 K;  2Z1J A;  3VES A;  3QNN A;  4RW4 A;  1KVB A;  4RTF D;  4E7K A;  4H4M A;  3NVK A;  1D5A A;  3H3O B;  3ZSO A;  4K42 A;  4FOE A;  3CHW A;  2YV0 X;  3AAR A;  2QWP A;  2ZF5 O;  3EZW A;  3E1Y A;  4FJI A;  1MDU B;  2HMI A;  1FXX A;  1NGI A;  4FLU A;  4I6M B;  2YHY A;  2KZM A;  3CCM N;  3ZT2 A;  4FJK A;  3DJC A;  4EIA A;  4JKB A;  1T6C A;  4EHT A;  2YKN A;  5BRD A;  4KKO A;  4CJP A;  4FLX A;  2HOE A;  3W3D A;  5KQ8 A;  3HJF A;  3WEE A;  5F2R A;  3QFU A;  4KTQ A;  3UB5 A;  3OYL A;  2EWS A;  3SK3 A;  4PL8 A;  4N5S A;  3VOV A;  1YF5 L;  3OHR A;  3QBX A;  4H8K A;  4JV5 K;  1X1P A;  1Q7Y O;  1N34 K;  2YHA A;  4GVM A;  5M1P A;  5GAD P;  5CZ2 A;  1BIS A;  2WC9 A;  2J4R A;  3AVL A;  3VEW A;  3MEC A;  4CD1 A;  4OVL A;  4CJS A;  3O9U A;  5CR4 A;  4O4G A;  4HVJ A;  4LF7 K;  4CEE A;  4DG1 A;  3J80 O;  1LW2 A;  4A62 A;  4BRE A;  1GLE G;  3NBP A;  1KVA A;  3A8Y A;  4Y1D A;  1XHX A;  2VWK A;  1NGF A;  4CF2 A;  1N8R O;  4CBX A;  1IKW A;  4H5V A;  1DT9 A;  4CHN A;  4IJN A;  1QVG M;  3NMU A;  5DM6 L;  2P5G A;  4B3M K;  5EXW A;  2E20 A;  4IFY A;  4WE1 A;  1WUA A;  3SV4 A;  3AA2 A;  4GV6 A;  3MN7 A;  5KPR A;  4FLY A;  4GKK K;  3J81 O;  3E9P A;  2E4L A;  5JVH L;  4AIL C;  1JLC A;  4B3S K;  1RDW X;  1C0M A;  2P9N B;  4BGB A;  3C95 A;  3CQY A;  3O9R A;  2X6S A;  4DFJ A;  2RPI A;  3QLH A;  4H0T B;  4LC9 B;  3SUP A;  5HP1 A;  1B9D A;  3VER A;  2IDO A;  3L2V A;  1BDG A;  4FLV A;  1GLB G;  3E66 A;  4FWL A;  4FK4 A;  4FJG A;  3RWU A;  3AVC A;  1VAZ A;  3THY B;  3VEX A;  4ELT A;  1KC8 O;  3D2F A;  4DFM A;  3DRP A;  1NK7 A;  3ZSW A;  1RT3 A;  4OLB A;  3HOS A;  3QML A;  3AY9 A;  1HQU A;  1TGO A;  1WLJ A;  3CCJ N;  2A1R A;  2XY8 A;  3IRX A;  1EX4 A;  3A0I X;  4O44 A;  1FW6 A;  4FYD A;  3DLB A;  3BZK A;  1VK0 A;  4X66 K;  3MX2 A;  2PY5 A;  3O9Q A;  3L2R A;  3DLR A;  2G8F A;  2KQ2 A;  1LWC A;  4F4K A;  4DR7 K;  3QER A;  5I42 A;  3I8D A;  3K0S A;  4DTO A;  3OYB A;  5CYQ A;  1VQK N;  5CY4 A;  3F2K A;  3Q7B A;  2FSN A;  4OPH A;  3SJH A;  5J2P A;  2O8F B;  2ZD1 A;  1QE1 A;  3B8A X;  5ELZ A;  4ICL A;  2D4W A;  5IT9 O;  3G10 A;  4JI6 K;  1HKB A;  4DQI A;  1NMD A;  3U3G A;  3HRG A;  1N36 K;  3LZJ A;  2ZM6 K;  3I0R A;  5LMU K;  2F7T A;  1WOQ A;  2WUS A;  3AVN A;  3VEY A;  4DQQ A;  3SUQ A;  1HYS A;  4FVU A;  2WTU A;  2B4J A;  3DOL A;  3LDQ A;  1HNX K;  4CJU A;  1IBK K;  1VSE A;  1A5V A;  4CER A;  3R1X A;  3V6D A;  5AQI A;  2PZS A;  4FPA A;  1MWM A;  3KLI A;  1RTI A;  4OX9 K;  4CFC A;  1QQN A;  1W97 L;  3L4Q A;  4CJW A;  4X62 K;  2WON A;  4GKJ K;  1KFD A;  1ZBS A;  1VQM N;  1VQ6 N;  5AQT A;  1SL1 A;  1WAJ A;  5FPD A;  3IS9 A;  4M3X A;  3JAM O;  3G6E N;  4OPJ A;  4IBN A;  3SPZ A;  3ZSX A;  3OJU A;  2P5O A;  4JN4 A;  3HI0 A;  4AF1 A;  3AA5 X;  3NF7 A;  3LDN A;  3G4S N;  5AQQ A;  3ULD A;  4E89 A;  4MLH A;  1N32 K;  4M42 A;  4B9V A;  3HK2 A;  3OS0 A;  1UA0 A;  4H0P A;  2P9U B;  1YIT N;  1ZYQ A;  2DY4 A;  3NDK A;  3ZX2 A;  4CEA A;  2YNF A;  2BDP A;  1GLD G;  1N6Q A;  5ADX A;  1D8Y A;  3OYA A;  4BR0 A;  4CJQ A;  1BWF O;  3CJC A;  5BRF A;  4WFB L;  3ZX0 A;  2CGL A;  4O5B A;  3MCP A;  4F9O A;  3F73 A;  3V4I A;  3GG4 A;  1TVR A;  3O3H A;  1HKC A;  1DEJ A;  4DHY A;  3ENH A;  4PL7 A;  3VQ5 A;  1OH5 A;  2NRR A;  4CF1 A;  4E7L A;  3ATV A;  4BRG A;  4C8O A;  3D7E O;  1B9F A;  2Z1H A;  3M3Z A;  1SKW A;  4CZF A;  3VF6 A;  4E19 A;  1CXU A;  4EP5 A;  2YX6 A;  3HVR A;  1EXQ A;  3AO5 A;  3F9K A;  1VQL N;  3AVK A;  4IFV A;  4XEI A;  4M45 A;  1TAU A;  1HQE A;  2IVP A;  1VHX A;  4FL9 A;  3U8X A;  1J5E K;  1IBM K;  4FCY A;  5KTQ A;  2Y1I A;  4E7H A;  5E41 A;  1VSM A;  2O8D B;  2CGK A;  4BQZ A;  4FWO A;  3QIP A;  4FLW A;  1TYQ B;  2PFU A;  3DRR A;  4B1Y B;  5JLF A;  2VG7 A;  4IOA L;  1RT6 A;  1K6Y A;  1VSF A;  4DV7 K;  1KXP A;  3SUN A;  1QS4 A;  1YTA A;  3KKS A;  3F9M A;  2KW4 A;  3O6W A;  4BE1 A;  1S9G A;  4CIE A;  3HO1 A;  3LDO A;  3UIQ A;  3VQ6 A;  4CZE A;  3EN9 A;  2YCH A;  3NCI A;  4M3Z A;  1HYZ A;  4M41 A;  3WNE A;  1VSK A;  1JCF A;  4FZZ A;  5HRO A;  3AVB A;  3LP0 A;  1VQ9 N;  2V7Z A;  4ZHR A;  4KH6 A;  4DUZ K;  1SQK A;  4J2E A;  3GDQ A;  3IKM A;  3HOT A;  4B1Z A;  4BE0 A;  4Y0W A;  4LF9 K;  1VQ7 N;  2HW3 A;  1XC9 A;  4CCH A;  4YOX A;  2RN2 A;  4WCE L;  2XY7 A;  1X9S A;  4KHP K;  3SMP A;  4KAZ A;  4BVO A;  1TK5 A;  1JLG A;  4ZTF A;  2CH5 A;  3PIO L;  3R9P A;  3AVA A;  3QFP A;  1ASU A;  3QB0 A;  3DOK A;  2I7P A;  5K14 A;  2QKK A;  3FZF A;  3O4W A;  4L3Q A;  3PSI A;  1T6D A;  2IOC A;  5M1O A;  4IFE A;  3P5J A;  1OH8 A;  1RCH A;  2QW9 A;  4LSN A;  4MO4 A;  1YTU A;  2FSJ A;  3OYJ A;  3CQ8 A;  1K8A O;  4I2Q A;  3D45 A;  3FFI A;  3TAE A;  1QTM A;  1GLF O;  3NH2 A;  4CK3 A;  4QCL A;  2JWK A;  3RRG A;  4JKF A;  5C0Y A;  4BRI A;  4I7F A;  2OCE A;  4U7B A;  3TTF A;  4B3R K;  2IAJ A;  4F2R A;  1IG9 A;  3TAQ A;  1V4T A;  1YJN N;  1CZB A;  1TUU A;  4WQ5 C;  3A5M C;  4A59 A;  3AA4 A;  1I39 A;  4H5N A;  5HRP A;  4C8L A;  1BO5 O;  3E01 A;  1BCO A;  2G8U A;  1QSS A;  3P1G A;  1WSF A;  5E26 A;  5FPE A;  1S9E A;  4DUY K;  2YHW A;  2F9T A;  3RMA A;  1J5O A;  3HST B;  4B1U B;  1Z25 A;  3VQE A;  4H0O A;  5AFU H;  4O5F A;  4FM1 A;  3P38 A;  3LZI A;  4CJE A;  2HVI A;  1OVY A;  1U04 A;  5AFU A;  4DSJ A;  4LD0 A;  3R3L A;  2OZS A;  3QEI A;  4B9S A;  3CCV N;  3H46 O;  4DQR A;  1U2V A;  1WAF A;  5J2Q A;  5MLC Q;  3VQ8 A;  4CED A;  2RF2 A;  3QO9 A;  1LAW A;  4CJV A;  3NGI A;  4B1W B;  1BG3 A;  2D0A A;  3EEQ A;  4J2D A;  1NKE A;  2JGU A;  1OVQ A;  5C2F A;  4U67 L;  5BR9 A;  3KVG A;  5JS2 A;  4PWD A;  3AVH A;  4HWI A;  4K41 A;  4CZH A;  2QXF A;  5JVG L;  4RW6 A;  3SV3 A;  3ISN C;  1JLQ A;  3VEO A;  1NK0 A;  3HP6 A;  3HTV A;  3ASM A;  4CF8 A;  1E4F T;  2NRW A;  3VGM A;  2P9L B;  3KTQ A;  1VQP N;  3KJV A;  4XIU A;  3AVJ A;  3CCU N;  1MWK A;  5LY3 A;  3CI5 A;  1K9M O;  1XI1 A;  1SL2 A;  4LF4 K;  1NGA A;  1RT1 A;  1HYV A;  2I7N A;  4HUG A;  4RWT A;  4EHU A;  3O9T A;  3TSQ A;  5J1E A;  5AQW A;  1YAG A;  4CF9 A;  1VSI A;  4HHT A;  2NZT A;  5M1Q A;  2P9U A;  5CE3 A;  1TKD A;  3J7Z O;  4C8N A;  3ZT3 A;  4A57 A;  1RTJ A;  5CYM A;  4Z4F A;  1P90 A;  3T7Z A;  2IS3 A;  4JI3 K;  2VQF K;  2IIR A;  1U47 A;  4K43 A;  2OAN A;  1NGH A;  4B1V A;  4WFN L;  2H3G X;  5I3U A;  4TSX A;  2UUB K;  4B9U A;  3P4I A;  4BWM A;  3LPU A;  5AZJ B;  3LDP A;  3AVF A;  3C6U A;  3LAL A;  1RT7 A;  2IVO A;  2GWJ A;  1XUP O;  3BZC A;  3EYZ A;  3SNN A;  2UXD K;  5AQL A;  2RHK A;  3RMB A;  4RW8 A;  4NLB A;  1ATN A;  1OKJ A;  4NXM K;  5AQV A;  4KV8 A;  5F1X A;  3CPW M;  1NLV A;  2F4V K;  3ZEU A;  1XHZ A;  3AAQ A;  4YOV A;  3N4P A;  1VRU A;  1ITG A;  1K8K A;  4E1N A;  4C8M A;  4OJR A;  4DV0 K;  3T1Y K;  3O4Q A;  3QEX A;  2E8A A;  1QSY A;  1YVN A;  1NM1 A;  3VQD A;  2F8S A;  4JKG A;  4CJ3 A;  5C15 A;  3CET A;  2ZQB A;  4JLH A;  4CFD A;  3KLH A;  2HBK A;  2HMP A;  3J8A A;  2NLX A;  2P9P B;  3D2F B;  3L0Q A;  1VQ4 N;  1GOA A;  1RDU A;  3O3F A;  4CEF A;  5C25 A;  2BGG A;  2P9S A;  1BGX T;  4YOR A;  1JJ2 M;  2R7Y A;  3KK7 A;  4DS4 A;  3WXK A;  1NKB A;  2P1J A;  3CJ1 A;  1K73 O;  1NU0 A;  4IEI A;  4HCC A;  4OLA A;  3T1A A;  4IO9 L;  5GAH P;  4H03 B;  3NAE A;  3IFR A;  1QQM A;  2P9N A;  4JS4 A;  5LJW A;  3SQ2 A;  4CZK A;  5FRO A;  5SZT A;  3KZB A;  4DMN A;  2P51 A;  1NK8 A;  4OKJ A;  3EE8 A;  4QS7 A;  3VEV A;  2UYT A;  4BC5 A;  1C1B A;  4FJH A;  2Z1I A;  1DTT A;  4IXC A;  3M6G A;  1IKX A;  3VEN A;  1KFS A;  5EOY A;  4JS5 A;  5HOO A;  3OYE A;  3T3F A;  1XMQ K;  4E1J A;  3H1Q A;  4FJ5 A;  3QES A;  2OPQ A;  4M7X A;  4IDK A;  3KWG A;  3G71 N;  4CFB A;  1Q9Y A;  3I0S A;  4CJL A;  3G0Z A;  3RRH A;  4JRP A;  2FLO A;  1QSL A;  1KTQ A;  3IDH A;  3HPH A;  3SAF A;  3UKU A;  4CGI A;  3HYF A;  3EE9 A;  4G1Q A;  1C0T A;  4B9T A;  4Q0B A;  4DB3 A;  4CIF A;  4PKI A;  4DTM A;  1O1W A;  3KIO A;  2E1Y A;  5AQY A;  3M8R A;  1UA1 A;  4YNQ A;  1N33 K;  2HBJ A;  4C1N K;  4MO5 A;  3OJS A;  1NWK A;  3AO4 A;  1IG8 A;  4DF4 A;  3FLC O;  3PIP L;  2P9K B;  1WSH A;  1NNE A;  1UWB A;  2AA4 A;  3CC7 N;  5KGX A;  4CZJ A;  4FM0 A;  4BAC A;  4JEP A;  1VQO N;  4V19 S;  4FJ8 A;  4JI1 K;  4O8K A;  4YFU A;  1NGB A;  2YHB A;  4KTW A;  1Y64 A;  4H5T A;  1W0H A;  4JI4 K;  2W40 A;  1U4B A;  4CHO A;  4CJR A;  1C1A A;  2VWJ A;  2YJF A;  3VET A;  2XY6 A;  1NK4 A;  1Q18 A;  1D4X A;  1R59 O;  3DYA A;  3DM2 A;  3MED A;  2ETJ A;  4IZ9 A;  4B08 A;  4WQ5 A;  4CJT A;  4KHN A;  4F8R A;  4BG8 A;  1JLE A;  3D2E A;  4QOZ B;  2YNI A;  1RT4 A;  4W5Q A;  2WBN A;  3TWH A;  4CGD A;  3HVT A;  3KLF A;  4KB0 A;  4IEE A;  4FWQ A;  3U3Y A;  3E9L A;  1RFQ A;  3L8B A;  2B5J A;  2W6L A; 
#chains in the Genus database with same CATH homology
 1B9F A;  1RBV A;  3RTV A;  2Z1H A;  1JLF A;  3AVI A;  4HTU A;  2DTU A;  3OY9 A;  3NH0 A;  4CHP A;  4CEO A;  3DI6 A;  3V1Q A;  4CJK A;  1WNS A;  1SKW A;  4CEQ A;  4KHQ A;  4UQG A;  4E19 A;  4BDZ A;  4N41 A;  4ELV A;  1CXU A;  5KI6 A;  4EP5 A;  3V1R A;  3EY1 A;  4DFK A;  4Z4I A;  3TAB A;  2ITG A;  4DTN A;  2WOM A;  3V9X A;  3MXJ A;  3B6O A;  3HVR A;  1Q9X A;  5FDL A;  1U48 A;  3OYG A;  1D9F A;  1RTH A;  1EXQ A;  3AO5 A;  3F9K A;  2E6L A;  1TK0 A;  3AVK A;  5FRN A;  4LH4 A;  4NYN A;  4IFV A;  4W5N A;  3LWL A;  4M45 A;  1TAU A;  3OVN A;  1HQE A;  4M3R A;  4B9L A;  3HM9 A;  4GMJ B;  3PX6 A;  2HVH A;  1T8E A;  3ITH A;  4B3O A;  4FJJ A;  4FCY A;  3V81 A;  5KTQ A;  2Y1I A;  4E7H A;  1L3T A;  2Q3S A;  5E41 A;  1VSM A;  5HRS A;  4N47 A;  3ZT0 A;  4FK0 A;  1TL1 A;  1TKZ A;  1LV5 A;  4NCA A;  1RDA A;  3QIP A;  4FLW A;  3NF8 A;  1F21 A;  1Q8I A;  3BGR A;  3DRR A;  2VG7 A;  1J54 A;  1RT6 A;  1K6Y A;  1UAX A;  1VSF A;  3HPO A;  1CXQ A;  5CZ1 A;  3SUN A;  1BI4 A;  1JL2 A;  1QS4 A;  1YTA A;  1S6Q A;  3WNF A;  1BI4 B;  3ZSR A;  4OKE A;  4KPY A;  3KKS A;  4DLE A;  4DTX A;  3QNO A;  2KW4 A;  4NYF A;  1BQN A;  3KLE A;  4AHS A;  1ZBH A;  4LY7 A;  3JYT A;  4BE1 A;  3H08 A;  1S9G A;  4CEZ A;  4CIE A;  3SQ0 A;  5D3G A;  3HO1 A;  3VQ4 A;  2XRI A;  1SKS A;  3UIQ A;  3VQ6 A;  1NJW A;  2FBX A;  3V9W A;  1ZBL A;  2GV9 A;  3HXM A;  2HHT A;  3OYF A;  3SCX A;  1G15 A;  4M3Z A;  3NCI A;  1NOY A;  4DSL A;  1HYZ A;  4M41 A;  1BL3 A;  3WNE A;  1VSK A;  3KKR A;  4KTZ A;  3LDS A;  4FJN A;  4FZZ A;  1KCF A;  4LH5 A;  1ZBI A;  4CJ5 A;  3AVB A;  4I2P A;  5HRO A;  2X74 A;  2KTQ A;  1VSH A;  3KK2 A;  3L3V A;  1TAQ A;  3V9Z A;  3QEP A;  3QET A;  2E6M A;  4FZX C;  1Z26 A;  3LP0 A;  4M3T A;  4ZHR A;  4CJ4 A;  1JLB A;  5DK5 A;  4J2E A;  3ZT4 A;  1N5Y A;  1D9D A;  3NF6 A;  1S1T A;  1C6V A;  3LWM A;  4Q5V A;  1WSJ A;  1REV A;  4FZY A;  4BE0 A;  3QEV A;  1FKO A;  2G8H A;  3ZSZ A;  2HW3 A;  1XC9 A;  3OYC A;  4M3W A;  4W5R A;  1RDB A;  4DSI A;  3DLH A;  4CCH A;  1X9W A;  2RN2 A;  4CEC A;  1RT5 A;  2XY7 A;  4DQS A;  1X9S A;  4KAZ A;  4HUE A;  2W42 A;  2DFE A;  4CJF A;  1TK5 A;  1JLG A;  4ZTF A;  4HUF A;  2AJQ A;  2BE2 A;  3B6P A;  3AVA A;  4DU1 A;  4IKF A;  1ASU A;  3DOK A;  4KRF A;  3M8Q A;  1MU2 A;  5K14 A;  4DWI A;  2QKB A;  1EET A;  2QKK A;  3PX0 A;  2PYJ A;  1NOZ A;  4DTR A;  2IOC A;  3ZSV A;  3KK3 A;  4FJ9 A;  2NUB A;  2ZE2 A;  2XHB A;  3P5J A;  4FK2 A;  1RCH A;  3SPY A;  4LSN A;  1RTD A;  4K8Z A;  1YTU A;  1JXB A;  3ZSY A;  4B9N A;  2PYL A;  3OYJ A;  3CQ8 A;  4F3O A;  3OYD A;  4I2Q A;  2HNZ A;  1JXE A;  3D45 A;  3FFI A;  3V9U A;  3PUF A;  3TAE A;  1QTM A;  1JL1 A;  3NH2 A;  4CK3 A;  3VA0 A;  1VSD A;  2GBZ A;  4DFP A;  4KHY A;  4QCL A;  1S1X A;  3S3O A;  3RRG A;  2GUI A;  4I7F A;  4AHC A;  2IC3 A;  5T7B A;  4Y1C A;  4RG8 A;  3ZCM A;  1L3U A;  4H4O A;  4Z0U A;  4OPK A;  4DSE A;  2D0C A;  2IAJ A;  1IG9 A;  1S6P A;  3TAQ A;  4F2R A;  1CZB A;  4KHW A;  4NCB A;  3AA4 A;  1I39 A;  5HRR A;  1XWL A;  3OYI A;  3NHG A;  4HCB A;  5HRP A;  4FJX A;  1RBR A;  1A5X A;  4C8L A;  3E01 A;  1BCO A;  1JKH A;  1S1V A;  3L2U A;  2Y1J A;  4ZTJ A;  1RIL A;  2G8U A;  2DFF A;  1J9A A;  3LP3 A;  1QSS A;  3P1G A;  3PO4 A;  1VRT A;  4I9L A;  4CK2 A;  1WSF A;  2YNG A;  2JLE A;  4Z4H A;  3AVG A;  5J2M A;  3SI6 A;  3K58 A;  1S9E A;  3SQ4 A;  3RR7 A;  1CZ9 A;  4DTJ A;  4DF8 A;  1A5W A;  4AH9 A;  1IO2 A;  3SJJ A;  1TKT A;  5HBM A;  2F8T A;  5JS1 A;  3RMA A;  3O3G A;  3K5M A;  1J5O A;  2HHV A;  2G8V A;  4RW7 A;  4B8A B;  3HST B;  1Z25 A;  3DLG A;  4I9Q A;  3VQE A;  1DLO A;  2G8I A;  1CLQ A;  3CYM A;  3QIO A;  4CHQ A;  4O55 A;  2OPS A;  4MQ3 A;  1TKX A;  4CHZ A;  4FM1 A;  3KK1 A;  1KLM A;  1HNV A;  3L2Q A;  3THV A;  2Z1G A;  4C8K A;  2Z1J A;  3O4N A;  4CJE A;  3LZI A;  2HVI A;  1U04 A;  3QNN A;  4IG0 A;  4RW4 A;  3C6T A;  4LD0 A;  2EHG A;  2OZM A;  4DSJ A;  1KVB A;  4R5P A;  4AHU A;  2O4G A;  3TAG A;  1NJX A;  3QEI A;  2OZS A;  4ID5 A;  4E7K A;  4H4M A;  4B9S A;  1D5A A;  4DQR A;  3ZSO A;  3WNH A;  1WAF A;  5J2Q A;  1LWE A;  1U45 A;  2YV0 X;  3KD1 E;  3VQ8 A;  4CED A;  4CHY A;  4FJI A;  2RF2 A;  3AO2 A;  3QO9 A;  1LAW A;  4JRQ A;  4CJV A;  2HMI A;  1FXX A;  3NGI A;  3CFP A;  1SL0 A;  1L3V A;  5FRM A;  4FLU A;  1KVC A;  1C1C A;  3D0P A;  3RMC A;  3KD5 E;  2KZM A;  3ZT2 A;  2D0A A;  4FJK A;  4FM2 A;  3LAN A;  3VQ9 A;  2KFZ A;  2YKN A;  4J2D A;  3VQQ A;  1NKE A;  4KKO A;  4CJP A;  1NJZ A;  2JGU A;  4FLX A;  3KLG A;  1ASV A;  3HJF A;  3QIN A;  3AO1 A;  3TAM A;  5JS2 A;  4FXD A;  4PWD A;  3AVH A;  4IG3 A;  4KTQ A;  3ZT1 A;  3OYL A;  3C94 A;  2IGI A;  1NK6 A;  1HJR A;  2QXF A;  4CE9 A;  1EKE A;  3K59 A;  3PV8 A;  1ZBF A;  4MFB A;  1L5U A;  4RW6 A;  4N5S A;  3SV3 A;  3ISN C;  1ASW A;  1JLQ A;  1W9H A;  4QAG A;  1NK0 A;  1LAV A;  5C42 A;  3DMJ A;  4LSL A;  1SV5 A;  2FBV A;  4EP4 A;  3HP6 A;  3ASM A;  4H8K A;  2B6A A;  4CF8 A;  3DLE A;  2I5J A;  5KRT A;  2KZZ A;  3SZ2 A;  2KFN A;  3HL8 A;  1X1P A;  2HHW A;  3A2F A;  3KTQ A;  2YHA A;  4GVM A;  1B92 A;  3KJV A;  4XIU A;  3AVJ A;  4O0J A;  3CG7 A;  3S9H A;  4OGE A;  4RW9 A;  2FBT A;  5CZ2 A;  1BIS A;  1XI1 A;  3AVL A;  1SL2 A;  2G8K A;  3S3N A;  1RT1 A;  1HYV A;  4HUG A;  4B9M A;  3VQ7 A;  4DTS A;  4CGH A;  2HND A;  1L3S A;  2XO7 A;  4DTP A;  5J1E A;  3MEC A;  4OKK A;  4KRE A;  4CF9 A;  1VSI A;  4E1M A;  4HHT A;  4PQU A;  4OVL A;  4CJS A;  1TKD A;  4C8N A;  4DSK A;  3ZT3 A;  2DFH A;  1NJY A;  1RTJ A;  4O4G A;  4HVJ A;  3VQB A;  4DQP A;  2A1S A;  5CYM A;  4CEE A;  1C0U A;  4DG1 A;  3IAY A;  4Z4F A;  1LW2 A;  3P83 D;  3OYH A;  3NBP A;  2IS3 A;  1KVA A;  4Y1D A;  1XHX A;  1EP4 A;  5KGW A;  2VWK A;  2OA8 A;  4CF2 A;  1U47 A;  4E0D A;  4KFB A;  1IKW A;  1T03 A;  3CFO A;  3L3U A;  4CHN A;  1FK9 A;  5I3U A;  1WSE A;  2ATQ A;  4ID1 A;  2P5G A;  4TSX A;  4WE1 A;  4IFY A;  4W5T A;  4B9U A;  3SV4 A;  4BWM A;  4CGF A;  4DU3 A;  4CFA A;  3AA2 A;  3AV9 A;  3HPG A;  3LPU A;  3MEG A;  4CES A;  3BDP A;  1YT3 A;  3AVF A;  3C6U A;  1RT7 A;  3LAL A;  4GW6 A;  4FLY A;  4F2S A;  3TAP A;  4FW1 A;  3VQA A;  4DSF A;  3TR8 A;  4FLT A;  3EYZ A;  3SNN A;  2EX3 A;  3DLK A;  4PA1 A;  2E4L A;  4RW8 A;  4AIL C;  1JLC A;  3RMB A;  4AHV A;  1C0M A;  3LPT A;  3C95 A;  2X6S A;  4DFJ A;  2RPI A;  3QLH A;  3V1O A;  4DTU A;  1KLN A;  4J2A A;  4KV8 A;  4OGC A;  3M8P A;  1BHL A;  3SUP A;  1RBS A;  5HP1 A;  4Z4G A;  3OYK A;  3CM5 A;  1B9D A;  1IH7 A;  2IDO A;  1XHZ A;  3L2V A;  3NF9 A;  4N56 A;  4FLV A;  1VSJ A;  1VRU A;  1ITG A;  1RNH A;  3SQ1 A;  3DRS A;  4E1N A;  1BQM A;  4C8M A;  1ZBU A;  4OJR A;  4FK4 A;  4FJG A;  4KHS A;  3RWU A;  2VG5 A;  3AVC A;  3O4Q A;  3QEX A;  3V9S A;  1QSY A;  2OPP A;  3VQD A;  4CGG A;  3TI0 A;  2F8S A;  4CJ3 A;  3K2P A;  1HMV A;  4DU4 A;  4ELT A;  2ZQB A;  4JLH A;  4CFD A;  3KLH A;  4BDY A;  4DFM A;  3DRP A;  3OS1 A;  3PX4 A;  1NK7 A;  3ZSW A;  1GOA A;  1RT3 A;  4OLB A;  2HB5 A;  1HQU A;  1TGO A;  1WLJ A;  2A1R A;  2XY8 A;  3IRX A;  4CEF A;  1QQC A;  1EX4 A;  3VN5 A;  3O3F A;  4O44 A;  5C25 A;  1X9M A;  4FYD A;  5SWM A;  2BGG A;  2RKI A;  1BGX T;  3HT3 A;  3DLB A;  1VK0 A;  2R7Y A;  4FJM A;  1QHT A;  3T19 A;  2PY5 A;  4E7J A;  4DS4 A;  3LP1 A;  4CK1 A;  1SUQ A;  3VQC A;  3MAQ A;  1NKB A;  3CFR A;  3TAR A;  1IKY A;  2P1J A;  3L2R A;  1I3A A;  3DLR A;  2X6N A;  2OPR A;  3SYZ A;  4W5O A;  3SUO A;  3ALY A;  4L8R B;  5C24 A;  2G8F A;  2KQ2 A;  4HCC A;  4KB1 A;  1LWC A;  3VQP A;  2VG6 A;  4F4K A;  1UOC A;  1NK9 A;  3QER A;  5I42 A;  3I8D A;  4OLA A;  4DTO A;  3OYB A;  5CYQ A;  3MXM A;  1WN7 A;  1WSG A;  3LAM A;  3T1A A;  3ZSQ A;  5CY4 A;  3M8S A;  1R0A A;  3LAK A;  3NAE A;  5J2P A;  2ZD1 A;  1QE1 A;  4FW2 A;  3EZ5 A;  1TV6 A;  4ICL A;  4FVM A;  1NKC A;  3G10 A;  4JS4 A;  5J2N A;  4BE2 A;  3SQ2 A;  3WNG A;  5KRS A;  5FRO A;  5SZT A;  3PO5 A;  4Z4E A;  4DMN A;  1NK8 A;  2P51 A;  4OKJ A;  4KI6 A;  4FJH A;  4DQI A;  1C1B A;  1J53 A;  3TAN A;  1RBU A;  2Z1I A;  3U3G A;  4CIG A;  4EZ9 A;  1DTT A;  3PY8 A;  1WSI A;  3LZJ A;  1IKX A;  2YKM A;  1HNI A;  3I0R A;  3NH1 A;  4JS5 A;  5HLF A;  1KFS A;  2OYQ A;  2D0B A;  2FBY A;  3AA3 A;  4K8X A;  3OYE A;  1DTQ A;  3AVN A;  3T3F A;  2HHQ A;  2F96 A;  2HHS A;  1JLA A;  4FJ5 A;  1RDC A;  4DQQ A;  3SUQ A;  3QES A;  2OPQ A;  1HYS A;  4KI4 A;  1IKV A;  2B4J A;  1FKP A;  1S1U A;  4IDK A;  3DOL A;  4CFB A;  1Q9Y A;  2HNY A;  3I0S A;  3G0Z A;  1VSE A;  4NCG A;  4CJL A;  4CJU A;  4JRP A;  3RRH A;  1QSL A;  1KRP A;  1A5V A;  1KTQ A;  4CER A;  3V6D A;  2FC0 A;  4PUO A;  1RT2 A;  4DLG A;  1LW0 A;  3HPH A;  2PZS A;  3CM6 A;  5HRN A;  3S3M A;  4AHR A;  3KLI A;  3AVM A;  4CGI A;  3HYF A;  1RTI A;  3TAF A;  4C8O A;  3OYM A;  3QEW A;  4CFC A;  4CGJ A;  4G1Q A;  1C0T A;  1BIU A;  4B9T A;  4Q0B A;  4CIF A;  1BIZ A;  4DTM A;  4CJW A;  1T05 A;  1O1W A;  3KIO A;  2WON A;  1KFD A;  3NGY A;  1LWF A;  3M8R A;  3OYN A;  1SL1 A;  1WAJ A;  3K57 A;  3IS9 A;  4KO0 A;  3VA3 A;  4YNQ A;  3U6F A;  1UA1 A;  1BCM A;  4M3X A;  1HPZ A;  3OJS A;  3MXI A;  1YVU A;  4OPJ A;  3AO4 A;  2YNH A;  4CEB A;  4IBN A;  4DF4 A;  4FLZ A;  3SPZ A;  3ZSX A;  4CF0 A;  1SKR A;  1WSH A;  3L2W A;  1UWB A;  3OJU A;  3AO3 A;  4BWJ A;  5KGX A;  3K5N A;  2P5O A;  4N76 A;  3K5L A;  4M3Y A;  4BDP A;  3AA5 X;  3NF7 A;  4FM0 A;  3ULD A;  4E89 A;  4BAC A;  4M42 A;  1S5J A;  4B9V A;  4J2B A;  2XY5 A;  1GOB A;  4YFU A;  4ELU A;  4FJ8 A;  3OS0 A;  3HK2 A;  2HHU A;  4AHT A;  1VSL A;  1TL3 A;  1UA0 A;  2YHB A;  3JSM A;  4KTW A;  4DS5 A;  1W0H A;  1ZYQ A;  2D5R A;  5EU7 A;  2DY4 A;  1U4B A;  4CHO A;  3NDK A;  4CEA A;  4CJR A;  2YNF A;  3RMD A;  1U49 A;  2BDP A;  1C1A A;  3IG1 A;  5DMR A;  2VWJ A;  2XY6 A;  4E7I A;  4B8C A;  1N6Q A;  3RR8 A;  4FJ7 A;  1NK4 A;  2HHX A;  4KHU A;  3NE6 A;  2QK9 A;  1D8Y A;  1HRH A;  3OYA A;  3DYA A;  3DM2 A;  3MED A;  1GOC A;  4CJQ A;  3OS2 A;  2ETJ A;  4B08 A;  4M3U A;  2BAN A;  4CJT A;  4KHN A;  4F3T A;  4F8R A;  1JLE A;  1Y97 A;  4O5B A;  2G8W A;  3LP2 A;  4QOZ B;  4Z4C A;  4PY5 A;  3F73 A;  3V4I A;  1KSP A;  2YNI A;  4E3S A;  1RT4 A;  4FJL A;  1TVR A;  1RDD A;  3NFA A;  4W5Q A;  3O3H A;  3TWH A;  2O4I A;  1TK8 A;  1RBT A;  4CGD A;  2LSN A;  3HVT A;  2X78 A;  3KLF A;  4KB0 A;  3NGZ A;  1S1W A;  3K5O A;  3VQ5 A;  3MEE A;  1T7P A;  3U3Y A;  4CF1 A;  4E7L A;  1NK5 A;  3HP9 A;  4EZ6 A;  4O0I A;  3L8B A;  2B5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...