3NF9A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf9A00
5C25A 4QAGA 1L3SA 3KTQA 3OJSA 2IAJA 2D5RA 4LY7A 4HUEA 2GV9A 4C8LA 4CF8A 5HP1A 3B6OA 1SL2A 4CCHA 1S1UA 2HHQA 1VRTA 2RF2A 3NGIA 2LSNA 4FJXA 4B9SA 4CEAA 4KKOA 3OYAA 3AVIA 4FJLA 4I7FA 4MQ3A 2VG7A 3SYZA 4B3OA 2P51A 4ELUA 4FLZA 1Q9YA 4W5TA 3RTVA 4FK0A 4RW6A 1XC9A 3AVFA 1DTQA 1N5YA 1KLMA 5T7BA 2OPSA 1TKZA 1XWLA 3CYMA 4AHSA 3K5NA 4B9VA 5JS1A 3SUQA 1RTIA 4OGCA 1HRHA 3JSMA 4HUFA 4CF2A 4E7IA 3DLGA 3CG7A 1S5JA 3G10A 4N76A 5HBMA 4PA1A 3TAGA 1B9DA 1WLJA 2VWKA 2XY8A 1Z26A 3T19A 4CIFA 1NK0A 4DU1A 5J2NA 4KTWA 4DTUA 1TKDA 4DSKA 3WNEA 3OYGA 5CZ1A 3SPZA 1JXBA 3DOKA 3TANA 1DTTA 3KKRA 2G8UA 1G15A 3LWLA 3ITHA 2KTQA 4XIUA 3QEVA 3MXMA 3SV4A 3SJJA 2ETJA 2B5JA 1EP4A 2D0CA 2IGIA 3MEDA 4Y1DA 1X1PA 4CGFA 3EZ5A 3RR7A 2HHVA 1NJZA 3D45A 2KZMA 1VSEA 4CJVA 3OYIA 3DYAA 5KRTA 2E6MA 2E4LA 1NOYA 4M3ZA 2O4IA 1RILA 3TABA 4HTUA 3RMBA 4CEFA 1VSJA 3LP0A 4DU4A 4ELTA 1NJYA 2B6AA 4RW7A 5KGWA 4CGHA 1FKPA 2WONA 3AA5X 1T03A 5HRPA 3AO1A 4E3SA 4CHNA 2G8VA 3PX0A 1VSKA 4KHNA 2HB5A 4DF4A 3QNNA 1LV5A 3K5OA 4AHTA 4W5OA 3NH2A 3SZ2A 3OYBA 1A5WA 3AVMA 3VQ7A 3BDPA 4DWIA 2O4GA 2X74A 2YKNA 4Z4FA 1TK0A 4W5RA 4FLVA 1NK7A 2F8TA 4PY5A 3ZSYA 4DTXA 3AVBA 4GVMA 4E0DA 1IKYA 3ZSOA 4FM2A 4K8ZA 3C95A 1BI4B 3HP6A 1W0HA 4KHUA 2KFZA 3AVKA 1JXEA 4B8CA 2BE2A 2YNIA 3PV8A 4DTSA 4MFBA 4DFKA 3F9KA 4CJRA 4CIGA 4PUOA 3AV9A 1LW2A 4CK3A 2WOMA 4CIEA 1C0MA 1VSMA 1L3TA 5JS2A 1ZBLA 1HNVA 1RDDA 3RR8A 3ULDA 3DRSA 4CJ3A 1FKOA 1IKVA 4H4OA 2ATQA 5KTQA 3B6PA 4JRQA 2PY5A 3HPGA 1RT7A 1RT4A 4RW8A 4C8KA 2Y1IA 3NE6A 4RW9A 4C8MA 3AVAA 3DLKA 4CERA 4CHYA 4HVJA 3ZSQA 4FLUA 1NKBA 3SQ2A 3OYDA 1SKWA 1NOZA 4Z4EA 2NUBA 1JLBA 4J2BA 4NYFA 4AHVA 4CK2A 3L2QA 3K58A 3HM9A 4DLEA 1X9MA 4KI6A 1W9HA 4JRPA 3V81A 1S1XA 2KFNA 1RDAA 2W42A 3PO5A 4CGDA 3H08A 3O3HA 1YTAA 3M8RA 3NBPA 4DSEA 3CM5A 4AHCA 3OYCA 4CJEA 4O0JA 3QEWA 1LAVA 4ID1A 3QEIA 4I9QA 3QERA 5FRNA 3RMDA 4FZXC 4DTPA 1EXQA 1RBSA 4CJQA 3SV3A 2X6SA 4ELVA 4CJ4A 1BI4A 1ASVA 3L3UA 4OLBA 3OY9A 4M3XA 3KLFA 4HCCA 4KV8A 1EETA 1O1WA 2GUIA 2ZD1A 4NCGA 3KIOA 3KLHA 2G8WA 1KSPA 4FJMA 4DU3A 4HHTA 3SQ4A 3ZSWA 1TL1A 3ASMA 3DMJA 4C8OA 3AO3A 5HLFA 1S1WA 3O3FA 4CJ5A 1HYSA 5KGXA 4FJGA 1XI1A 1QTMA 4WE1A 3VQ6A 4E7KA 2QKKA 1MU2A 3KD5E 3WNFA 1RDBA 4W5QA 4QCLA 5I42A 2EX3A 4FJHA 3F73A 1CZ9A 2D0BA 1HQEA 1VSIA 4BWJA 1TKTA 4CFDA 3M8PA 3V1RA 4OPKA 3L2VA 2QKBA 3VQQA 3L2WA 1LAWA 1WAJA 3RMCA 4F4KA 3MECA 1RTJA 2FBYA 1IKXA 1KFSA 4DG1A 4CE9A 1S6QA 1EX4A 1D9DA 1S9EA 4BWMA 2OPRA 1UOCA 4HUGA 4KB1A 2OYQA 4CJPA 3SCXA 4CJFA 1JLQA 3HP9A 2KW4A 4FXDA 4LH4A 1NJXA 1IKWA 2PZSA 2AJQA 2D0AA 3LWMA 3SUNA 4EZ6A 1S1VA 5EU7A 1T8EA 2KZZA 2OPPA 4DLGA 4M45A 1WSHA 3MXJA 1YT3A 4E19A 3OYHA 2Q3SA 4NYNA 4PWDA 2DTUA 2RN2A 3KLIA 2BANA 3HJFA 3TI0A 5K14A 1Q8IA 3D0PA 3LP2A 3TAFA 1QS4A 4F2RA 4DSIA 4FJ9A 2HNYA 4OKJA 1U4BA 2HVHA 3HSTB 3QEXA 2HNZA 1NK5A 3OVNA 1JLEA 4DQSA 1ZYQA 5HROA 1C6VA 3RWUA 1FK9A 3BGRA 4Q5VA 1I39A 3TARA 2OPQA 4AHUA 1WN7A 3EY1A 1HYVA 3C94A 4FLYA 3QINA 3V6DA 3NF7A 3VQDA 1UA0A 3VQAA 3OYMA 4Z4CA 4LD0A 3U3GA 3KK3A 2I5JA 1D5AA 4Z4GA 3P1GA 4BDZA 3TWHA 4B9TA 1IG9A 2P1JA 3L2RA 3UIQA 1SL1A 2BGGA 1JLCA 3MEGA 2HMIA 4KHYA 3HVTA 3DLHA 3HVRA 3HPOA 3VQCA 1BCMA 3TAQA 3S3NA 1C0TA 4FM0A 3HL8A 4EP4A 1RTHA 3V9XA 4Z0UA 3PX4A 4Y1CA 1L3VA 1RBRA 1JLFA 3LP3A 1TL3A 3NH0A 4FJ7A 4DQIA 4FJJA 4Z4IA 3KLEA 4IG0A 1RDCA 1S6PA 4H4MA 2F8SA 3P83D 4IBNA 4CHZA 3AA4A 2E6LA 4FM1A 1L5UA 2RKIA 4AH9A 5J2MA 3K5LA 3AVNA 1HNIA 3CFPA 1KVBA 1F21A 3ZSVA 3VA3A 1WAFA 1YVUA 4B9UA 1YTUA 1RT5A 5C42A 3OYFA 4O5BA 4KPYA 2HVIA 4DSJA 2G8IA 1BCOA 1DLOA 4FW1A 4BE2A 2QK9A 3ZSRA 2F96A 2HHWA 3AVCA 4BACA 1R0AA 4ZTFA 3CFRA 4OKEA 4M42A 5CZ2A 2YKMA 3AA3A 4F3OA 3EYZA 3MXIA 1BGXT 4DQPA 1KLNA 5J2PA 4CF0A 1RT2A 1KVAA 2HHTA 3NF8A 3T1AA 4CHPA 3QEPA 2BDPA 3OYKA 1KFDA 3LZJA 4DQQA 2OZSA 2ZE2A 2HHXA 3KK1A 4J2DA 1HQUA 4CEOA 4FZZA 2X78A 4BDPA 4QOZB 1TAUA 1TKXA 3DOLA 4B9NA 1HPZA 3DM2A 2HHSA 4FVMA 1KRPA 1L3UA 1RT6A 4FJ8A 1J53A 4O4GA 1RBVA 4CEBA 4ZHRA 3TAPA 5J1EA 1A5XA 2Z1IA 2XY6A 4N56A 4DMNA 3OYNA 3V9SA 2IOCA 4JS4A 1NKCA 3IS9A 4O44A 4J2EA 4CEZA 1VSDA 1ASWA 3OJUA 3ALYA 4CGJA 3SUPA 1WSFA 1NJWA 1B9FA 1X9WA 1LWFA 3OYLA 2JGUA 4AILC 1HJRA 4OKKA 1UAXA 4E89A 4CF1A 2OZMA 4NCAA 4CECA 4CJWA 4CF9A 3AO5A 3VQ8A 4E1NA 5HRSA 1HMVA 3ZT3A 4OJRA 4M3RA 4JS5A 3LAKA 3V9ZA 4FJNA 4FJKA 2FBTA 3AVJA 4DS4A 5FROA 3NAEA 4IKFA 3C6UA 4BE1A 2XRIA 1NK4A 3A2FA 3I0RA 1JL1A 1S1TA 3K57A 3FFIA 4FK2A 4W5NA 4IG3A 1VK0A 4OVLA 1T05A 2P5OA 3VQEA 1GOBA 3M8QA 1C1CA 3KD1E 1ITGA 3V9UA 4FLWA 3VN5A 5E41A 3ZT2A 1J5OA 2PYLA 4M3UA 3NGZA 1BQNA 4CEQA 1TGOA 1ZBUA 3AVLA 1NK9A 4J2AA 1BIZA 5SZTA 3QESA 4CEDA 3KJVA 2EHGA 4I2PA 2JLEA 2VG5A 3DLBA 3U6FA 1D8YA 4GMJB 3NF9A 5SWMA 3HXMA 1U45A 1NK6A 1VSFA 3QIOA 4CJKA 4IDKA 4KFBA 2YNGA 1JLGA 4IFYA 2P5GA 4OLAA 3K5MA 4M3WA 4N41A 1TK8A 1CXQA 5CYQA 4B9MA 3AO4A 4I9LA 3ZCMA 4OPJA 1ZBHA 1RBTA 1KCFA 3ZT4A 3S3MA 4JLHA 3ZSZA 4KB0A 3LALA 5C24A 3SUOA 3VQ5A 1T7PA 2FC0A 3CM6A 2A1RA 4KTQA 4CESA 3P5JA 4DFMA 2A1SA 4KRFA 2G8KA 1HYZA 3QO9A 3V9WA 1IO2A 3S9HA 3CQ8A 1LWCA 3MAQA 4H8KA 3DLRA 3TAMA 4PQUA 4DSLA 1Z25A 2FBVA 4CFAA 2R7YA 4DQRA 4BDYA 1SUQA 4CFBA 1Q9XA 3VQ4A 4CFCA 4LSNA 3JYTA 4CEEA 1U49A 2IS3A 4KHSA 3V1QA 1KVCA 3HPHA 3HYFA 5J2QA 1RBUA 1RTDA 4EP5A 4FW2A 3LZIA 4G1QA 4ZTJA 4CHQA 4DFPA 1C1AA 4RG8A 4CGGA 4N5SA 4DTMA 4KHWA 1BL3A 1QQCA 1QSSA 3AA2A 5DMRA 3E01A 4E1MA 3OS0A 4CJUA 1QSLA 4DFJA 5D3GA 3RMAA 5CY4A 4CK1A 4OGEA 1JLAA 1Y97A 3AVHA 4B9LA 4FZYA 4ICLA 3U3YA 4L8RB 1B92A 1XHXA 4CJLA 3C6TA 4YFUA 1U48A 4KAZA 2VG6A 1QHTA 4AHRA 4O0IA 3ZT0A 1J9AA 1N6QA 1JKHA 4E7LA 3RRHA 5FRMA 1REVA 3VQ9A 2OA8A 1C0UA 1UWBA 2X6NA 2KQ2A 2HHUA 1QE1A 1GOCA 1D9FA 1I3AA 3PUFA 3KK2A 2YNFA 4BE0A 1TAQA 3IRXA 4DTJA 4FJ5A 4HCBA 3IAYA 3OYJA 3G0ZA 2GBZA 4TSXA 3NH1A 3PO4A 2B4JA 2YHAA 3I8DA 2IDOA 4DTNA 1XHZA 2DFHA 1RCHA 3PY8A 3IG1A 5FDLA 3LDSA 2RPIA 1FXXA 2IC3A 4RW4A 1NK8A 1SL0A 3M8SA 4KO0A 4CJTA 3THVA 1UA1A 4B8AB 4E7HA 1A5VA 3SPYA 3V1OA 3WNGA 2G8FA 2Z1HA 3VQBA 4DSFA 1BQMA 3AO2A 2XY5A 3S3OA 3HK2A 3LP1A 4FCYA 2PYJA 1CLQA 1BISA 1LW0A 3NHGA 4KTZA 1TK5A 5KRSA 1TV6A 3TR8A 3NGYA 1WSIA 1WSGA 5HRRA 2DY4A 2QXFA 3VQPA 2ITGA 3AVGA 1RNHA 1RT3A 2YHBA 4KHQA 3DLEA 3I0SA 3L8BA 3LPTA 3OS2A 1ZBFA 2DFFA 3NFAA 1CXUA 3SQ0A 1SKRA 4O55A 4ID5A 1TVRA 2XO7A 1X9SA 4M3TA 1RT1A 3L2UA 5I3UA 1WSEA 4DS5A 4B08A 2Z1GA 4E7JA 3DRPA 3K2PA 4FYDA 1VSLA 3LAMA 2Z1JA 3CFOA 4KI4A 4K8XA 4FJIA 3HT3A 1JL2A 3VA0A 3QLHA 1ASUA 3MEEA 4I2QA 3ZT1A 1VSHA 3QETA 1SKSA 4CJSA 2G8HA 3SI6A 1EKEA 3OYEA 3L3VA 3ISNC 4Z4HA 1J54A 3NF6A 3RRGA 2XY7A 4DTRA 4EZ9A 1S9GA 2YNHA 5DK5A 1C1BA 3T3FA 2XHBA 1SV5A 2DFEA 3WNHA 4GW6A 4FLTA 3QNOA 4CGIA 4N47A 4DF8A 1NKEA 4Q0BA 1WSJA 4YNQA 4LSLA 2FBXA 3O4QA 4UQGA 3NDKA 3NCIA 1U47A 2YV0X 3O3GA 1IH7A 4NCBA 4C8NA 1GOAA 2ZQBA 1KTQA 5HRNA 5CYMA 3OS1A 1QSYA 1ZBIA 3HO1A 3LANA 2HNDA 3SNNA 4R5PA 3DRRA 3LPUA 1BIUA 1CZBA 1BHLA 4KREA 1K6YA 3DI6A 4FLXA 3TAEA 3KLGA 3O4NA 3SQ1A 3ZSXA 4FK4A 4DTOA 3QIPA 4F3TA 1VRUA 3PX6A 4F2SA 4M41A 2HW3A 4F8RA 2VWJA 3KKSA 1WNSA 4LH5A 1LWEA 4M3YA 3V4IA 1U04A 4CHOA 3K59A 2Y1JA 4IFVA 5KI6A
chains in the Genus database with same CATH superfamily
1L3SA 4QAGA 3VPZA 3MMVA 4A57A 4BGAA 3OJSA 3JXUA 2V7YA 2GV9A 1VRTA 3VETA 4E1JA 4CEAA 3M1FA 4B9SA 2VG7A 1OH5A 4ELUA 3VGMA 1RDWX 4W5TA 4RW6A 1KLMA 5T7BA 2OPSA 4JYAK 1TKZA 2QI2A 3CYMA 4HUFA 1HRHA 4GV9A 4CF2A 3A5NC 3CG7A 3HRGA 1S5JA 5HBMA 1B9DA 2XY8A 4IO8A 4DU1A 2FSKA 5J2NA 1HR0K 4IJNA 1ATRA 4F9OA 3OYGA 5CZ1A 4A2AA 4GNIA 3TANA 1DTTA 3KKRA 3HOTA 4U7BA 4XIUA 3THWA 3QEVA 2ETJA 4QS7A 2D0CA 3KK7A 3D45A 3OYIA 3DYAA 5KRTA 4EIAA 4M3ZA 2O4IA 4BRIA 3DLLL 3TABA 1VSJA 4DU4A 2A5XA 3U8XA 4DUZK 2Q1NA 2B6AA 2CGKA 3A5MC 1YI2N 3AA5X 2YHYA 4CI6A 3ZLJA 2HB5A 5ADXH 3NH2A 2A42A 4LFBK 3BDPA 1X3MA 4DWIA 4W5RA 4FLVA 1NK7A 4DTXA 1BA0A 1IKYA 3AVKA 4B8CA 4PKGA 1QVFM 4IOCL 2ZGYA 5JS2A 1XMQK 1RDDA 3I8BA 3ULDA 3CPEA 4IZ9A 3DRSA 4CJ3A 3FGUA 1FKOA 1IKVA 5KTQA 4JRQA 1RT7A 2IIRA 4RW8A 3ZX3A 3C7NA 3CERA 4DV2K 2F9TA 4HVJA 4CZMA 3OYDA 2AA4A 2NUBA 2GX9A 4CK2A 3K58A 4K43A 4JRPA 2W40A 1S1XA 3VEZA 3PSIA 3H08A 4I9QA 2O8DA 2EWSA 4DTPA 3CQYA 3DWLA 4KV8A 1EETA 3KIOA 4FJMA 1Q81O 4C8OA 5BN9A 5HLFA 1YHQN 4CJ5A 4FJGA 3CCUN 2QWQA 2QKKA 3KD5E 5I42A 2W6KA 4FJHA 5GAEP 3IDHA 3M8PA 4OPKA 3VQQA 3RMCA 2FBYA 2E88A 4ISFA 1QQMA 1QHAA 1S6QA 2O8EB 2OPRA 1UOCA 2HOEA 3CJ1A 4FXDA 4FWKA 2KZZA 4HTLA 4R79A 4YDUC 4DLGA 1YT3A 2JWKA 3WUHA 4NYNA 3ULEB 2RN2A 2BANA 3TI0A 5K14A 1Q8IA 3D0PA 3TAFA 2V7ZA 2HVHA 1NMNA 3MCPA 3QEXA 3OVNA 5AJ3K 2E1ZA 1C6VA 5LY3A 3RWUA 1S3XA 1I39A 5JVHL 1T3VA 4A59A 1HYVA 2P9LA 3V6DA 4PKHA 4BR5A 1D5AA 3P1GA 1QVGM 1IG9A 3L2RA 1WB9A 1JLCA 3MEGA 2E2PA 3VF4A 3HPOA 1VQ6N 3PLAA 2FF3B 2ASPA 1VQPN 3HL8A 2A40A 4KH5A 4AQYK 4B1VA 3V9XA 1VQ5N 4Z0UA 3S41A 3HZ6A 1L3VA 1S22A 3A5LC 3K9KA 3O5BA 3NH0A 2VCPA 1RDCA 1S6PA 3UKRB 3CHWA 3ATVA 1IBMK 1KVBA 4OX9K 3GL1A 3TSQA 4BACA 3VGKA 1WOQA 3O08A 1XQSC 2YKMA 4BRAA 4F3OA 2HF3A 4DQPA 2QWNA 1KLNA 4CF0A 3G6EN 2HHTA 1BA1A 1KVAA 1ZBSA 4CHPA 3OYKA 5BRFA 5M1PA 2ASOA 3KK1A 5E84A 2VQFK 1HQUA 4CEOA 2V51B 4CZJA 4BDPA 1TKXA 3DM2A 3TTDA 1KRPA 3SMPA 4DKWA 4CEBA 1GLLO 2ZJRL 4KH6A 4N56A 4BQZA 2NRZA 1NGJA 3H6EA 4O44A 4BY9C 4CBWA 4FOEA 1VSDA 4JHDB 4BR2A 3RSEA 2FSNA 1X9WA 4IXCA 4OKKA 1UAXA 4H5VA 1M1KO 4FPAA 4CF9A 3AARA 3VQ8A 1GLAG 1HMVA 5BRHA 1W2BM 2FBTA 2QWLA 1YF5L 3A2FA 3K57A 3H1QA 4OVLA 4NLBA 1HUXA 3KD1E 3VN5A 2ZWHA 5AQGA 1J5OA 1BQNA 1BIZA 2EHGA 3E9PA 1Q18A 2JLEA 4FWSA 5H1SQ 1U45A 4ILJA 4AM7A 2ASMA 3GDQA 4WFBL 4KFBA 2Q31A 4M3WA 2RHKA 3AAQA 4B9MA 5CYQA 4I9LA 4JLHA 4DQ8A 3VQ5A 2FC0A 4CESA 2P9IB 2G8KA 3QO9A 1IO2A 1WBBA 1Y64A 3DLRA 4PQUA 3VERA 3U9ZA 5AQUA 2UU9K 1SUQA 3M5RA 2CH5A 4BR9A 4CFCA 1GLDG 1U49A 2IS3A 4KHSA 5AR0A 3HPHA 3HYFA 5M1FA 1RBUA 3WEEA 3QFUA 4YOYA 3LZIA 1C1AA 1IG8A 4CGGA 1QQCA 4JD2B 2YHXA 3AA2A 3E01A 3THXB 4H5WA 5LMNK 1K8AO 4IJAA 3RMAA 4OGEA 4B9LA 3AVHA 4L8RB 1E3MA 1BOTO 1XHXA 4YFUA 1U48A 1NMDA 5EY4A 1QHTA 4AHRA 4UY8O 2FXUA 3O1WA 1J9AA 4DHYA 1REVA 4M63C 4K25A 1NNEA 5A2QO 3MX2A 3WXJA 1TAQA 4FJ5A 3G0ZA 3J80O 4IO9L 4K42A 4TSXA 1WBDA 2YHAA 2IDOA 5BREA 1XHZA 1X3NA 3PY8A 3GE1A 2RPIA 1UA1A 2P9KA 1A5VA 1MWKA 3V1OA 4L3QA 2Z1HA 3HK2A 3LP1A 4FCYA 1BISA 3U4LA 3QICA 1WSGA 2ITGA 4RTFD 1V4TA 3DLEA 3OS2A 2DFFA 3NFAA 4CZIA 3QMLA 4CZLA 1TVRA 4M3TA 1T44A 4DS5A 4B08A 4E7JA 1BO5O 3K2PA 4FYDA 3A8YA 4J8FA 3LAMA 1JL2A 1HKBA 3G4SN 1QQNA 3QETA 4H0PA 3OYEA 3ISNC 5AQKA 4EZ9A 1S9GA 1C1BA 2PBDA 1SV5A 4GW6A 3QNOA 4Q0BA 5BR8K 1WSJA 2FBXA 4OPAA 1BWFO 4FVUA 4BR4A 4NCBA 4JK8A 1VQ4N 1ZBIA 2VGMA 3LANA 1HLUA 1SS6A 1BHLA 4FLXA 3TAEA 3KLGA 4FK4A 1VRUA 3PX6A 4NXMK 4F8RA 3MN6A 1LWEA 2Y1JA 3NMUA 4IFVA 5C25A 4HUEA 4JKGA 4CF8A 3FZMA 3ZX0A 1S1UA 2LSNA 3ZEUB 3OYAA 1ZXOA 3AVIA 1Q9YA 1YIJN 4FK0A 3RTVA 1N5YA 1FW6A 3VENA 4B9VA 1XWLA 4FSVA 1RTIA 4E7IA 3DLGA 4N76A 3SBTA 4PA1A 3WXKA 4BRNA 5CHIA 4MDBA 5BRDA 4DTUA 1TKDA 1GLEG 4DSKA 4H0YB 2NRXA 5CR4A 3DOKA 3IMXA 4BVPA 2GWJA 5EXWA 2G8UA 1G15A 4JK9A 3SV4A 2B5JA 1EP4A 2IGIA 3MEDA 3EE9A 4CGFA 3MX5A 4DR1K 2HHVA 4WFNL 2KZMA 4CJVA 4JI2K 1N32K 2E6MA 1NOYA 4FWOA 3ZEUA 4EHTA 5IWAK 1NJYA 3G25A 5KGWA 1YJ9N 2WONA 4CHNA 1VSKA 3PSFA 3QNNA 3K5OA 3SZ2A 3VQ7A 4B1XB 2O4GA 1TK0A 4PY5A 1WUAA 2QWRA 2YCHA 4QS9A 3ZSYA 4C1NI 1JCEA 3C95A 1BI4B 2KFZA 2BE2A 4RCHA 2VQEK 4DFKA 5C2FA 4CIGA 3AV9A 1LW2A 1L3TA 4ISEA 3RR8A 5GIPA 3CJBA 4H4OA 2ATQA 3B6PA 2PY5A 4GKJK 1RT4A 2WC9A 4C8KA 1BU6O 3AVAA 4CHYA 4YOXA 1SKWA 1NOZA 1JLBA 4NYFA 4BG8A 1X9MA 4KI6A 3HM9A 4I6MB 3LDPA 3P39A 4JV5K 2W42A 3PO5A 3O3HA 1YTAA 5FPMA 3NBPA 1U2VB 2GWKA 3OYCA 3QEWA 3MWTA 3RMDA 1EXQA 4CJQA 2QM1A 3UKUB 4CJ4A 3ATUA 1BI4A 3T7ZA 3OY9A 3TU5A 3KLFA 2D0PA 3KLHA 2YI1A 3J7YP 4DV7K 4DU3A 4HHTA 3ASMA 2HBKA 3AO3A 3J81O 1P8ZA 1S1WA 5KGXA 4BQLA 5BPNA 3THWB 3H3OB 3F73A 2D0BA 1HQEA 1VSIA 4BWJA 1TKTA 4CFDA 3L2WA 2QW9A 4F4KA 3MECA 4I6MA 1KFSA 1D9DA 1S9EA 1TYQA 4BWMA 4Y0WA 3LM2A 1BG3A 1U2VA 4CJFA 3SMSA 2KW4A 4LH4A 1NJXA 1OH8A 3SUNA 4EZ6A 5EU7A 3WQTA 2OPPA 3UKUA 3FLCO 4M45A 2Q3SA 4JKDA 3EZWA 4FWRA 3P4IA 3AY9A 5KPTA 3AGKA 4PHTX 1O13A 3KZBA 2H3GX 2HNZA 2GELA 1FK9A 4Q5VA 3TARA 5KQDA 4LF8K 4AHUA 3C6HA 1OH7A 4FLYA 1UA0A 4Z4CA 3U3GA 3KK3A 1R59O 1VQLN 3K9JA 3TWHA 3C7NB 2P1JA 4AM6A 1SL1A 2QWOA 4KHYA 4EHUA 1Q82O 3P31A 3CCJN 1GLBG 4Y1CA 5C2DA 3LP3A 4FJ7A 4IG0A 4BRDA 2O8DB 4IBNA 2E6LA 3EL2A 1HNIA 3CFPA 1F21A 1K73O 1YVUA 5C42A 1DLOA 4FW1A 2Q2RA 5KPZA 4BC3A 2F96A 1GLFO 3AVCA 2HHWA 4ZTFA 5C10A 4H0VB 4OKEA 1HJOA 5AQPA 2BUPA 2HMPA 3PIPL 2E8AA 3T1AA 3QEPA 4DQQA 3LZJA 3G71N 3E9OA 2OZSA 2HHXA 1N8RO 5AQFA 4Z94A 4FZZA 3H46O 2Q97A 1YJNN 4B9NA 2HHSA 4FVMA 1K9MO 4FJ8A 1RT6A 1RBVA 2ZF5O 1EO1A 3VTHA 1NGAA 2Z1IA 4DMNA 1JCGA 3OYNA 3DXKB 4DR7K 1S72N 3CD6N 3V9SA 1NKCA 4MLHA 4PL8A 3VOVA 4WQ5A 1WSFA 2JGUA 2GUPA 3EN9A 3O1BA 4E89A 4IEIA 2OZMA 4C1NK 1Z6RA 4CECA 4NCAA 4JKHA 3CIPA 3ZT3A 1NM1A 4OJRA 3IKMA 4M3RA 4B9QA 4YY3K 4JS5A 4FJNA 1VAZA 4DS4A 5FROA 3VEYA 3MDQA 5LJVA 2QXLA 4B1YB 5AFUH 4BE1A 2UUCK 5AQZA 5KQ8A 2W6LA 1JL1A 1S1TA 4W5NA 3FFIA 4FK2A 2P9LB 3OTOK 1T05A 2P5OA 5AQJA 3V9UA 4G9ZA 5E41A 3CCEN 4M3UA 1ZBUA 4J2AA 2PAVA 5AZJB 5SZTA 1NG9A 4JI3K 4CEDA 2VG5A 4CZGA 3DXKA 4FWLA 4LFAK 4GMJB 5SWMA 4CJKA 5LJWA 1JLGA 1C0FA 4OLAA 3GG4A 1CXQA 3OBYA 4OPJA 1VQON 1RBTA 1KCFA 3ZT4A 4DCHA 4KB0A 1NGCA 5C24A 4GV6A 1SAZA 2A1SA 1HYZA 4JI6K 4O5FA 2UXDK 3CCVN 3MAQA 1Q9XA 2FBVA 4FZYA 4DQRA 3CMEN 3VQ4A 5ADXA 4CEEA 5DM6L 1CZAN 5J2QA 4JNEA 4BRMA 4RG8A 4KHWA 5AZJA 2F9WA 4DTMA 1BL3A 5AQVA 5DMRA 2VYPA 1M90O 5D3GA 3SK3A 1JLAA 5M1QA 3U3YA 5AQLA 2D1KA 4NO7A 3KVGA 3ZT0A 3FZKA 5FRMA 3CJ7A 4WYBA 1C0UA 1UWBA 2X6NA 2KQ2A 1GOCA 4BE0A 4DTJA 3IAYA 3NH1A 3RSEB 4DR3K 4DTNA 2DFHA 1RCHA 3IG1A 2IC3A 3VESA 4KO0A 3M8SA 3THVA 1K8KA 1NGGA 4B8AB 3SPYA 4YOVA 3WNGA 2CH6A 2XY5A 3S3OA 1CLQA 1LW0A 4KTZA 5KRSA 4AF1A 3FZHA 3NGYA 5HRRA 4JI5K 4M7XA 2VWBA 4CD3A 2OCEA 3I0SA 5EX5A 3L8BA 3LPTA 1ZBFA 1CXUA 2E20A 1NGFA 3SQ0A 5ELZA 4O55A 1KAXA 5AQIA 1VQ9N 2XO7A 1X9SA 1RT1A 3L2UA 1WSEA 3CCQN 1YXQA 1IJJA 2IVOA 1VSLA 5AZIB 2Z1JA 3CFOA 4FJIA 4H0TB 3QLHA 1ASUA 1NBWA 1VSHA 1SKSA 3CC4N 4DV6K 3WQUA 4O8UA 1ILYA 3EKSA 1LOTB 4EFHA 5TKWA 4IOAL 5DK5A 3T3FA 3ID6A 4CGIA 4N47A 3NCIA 4A2BA 3NDKA 1U47A 3FZFA 4GKKK 3UE5A 2YJFA 3O3GA 3WEEB 1IH7A 1DEJA 4JKAA 4C8NA 5HRNA 2ZQBA 3KWIA 4QS8A 2JWLA 4CZHA 4WQ5C 3JAMO 2WBNA 4R5PA 1CZBA 1T6CA 1K6YA 3O4NA 3QIPA 4JKCA 1OKJA 3KKSA 4JAXA 4LH5A 3V4IA 5AZIA 5KI6A 4FL9A 3VEXA 4B1WB 1IBLK 3KTQA 4K41A 4PKIA 4C8LA 1SL2A 3B6OA 2O8FA 2RF2A 5JLFA 3NGIA 4FJXA 4B3MK 4MQ3A 3SYZA 2P51A 4FLZA 1NJIO 1DTQA 2P9KB 3M6GA 4AHSA 3K5NA 4IFEA 1NGDA 5JS1A 3BEXA 3G10A 1WLJA 4O8KA 3T19A 1NK0A 4WCEL 3WNEA 1P90A 5AQWA 3CI5A 3LWLA 3ITHA 4BRFA 3MXMA 1MA9B 3BF1A 3MN5A 4Y1DA 2NRVA 3EZ5A 3RR7A 2NRWA 1NJZA 1VSEA 4BRQA 5BN8A 4DV3K 1RILA 4HTUA 3LP0A 5C15A 2NNWA 1XUPO 4RW7A 1T6DA 4CGHA 4EAHD 5HRPA 3CF5L 4E3SA 4KHNA 4BG9A 3CC7N 3LDOA 4AHTA 4W5OA 1OH6A 3OYBA 1A5WA 3AVMA 4BROA 3SAFA 2YKNA 3LDLA 2F8TA 3AVBA 4GVMA 2HF4A 3BZKA 1W7AA 2E2QA 2YNIA 3ZETA 4DTSA 4MFBA 1QZ6A 2HBLA 4CJRA 4CK3A 2WOMA 2P9PA 4CIEA 2WUSA 1VSMA 1ZBLA 1HNVA 3H1VX 3U9DA 2O8BA 3AGRA 3VEWA 3DXMA 2P9UA 2Y1IA 2E2NA 3R3LA 4C8MA 3NE6A 4CERA 3DLKA 1NKBA 5JVGL 3R9PA 1EWQA 4J2BA 4JKGB 4DR2K 3L2QA 3HTVA 2NLXA 1W9HA 1MDUB 4A62A 4CGDA 4JI4K 4LF9K 3CM5A 4AHCA 1LAVA 4ID1A 3QEIA 5FRNA 4XH5A 1J6ZA 4BRKA 2GTDA 3SV3A 4ELVA 2WFBA 4OLBA 2WTUA 1BUPA 4MLEA 2UUAK 4HCCA 3L6QA 3T1YK 1KSPA 2RE2A 2Q0RA 4MO4A 1JCFA 4YORA 3A5OC 2E2OA 2ZGZA 3O3FA 1HYSA 1XI1A 1QTMA 4QCLA 4E7KA 1MU2A 1RDBA 3D2EA 4W5QA 2EX3A 2IVNA 2QKBA 3V1RA 1WAJA 3A0IX 1RTJA 1I94K 1EX4A 1NGBA 2VGNA 4HUGA 4KB1A 4CJPA 3SCXA 5AQHA 1IKWA 2AJQA 1T8EA 1WSHA 3OYHA 4PWDA 2DTUA 4JI8K 3HJFA 3TSPA 3LP2A 1QS4A 4F2RA 1N36K 4OKJA 1U4BA 5F0XA 2D0OA 4DR4K 3DJCA 3CXCM 5HROA 5LMUK 4JI0K 3BGRA 4XH1A 2OPQA 3ZX2A 1WN7A 3CCMN 3EO3A 3NVKA 2OTJN 3QINA 3NF7A 4Z4GA 4BDZA 3OA9A 4B9TA 2NRTA 2HMIA 1DGKN 3CCSN 1BCMA 3TAQA 3S3NA 1C0TA 3N4PA 3KWGA 4EP4A 1NLVA 4WQ4A 4GV3A 4Z4IA 4DQIA 1KQSM 4H4MA 2F8SA 3AA4A 4FM1A 2RKIA 4AH9A 3K5LA 1KC8O 4JK7A 3ZSVA 4X65K 1WAFA 3VA3A 1RT5A 4O5BA 3W3DA 4BE2A 4BC2A 1NWKA 3ZSRA 4JN4A 3CFRA 4M42A 3BP8A 3AA3A 5CZ2A 3EYZA 4LF7K 3D2FA 1RDUA 2I7NA 1RT2A 1KFDA 2NZTA 2ZE2A 1XNQK 4J2DA 4BRPA 4DR5K 2HBMA 1TAUA 4A5AA 2P9NA 1YVNA 1GLJO 2PFUA 2HSTA 2QEXN 4CW7B 1J53A 4O4GA 1TYQB 2XY6A 4CJ7A 2IOCA 2P9SB 4J2EA 3O9UA 3BF3A 1ASWA 3OJUA 4CGJA 3SUPA 1NGEA 1LCUA 1B9FA 3BY5A 1LWFA 4CF1A 3HBTA 4BR0A 3L4IA 4CJWA 5HRSA 3V9ZA 4FJKA 3AVJA 3LDNA 1Z05A 4LC9B 2XRIA 1YAGA 1NK4A 3MN9A 3I0RA 1RFQA 3VQEA 3M8QA 1C1CA 3VTIA 1ITGA 2NRRA 4FLWA 2PYLA 1E4FT 1TGOA 3THYA 3QESA 2UUBK 1KXPA 3VGLA 3DLBA 3SJHA 3U6FA 3H45C 3SAHA 3HXMA 1NK6A 2E5LK 2P9SA 3QIOA 4DV4K 2P5GA 4BC5A 1C0GA 3K5MA 3CJAA 4XH4A 1TK8A 4CZEA 3S3MA 1QZ5A 5B8HA 3LALA 1T7PA 5KPRA 4DFMA 3CPWM 3WXMB 5AQYA 3V9WA 1LWCA 3EEQA 5C12A 1YUWA 1Z25A 2R7YA 2OTLN 4CFBA 5F1XA 3JYTA 5AQOA 3D6RA 3V1QA 5DM7L 3UB5A 1RTDA 4EP5A 4ZTJA 4G1QA 4CHQA 4N5SA 3NVMA 4JKBA 5JMVA 3C6AA 3OS0A 4CJUA 4BRGA 5EVZA 4BGBA 4ICLA 1VQKN 4KAZA 5MLCQ 4MDAA 2VG6A 5HOOA 4O0IA 1N6QA 4E7LA 3VQ9A 2OA8A 3PUFA 3J8AA 3IFRA 3KK2A 3IRXA 1EQYA 3OYJA 1SZ2A 5IT9O 3I8DA 2A41A 5FDLA 4RW4A 1NK8A 4CJTA 4KH4A 2J4RA 4E7HA 2IVPA 3IUCA 5E26A 1BQMA 3AO2A 2PYJA 1TK5A 3WXIA 4LF4K 3I56N 1WSIA 4WQ4C 2DY4A 2QXFA 3AVGA 3EKUA 2I7PA 2YHBA 2FLOA 4YHHK 4CD1A 1SKRA 4BRCA 2F4VK 1W97L 3OBWA 3PIOL 4A61A 1EWRA 4K8XA 3HT3A 1E4GT 3VA0A 1Q7YO 5TKYA 5FPEA 1VQNN 3RVCA 2G8HA 2W41A 3SI6A 1EKEA 3DAWA 3L3VA 4Z4HA 5AQNA 1J54A 4JEPA 4IOXA 3VF6A 3RRGA 3CCLN 4BRLA 5GINA 1DT9A 4H5NA 5FPDA 2XHBA 4K0KK 3HM8A 4FLTA 4LSLA 3O4QA 4UQGA 2BTFA 2YV0X 1H1VA 1QSYA 5CYMA 2OANA 4JKFA 2HNDA 3DRRA 5F2RA 1BIUA 4KREA 3B8AX 3SQ1A 1IV0A 3LM9A 1HX1A 4M41A 2UXBK 2VWJA 1U04A 4NB4A 4JI1K 1X9JA 4DV1K 2IAJA 2D5RA 4LY7A 4M7YA 1GLCG 5HP1A 4CCHA 2HHQA 5M1NA 4FJLA 4KKOA 4I7FA 4B3OA 3L0QA 4OO1J 1XC9A 3AVFA 4B3RK 1K8KB 2FF6A 1KD1O 4H0OA 3SUQA 5FLXO 4OGCA 3QBWA 2AP1A 2Q36A 3JSMA 3SAGA 3CJCA 4CBXA 3TPQA 3TAGA 2VWKA 3ENOA 3C65A 3MCAB 1Z26A 3FR0A 4CIFA 4KTWA 2A6AA 5FPNA 3SPZA 1JXBA 4U67L 1RGIA 2KTQA 4H5RA 3O4WA 3SJJA 3FFKB 1X1PA 1ZC6A 2E4LA 2D4WA 4YOTA 3RMBA 4CEFA 3CJ9A 4IEEA 5HL7L 4ELTA 3O6WA 2QA4N 2O8EA 1FKPA 1OVYA 5C0YA 3O9QA 1T03A 3AO1A 5BPMA 2G8VA 3PX0A 4WFAL 3VF2A 4DF4A 1LV5A 4FWNA 3R6MA 3K0SA 1N33K 3ULEA 2X74A 1TUUA 4Z4FA 1J5EK 1XMOK 2F7TA 4E0DA 3ZSOA 4K8ZA 4FM2A 4BC4A 4KHUA 3HP6A 1W0HA 1JXEA 3PV8A 4FWPA 3F9KA 3CQXA 4PUOA 1C0MA 2UXCK 3O9RA 3HSCA 2CGJA 3Q7BA 5AFUA 2E1YA 3HPGA 4KHPK 3GBTA 3TTCA 3MK6A 2ITMA 1V4SA 4CZKA 4RW9A 4FLUA 3ZSQA 3SQ2A 1OVQA 4Z4EA 3MN7A 4AHVA 1BDGA 3BUZB 4DLEA 2O8FB 2O8CB 3V81A 4DV0K 1RDAA 4DR6K 2KFNA 1HPMA 3ID8A 3M8RA 4DSEA 4CJEA 4O0JA 3TSUA 3UKRA 3QERA 3QDKA 4GVEA 4FZXC 1RBSA 3KHYA 4YOWA 4CVNE 2X6SA 4DB3A 2CGLA 2ZM6K 1VQ7N 3L3UA 1ASVA 4M3XA 1O1WA 4NCGA 2GUIA 2ZD1A 4GY2B 2G8WA 3SQ4A 3ZSWA 1TL1A 3DMJA 3D7EO 3F5TA 4BVOA 4X66K 4WE1A 3VQ6A 5BR9A 3WNFA 2KLAA 3VEVA 1CZ9A 3T1HK 2DPNA 1ESVA 4YOUA 3L2VA 1LAWA 3O8MA 1IBKK 3WXLA 4FPBA 4FO0A 1QQOA 1IKXA 1YITN 2O8CA 3AAPA 4DG1A 4CE9A 3MWPA 2OYQA 3FZLA 1JLQA 3HP9A 4ILGB 2PZSA 2D0AA 3LWMA 1S1VA 4JHDA 3MXJA 4E19A 3KLIA 3QFPA 1DKGD 2ZJQL 5GADP 4DSIA 4FJ9A 2HNYA 3LDQA 1FJGK 3HSTB 4KBOA 4LFCK 3I55N 1NK5A 2A3ZA 1JLEA 3ZETB 4DQSA 1ZYQA 2UYTA 2P9PB 3EY1A 3C94A 4H0XB 4ILHA 3VQDA 3E9LA 3VQAA 3OYMA 4LD0A 3EE8A 4X64K 2O8BB 2BH1A 2I5JA 1ATNA 3DXMB 5GAGP 3E66A 2P9UB 2NRHA 3UIQA 2BGGA 3HVTA 3DLHA 4IWVA 3HVRA 4CBUA 3C0BA 3VQCA 5JLHA 1HNZK 4FM0A 1RTHA 4OPHA 3F2KA 3PX4A 4ISGA 3H3NO 1RBRA 1JLFA 1TL3A 4FJJA 3KLEA 3P83D 3Q7CA 4CHZA 1HKGA 2P9IA 4CZFA 1L5UA 5J2MA 3AVNA 3CCRN 4B9UA 1YTUA 4MO5A 4XEIA 1HKCA 3OYFA 4KPYA 2HVIA 4DSJA 2G8IA 1BCOA 2YHWA 2QK9A 1Q86O 1HNXK 1R0AA 4NLCA 3MXIA 4B3SK 2YJEA 1BGXT 5J2PA 4RWTA 3D2EB 3NF8A 2BDPA 4JD2A 2GEMA 3W0LA 3THXA 2X78A 4QOZB 3R8EA 4X62K 3DOLA 1HPZA 1L3UA 3TAPA 3O9TA 4ZHRA 4PL7A 5J1EA 1A5XA 3QB0A 3CMAN 4JS4A 4JKEA 3IS9A 3VMFB 4CEZA 3ALYA 1NJWA 3OYLA 4AILC 1HJRA 4H03B 2V52B 4C23A 1G99A 1NGIA 3AO5A 4E1NA 3O9SA 4B1ZA 3LAKA 3HI0A 5M1KA 3R1XA 3NAEA 4IKFA 3C6UA 1JJ2M 3VEOA 2HBJA 2Q0UA 3GOIA 1N34K 3N4QA 4IG3A 1VK0A 1GOBA 3ENBA 3ZT2A 3NGZA 4CEQA 1NK9A 3AVLA 4JI7K 1SQKA 5LL6Z 3KJVA 4I2PA 3BZCA 4LF5K 1NGHA 1D8YA 4B1UB 3NF9A 2FSJA 5M1OA 1KAZA 1VSFA 4IDKA 1HNWK 2YNGA 4IFYA 4N41A 5AQXA 3AO4A 3ZCMA 1ZBHA 3WT0A 3ZSZA 1D4XA 5AQQA 3SUOA 5EOYA 5AQRA 3CM6A 4A5BA 4FWQA 3LL3A 5AQTA 3P5JA 2A1RA 4KTQA 4KRFA 5AQSA 3S9HA 3CQ8A 1MWMA 4H8KA 3TAMA 4DSLA 4CFAA 4BDYA 4LSNA 2KKZA 2HHHK 3SBGA 3D2FB 1KVCA 4LF6K 2KHOA 4FW2A 4DFPA 1QSSA 4E1MA 2QWPA 1QSLA 3OHRA 4DFJA 3QBXA 5CY4A 4CK1A 1Y97A 2P9NB 4HWIA 3JS6A 1B92A 4CJLA 3C6TA 5JICA 1ATSA 1JKHA 3RRHA 3J7AP 2HHUA 1QE1A 3J7ZO 1D9FA 1I3AA 2YNFA 4HCBA 2GBZA 3PO4A 2B4JA 3LDSA 1FXXA 1SL0A 5I9EB 3HOSA 4NXNK 2G8FA 3VQBA 4DSFA 4FWMA 1KAYA 3NHGA 4BR7A 1TV6A 3TR8A 3VQPA 3OW2M 1RNHA 1RT3A 4KHQA 1YJWN 3SLCA 1XC3A 1TUYA 3CETA 3THYB 3E1YA 4FOIA 1VQMN 2QTDA 4ID5A 5BPLA 3P38A 5I3UA 3CC2N 2Z1GA 3DRPA 4B3TK 1NU0A 4H5TA 4BREA 4KI4A 3L4QA 3F9MA 1VHXA 3MEEA 4I2QA 3ZT1A 4CJSA 5CE3A 5GAHP 4WF9L 1XNRK 2ZJPL 3NF6A 2XY7A 4DTRA 5GIOA 3T69A 3ZYYX 4DV5K 2YNHA 1VQ8N 4V19S 4BRHA 2DFEA 3FE1A 3WNHA 1NKEA 4DF8A 3M3ZA 4YNQA 3O80A 3ENHA 3TTFA 1GOAA 2YX6A 1KTQA 3OS1A 4DUYK 3HO1A 1U6ZA 3SNNA 3LPUA 4YDUA 3DI6A 5AQMA 4IDHA 3ZSXA 4F3TA 4DTOA 3I33A 2QWMA 4F2SA 2HW3A 1WNSA 4M3YA 3K59A 4CHOA
chains in the Genus database with same CATH topology
5C25A 4QAGA 1L3SA 3KTQA 3OJSA 2IAJA 2D5RA 4LY7A 4HUEA 2GV9A 4C8LA 4CF8A 5HP1A 3B6OA 1SL2A 4CCHA 1S1UA 2HHQA 1VRTA 2RF2A 3NGIA 2LSNA 4FJXA 4B9SA 4CEAA 4KKOA 3OYAA 3AVIA 4FJLA 4I7FA 4MQ3A 2VG7A 3SYZA 4B3OA 2P51A 4ELUA 4FLZA 1Q9YA 4W5TA 3RTVA 4FK0A 4RW6A 1XC9A 3AVFA 1DTQA 1N5YA 1KLMA 5T7BA 2OPSA 1TKZA 1XWLA 3CYMA 4AHSA 3K5NA 4B9VA 5JS1A 3SUQA 1RTIA 4OGCA 1HRHA 3JSMA 4HUFA 4CF2A 4E7IA 3DLGA 3CG7A 1S5JA 3G10A 4N76A 5HBMA 4PA1A 3TAGA 1B9DA 1WLJA 2VWKA 2XY8A 1Z26A 3T19A 4CIFA 1NK0A 4DU1A 5J2NA 4KTWA 4DTUA 1TKDA 4DSKA 3WNEA 3OYGA 5CZ1A 3SPZA 1JXBA 3DOKA 3TANA 1DTTA 3KKRA 2G8UA 1G15A 3LWLA 3ITHA 2KTQA 4XIUA 3QEVA 3MXMA 3SV4A 3SJJA 2ETJA 2B5JA 1EP4A 2D0CA 2IGIA 3MEDA 4Y1DA 1X1PA 4CGFA 3EZ5A 3RR7A 2HHVA 1NJZA 3D45A 2KZMA 1VSEA 4CJVA 3OYIA 3DYAA 5KRTA 2E6MA 2E4LA 1NOYA 4M3ZA 2O4IA 1RILA 3TABA 4HTUA 3RMBA 4CEFA 1VSJA 3LP0A 4DU4A 4ELTA 1NJYA 2B6AA 4RW7A 5KGWA 4CGHA 1FKPA 2WONA 3AA5X 1T03A 5HRPA 3AO1A 4E3SA 4CHNA 2G8VA 3PX0A 1VSKA 4KHNA 2HB5A 4DF4A 3QNNA 1LV5A 3K5OA 4AHTA 4W5OA 3NH2A 3SZ2A 3OYBA 1A5WA 3AVMA 3VQ7A 3BDPA 4DWIA 2O4GA 2X74A 2YKNA 4Z4FA 1TK0A 4W5RA 4FLVA 1NK7A 2F8TA 4PY5A 3ZSYA 4DTXA 3AVBA 4GVMA 4E0DA 1IKYA 3ZSOA 4FM2A 4K8ZA 3C95A 1BI4B 3HP6A 1W0HA 4KHUA 2KFZA 3AVKA 1JXEA 4B8CA 2BE2A 2YNIA 3PV8A 4DTSA 4MFBA 4DFKA 3F9KA 4CJRA 4CIGA 4PUOA 3AV9A 1LW2A 4CK3A 2WOMA 4CIEA 1C0MA 1VSMA 1L3TA 5JS2A 1ZBLA 1HNVA 1RDDA 3RR8A 3ULDA 3DRSA 4CJ3A 1FKOA 1IKVA 4H4OA 2ATQA 5KTQA 3B6PA 4JRQA 2PY5A 3HPGA 1RT7A 1RT4A 4RW8A 4C8KA 2Y1IA 3NE6A 4RW9A 4C8MA 3AVAA 3DLKA 4CERA 4CHYA 4HVJA 3ZSQA 4FLUA 1NKBA 3SQ2A 3OYDA 1SKWA 1NOZA 4Z4EA 2NUBA 1JLBA 4J2BA 4NYFA 4AHVA 4CK2A 3L2QA 3K58A 3HM9A 4DLEA 1X9MA 4KI6A 1W9HA 4JRPA 3V81A 1S1XA 2KFNA 1RDAA 2W42A 3PO5A 4CGDA 3H08A 3O3HA 1YTAA 3M8RA 3NBPA 4DSEA 3CM5A 4AHCA 3OYCA 4CJEA 4O0JA 3QEWA 1LAVA 4ID1A 3QEIA 4I9QA 3QERA 5FRNA 3RMDA 4FZXC 4DTPA 1EXQA 1RBSA 4CJQA 3SV3A 2X6SA 4ELVA 4CJ4A 1BI4A 1ASVA 3L3UA 4OLBA 3OY9A 4M3XA 3KLFA 4HCCA 4KV8A 1EETA 1O1WA 2GUIA 2ZD1A 4NCGA 3KIOA 3KLHA 2G8WA 1KSPA 4FJMA 4DU3A 4HHTA 3SQ4A 3ZSWA 1TL1A 3ASMA 3DMJA 4C8OA 3AO3A 5HLFA 1S1WA 3O3FA 4CJ5A 1HYSA 5KGXA 4FJGA 1XI1A 1QTMA 4WE1A 3VQ6A 4E7KA 2QKKA 1MU2A 3KD5E 3WNFA 1RDBA 4W5QA 4QCLA 5I42A 2EX3A 4FJHA 3F73A 1CZ9A 2D0BA 1HQEA 1VSIA 4BWJA 1TKTA 4CFDA 3M8PA 3V1RA 4OPKA 3L2VA 2QKBA 3VQQA 3L2WA 1LAWA 1WAJA 3RMCA 4F4KA 3MECA 1RTJA 2FBYA 1IKXA 1KFSA 4DG1A 4CE9A 1S6QA 1EX4A 1D9DA 1S9EA 4BWMA 2OPRA 1UOCA 4HUGA 4KB1A 2OYQA 4CJPA 3SCXA 4CJFA 1JLQA 3HP9A 2KW4A 4FXDA 4LH4A 1NJXA 1IKWA 2PZSA 2AJQA 2D0AA 3LWMA 3SUNA 4EZ6A 1S1VA 5EU7A 1T8EA 2KZZA 2OPPA 4DLGA 4M45A 1WSHA 3MXJA 1YT3A 4E19A 3OYHA 2Q3SA 4NYNA 4PWDA 2DTUA 2RN2A 3KLIA 2BANA 3HJFA 3TI0A 5K14A 1Q8IA 3D0PA 3LP2A 3TAFA 1QS4A 4F2RA 4DSIA 4FJ9A 2HNYA 4OKJA 1U4BA 2HVHA 3HSTB 3QEXA 2HNZA 1NK5A 3OVNA 1JLEA 4DQSA 1ZYQA 5HROA 1C6VA 3RWUA 1FK9A 3BGRA 4Q5VA 1I39A 3TARA 2OPQA 4AHUA 1WN7A 3EY1A 1HYVA 3C94A 4FLYA 3QINA 3V6DA 3NF7A 3VQDA 1UA0A 3VQAA 3OYMA 4Z4CA 4LD0A 3U3GA 3KK3A 2I5JA 1D5AA 4Z4GA 3P1GA 4BDZA 3TWHA 4B9TA 1IG9A 2P1JA 3L2RA 3UIQA 1SL1A 2BGGA 1JLCA 3MEGA 2HMIA 4KHYA 3HVTA 3DLHA 3HVRA 3HPOA 3VQCA 1BCMA 3TAQA 3S3NA 1C0TA 4FM0A 3HL8A 4EP4A 1RTHA 3V9XA 4Z0UA 3PX4A 4Y1CA 1L3VA 1RBRA 1JLFA 3LP3A 1TL3A 3NH0A 4FJ7A 4DQIA 4FJJA 4Z4IA 3KLEA 4IG0A 1RDCA 1S6PA 4H4MA 2F8SA 3P83D 4IBNA 4CHZA 3AA4A 2E6LA 4FM1A 1L5UA 2RKIA 4AH9A 5J2MA 3K5LA 3AVNA 1HNIA 3CFPA 1KVBA 1F21A 3ZSVA 3VA3A 1WAFA 1YVUA 4B9UA 1YTUA 1RT5A 5C42A 3OYFA 4O5BA 4KPYA 2HVIA 4DSJA 2G8IA 1BCOA 1DLOA 4FW1A 4BE2A 2QK9A 3ZSRA 2F96A 2HHWA 3AVCA 4BACA 1R0AA 4ZTFA 3CFRA 4OKEA 4M42A 5CZ2A 2YKMA 3AA3A 4F3OA 3EYZA 3MXIA 1BGXT 4DQPA 1KLNA 5J2PA 4CF0A 1RT2A 1KVAA 2HHTA 3NF8A 3T1AA 4CHPA 3QEPA 2BDPA 3OYKA 1KFDA 3LZJA 4DQQA 2OZSA 2ZE2A 2HHXA 3KK1A 4J2DA 1HQUA 4CEOA 4FZZA 2X78A 4BDPA 4QOZB 1TAUA 1TKXA 3DOLA 4B9NA 1HPZA 3DM2A 2HHSA 4FVMA 1KRPA 1L3UA 1RT6A 4FJ8A 1J53A 4O4GA 1RBVA 4CEBA 4ZHRA 3TAPA 5J1EA 1A5XA 2Z1IA 2XY6A 4N56A 4DMNA 3OYNA 3V9SA 2IOCA 4JS4A 1NKCA 3IS9A 4O44A 4J2EA 4CEZA 1VSDA 1ASWA 3OJUA 3ALYA 4CGJA 3SUPA 1WSFA 1NJWA 1B9FA 1X9WA 1LWFA 3OYLA 2JGUA 4AILC 1HJRA 4OKKA 1UAXA 4E89A 4CF1A 2OZMA 4NCAA 4CECA 4CJWA 4CF9A 3AO5A 3VQ8A 4E1NA 5HRSA 1HMVA 3ZT3A 4OJRA 4M3RA 4JS5A 3LAKA 3V9ZA 4FJNA 4FJKA 2FBTA 3AVJA 4DS4A 5FROA 3NAEA 4IKFA 3C6UA 4BE1A 2XRIA 1NK4A 3A2FA 3I0RA 1JL1A 1S1TA 3K57A 3FFIA 4FK2A 4W5NA 4IG3A 1VK0A 4OVLA 1T05A 2P5OA 3VQEA 1GOBA 3M8QA 1C1CA 3KD1E 1ITGA 3V9UA 4FLWA 3VN5A 5E41A 3ZT2A 1J5OA 2PYLA 4M3UA 3NGZA 1BQNA 4CEQA 1TGOA 1ZBUA 3AVLA 1NK9A 4J2AA 1BIZA 5SZTA 3QESA 4CEDA 3KJVA 2EHGA 4I2PA 2JLEA 2VG5A 3DLBA 3U6FA 1D8YA 4GMJB 3NF9A 5SWMA 3HXMA 1U45A 1NK6A 1VSFA 3QIOA 4CJKA 4IDKA 4KFBA 2YNGA 1JLGA 4IFYA 2P5GA 4OLAA 3K5MA 4M3WA 4N41A 1TK8A 1CXQA 5CYQA 4B9MA 3AO4A 4I9LA 3ZCMA 4OPJA 1ZBHA 1RBTA 1KCFA 3ZT4A 3S3MA 4JLHA 3ZSZA 4KB0A 3LALA 5C24A 3SUOA 3VQ5A 1T7PA 2FC0A 3CM6A 2A1RA 4KTQA 4CESA 3P5JA 4DFMA 2A1SA 4KRFA 2G8KA 1HYZA 3QO9A 3V9WA 1IO2A 3S9HA 3CQ8A 1LWCA 3MAQA 4H8KA 3DLRA 3TAMA 4PQUA 4DSLA 1Z25A 2FBVA 4CFAA 2R7YA 4DQRA 4BDYA 1SUQA 4CFBA 1Q9XA 3VQ4A 4CFCA 4LSNA 3JYTA 4CEEA 1U49A 2IS3A 4KHSA 3V1QA 1KVCA 3HPHA 3HYFA 5J2QA 1RBUA 1RTDA 4EP5A 4FW2A 3LZIA 4G1QA 4ZTJA 4CHQA 4DFPA 1C1AA 4RG8A 4CGGA 4N5SA 4DTMA 4KHWA 1BL3A 1QQCA 1QSSA 3AA2A 5DMRA 3E01A 4E1MA 3OS0A 4CJUA 1QSLA 4DFJA 5D3GA 3RMAA 5CY4A 4CK1A 4OGEA 1JLAA 1Y97A 3AVHA 4B9LA 4FZYA 4ICLA 3U3YA 4L8RB 1B92A 1XHXA 4CJLA 3C6TA 4YFUA 1U48A 4KAZA 2VG6A 1QHTA 4AHRA 4O0IA 3ZT0A 1J9AA 1N6QA 1JKHA 4E7LA 3RRHA 5FRMA 1REVA 3VQ9A 2OA8A 1C0UA 1UWBA 2X6NA 2KQ2A 2HHUA 1QE1A 1GOCA 1D9FA 1I3AA 3PUFA 3KK2A 2YNFA 4BE0A 1TAQA 3IRXA 4DTJA 4FJ5A 4HCBA 3IAYA 3OYJA 3G0ZA 2GBZA 4TSXA 3NH1A 3PO4A 2B4JA 2YHAA 3I8DA 2IDOA 4DTNA 1XHZA 2DFHA 1RCHA 3PY8A 3IG1A 5FDLA 3LDSA 2RPIA 1FXXA 2IC3A 4RW4A 1NK8A 1SL0A 3M8SA 4KO0A 4CJTA 3THVA 1UA1A 4B8AB 4E7HA 1A5VA 3SPYA 3V1OA 3WNGA 2G8FA 2Z1HA 3VQBA 4DSFA 1BQMA 3AO2A 2XY5A 3S3OA 3HK2A 3LP1A 4FCYA 2PYJA 1CLQA 1BISA 1LW0A 3NHGA 4KTZA 1TK5A 5KRSA 1TV6A 3TR8A 3NGYA 1WSIA 1WSGA 5HRRA 2DY4A 2QXFA 3VQPA 2ITGA 3AVGA 1RNHA 1RT3A 2YHBA 4KHQA 3DLEA 3I0SA 3L8BA 3LPTA 3OS2A 1ZBFA 2DFFA 3NFAA 1CXUA 3SQ0A 1SKRA 4O55A 4ID5A 1TVRA 2XO7A 1X9SA 4M3TA 1RT1A 3L2UA 5I3UA 1WSEA 4DS5A 4B08A 2Z1GA 4E7JA 3DRPA 3K2PA 4FYDA 1VSLA 3LAMA 2Z1JA 3CFOA 4KI4A 4K8XA 4FJIA 3HT3A 1JL2A 3VA0A 3QLHA 1ASUA 3MEEA 4I2QA 3ZT1A 1VSHA 3QETA 1SKSA 4CJSA 2G8HA 3SI6A 1EKEA 3OYEA 3L3VA 3ISNC 4Z4HA 1J54A 3NF6A 3RRGA 2XY7A 4DTRA 4EZ9A 1S9GA 2YNHA 5DK5A 1C1BA 3T3FA 2XHBA 1SV5A 2DFEA 3WNHA 4GW6A 4FLTA 3QNOA 4CGIA 4N47A 4DF8A 1NKEA 4Q0BA 1WSJA 4YNQA 4LSLA 2FBXA 3O4QA 4UQGA 3NDKA 3NCIA 1U47A 2YV0X 3O3GA 1IH7A 4NCBA 4C8NA 1GOAA 2ZQBA 1KTQA 5HRNA 5CYMA 3OS1A 1QSYA 1ZBIA 3HO1A 3LANA 2HNDA 3SNNA 4R5PA 3DRRA 3LPUA 1BIUA 1CZBA 1BHLA 4KREA 1K6YA 3DI6A 4FLXA 3TAEA 3KLGA 3O4NA 3SQ1A 3ZSXA 4FK4A 4DTOA 3QIPA 4F3TA 1VRUA 3PX6A 4F2SA 4M41A 2HW3A 4F8RA 2VWJA 3KKSA 1WNSA 4LH5A 1LWEA 4M3YA 3V4IA 1U04A 4CHOA 3K59A 2Y1JA 4IFVA 5KI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C25 A;  4QAG A;  1L3S A;  3KTQ A;  3OJS A;  2IAJ A;  2D5R A;  4LY7 A;  4HUE A;  2GV9 A;  4C8L A;  4CF8 A;  5HP1 A;  3B6O A;  1SL2 A;  4CCH A;  1S1U A;  2HHQ A;  1VRT A;  2RF2 A;  3NGI A;  2LSN A;  4FJX A;  4B9S A;  4CEA A;  4KKO A;  3OYA A;  3AVI A;  4FJL A;  4I7F A;  4MQ3 A;  2VG7 A;  3SYZ A;  4B3O A;  2P51 A;  4ELU A;  4FLZ A;  1Q9Y A;  4W5T A;  3RTV A;  4FK0 A;  4RW6 A;  1XC9 A;  3AVF A;  1DTQ A;  1N5Y A;  1KLM A;  5T7B A;  2OPS A;  1TKZ A;  1XWL A;  3CYM A;  4AHS A;  3K5N A;  4B9V A;  5JS1 A;  3SUQ A;  1RTI A;  4OGC A;  1HRH A;  3JSM A;  4HUF A;  4CF2 A;  4E7I A;  3DLG A;  3CG7 A;  1S5J A;  3G10 A;  4N76 A;  5HBM A;  4PA1 A;  3TAG A;  1B9D A;  1WLJ A;  2VWK A;  2XY8 A;  1Z26 A;  3T19 A;  4CIF A;  1NK0 A;  4DU1 A;  5J2N A;  4KTW A;  4DTU A;  1TKD A;  4DSK A;  3WNE A;  3OYG A;  5CZ1 A;  3SPZ A;  1JXB A;  3DOK A;  3TAN A;  1DTT A;  3KKR A;  2G8U A;  1G15 A;  3LWL A;  3ITH A;  2KTQ A;  4XIU A;  3QEV A;  3MXM A;  3SV4 A;  3SJJ A;  2ETJ A;  2B5J A;  1EP4 A;  2D0C A;  2IGI A;  3MED A;  4Y1D A;  1X1P A;  4CGF A;  3EZ5 A;  3RR7 A;  2HHV A;  1NJZ A;  3D45 A;  2KZM A;  1VSE A;  4CJV A;  3OYI A;  3DYA A;  5KRT A;  2E6M A;  2E4L A;  1NOY A;  4M3Z A;  2O4I A;  1RIL A;  3TAB A;  4HTU A;  3RMB A;  4CEF A;  1VSJ A;  3LP0 A;  4DU4 A;  4ELT A;  1NJY A;  2B6A A;  4RW7 A;  5KGW A;  4CGH A;  1FKP A;  2WON A;  3AA5 X;  1T03 A;  5HRP A;  3AO1 A;  4E3S A;  4CHN A;  2G8V A;  3PX0 A;  1VSK A;  4KHN A;  2HB5 A;  4DF4 A;  3QNN A;  1LV5 A;  3K5O A;  4AHT A;  4W5O A;  3NH2 A;  3SZ2 A;  3OYB A;  1A5W A;  3AVM A;  3VQ7 A;  3BDP A;  4DWI A;  2O4G A;  2X74 A;  2YKN A;  4Z4F A;  1TK0 A;  4W5R A;  4FLV A;  1NK7 A;  2F8T A;  4PY5 A;  3ZSY A;  4DTX A;  3AVB A;  4GVM A;  4E0D A;  1IKY A;  3ZSO A;  4FM2 A;  4K8Z A;  3C95 A;  1BI4 B;  3HP6 A;  1W0H A;  4KHU A;  2KFZ A;  3AVK A;  1JXE A;  4B8C A;  2BE2 A;  2YNI A;  3PV8 A;  4DTS A;  4MFB A;  4DFK A;  3F9K A;  4CJR A;  4CIG A;  4PUO A;  3AV9 A;  1LW2 A;  4CK3 A;  2WOM A;  4CIE A;  1C0M A;  1VSM A;  1L3T A;  5JS2 A;  1ZBL A;  1HNV A;  1RDD A;  3RR8 A;  3ULD A;  3DRS A;  4CJ3 A;  1FKO A;  1IKV A;  4H4O A;  2ATQ A;  5KTQ A;  3B6P A;  4JRQ A;  2PY5 A;  3HPG A;  1RT7 A;  1RT4 A;  4RW8 A;  4C8K A;  2Y1I A;  3NE6 A;  4RW9 A;  4C8M A;  3AVA A;  3DLK A;  4CER A;  4CHY A;  4HVJ A;  3ZSQ A;  4FLU A;  1NKB A;  3SQ2 A;  3OYD A;  1SKW A;  1NOZ A;  4Z4E A;  2NUB A;  1JLB A;  4J2B A;  4NYF A;  4AHV A;  4CK2 A;  3L2Q A;  3K58 A;  3HM9 A;  4DLE A;  1X9M A;  4KI6 A;  1W9H A;  4JRP A;  3V81 A;  1S1X A;  2KFN A;  1RDA A;  2W42 A;  3PO5 A;  4CGD A;  3H08 A;  3O3H A;  1YTA A;  3M8R A;  3NBP A;  4DSE A;  3CM5 A;  4AHC A;  3OYC A;  4CJE A;  4O0J A;  3QEW A;  1LAV A;  4ID1 A;  3QEI A;  4I9Q A;  3QER A;  5FRN A;  3RMD A;  4FZX C;  4DTP A;  1EXQ A;  1RBS A;  4CJQ A;  3SV3 A;  2X6S A;  4ELV A;  4CJ4 A;  1BI4 A;  1ASV A;  3L3U A;  4OLB A;  3OY9 A;  4M3X A;  3KLF A;  4HCC A;  4KV8 A;  1EET A;  1O1W A;  2GUI A;  2ZD1 A;  4NCG A;  3KIO A;  3KLH A;  2G8W A;  1KSP A;  4FJM A;  4DU3 A;  4HHT A;  3SQ4 A;  3ZSW A;  1TL1 A;  3ASM A;  3DMJ A;  4C8O A;  3AO3 A;  5HLF A;  1S1W A;  3O3F A;  4CJ5 A;  1HYS A;  5KGX A;  4FJG A;  1XI1 A;  1QTM A;  4WE1 A;  3VQ6 A;  4E7K A;  2QKK A;  1MU2 A;  3KD5 E;  3WNF A;  1RDB A;  4W5Q A;  4QCL A;  5I42 A;  2EX3 A;  4FJH A;  3F73 A;  1CZ9 A;  2D0B A;  1HQE A;  1VSI A;  4BWJ A;  1TKT A;  4CFD A;  3M8P A;  3V1R A;  4OPK A;  3L2V A;  2QKB A;  3VQQ A;  3L2W A;  1LAW A;  1WAJ A;  3RMC A;  4F4K A;  3MEC A;  1RTJ A;  2FBY A;  1IKX A;  1KFS A;  4DG1 A;  4CE9 A;  1S6Q A;  1EX4 A;  1D9D A;  1S9E A;  4BWM A;  2OPR A;  1UOC A;  4HUG A;  4KB1 A;  2OYQ A;  4CJP A;  3SCX A;  4CJF A;  1JLQ A;  3HP9 A;  2KW4 A;  4FXD A;  4LH4 A;  1NJX A;  1IKW A;  2PZS A;  2AJQ A;  2D0A A;  3LWM A;  3SUN A;  4EZ6 A;  1S1V A;  5EU7 A;  1T8E A;  2KZZ A;  2OPP A;  4DLG A;  4M45 A;  1WSH A;  3MXJ A;  1YT3 A;  4E19 A;  3OYH A;  2Q3S A;  4NYN A;  4PWD A;  2DTU A;  2RN2 A;  3KLI A;  2BAN A;  3HJF A;  3TI0 A;  5K14 A;  1Q8I A;  3D0P A;  3LP2 A;  3TAF A;  1QS4 A;  4F2R A;  4DSI A;  4FJ9 A;  2HNY A;  4OKJ A;  1U4B A;  2HVH A;  3HST B;  3QEX A;  2HNZ A;  1NK5 A;  3OVN A;  1JLE A;  4DQS A;  1ZYQ A;  5HRO A;  1C6V A;  3RWU A;  1FK9 A;  3BGR A;  4Q5V A;  1I39 A;  3TAR A;  2OPQ A;  4AHU A;  1WN7 A;  3EY1 A;  1HYV A;  3C94 A;  4FLY A;  3QIN A;  3V6D A;  3NF7 A;  3VQD A;  1UA0 A;  3VQA A;  3OYM A;  4Z4C A;  4LD0 A;  3U3G A;  3KK3 A;  2I5J A;  1D5A A;  4Z4G A;  3P1G A;  4BDZ A;  3TWH A;  4B9T A;  1IG9 A;  2P1J A;  3L2R A;  3UIQ A;  1SL1 A;  2BGG A;  1JLC A;  3MEG A;  2HMI A;  4KHY A;  3HVT A;  3DLH A;  3HVR A;  3HPO A;  3VQC A;  1BCM A;  3TAQ A;  3S3N A;  1C0T A;  4FM0 A;  3HL8 A;  4EP4 A;  1RTH A;  3V9X A;  4Z0U A;  3PX4 A;  4Y1C A;  1L3V A;  1RBR A;  1JLF A;  3LP3 A;  1TL3 A;  3NH0 A;  4FJ7 A;  4DQI A;  4FJJ A;  4Z4I A;  3KLE A;  4IG0 A;  1RDC A;  1S6P A;  4H4M A;  2F8S A;  3P83 D;  4IBN A;  4CHZ A;  3AA4 A;  2E6L A;  4FM1 A;  1L5U A;  2RKI A;  4AH9 A;  5J2M A;  3K5L A;  3AVN A;  1HNI A;  3CFP A;  1KVB A;  1F21 A;  3ZSV A;  3VA3 A;  1WAF A;  1YVU A;  4B9U A;  1YTU A;  1RT5 A;  5C42 A;  3OYF A;  4O5B A;  4KPY A;  2HVI A;  4DSJ A;  2G8I A;  1BCO A;  1DLO A;  4FW1 A;  4BE2 A;  2QK9 A;  3ZSR A;  2F96 A;  2HHW A;  3AVC A;  4BAC A;  1R0A A;  4ZTF A;  3CFR A;  4OKE A;  4M42 A;  5CZ2 A;  2YKM A;  3AA3 A;  4F3O A;  3EYZ A;  3MXI A;  1BGX T;  4DQP A;  1KLN A;  5J2P A;  4CF0 A;  1RT2 A;  1KVA A;  2HHT A;  3NF8 A;  3T1A A;  4CHP A;  3QEP A;  2BDP A;  3OYK A;  1KFD A;  3LZJ A;  4DQQ A;  2OZS A;  2ZE2 A;  2HHX A;  3KK1 A;  4J2D A;  1HQU A;  4CEO A;  4FZZ A;  2X78 A;  4BDP A;  4QOZ B;  1TAU A;  1TKX A;  3DOL A;  4B9N A;  1HPZ A;  3DM2 A;  2HHS A;  4FVM A;  1KRP A;  1L3U A;  1RT6 A;  4FJ8 A;  1J53 A;  4O4G A;  1RBV A;  4CEB A;  4ZHR A;  3TAP A;  5J1E A;  1A5X A;  2Z1I A;  2XY6 A;  4N56 A;  4DMN A;  3OYN A;  3V9S A;  2IOC A;  4JS4 A;  1NKC A;  3IS9 A;  4O44 A;  4J2E A;  4CEZ A;  1VSD A;  1ASW A;  3OJU A;  3ALY A;  4CGJ A;  3SUP A;  1WSF A;  1NJW A;  1B9F A;  1X9W A;  1LWF A;  3OYL A;  2JGU A;  4AIL C;  1HJR A;  4OKK A;  1UAX A;  4E89 A;  4CF1 A;  2OZM A;  4NCA A;  4CEC A;  4CJW A;  4CF9 A;  3AO5 A;  3VQ8 A;  4E1N A;  5HRS A;  1HMV A;  3ZT3 A;  4OJR A;  4M3R A;  4JS5 A;  3LAK A;  3V9Z A;  4FJN A;  4FJK A;  2FBT A;  3AVJ A;  4DS4 A;  5FRO A;  3NAE A;  4IKF A;  3C6U A;  4BE1 A;  2XRI A;  1NK4 A;  3A2F A;  3I0R A;  1JL1 A;  1S1T A;  3K57 A;  3FFI A;  4FK2 A;  4W5N A;  4IG3 A;  1VK0 A;  4OVL A;  1T05 A;  2P5O A;  3VQE A;  1GOB A;  3M8Q A;  1C1C A;  3KD1 E;  1ITG A;  3V9U A;  4FLW A;  3VN5 A;  5E41 A;  3ZT2 A;  1J5O A;  2PYL A;  4M3U A;  3NGZ A;  1BQN A;  4CEQ A;  1TGO A;  1ZBU A;  3AVL A;  1NK9 A;  4J2A A;  1BIZ A;  5SZT A;  3QES A;  4CED A;  3KJV A;  2EHG A;  4I2P A;  2JLE A;  2VG5 A;  3DLB A;  3U6F A;  1D8Y A;  4GMJ B;  3NF9 A;  5SWM A;  3HXM A;  1U45 A;  1NK6 A;  1VSF A;  3QIO A;  4CJK A;  4IDK A;  4KFB A;  2YNG A;  1JLG A;  4IFY A;  2P5G A;  4OLA A;  3K5M A;  4M3W A;  4N41 A;  1TK8 A;  1CXQ A;  5CYQ A;  4B9M A;  3AO4 A;  4I9L A;  3ZCM A;  4OPJ A;  1ZBH A;  1RBT A;  1KCF A;  3ZT4 A;  3S3M A;  4JLH A;  3ZSZ A;  4KB0 A;  3LAL A;  5C24 A;  3SUO A;  3VQ5 A;  1T7P A;  2FC0 A;  3CM6 A;  2A1R A;  4KTQ A;  4CES A;  3P5J A;  4DFM A;  2A1S A;  4KRF A;  2G8K A;  1HYZ A;  3QO9 A;  3V9W A;  1IO2 A;  3S9H A;  3CQ8 A;  1LWC A;  3MAQ A;  4H8K A;  3DLR A;  3TAM A;  4PQU A;  4DSL A;  1Z25 A;  2FBV A;  4CFA A;  2R7Y A;  4DQR A;  4BDY A;  1SUQ A;  4CFB A;  1Q9X A;  3VQ4 A;  4CFC A;  4LSN A;  3JYT A;  4CEE A;  1U49 A;  2IS3 A;  4KHS A;  3V1Q A;  1KVC A;  3HPH A;  3HYF A;  5J2Q A;  1RBU A;  1RTD A;  4EP5 A;  4FW2 A;  3LZI A;  4G1Q A;  4ZTJ A;  4CHQ A;  4DFP A;  1C1A A;  4RG8 A;  4CGG A;  4N5S A;  4DTM A;  4KHW A;  1BL3 A;  1QQC A;  1QSS A;  3AA2 A;  5DMR A;  3E01 A;  4E1M A;  3OS0 A;  4CJU A;  1QSL A;  4DFJ A;  5D3G A;  3RMA A;  5CY4 A;  4CK1 A;  4OGE A;  1JLA A;  1Y97 A;  3AVH A;  4B9L A;  4FZY A;  4ICL A;  3U3Y A;  4L8R B;  1B92 A;  1XHX A;  4CJL A;  3C6T A;  4YFU A;  1U48 A;  4KAZ A;  2VG6 A;  1QHT A;  4AHR A;  4O0I A;  3ZT0 A;  1J9A A;  1N6Q A;  1JKH A;  4E7L A;  3RRH A;  5FRM A;  1REV A;  3VQ9 A;  2OA8 A;  1C0U A;  1UWB A;  2X6N A;  2KQ2 A;  2HHU A;  1QE1 A;  1GOC A;  1D9F A;  1I3A A;  3PUF A;  3KK2 A;  2YNF A;  4BE0 A;  1TAQ A;  3IRX A;  4DTJ A;  4FJ5 A;  4HCB A;  3IAY A;  3OYJ A;  3G0Z A;  2GBZ A;  4TSX A;  3NH1 A;  3PO4 A;  2B4J A;  2YHA A;  3I8D A;  2IDO A;  4DTN A;  1XHZ A;  2DFH A;  1RCH A;  3PY8 A;  3IG1 A;  5FDL A;  3LDS A;  2RPI A;  1FXX A;  2IC3 A;  4RW4 A;  1NK8 A;  1SL0 A;  3M8S A;  4KO0 A;  4CJT A;  3THV A;  1UA1 A;  4B8A B;  4E7H A;  1A5V A;  3SPY A;  3V1O A;  3WNG A;  2G8F A;  2Z1H A;  3VQB A;  4DSF A;  1BQM A;  3AO2 A;  2XY5 A;  3S3O A;  3HK2 A;  3LP1 A;  4FCY A;  2PYJ A;  1CLQ A;  1BIS A;  1LW0 A;  3NHG A;  4KTZ A;  1TK5 A;  5KRS A;  1TV6 A;  3TR8 A;  3NGY A;  1WSI A;  1WSG A;  5HRR A;  2DY4 A;  2QXF A;  3VQP A;  2ITG A;  3AVG A;  1RNH A;  1RT3 A;  2YHB A;  4KHQ A;  3DLE A;  3I0S A;  3L8B A;  3LPT A;  3OS2 A;  1ZBF A;  2DFF A;  3NFA A;  1CXU A;  3SQ0 A;  1SKR A;  4O55 A;  4ID5 A;  1TVR A;  2XO7 A;  1X9S A;  4M3T A;  1RT1 A;  3L2U A;  5I3U A;  1WSE A;  4DS5 A;  4B08 A;  2Z1G A;  4E7J A;  3DRP A;  3K2P A;  4FYD A;  1VSL A;  3LAM A;  2Z1J A;  3CFO A;  4KI4 A;  4K8X A;  4FJI A;  3HT3 A;  1JL2 A;  3VA0 A;  3QLH A;  1ASU A;  3MEE A;  4I2Q A;  3ZT1 A;  1VSH A;  3QET A;  1SKS A;  4CJS A;  2G8H A;  3SI6 A;  1EKE A;  3OYE A;  3L3V A;  3ISN C;  4Z4H A;  1J54 A;  3NF6 A;  3RRG A;  2XY7 A;  4DTR A;  4EZ9 A;  1S9G A;  2YNH A;  5DK5 A;  1C1B A;  3T3F A;  2XHB A;  1SV5 A;  2DFE A;  3WNH A;  4GW6 A;  4FLT A;  3QNO A;  4CGI A;  4N47 A;  4DF8 A;  1NKE A;  4Q0B A;  1WSJ A;  4YNQ A;  4LSL A;  2FBX A;  3O4Q A;  4UQG A;  3NDK A;  3NCI A;  1U47 A;  2YV0 X;  3O3G A;  1IH7 A;  4NCB A;  4C8N A;  1GOA A;  2ZQB A;  1KTQ A;  5HRN A;  5CYM A;  3OS1 A;  1QSY A;  1ZBI A;  3HO1 A;  3LAN A;  2HND A;  3SNN A;  4R5P A;  3DRR A;  3LPU A;  1BIU A;  1CZB A;  1BHL A;  4KRE A;  1K6Y A;  3DI6 A;  4FLX A;  3TAE A;  3KLG A;  3O4N A;  3SQ1 A;  3ZSX A;  4FK4 A;  4DTO A;  3QIP A;  4F3T A;  1VRU A;  3PX6 A;  4F2S A;  4M41 A;  2HW3 A;  4F8R A;  2VWJ A;  3KKS A;  1WNS A;  4LH5 A;  1LWE A;  4M3Y A;  3V4I A;  1U04 A;  4CHO A;  3K59 A;  2Y1J A;  4IFV A;  5KI6 A; 
#chains in the Genus database with same CATH topology
 1L3S A;  4QAG A;  3VPZ A;  3MMV A;  4A57 A;  4BGA A;  3OJS A;  3JXU A;  2V7Y A;  2GV9 A;  1VRT A;  3VET A;  4E1J A;  4CEA A;  3M1F A;  4B9S A;  2VG7 A;  1OH5 A;  4ELU A;  3VGM A;  1RDW X;  4W5T A;  4RW6 A;  1KLM A;  5T7B A;  2OPS A;  4JYA K;  1TKZ A;  2QI2 A;  3CYM A;  4HUF A;  1HRH A;  4GV9 A;  4CF2 A;  3A5N C;  3CG7 A;  3HRG A;  1S5J A;  5HBM A;  1B9D A;  2XY8 A;  4IO8 A;  4DU1 A;  2FSK A;  5J2N A;  1HR0 K;  4IJN A;  1ATR A;  4F9O A;  3OYG A;  5CZ1 A;  4A2A A;  4GNI A;  3TAN A;  1DTT A;  3KKR A;  3HOT A;  4U7B A;  4XIU A;  3THW A;  3QEV A;  2ETJ A;  4QS7 A;  2D0C A;  3KK7 A;  3D45 A;  3OYI A;  3DYA A;  5KRT A;  4EIA A;  4M3Z A;  2O4I A;  4BRI A;  3DLL L;  3TAB A;  1VSJ A;  4DU4 A;  2A5X A;  3U8X A;  4DUZ K;  2Q1N A;  2B6A A;  2CGK A;  3A5M C;  1YI2 N;  3AA5 X;  2YHY A;  4CI6 A;  3ZLJ A;  2HB5 A;  5ADX H;  3NH2 A;  2A42 A;  4LFB K;  3BDP A;  1X3M A;  4DWI A;  4W5R A;  4FLV A;  1NK7 A;  4DTX A;  1BA0 A;  1IKY A;  3AVK A;  4B8C A;  4PKG A;  1QVF M;  4IOC L;  2ZGY A;  5JS2 A;  1XMQ K;  1RDD A;  3I8B A;  3ULD A;  3CPE A;  4IZ9 A;  3DRS A;  4CJ3 A;  3FGU A;  1FKO A;  1IKV A;  5KTQ A;  4JRQ A;  1RT7 A;  2IIR A;  4RW8 A;  3ZX3 A;  3C7N A;  3CER A;  4DV2 K;  2F9T A;  4HVJ A;  4CZM A;  3OYD A;  2AA4 A;  2NUB A;  2GX9 A;  4CK2 A;  3K58 A;  4K43 A;  4JRP A;  2W40 A;  1S1X A;  3VEZ A;  3PSI A;  3H08 A;  4I9Q A;  2O8D A;  2EWS A;  4DTP A;  3CQY A;  3DWL A;  4KV8 A;  1EET A;  3KIO A;  4FJM A;  1Q81 O;  4C8O A;  5BN9 A;  5HLF A;  1YHQ N;  4CJ5 A;  4FJG A;  3CCU N;  2QWQ A;  2QKK A;  3KD5 E;  5I42 A;  2W6K A;  4FJH A;  5GAE P;  3IDH A;  3M8P A;  4OPK A;  3VQQ A;  3RMC A;  2FBY A;  2E88 A;  4ISF A;  1QQM A;  1QHA A;  1S6Q A;  2O8E B;  2OPR A;  1UOC A;  2HOE A;  3CJ1 A;  4FXD A;  4FWK A;  2KZZ A;  4HTL A;  4R79 A;  4YDU C;  4DLG A;  1YT3 A;  2JWK A;  3WUH A;  4NYN A;  3ULE B;  2RN2 A;  2BAN A;  3TI0 A;  5K14 A;  1Q8I A;  3D0P A;  3TAF A;  2V7Z A;  2HVH A;  1NMN A;  3MCP A;  3QEX A;  3OVN A;  5AJ3 K;  2E1Z A;  1C6V A;  5LY3 A;  3RWU A;  1S3X A;  1I39 A;  5JVH L;  1T3V A;  4A59 A;  1HYV A;  2P9L A;  3V6D A;  4PKH A;  4BR5 A;  1D5A A;  3P1G A;  1QVG M;  1IG9 A;  3L2R A;  1WB9 A;  1JLC A;  3MEG A;  2E2P A;  3VF4 A;  3HPO A;  1VQ6 N;  3PLA A;  2FF3 B;  2ASP A;  1VQP N;  3HL8 A;  2A40 A;  4KH5 A;  4AQY K;  4B1V A;  3V9X A;  1VQ5 N;  4Z0U A;  3S41 A;  3HZ6 A;  1L3V A;  1S22 A;  3A5L C;  3K9K A;  3O5B A;  3NH0 A;  2VCP A;  1RDC A;  1S6P A;  3UKR B;  3CHW A;  3ATV A;  1IBM K;  1KVB A;  4OX9 K;  3GL1 A;  3TSQ A;  4BAC A;  3VGK A;  1WOQ A;  3O08 A;  1XQS C;  2YKM A;  4BRA A;  4F3O A;  2HF3 A;  4DQP A;  2QWN A;  1KLN A;  4CF0 A;  3G6E N;  2HHT A;  1BA1 A;  1KVA A;  1ZBS A;  4CHP A;  3OYK A;  5BRF A;  5M1P A;  2ASO A;  3KK1 A;  5E84 A;  2VQF K;  1HQU A;  4CEO A;  2V51 B;  4CZJ A;  4BDP A;  1TKX A;  3DM2 A;  3TTD A;  1KRP A;  3SMP A;  4DKW A;  4CEB A;  1GLL O;  2ZJR L;  4KH6 A;  4N56 A;  4BQZ A;  2NRZ A;  1NGJ A;  3H6E A;  4O44 A;  4BY9 C;  4CBW A;  4FOE A;  1VSD A;  4JHD B;  4BR2 A;  3RSE A;  2FSN A;  1X9W A;  4IXC A;  4OKK A;  1UAX A;  4H5V A;  1M1K O;  4FPA A;  4CF9 A;  3AAR A;  3VQ8 A;  1GLA G;  1HMV A;  5BRH A;  1W2B M;  2FBT A;  2QWL A;  1YF5 L;  3A2F A;  3K57 A;  3H1Q A;  4OVL A;  4NLB A;  1HUX A;  3KD1 E;  3VN5 A;  2ZWH A;  5AQG A;  1J5O A;  1BQN A;  1BIZ A;  2EHG A;  3E9P A;  1Q18 A;  2JLE A;  4FWS A;  5H1S Q;  1U45 A;  4ILJ A;  4AM7 A;  2ASM A;  3GDQ A;  4WFB L;  4KFB A;  2Q31 A;  4M3W A;  2RHK A;  3AAQ A;  4B9M A;  5CYQ A;  4I9L A;  4JLH A;  4DQ8 A;  3VQ5 A;  2FC0 A;  4CES A;  2P9I B;  2G8K A;  3QO9 A;  1IO2 A;  1WBB A;  1Y64 A;  3DLR A;  4PQU A;  3VER A;  3U9Z A;  5AQU A;  2UU9 K;  1SUQ A;  3M5R A;  2CH5 A;  4BR9 A;  4CFC A;  1GLD G;  1U49 A;  2IS3 A;  4KHS A;  5AR0 A;  3HPH A;  3HYF A;  5M1F A;  1RBU A;  3WEE A;  3QFU A;  4YOY A;  3LZI A;  1C1A A;  1IG8 A;  4CGG A;  1QQC A;  4JD2 B;  2YHX A;  3AA2 A;  3E01 A;  3THX B;  4H5W A;  5LMN K;  1K8A O;  4IJA A;  3RMA A;  4OGE A;  4B9L A;  3AVH A;  4L8R B;  1E3M A;  1BOT O;  1XHX A;  4YFU A;  1U48 A;  1NMD A;  5EY4 A;  1QHT A;  4AHR A;  4UY8 O;  2FXU A;  3O1W A;  1J9A A;  4DHY A;  1REV A;  4M63 C;  4K25 A;  1NNE A;  5A2Q O;  3MX2 A;  3WXJ A;  1TAQ A;  4FJ5 A;  3G0Z A;  3J80 O;  4IO9 L;  4K42 A;  4TSX A;  1WBD A;  2YHA A;  2IDO A;  5BRE A;  1XHZ A;  1X3N A;  3PY8 A;  3GE1 A;  2RPI A;  1UA1 A;  2P9K A;  1A5V A;  1MWK A;  3V1O A;  4L3Q A;  2Z1H A;  3HK2 A;  3LP1 A;  4FCY A;  1BIS A;  3U4L A;  3QIC A;  1WSG A;  2ITG A;  4RTF D;  1V4T A;  3DLE A;  3OS2 A;  2DFF A;  3NFA A;  4CZI A;  3QML A;  4CZL A;  1TVR A;  4M3T A;  1T44 A;  4DS5 A;  4B08 A;  4E7J A;  1BO5 O;  3K2P A;  4FYD A;  3A8Y A;  4J8F A;  3LAM A;  1JL2 A;  1HKB A;  3G4S N;  1QQN A;  3QET A;  4H0P A;  3OYE A;  3ISN C;  5AQK A;  4EZ9 A;  1S9G A;  1C1B A;  2PBD A;  1SV5 A;  4GW6 A;  3QNO A;  4Q0B A;  5BR8 K;  1WSJ A;  2FBX A;  4OPA A;  1BWF O;  4FVU A;  4BR4 A;  4NCB A;  4JK8 A;  1VQ4 N;  1ZBI A;  2VGM A;  3LAN A;  1HLU A;  1SS6 A;  1BHL A;  4FLX A;  3TAE A;  3KLG A;  4FK4 A;  1VRU A;  3PX6 A;  4NXM K;  4F8R A;  3MN6 A;  1LWE A;  2Y1J A;  3NMU A;  4IFV A;  5C25 A;  4HUE A;  4JKG A;  4CF8 A;  3FZM A;  3ZX0 A;  1S1U A;  2LSN A;  3ZEU B;  3OYA A;  1ZXO A;  3AVI A;  1Q9Y A;  1YIJ N;  4FK0 A;  3RTV A;  1N5Y A;  1FW6 A;  3VEN A;  4B9V A;  1XWL A;  4FSV A;  1RTI A;  4E7I A;  3DLG A;  4N76 A;  3SBT A;  4PA1 A;  3WXK A;  4BRN A;  5CHI A;  4MDB A;  5BRD A;  4DTU A;  1TKD A;  1GLE G;  4DSK A;  4H0Y B;  2NRX A;  5CR4 A;  3DOK A;  3IMX A;  4BVP A;  2GWJ A;  5EXW A;  2G8U A;  1G15 A;  4JK9 A;  3SV4 A;  2B5J A;  1EP4 A;  2IGI A;  3MED A;  3EE9 A;  4CGF A;  3MX5 A;  4DR1 K;  2HHV A;  4WFN L;  2KZM A;  4CJV A;  4JI2 K;  1N32 K;  2E6M A;  1NOY A;  4FWO A;  3ZEU A;  4EHT A;  5IWA K;  1NJY A;  3G25 A;  5KGW A;  1YJ9 N;  2WON A;  4CHN A;  1VSK A;  3PSF A;  3QNN A;  3K5O A;  3SZ2 A;  3VQ7 A;  4B1X B;  2O4G A;  1TK0 A;  4PY5 A;  1WUA A;  2QWR A;  2YCH A;  4QS9 A;  3ZSY A;  4C1N I;  1JCE A;  3C95 A;  1BI4 B;  2KFZ A;  2BE2 A;  4RCH A;  2VQE K;  4DFK A;  5C2F A;  4CIG A;  3AV9 A;  1LW2 A;  1L3T A;  4ISE A;  3RR8 A;  5GIP A;  3CJB A;  4H4O A;  2ATQ A;  3B6P A;  2PY5 A;  4GKJ K;  1RT4 A;  2WC9 A;  4C8K A;  1BU6 O;  3AVA A;  4CHY A;  4YOX A;  1SKW A;  1NOZ A;  1JLB A;  4NYF A;  4BG8 A;  1X9M A;  4KI6 A;  3HM9 A;  4I6M B;  3LDP A;  3P39 A;  4JV5 K;  2W42 A;  3PO5 A;  3O3H A;  1YTA A;  5FPM A;  3NBP A;  1U2V B;  2GWK A;  3OYC A;  3QEW A;  3MWT A;  3RMD A;  1EXQ A;  4CJQ A;  2QM1 A;  3UKU B;  4CJ4 A;  3ATU A;  1BI4 A;  3T7Z A;  3OY9 A;  3TU5 A;  3KLF A;  2D0P A;  3KLH A;  2YI1 A;  3J7Y P;  4DV7 K;  4DU3 A;  4HHT A;  3ASM A;  2HBK A;  3AO3 A;  3J81 O;  1P8Z A;  1S1W A;  5KGX A;  4BQL A;  5BPN A;  3THW B;  3H3O B;  3F73 A;  2D0B A;  1HQE A;  1VSI A;  4BWJ A;  1TKT A;  4CFD A;  3L2W A;  2QW9 A;  4F4K A;  3MEC A;  4I6M A;  1KFS A;  1D9D A;  1S9E A;  1TYQ A;  4BWM A;  4Y0W A;  3LM2 A;  1BG3 A;  1U2V A;  4CJF A;  3SMS A;  2KW4 A;  4LH4 A;  1NJX A;  1OH8 A;  3SUN A;  4EZ6 A;  5EU7 A;  3WQT A;  2OPP A;  3UKU A;  3FLC O;  4M45 A;  2Q3S A;  4JKD A;  3EZW A;  4FWR A;  3P4I A;  3AY9 A;  5KPT A;  3AGK A;  4PHT X;  1O13 A;  3KZB A;  2H3G X;  2HNZ A;  2GEL A;  1FK9 A;  4Q5V A;  3TAR A;  5KQD A;  4LF8 K;  4AHU A;  3C6H A;  1OH7 A;  4FLY A;  1UA0 A;  4Z4C A;  3U3G A;  3KK3 A;  1R59 O;  1VQL N;  3K9J A;  3TWH A;  3C7N B;  2P1J A;  4AM6 A;  1SL1 A;  2QWO A;  4KHY A;  4EHU A;  1Q82 O;  3P31 A;  3CCJ N;  1GLB G;  4Y1C A;  5C2D A;  3LP3 A;  4FJ7 A;  4IG0 A;  4BRD A;  2O8D B;  4IBN A;  2E6L A;  3EL2 A;  1HNI A;  3CFP A;  1F21 A;  1K73 O;  1YVU A;  5C42 A;  1DLO A;  4FW1 A;  2Q2R A;  5KPZ A;  4BC3 A;  2F96 A;  1GLF O;  3AVC A;  2HHW A;  4ZTF A;  5C10 A;  4H0V B;  4OKE A;  1HJO A;  5AQP A;  2BUP A;  2HMP A;  3PIP L;  2E8A A;  3T1A A;  3QEP A;  4DQQ A;  3LZJ A;  3G71 N;  3E9O A;  2OZS A;  2HHX A;  1N8R O;  5AQF A;  4Z94 A;  4FZZ A;  3H46 O;  2Q97 A;  1YJN N;  4B9N A;  2HHS A;  4FVM A;  1K9M O;  4FJ8 A;  1RT6 A;  1RBV A;  2ZF5 O;  1EO1 A;  3VTH A;  1NGA A;  2Z1I A;  4DMN A;  1JCG A;  3OYN A;  3DXK B;  4DR7 K;  1S72 N;  3CD6 N;  3V9S A;  1NKC A;  4MLH A;  4PL8 A;  3VOV A;  4WQ5 A;  1WSF A;  2JGU A;  2GUP A;  3EN9 A;  3O1B A;  4E89 A;  4IEI A;  2OZM A;  4C1N K;  1Z6R A;  4CEC A;  4NCA A;  4JKH A;  3CIP A;  3ZT3 A;  1NM1 A;  4OJR A;  3IKM A;  4M3R A;  4B9Q A;  4YY3 K;  4JS5 A;  4FJN A;  1VAZ A;  4DS4 A;  5FRO A;  3VEY A;  3MDQ A;  5LJV A;  2QXL A;  4B1Y B;  5AFU H;  4BE1 A;  2UUC K;  5AQZ A;  5KQ8 A;  2W6L A;  1JL1 A;  1S1T A;  4W5N A;  3FFI A;  4FK2 A;  2P9L B;  3OTO K;  1T05 A;  2P5O A;  5AQJ A;  3V9U A;  4G9Z A;  5E41 A;  3CCE N;  4M3U A;  1ZBU A;  4J2A A;  2PAV A;  5AZJ B;  5SZT A;  1NG9 A;  4JI3 K;  4CED A;  2VG5 A;  4CZG A;  3DXK A;  4FWL A;  4LFA K;  4GMJ B;  5SWM A;  4CJK A;  5LJW A;  1JLG A;  1C0F A;  4OLA A;  3GG4 A;  1CXQ A;  3OBY A;  4OPJ A;  1VQO N;  1RBT A;  1KCF A;  3ZT4 A;  4DCH A;  4KB0 A;  1NGC A;  5C24 A;  4GV6 A;  1SAZ A;  2A1S A;  1HYZ A;  4JI6 K;  4O5F A;  2UXD K;  3CCV N;  3MAQ A;  1Q9X A;  2FBV A;  4FZY A;  4DQR A;  3CME N;  3VQ4 A;  5ADX A;  4CEE A;  5DM6 L;  1CZA N;  5J2Q A;  4JNE A;  4BRM A;  4RG8 A;  4KHW A;  5AZJ A;  2F9W A;  4DTM A;  1BL3 A;  5AQV A;  5DMR A;  2VYP A;  1M90 O;  5D3G A;  3SK3 A;  1JLA A;  5M1Q A;  3U3Y A;  5AQL A;  2D1K A;  4NO7 A;  3KVG A;  3ZT0 A;  3FZK A;  5FRM A;  3CJ7 A;  4WYB A;  1C0U A;  1UWB A;  2X6N A;  2KQ2 A;  1GOC A;  4BE0 A;  4DTJ A;  3IAY A;  3NH1 A;  3RSE B;  4DR3 K;  4DTN A;  2DFH A;  1RCH A;  3IG1 A;  2IC3 A;  3VES A;  4KO0 A;  3M8S A;  3THV A;  1K8K A;  1NGG A;  4B8A B;  3SPY A;  4YOV A;  3WNG A;  2CH6 A;  2XY5 A;  3S3O A;  1CLQ A;  1LW0 A;  4KTZ A;  5KRS A;  4AF1 A;  3FZH A;  3NGY A;  5HRR A;  4JI5 K;  4M7X A;  2VWB A;  4CD3 A;  2OCE A;  3I0S A;  5EX5 A;  3L8B A;  3LPT A;  1ZBF A;  1CXU A;  2E20 A;  1NGF A;  3SQ0 A;  5ELZ A;  4O55 A;  1KAX A;  5AQI A;  1VQ9 N;  2XO7 A;  1X9S A;  1RT1 A;  3L2U A;  1WSE A;  3CCQ N;  1YXQ A;  1IJJ A;  2IVO A;  1VSL A;  5AZI B;  2Z1J A;  3CFO A;  4FJI A;  4H0T B;  3QLH A;  1ASU A;  1NBW A;  1VSH A;  1SKS A;  3CC4 N;  4DV6 K;  3WQU A;  4O8U A;  1ILY A;  3EKS A;  1LOT B;  4EFH A;  5TKW A;  4IOA L;  5DK5 A;  3T3F A;  3ID6 A;  4CGI A;  4N47 A;  3NCI A;  4A2B A;  3NDK A;  1U47 A;  3FZF A;  4GKK K;  3UE5 A;  2YJF A;  3O3G A;  3WEE B;  1IH7 A;  1DEJ A;  4JKA A;  4C8N A;  5HRN A;  2ZQB A;  3KWI A;  4QS8 A;  2JWL A;  4CZH A;  4WQ5 C;  3JAM O;  2WBN A;  4R5P A;  1CZB A;  1T6C A;  1K6Y A;  3O4N A;  3QIP A;  4JKC A;  1OKJ A;  3KKS A;  4JAX A;  4LH5 A;  3V4I A;  5AZI A;  5KI6 A;  4FL9 A;  3VEX A;  4B1W B;  1IBL K;  3KTQ A;  4K41 A;  4PKI A;  4C8L A;  1SL2 A;  3B6O A;  2O8F A;  2RF2 A;  5JLF A;  3NGI A;  4FJX A;  4B3M K;  4MQ3 A;  3SYZ A;  2P51 A;  4FLZ A;  1NJI O;  1DTQ A;  2P9K B;  3M6G A;  4AHS A;  3K5N A;  4IFE A;  1NGD A;  5JS1 A;  3BEX A;  3G10 A;  1WLJ A;  4O8K A;  3T19 A;  1NK0 A;  4WCE L;  3WNE A;  1P90 A;  5AQW A;  3CI5 A;  3LWL A;  3ITH A;  4BRF A;  3MXM A;  1MA9 B;  3BF1 A;  3MN5 A;  4Y1D A;  2NRV A;  3EZ5 A;  3RR7 A;  2NRW A;  1NJZ A;  1VSE A;  4BRQ A;  5BN8 A;  4DV3 K;  1RIL A;  4HTU A;  3LP0 A;  5C15 A;  2NNW A;  1XUP O;  4RW7 A;  1T6D A;  4CGH A;  4EAH D;  5HRP A;  3CF5 L;  4E3S A;  4KHN A;  4BG9 A;  3CC7 N;  3LDO A;  4AHT A;  4W5O A;  1OH6 A;  3OYB A;  1A5W A;  3AVM A;  4BRO A;  3SAF A;  2YKN A;  3LDL A;  2F8T A;  3AVB A;  4GVM A;  2HF4 A;  3BZK A;  1W7A A;  2E2Q A;  2YNI A;  3ZET A;  4DTS A;  4MFB A;  1QZ6 A;  2HBL A;  4CJR A;  4CK3 A;  2WOM A;  2P9P A;  4CIE A;  2WUS A;  1VSM A;  1ZBL A;  1HNV A;  3H1V X;  3U9D A;  2O8B A;  3AGR A;  3VEW A;  3DXM A;  2P9U A;  2Y1I A;  2E2N A;  3R3L A;  4C8M A;  3NE6 A;  4CER A;  3DLK A;  1NKB A;  5JVG L;  3R9P A;  1EWQ A;  4J2B A;  4JKG B;  4DR2 K;  3L2Q A;  3HTV A;  2NLX A;  1W9H A;  1MDU B;  4A62 A;  4CGD A;  4JI4 K;  4LF9 K;  3CM5 A;  4AHC A;  1LAV A;  4ID1 A;  3QEI A;  5FRN A;  4XH5 A;  1J6Z A;  4BRK A;  2GTD A;  3SV3 A;  4ELV A;  2WFB A;  4OLB A;  2WTU A;  1BUP A;  4MLE A;  2UUA K;  4HCC A;  3L6Q A;  3T1Y K;  1KSP A;  2RE2 A;  2Q0R A;  4MO4 A;  1JCF A;  4YOR A;  3A5O C;  2E2O A;  2ZGZ A;  3O3F A;  1HYS A;  1XI1 A;  1QTM A;  4QCL A;  4E7K A;  1MU2 A;  1RDB A;  3D2E A;  4W5Q A;  2EX3 A;  2IVN A;  2QKB A;  3V1R A;  1WAJ A;  3A0I X;  1RTJ A;  1I94 K;  1EX4 A;  1NGB A;  2VGN A;  4HUG A;  4KB1 A;  4CJP A;  3SCX A;  5AQH A;  1IKW A;  2AJQ A;  1T8E A;  1WSH A;  3OYH A;  4PWD A;  2DTU A;  4JI8 K;  3HJF A;  3TSP A;  3LP2 A;  1QS4 A;  4F2R A;  1N36 K;  4OKJ A;  1U4B A;  5F0X A;  2D0O A;  4DR4 K;  3DJC A;  3CXC M;  5HRO A;  5LMU K;  4JI0 K;  3BGR A;  4XH1 A;  2OPQ A;  3ZX2 A;  1WN7 A;  3CCM N;  3EO3 A;  3NVK A;  2OTJ N;  3QIN A;  3NF7 A;  4Z4G A;  4BDZ A;  3OA9 A;  4B9T A;  2NRT A;  2HMI A;  1DGK N;  3CCS N;  1BCM A;  3TAQ A;  3S3N A;  1C0T A;  3N4P A;  3KWG A;  4EP4 A;  1NLV A;  4WQ4 A;  4GV3 A;  4Z4I A;  4DQI A;  1KQS M;  4H4M A;  2F8S A;  3AA4 A;  4FM1 A;  2RKI A;  4AH9 A;  3K5L A;  1KC8 O;  4JK7 A;  3ZSV A;  4X65 K;  1WAF A;  3VA3 A;  1RT5 A;  4O5B A;  3W3D A;  4BE2 A;  4BC2 A;  1NWK A;  3ZSR A;  4JN4 A;  3CFR A;  4M42 A;  3BP8 A;  3AA3 A;  5CZ2 A;  3EYZ A;  4LF7 K;  3D2F A;  1RDU A;  2I7N A;  1RT2 A;  1KFD A;  2NZT A;  2ZE2 A;  1XNQ K;  4J2D A;  4BRP A;  4DR5 K;  2HBM A;  1TAU A;  4A5A A;  2P9N A;  1YVN A;  1GLJ O;  2PFU A;  2HST A;  2QEX N;  4CW7 B;  1J53 A;  4O4G A;  1TYQ B;  2XY6 A;  4CJ7 A;  2IOC A;  2P9S B;  4J2E A;  3O9U A;  3BF3 A;  1ASW A;  3OJU A;  4CGJ A;  3SUP A;  1NGE A;  1LCU A;  1B9F A;  3BY5 A;  1LWF A;  4CF1 A;  3HBT A;  4BR0 A;  3L4I A;  4CJW A;  5HRS A;  3V9Z A;  4FJK A;  3AVJ A;  3LDN A;  1Z05 A;  4LC9 B;  2XRI A;  1YAG A;  1NK4 A;  3MN9 A;  3I0R A;  1RFQ A;  3VQE A;  3M8Q A;  1C1C A;  3VTI A;  1ITG A;  2NRR A;  4FLW A;  2PYL A;  1E4F T;  1TGO A;  3THY A;  3QES A;  2UUB K;  1KXP A;  3VGL A;  3DLB A;  3SJH A;  3U6F A;  3H45 C;  3SAH A;  3HXM A;  1NK6 A;  2E5L K;  2P9S A;  3QIO A;  4DV4 K;  2P5G A;  4BC5 A;  1C0G A;  3K5M A;  3CJA A;  4XH4 A;  1TK8 A;  4CZE A;  3S3M A;  1QZ5 A;  5B8H A;  3LAL A;  1T7P A;  5KPR A;  4DFM A;  3CPW M;  3WXM B;  5AQY A;  3V9W A;  1LWC A;  3EEQ A;  5C12 A;  1YUW A;  1Z25 A;  2R7Y A;  2OTL N;  4CFB A;  5F1X A;  3JYT A;  5AQO A;  3D6R A;  3V1Q A;  5DM7 L;  3UB5 A;  1RTD A;  4EP5 A;  4ZTJ A;  4G1Q A;  4CHQ A;  4N5S A;  3NVM A;  4JKB A;  5JMV A;  3C6A A;  3OS0 A;  4CJU A;  4BRG A;  5EVZ A;  4BGB A;  4ICL A;  1VQK N;  4KAZ A;  5MLC Q;  4MDA A;  2VG6 A;  5HOO A;  4O0I A;  1N6Q A;  4E7L A;  3VQ9 A;  2OA8 A;  3PUF A;  3J8A A;  3IFR A;  3KK2 A;  3IRX A;  1EQY A;  3OYJ A;  1SZ2 A;  5IT9 O;  3I8D A;  2A41 A;  5FDL A;  4RW4 A;  1NK8 A;  4CJT A;  4KH4 A;  2J4R A;  4E7H A;  2IVP A;  3IUC A;  5E26 A;  1BQM A;  3AO2 A;  2PYJ A;  1TK5 A;  3WXI A;  4LF4 K;  3I56 N;  1WSI A;  4WQ4 C;  2DY4 A;  2QXF A;  3AVG A;  3EKU A;  2I7P A;  2YHB A;  2FLO A;  4YHH K;  4CD1 A;  1SKR A;  4BRC A;  2F4V K;  1W97 L;  3OBW A;  3PIO L;  4A61 A;  1EWR A;  4K8X A;  3HT3 A;  1E4G T;  3VA0 A;  1Q7Y O;  5TKY A;  5FPE A;  1VQN N;  3RVC A;  2G8H A;  2W41 A;  3SI6 A;  1EKE A;  3DAW A;  3L3V A;  4Z4H A;  5AQN A;  1J54 A;  4JEP A;  4IOX A;  3VF6 A;  3RRG A;  3CCL N;  4BRL A;  5GIN A;  1DT9 A;  4H5N A;  5FPD A;  2XHB A;  4K0K K;  3HM8 A;  4FLT A;  4LSL A;  3O4Q A;  4UQG A;  2BTF A;  2YV0 X;  1H1V A;  1QSY A;  5CYM A;  2OAN A;  4JKF A;  2HND A;  3DRR A;  5F2R A;  1BIU A;  4KRE A;  3B8A X;  3SQ1 A;  1IV0 A;  3LM9 A;  1HX1 A;  4M41 A;  2UXB K;  2VWJ A;  1U04 A;  4NB4 A;  4JI1 K;  1X9J A;  4DV1 K;  2IAJ A;  2D5R A;  4LY7 A;  4M7Y A;  1GLC G;  5HP1 A;  4CCH A;  2HHQ A;  5M1N A;  4FJL A;  4KKO A;  4I7F A;  4B3O A;  3L0Q A;  4OO1 J;  1XC9 A;  3AVF A;  4B3R K;  1K8K B;  2FF6 A;  1KD1 O;  4H0O A;  3SUQ A;  5FLX O;  4OGC A;  3QBW A;  2AP1 A;  2Q36 A;  3JSM A;  3SAG A;  3CJC A;  4CBX A;  3TPQ A;  3TAG A;  2VWK A;  3ENO A;  3C65 A;  3MCA B;  1Z26 A;  3FR0 A;  4CIF A;  4KTW A;  2A6A A;  5FPN A;  3SPZ A;  1JXB A;  4U67 L;  1RGI A;  2KTQ A;  4H5R A;  3O4W A;  3SJJ A;  3FFK B;  1X1P A;  1ZC6 A;  2E4L A;  2D4W A;  4YOT A;  3RMB A;  4CEF A;  3CJ9 A;  4IEE A;  5HL7 L;  4ELT A;  3O6W A;  2QA4 N;  2O8E A;  1FKP A;  1OVY A;  5C0Y A;  3O9Q A;  1T03 A;  3AO1 A;  5BPM A;  2G8V A;  3PX0 A;  4WFA L;  3VF2 A;  4DF4 A;  1LV5 A;  4FWN A;  3R6M A;  3K0S A;  1N33 K;  3ULE A;  2X74 A;  1TUU A;  4Z4F A;  1J5E K;  1XMO K;  2F7T A;  4E0D A;  3ZSO A;  4K8Z A;  4FM2 A;  4BC4 A;  4KHU A;  3HP6 A;  1W0H A;  1JXE A;  3PV8 A;  4FWP A;  3F9K A;  3CQX A;  4PUO A;  1C0M A;  2UXC K;  3O9R A;  3HSC A;  2CGJ A;  3Q7B A;  5AFU A;  2E1Y A;  3HPG A;  4KHP K;  3GBT A;  3TTC A;  3MK6 A;  2ITM A;  1V4S A;  4CZK A;  4RW9 A;  4FLU A;  3ZSQ A;  3SQ2 A;  1OVQ A;  4Z4E A;  3MN7 A;  4AHV A;  1BDG A;  3BUZ B;  4DLE A;  2O8F B;  2O8C B;  3V81 A;  4DV0 K;  1RDA A;  4DR6 K;  2KFN A;  1HPM A;  3ID8 A;  3M8R A;  4DSE A;  4CJE A;  4O0J A;  3TSU A;  3UKR A;  3QER A;  3QDK A;  4GVE A;  4FZX C;  1RBS A;  3KHY A;  4YOW A;  4CVN E;  2X6S A;  4DB3 A;  2CGL A;  2ZM6 K;  1VQ7 N;  3L3U A;  1ASV A;  4M3X A;  1O1W A;  4NCG A;  2GUI A;  2ZD1 A;  4GY2 B;  2G8W A;  3SQ4 A;  3ZSW A;  1TL1 A;  3DMJ A;  3D7E O;  3F5T A;  4BVO A;  4X66 K;  4WE1 A;  3VQ6 A;  5BR9 A;  3WNF A;  2KLA A;  3VEV A;  1CZ9 A;  3T1H K;  2DPN A;  1ESV A;  4YOU A;  3L2V A;  1LAW A;  3O8M A;  1IBK K;  3WXL A;  4FPB A;  4FO0 A;  1QQO A;  1IKX A;  1YIT N;  2O8C A;  3AAP A;  4DG1 A;  4CE9 A;  3MWP A;  2OYQ A;  3FZL A;  1JLQ A;  3HP9 A;  4ILG B;  2PZS A;  2D0A A;  3LWM A;  1S1V A;  4JHD A;  3MXJ A;  4E19 A;  3KLI A;  3QFP A;  1DKG D;  2ZJQ L;  5GAD P;  4DSI A;  4FJ9 A;  2HNY A;  3LDQ A;  1FJG K;  3HST B;  4KBO A;  4LFC K;  3I55 N;  1NK5 A;  2A3Z A;  1JLE A;  3ZET B;  4DQS A;  1ZYQ A;  2UYT A;  2P9P B;  3EY1 A;  3C94 A;  4H0X B;  4ILH A;  3VQD A;  3E9L A;  3VQA A;  3OYM A;  4LD0 A;  3EE8 A;  4X64 K;  2O8B B;  2BH1 A;  2I5J A;  1ATN A;  3DXM B;  5GAG P;  3E66 A;  2P9U B;  2NRH A;  3UIQ A;  2BGG A;  3HVT A;  3DLH A;  4IWV A;  3HVR A;  4CBU A;  3C0B A;  3VQC A;  5JLH A;  1HNZ K;  4FM0 A;  1RTH A;  4OPH A;  3F2K A;  3PX4 A;  4ISG A;  3H3N O;  1RBR A;  1JLF A;  1TL3 A;  4FJJ A;  3KLE A;  3P83 D;  3Q7C A;  4CHZ A;  1HKG A;  2P9I A;  4CZF A;  1L5U A;  5J2M A;  3AVN A;  3CCR N;  4B9U A;  1YTU A;  4MO5 A;  4XEI A;  1HKC A;  3OYF A;  4KPY A;  2HVI A;  4DSJ A;  2G8I A;  1BCO A;  2YHW A;  2QK9 A;  1Q86 O;  1HNX K;  1R0A A;  4NLC A;  3MXI A;  4B3S K;  2YJE A;  1BGX T;  5J2P A;  4RWT A;  3D2E B;  3NF8 A;  2BDP A;  4JD2 A;  2GEM A;  3W0L A;  3THX A;  2X78 A;  4QOZ B;  3R8E A;  4X62 K;  3DOL A;  1HPZ A;  1L3U A;  3TAP A;  3O9T A;  4ZHR A;  4PL7 A;  5J1E A;  1A5X A;  3QB0 A;  3CMA N;  4JS4 A;  4JKE A;  3IS9 A;  3VMF B;  4CEZ A;  3ALY A;  1NJW A;  3OYL A;  4AIL C;  1HJR A;  4H03 B;  2V52 B;  4C23 A;  1G99 A;  1NGI A;  3AO5 A;  4E1N A;  3O9S A;  4B1Z A;  3LAK A;  3HI0 A;  5M1K A;  3R1X A;  3NAE A;  4IKF A;  3C6U A;  1JJ2 M;  3VEO A;  2HBJ A;  2Q0U A;  3GOI A;  1N34 K;  3N4Q A;  4IG3 A;  1VK0 A;  1GOB A;  3ENB A;  3ZT2 A;  3NGZ A;  4CEQ A;  1NK9 A;  3AVL A;  4JI7 K;  1SQK A;  5LL6 Z;  3KJV A;  4I2P A;  3BZC A;  4LF5 K;  1NGH A;  1D8Y A;  4B1U B;  3NF9 A;  2FSJ A;  5M1O A;  1KAZ A;  1VSF A;  4IDK A;  1HNW K;  2YNG A;  4IFY A;  4N41 A;  5AQX A;  3AO4 A;  3ZCM A;  1ZBH A;  3WT0 A;  3ZSZ A;  1D4X A;  5AQQ A;  3SUO A;  5EOY A;  5AQR A;  3CM6 A;  4A5B A;  4FWQ A;  3LL3 A;  5AQT A;  3P5J A;  2A1R A;  4KTQ A;  4KRF A;  5AQS A;  3S9H A;  3CQ8 A;  1MWM A;  4H8K A;  3TAM A;  4DSL A;  4CFA A;  4BDY A;  4LSN A;  2KKZ A;  2HHH K;  3SBG A;  3D2F B;  1KVC A;  4LF6 K;  2KHO A;  4FW2 A;  4DFP A;  1QSS A;  4E1M A;  2QWP A;  1QSL A;  3OHR A;  4DFJ A;  3QBX A;  5CY4 A;  4CK1 A;  1Y97 A;  2P9N B;  4HWI A;  3JS6 A;  1B92 A;  4CJL A;  3C6T A;  5JIC A;  1ATS A;  1JKH A;  3RRH A;  3J7A P;  2HHU A;  1QE1 A;  3J7Z O;  1D9F A;  1I3A A;  2YNF A;  4HCB A;  2GBZ A;  3PO4 A;  2B4J A;  3LDS A;  1FXX A;  1SL0 A;  5I9E B;  3HOS A;  4NXN K;  2G8F A;  3VQB A;  4DSF A;  4FWM A;  1KAY A;  3NHG A;  4BR7 A;  1TV6 A;  3TR8 A;  3VQP A;  3OW2 M;  1RNH A;  1RT3 A;  4KHQ A;  1YJW N;  3SLC A;  1XC3 A;  1TUY A;  3CET A;  3THY B;  3E1Y A;  4FOI A;  1VQM N;  2QTD A;  4ID5 A;  5BPL A;  3P38 A;  5I3U A;  3CC2 N;  2Z1G A;  3DRP A;  4B3T K;  1NU0 A;  4H5T A;  4BRE A;  4KI4 A;  3L4Q A;  3F9M A;  1VHX A;  3MEE A;  4I2Q A;  3ZT1 A;  4CJS A;  5CE3 A;  5GAH P;  4WF9 L;  1XNR K;  2ZJP L;  3NF6 A;  2XY7 A;  4DTR A;  5GIO A;  3T69 A;  3ZYY X;  4DV5 K;  2YNH A;  1VQ8 N;  4V19 S;  4BRH A;  2DFE A;  3FE1 A;  3WNH A;  1NKE A;  4DF8 A;  3M3Z A;  4YNQ A;  3O80 A;  3ENH A;  3TTF A;  1GOA A;  2YX6 A;  1KTQ A;  3OS1 A;  4DUY K;  3HO1 A;  1U6Z A;  3SNN A;  3LPU A;  4YDU A;  3DI6 A;  5AQM A;  4IDH A;  3ZSX A;  4F3T A;  4DTO A;  3I33 A;  2QWM A;  4F2S A;  2HW3 A;  1WNS A;  4M3Y A;  3K59 A;  4CHO A; 
#chains in the Genus database with same CATH homology
 5C25 A;  4QAG A;  1L3S A;  3KTQ A;  3OJS A;  2IAJ A;  2D5R A;  4LY7 A;  4HUE A;  2GV9 A;  4C8L A;  4CF8 A;  5HP1 A;  3B6O A;  1SL2 A;  4CCH A;  1S1U A;  2HHQ A;  1VRT A;  2RF2 A;  3NGI A;  2LSN A;  4FJX A;  4B9S A;  4CEA A;  4KKO A;  3OYA A;  3AVI A;  4FJL A;  4I7F A;  4MQ3 A;  2VG7 A;  3SYZ A;  4B3O A;  2P51 A;  4ELU A;  4FLZ A;  1Q9Y A;  4W5T A;  3RTV A;  4FK0 A;  4RW6 A;  1XC9 A;  3AVF A;  1DTQ A;  1N5Y A;  1KLM A;  5T7B A;  2OPS A;  1TKZ A;  1XWL A;  3CYM A;  4AHS A;  3K5N A;  4B9V A;  5JS1 A;  3SUQ A;  1RTI A;  4OGC A;  1HRH A;  3JSM A;  4HUF A;  4CF2 A;  4E7I A;  3DLG A;  3CG7 A;  1S5J A;  3G10 A;  4N76 A;  5HBM A;  4PA1 A;  3TAG A;  1B9D A;  1WLJ A;  2VWK A;  2XY8 A;  1Z26 A;  3T19 A;  4CIF A;  1NK0 A;  4DU1 A;  5J2N A;  4KTW A;  4DTU A;  1TKD A;  4DSK A;  3WNE A;  3OYG A;  5CZ1 A;  3SPZ A;  1JXB A;  3DOK A;  3TAN A;  1DTT A;  3KKR A;  2G8U A;  1G15 A;  3LWL A;  3ITH A;  2KTQ A;  4XIU A;  3QEV A;  3MXM A;  3SV4 A;  3SJJ A;  2ETJ A;  2B5J A;  1EP4 A;  2D0C A;  2IGI A;  3MED A;  4Y1D A;  1X1P A;  4CGF A;  3EZ5 A;  3RR7 A;  2HHV A;  1NJZ A;  3D45 A;  2KZM A;  1VSE A;  4CJV A;  3OYI A;  3DYA A;  5KRT A;  2E6M A;  2E4L A;  1NOY A;  4M3Z A;  2O4I A;  1RIL A;  3TAB A;  4HTU A;  3RMB A;  4CEF A;  1VSJ A;  3LP0 A;  4DU4 A;  4ELT A;  1NJY A;  2B6A A;  4RW7 A;  5KGW A;  4CGH A;  1FKP A;  2WON A;  3AA5 X;  1T03 A;  5HRP A;  3AO1 A;  4E3S A;  4CHN A;  2G8V A;  3PX0 A;  1VSK A;  4KHN A;  2HB5 A;  4DF4 A;  3QNN A;  1LV5 A;  3K5O A;  4AHT A;  4W5O A;  3NH2 A;  3SZ2 A;  3OYB A;  1A5W A;  3AVM A;  3VQ7 A;  3BDP A;  4DWI A;  2O4G A;  2X74 A;  2YKN A;  4Z4F A;  1TK0 A;  4W5R A;  4FLV A;  1NK7 A;  2F8T A;  4PY5 A;  3ZSY A;  4DTX A;  3AVB A;  4GVM A;  4E0D A;  1IKY A;  3ZSO A;  4FM2 A;  4K8Z A;  3C95 A;  1BI4 B;  3HP6 A;  1W0H A;  4KHU A;  2KFZ A;  3AVK A;  1JXE A;  4B8C A;  2BE2 A;  2YNI A;  3PV8 A;  4DTS A;  4MFB A;  4DFK A;  3F9K A;  4CJR A;  4CIG A;  4PUO A;  3AV9 A;  1LW2 A;  4CK3 A;  2WOM A;  4CIE A;  1C0M A;  1VSM A;  1L3T A;  5JS2 A;  1ZBL A;  1HNV A;  1RDD A;  3RR8 A;  3ULD A;  3DRS A;  4CJ3 A;  1FKO A;  1IKV A;  4H4O A;  2ATQ A;  5KTQ A;  3B6P A;  4JRQ A;  2PY5 A;  3HPG A;  1RT7 A;  1RT4 A;  4RW8 A;  4C8K A;  2Y1I A;  3NE6 A;  4RW9 A;  4C8M A;  3AVA A;  3DLK A;  4CER A;  4CHY A;  4HVJ A;  3ZSQ A;  4FLU A;  1NKB A;  3SQ2 A;  3OYD A;  1SKW A;  1NOZ A;  4Z4E A;  2NUB A;  1JLB A;  4J2B A;  4NYF A;  4AHV A;  4CK2 A;  3L2Q A;  3K58 A;  3HM9 A;  4DLE A;  1X9M A;  4KI6 A;  1W9H A;  4JRP A;  3V81 A;  1S1X A;  2KFN A;  1RDA A;  2W42 A;  3PO5 A;  4CGD A;  3H08 A;  3O3H A;  1YTA A;  3M8R A;  3NBP A;  4DSE A;  3CM5 A;  4AHC A;  3OYC A;  4CJE A;  4O0J A;  3QEW A;  1LAV A;  4ID1 A;  3QEI A;  4I9Q A;  3QER A;  5FRN A;  3RMD A;  4FZX C;  4DTP A;  1EXQ A;  1RBS A;  4CJQ A;  3SV3 A;  2X6S A;  4ELV A;  4CJ4 A;  1BI4 A;  1ASV A;  3L3U A;  4OLB A;  3OY9 A;  4M3X A;  3KLF A;  4HCC A;  4KV8 A;  1EET A;  1O1W A;  2GUI A;  2ZD1 A;  4NCG A;  3KIO A;  3KLH A;  2G8W A;  1KSP A;  4FJM A;  4DU3 A;  4HHT A;  3SQ4 A;  3ZSW A;  1TL1 A;  3ASM A;  3DMJ A;  4C8O A;  3AO3 A;  5HLF A;  1S1W A;  3O3F A;  4CJ5 A;  1HYS A;  5KGX A;  4FJG A;  1XI1 A;  1QTM A;  4WE1 A;  3VQ6 A;  4E7K A;  2QKK A;  1MU2 A;  3KD5 E;  3WNF A;  1RDB A;  4W5Q A;  4QCL A;  5I42 A;  2EX3 A;  4FJH A;  3F73 A;  1CZ9 A;  2D0B A;  1HQE A;  1VSI A;  4BWJ A;  1TKT A;  4CFD A;  3M8P A;  3V1R A;  4OPK A;  3L2V A;  2QKB A;  3VQQ A;  3L2W A;  1LAW A;  1WAJ A;  3RMC A;  4F4K A;  3MEC A;  1RTJ A;  2FBY A;  1IKX A;  1KFS A;  4DG1 A;  4CE9 A;  1S6Q A;  1EX4 A;  1D9D A;  1S9E A;  4BWM A;  2OPR A;  1UOC A;  4HUG A;  4KB1 A;  2OYQ A;  4CJP A;  3SCX A;  4CJF A;  1JLQ A;  3HP9 A;  2KW4 A;  4FXD A;  4LH4 A;  1NJX A;  1IKW A;  2PZS A;  2AJQ A;  2D0A A;  3LWM A;  3SUN A;  4EZ6 A;  1S1V A;  5EU7 A;  1T8E A;  2KZZ A;  2OPP A;  4DLG A;  4M45 A;  1WSH A;  3MXJ A;  1YT3 A;  4E19 A;  3OYH A;  2Q3S A;  4NYN A;  4PWD A;  2DTU A;  2RN2 A;  3KLI A;  2BAN A;  3HJF A;  3TI0 A;  5K14 A;  1Q8I A;  3D0P A;  3LP2 A;  3TAF A;  1QS4 A;  4F2R A;  4DSI A;  4FJ9 A;  2HNY A;  4OKJ A;  1U4B A;  2HVH A;  3HST B;  3QEX A;  2HNZ A;  1NK5 A;  3OVN A;  1JLE A;  4DQS A;  1ZYQ A;  5HRO A;  1C6V A;  3RWU A;  1FK9 A;  3BGR A;  4Q5V A;  1I39 A;  3TAR A;  2OPQ A;  4AHU A;  1WN7 A;  3EY1 A;  1HYV A;  3C94 A;  4FLY A;  3QIN A;  3V6D A;  3NF7 A;  3VQD A;  1UA0 A;  3VQA A;  3OYM A;  4Z4C A;  4LD0 A;  3U3G A;  3KK3 A;  2I5J A;  1D5A A;  4Z4G A;  3P1G A;  4BDZ A;  3TWH A;  4B9T A;  1IG9 A;  2P1J A;  3L2R A;  3UIQ A;  1SL1 A;  2BGG A;  1JLC A;  3MEG A;  2HMI A;  4KHY A;  3HVT A;  3DLH A;  3HVR A;  3HPO A;  3VQC A;  1BCM A;  3TAQ A;  3S3N A;  1C0T A;  4FM0 A;  3HL8 A;  4EP4 A;  1RTH A;  3V9X A;  4Z0U A;  3PX4 A;  4Y1C A;  1L3V A;  1RBR A;  1JLF A;  3LP3 A;  1TL3 A;  3NH0 A;  4FJ7 A;  4DQI A;  4FJJ A;  4Z4I A;  3KLE A;  4IG0 A;  1RDC A;  1S6P A;  4H4M A;  2F8S A;  3P83 D;  4IBN A;  4CHZ A;  3AA4 A;  2E6L A;  4FM1 A;  1L5U A;  2RKI A;  4AH9 A;  5J2M A;  3K5L A;  3AVN A;  1HNI A;  3CFP A;  1KVB A;  1F21 A;  3ZSV A;  3VA3 A;  1WAF A;  1YVU A;  4B9U A;  1YTU A;  1RT5 A;  5C42 A;  3OYF A;  4O5B A;  4KPY A;  2HVI A;  4DSJ A;  2G8I A;  1BCO A;  1DLO A;  4FW1 A;  4BE2 A;  2QK9 A;  3ZSR A;  2F96 A;  2HHW A;  3AVC A;  4BAC A;  1R0A A;  4ZTF A;  3CFR A;  4OKE A;  4M42 A;  5CZ2 A;  2YKM A;  3AA3 A;  4F3O A;  3EYZ A;  3MXI A;  1BGX T;  4DQP A;  1KLN A;  5J2P A;  4CF0 A;  1RT2 A;  1KVA A;  2HHT A;  3NF8 A;  3T1A A;  4CHP A;  3QEP A;  2BDP A;  3OYK A;  1KFD A;  3LZJ A;  4DQQ A;  2OZS A;  2ZE2 A;  2HHX A;  3KK1 A;  4J2D A;  1HQU A;  4CEO A;  4FZZ A;  2X78 A;  4BDP A;  4QOZ B;  1TAU A;  1TKX A;  3DOL A;  4B9N A;  1HPZ A;  3DM2 A;  2HHS A;  4FVM A;  1KRP A;  1L3U A;  1RT6 A;  4FJ8 A;  1J53 A;  4O4G A;  1RBV A;  4CEB A;  4ZHR A;  3TAP A;  5J1E A;  1A5X A;  2Z1I A;  2XY6 A;  4N56 A;  4DMN A;  3OYN A;  3V9S A;  2IOC A;  4JS4 A;  1NKC A;  3IS9 A;  4O44 A;  4J2E A;  4CEZ A;  1VSD A;  1ASW A;  3OJU A;  3ALY A;  4CGJ A;  3SUP A;  1WSF A;  1NJW A;  1B9F A;  1X9W A;  1LWF A;  3OYL A;  2JGU A;  4AIL C;  1HJR A;  4OKK A;  1UAX A;  4E89 A;  4CF1 A;  2OZM A;  4NCA A;  4CEC A;  4CJW A;  4CF9 A;  3AO5 A;  3VQ8 A;  4E1N A;  5HRS A;  1HMV A;  3ZT3 A;  4OJR A;  4M3R A;  4JS5 A;  3LAK A;  3V9Z A;  4FJN A;  4FJK A;  2FBT A;  3AVJ A;  4DS4 A;  5FRO A;  3NAE A;  4IKF A;  3C6U A;  4BE1 A;  2XRI A;  1NK4 A;  3A2F A;  3I0R A;  1JL1 A;  1S1T A;  3K57 A;  3FFI A;  4FK2 A;  4W5N A;  4IG3 A;  1VK0 A;  4OVL A;  1T05 A;  2P5O A;  3VQE A;  1GOB A;  3M8Q A;  1C1C A;  3KD1 E;  1ITG A;  3V9U A;  4FLW A;  3VN5 A;  5E41 A;  3ZT2 A;  1J5O A;  2PYL A;  4M3U A;  3NGZ A;  1BQN A;  4CEQ A;  1TGO A;  1ZBU A;  3AVL A;  1NK9 A;  4J2A A;  1BIZ A;  5SZT A;  3QES A;  4CED A;  3KJV A;  2EHG A;  4I2P A;  2JLE A;  2VG5 A;  3DLB A;  3U6F A;  1D8Y A;  4GMJ B;  3NF9 A;  5SWM A;  3HXM A;  1U45 A;  1NK6 A;  1VSF A;  3QIO A;  4CJK A;  4IDK A;  4KFB A;  2YNG A;  1JLG A;  4IFY A;  2P5G A;  4OLA A;  3K5M A;  4M3W A;  4N41 A;  1TK8 A;  1CXQ A;  5CYQ A;  4B9M A;  3AO4 A;  4I9L A;  3ZCM A;  4OPJ A;  1ZBH A;  1RBT A;  1KCF A;  3ZT4 A;  3S3M A;  4JLH A;  3ZSZ A;  4KB0 A;  3LAL A;  5C24 A;  3SUO A;  3VQ5 A;  1T7P A;  2FC0 A;  3CM6 A;  2A1R A;  4KTQ A;  4CES A;  3P5J A;  4DFM A;  2A1S A;  4KRF A;  2G8K A;  1HYZ A;  3QO9 A;  3V9W A;  1IO2 A;  3S9H A;  3CQ8 A;  1LWC A;  3MAQ A;  4H8K A;  3DLR A;  3TAM A;  4PQU A;  4DSL A;  1Z25 A;  2FBV A;  4CFA A;  2R7Y A;  4DQR A;  4BDY A;  1SUQ A;  4CFB A;  1Q9X A;  3VQ4 A;  4CFC A;  4LSN A;  3JYT A;  4CEE A;  1U49 A;  2IS3 A;  4KHS A;  3V1Q A;  1KVC A;  3HPH A;  3HYF A;  5J2Q A;  1RBU A;  1RTD A;  4EP5 A;  4FW2 A;  3LZI A;  4G1Q A;  4ZTJ A;  4CHQ A;  4DFP A;  1C1A A;  4RG8 A;  4CGG A;  4N5S A;  4DTM A;  4KHW A;  1BL3 A;  1QQC A;  1QSS A;  3AA2 A;  5DMR A;  3E01 A;  4E1M A;  3OS0 A;  4CJU A;  1QSL A;  4DFJ A;  5D3G A;  3RMA A;  5CY4 A;  4CK1 A;  4OGE A;  1JLA A;  1Y97 A;  3AVH A;  4B9L A;  4FZY A;  4ICL A;  3U3Y A;  4L8R B;  1B92 A;  1XHX A;  4CJL A;  3C6T A;  4YFU A;  1U48 A;  4KAZ A;  2VG6 A;  1QHT A;  4AHR A;  4O0I A;  3ZT0 A;  1J9A A;  1N6Q A;  1JKH A;  4E7L A;  3RRH A;  5FRM A;  1REV A;  3VQ9 A;  2OA8 A;  1C0U A;  1UWB A;  2X6N A;  2KQ2 A;  2HHU A;  1QE1 A;  1GOC A;  1D9F A;  1I3A A;  3PUF A;  3KK2 A;  2YNF A;  4BE0 A;  1TAQ A;  3IRX A;  4DTJ A;  4FJ5 A;  4HCB A;  3IAY A;  3OYJ A;  3G0Z A;  2GBZ A;  4TSX A;  3NH1 A;  3PO4 A;  2B4J A;  2YHA A;  3I8D A;  2IDO A;  4DTN A;  1XHZ A;  2DFH A;  1RCH A;  3PY8 A;  3IG1 A;  5FDL A;  3LDS A;  2RPI A;  1FXX A;  2IC3 A;  4RW4 A;  1NK8 A;  1SL0 A;  3M8S A;  4KO0 A;  4CJT A;  3THV A;  1UA1 A;  4B8A B;  4E7H A;  1A5V A;  3SPY A;  3V1O A;  3WNG A;  2G8F A;  2Z1H A;  3VQB A;  4DSF A;  1BQM A;  3AO2 A;  2XY5 A;  3S3O A;  3HK2 A;  3LP1 A;  4FCY A;  2PYJ A;  1CLQ A;  1BIS A;  1LW0 A;  3NHG A;  4KTZ A;  1TK5 A;  5KRS A;  1TV6 A;  3TR8 A;  3NGY A;  1WSI A;  1WSG A;  5HRR A;  2DY4 A;  2QXF A;  3VQP A;  2ITG A;  3AVG A;  1RNH A;  1RT3 A;  2YHB A;  4KHQ A;  3DLE A;  3I0S A;  3L8B A;  3LPT A;  3OS2 A;  1ZBF A;  2DFF A;  3NFA A;  1CXU A;  3SQ0 A;  1SKR A;  4O55 A;  4ID5 A;  1TVR A;  2XO7 A;  1X9S A;  4M3T A;  1RT1 A;  3L2U A;  5I3U A;  1WSE A;  4DS5 A;  4B08 A;  2Z1G A;  4E7J A;  3DRP A;  3K2P A;  4FYD A;  1VSL A;  3LAM A;  2Z1J A;  3CFO A;  4KI4 A;  4K8X A;  4FJI A;  3HT3 A;  1JL2 A;  3VA0 A;  3QLH A;  1ASU A;  3MEE A;  4I2Q A;  3ZT1 A;  1VSH A;  3QET A;  1SKS A;  4CJS A;  2G8H A;  3SI6 A;  1EKE A;  3OYE A;  3L3V A;  3ISN C;  4Z4H A;  1J54 A;  3NF6 A;  3RRG A;  2XY7 A;  4DTR A;  4EZ9 A;  1S9G A;  2YNH A;  5DK5 A;  1C1B A;  3T3F A;  2XHB A;  1SV5 A;  2DFE A;  3WNH A;  4GW6 A;  4FLT A;  3QNO A;  4CGI A;  4N47 A;  4DF8 A;  1NKE A;  4Q0B A;  1WSJ A;  4YNQ A;  4LSL A;  2FBX A;  3O4Q A;  4UQG A;  3NDK A;  3NCI A;  1U47 A;  2YV0 X;  3O3G A;  1IH7 A;  4NCB A;  4C8N A;  1GOA A;  2ZQB A;  1KTQ A;  5HRN A;  5CYM A;  3OS1 A;  1QSY A;  1ZBI A;  3HO1 A;  3LAN A;  2HND A;  3SNN A;  4R5P A;  3DRR A;  3LPU A;  1BIU A;  1CZB A;  1BHL A;  4KRE A;  1K6Y A;  3DI6 A;  4FLX A;  3TAE A;  3KLG A;  3O4N A;  3SQ1 A;  3ZSX A;  4FK4 A;  4DTO A;  3QIP A;  4F3T A;  1VRU A;  3PX6 A;  4F2S A;  4M41 A;  2HW3 A;  4F8R A;  2VWJ A;  3KKS A;  1WNS A;  4LH5 A;  1LWE A;  4M3Y A;  3V4I A;  1U04 A;  4CHO A;  3K59 A;  2Y1J A;  4IFV A;  5KI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...