3NFAA

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nfaA00
1RBVA 4MQ3A 4PY5A 3AVBA 1JL2A 4J2AA 3QEIA 3SNNA 3HM9A 4J2BA 2FBTA 3DRRA 4OVLA 3ZT3A 5SZTA 4YNQA 4FK0A 3TI0A 2OPSA 1ASVA 2D0AA 2ZQBA 4O55A 4AHSA 4DLEA 3DLGA 1BI4B 4M3TA 4NCGA 1VSDA 4WE1A 5K14A 4CJLA 3LWLA 4FM1A 1XHZA 3ZT1A 2G8VA 4C8OA 2BGGA 2HW3A 1EP4A 3LZJA 4E7KA 4LH5A 1TL3A 3HPOA 4M41A 2HMIA 3IG1A 2AJQA 3V9WA 4B9NA 4Z4IA 4FVMA 3M8SA 1S1WA 3U3YA 3KTQA 4DQPA 2G8IA 4DTNA 1C0TA 4KI6A 3V1OA 4CJKA 4OPKA 2VWKA 3TAFA 2FBVA 2P5OA 1TV6A 3DLKA 4KO0A 1BQNA 4W5TA 1ASWA 3CG7A 3MECA 1RT7A 4KTQA 4B9LA 1TAQA 4O4GA 3SQ4A 5KI6A 3OYHA 2JLEA 2X6NA 3F73A 4O5BA 1NK8A 4FJHA 3K2PA 3DRSA 3L3VA 1QSYA 5CY4A 3SYZA 4FJGA 3ZCMA 1LV5A 1HJRA 4KHUA 1RTDA 1WSIA 3HXMA 1VSKA 5HRSA 1U47A 4OGCA 1SL0A 2VG5A 3DLRA 1IH7A 3A2FA 1Z26A 3QERA 4KAZA 4RW8A 4ELVA 1R0AA 2KZMA 3KLFA 4HCBA 1DTTA 4C8NA 3RMAA 4OJRA 4B9TA 1RT2A 1UAXA 4KTZA 4AHRA 4N41A 5J1EA 3RR7A 1S1XA 2YHBA 3HP6A 4NYNA 4CJEA 4I9QA 4CFAA 1ITGA 1RTJA 1A5XA 3O3GA 2JGUA 5J2QA 5CYMA 2XY8A 3L2QA 3AVCA 4B9MA 3K58A 2KZZA 1L5UA 1RTHA 4DG1A 3AVAA 4CIGA 1NK6A 2HHQA 4CECA 4NCAA 4CEFA 5SWMA 3OYGA 3B6OA 4DFMA 1NK9A 3EY1A 4PQUA 3OS1A 3HPGA 4HTUA 3TAQA 1WSJA 4CHOA 1NOYA 4QAGA 1HNVA 1L3VA 2F96A 3MXJA 3CFPA 2YKMA 3L2RA 4CJRA 3VA0A 3QEWA 4M42A 4ZHRA 4E7LA 4DTRA 1QTMA 4F3TA 2PZSA 2G8WA 3LWMA 1S1VA 3ZSZA 4CF9A 4FM0A 4JLHA 1KVCA 4DU4A 1QE1A 1S9EA 1TGOA 4CJFA 4E7JA 4ELTA 3NF6A 3SI6A 2O4IA 3DLBA 3MXMA 3RTVA 3ISNC 1D8YA 2FBYA 2P1JA 1GOCA 4OPJA 2GBZA 2XY6A 2KFNA 2Q3SA 4CEOA 2HNZA 5CZ1A 4CF0A 1A5VA 4YFUA 1VSFA 2XHBA 3QIPA 4CFDA 4DSJA 3V81A 1RT5A 1X9SA 1RCHA 4I9LA 4DTOA 3K5NA 4EZ6A 4IG3A 1MU2A 4CHYA 4OKKA 4W5QA 3SPZA 4CF8A 4Z4EA 3L3UA 1J54A 4KHNA 4OKJA 1UOCA 4E89A 4FLXA 4E7IA 2HNYA 4B9SA 3HL8A 3RRGA 3AVIA 5EU7A 1QSLA 1WSHA 3KD5E 4QCLA 3VQPA 4DMNA 4Z4CA 4UQGA 4LH4A 3K57A 1CZBA 4PWDA 2Y1IA 4DQIA 4M3ZA 2LSNA 4B08A 2FBXA 4DTJA 1RBSA 3OYNA 4DTPA 3OYCA 4KKOA 4W5OA 3CM5A 4DF8A 3TAEA 1NKEA 3RR8A 4QOZB 4DTSA 4AHUA 3MEDA 1T05A 3SZ2A 3O3FA 3PX0A 1D5AA 5J2PA 4CFBA 2XY7A 4F2RA 2DFFA 3OS0A 3SUNA 3D0PA 2HHSA 4FXDA 4B9UA 1EX4A 1JXBA 5CYQA 3VQDA 2IS3A 4RW4A 4DF4A 1UA0A 4B3OA 5I42A 3PUFA 3UIQA 3DOKA 1RDCA 3T1AA 4KREA 4DQSA 3VQQA 2E6MA 2NUBA 3HPHA 1EXQA 1KVBA 1BGXT 1WSFA 3DRPA 3MEGA 4RW7A 3TAPA 4RW9A 4ID5A 2E4LA 3V4IA 4KI4A 3SQ0A 3KIOA 1YT3A 4KHSA 5HRRA 1XI1A 5CZ2A 1NJXA 3ITHA 4DSFA 1U4BA 2X74A 4CEBA 1SL1A 3OY9A 1C1AA 4FZZA 3CQ8A 3PO4A 4CEAA 3V9UA 3AA2A 4L8RB 3AVHA 3RMBA 2DY4A 4IFYA 4Q0BA 1C0MA 1RDBA 3VQ9A 3WNFA 4KB1A 3EZ5A 4JS4A 3V6DA 1LW0A 2YNGA 5E41A 4LSNA 4BE0A 2Y1JA 4Q5VA 4KV8A 3S3MA 2PY5A 3HP9A 3VQ6A 3KJVA 2HHXA 1S5JA 3DMJA 3QINA 3THVA 4FK4A 4FLTA 2PYJA 3K59A 4E1NA 1A5WA 2ITGA 4FLUA 1BIZA 3HVTA 1RT3A 3KKRA 3NBPA 3AVNA 4E0DA 5C42A 4KB0A 3VN5A 4CGIA 3ZT0A 4CJPA 1XHXA 4CEDA 2HVHA 2IGIA 1JXEA 1BCMA 4CERA 3OYDA 3KK3A 1NJYA 1RTIA 3M8RA 1I3AA 1W0HA 2D0CA 1NK5A 4FK2A 2DFEA 1L3SA 4Z0UA 4HUGA 4C8LA 4B8AB 2HNDA 1RBUA 1T8EA 4E19A 3JYTA 2EHGA 2RN2A 4CIFA 3AV9A 3O3HA 3DLEA 3V9SA 4FJJA 4FLWA 4M3YA 3AO4A 3HVRA 1B9DA 3LDSA 3LP1A 3NDKA 4H4MA 1HMVA 4CIEA 2HHUA 3ASMA 3ZSVA 2GUIA 4CEZA 5DK5A 3VQBA 3QEVA 4B8CA 4Z4HA 1VSIA 1QSSA 4ZTFA 1RT4A 4CJ4A 4HCCA 1KLMA 3TR8A 4DTMA 1NK4A 2BE2A 1BHLA 1REVA 1NJZA 4H8KA 1BIUA 3HK2A 1UA1A 5C24A 2IOCA 3ZT4A 1L3UA 1IO2A 1J5OA 3KK1A 1TAUA 3QEXA 4JS5A 3QIOA 4XIUA 4DSEA 3C6TA 1RDAA 4KHQA 4LY7A 3L2UA 4IBNA 4CF2A 2O4GA 1IKXA 5HRPA 2QKKA 2ETJA 2OZSA 3IRXA 1SKRA 4M3UA 3AA5X 4FJ9A 4FYDA 3VQ4A 1NKCA 1BISA 3NHGA 4H4OA 1D9DA 1J53A 3AVKA 1ZBUA 1JL1A 4CHPA 5I3UA 3LAKA 4KHWA 3FFIA 4FW1A 3VQCA 3LP3A 1SUQA 4KFBA 3NH0A 2OPPA 2WONA 3LANA 3OVNA 3ULDA 3PX6A 4AHCA 1HNIA 1NKBA 4CK3A 1CXUA 4JRPA 4FM2A 5HROA 4FJMA 3K5OA 2VG7A 3V9ZA 1GOAA 4GW6A 4KTWA 3LAMA 4W5RA 4AH9A 1VSJA 1ZBHA 5KGXA 4FJKA 3VQ5A 3SJJA 2YNHA 1TKXA 1JLQA 2GV9A 2VG6A 3NF7A 4CGDA 3S3NA 3DLHA 3QESA 3CYMA 4DFJA 4RG8A 3ZSOA 4EP5A 3RRHA 3RMCA 1X9MA 1C6VA 3D45A 3PO5A 1S9GA 1SL2A 4BWJA 1JLBA 4OKEA 3LZIA 4F4KA 4KHYA 2RF2A 1HYSA 4O0JA 4DQRA 3HSTB 4BWMA 4FJ5A 2QXFA 3VQEA 3KK2A 1HYZA 2Z1HA 4DU1A 3TARA 3AA4A 1QHTA 3OYKA 3L8BA 3VQ7A 3PY8A 4HUEA 3SQ2A 1RDDA 4J2EA 1CXQA 2YNIA 3ZSQA 4CGHA 1HRHA 3SUPA 3PV8A 4DS5A 4PUOA 4CK2A 1O1WA 4CJUA 4BDZA 3EYZA 3T3FA 3KKSA 2HHTA 4CJ5A 5JS1A 3OYFA 5FROA 3OYIA 1IKYA 1X1PA 1ZBFA 2RPIA 4JRQA 2DTUA 1VK0A 3KLEA 4EP4A 3ZT2A 5DMRA 2OZMA 3G10A 3NF8A 4R5PA 4FJ7A 4M3WA 2ATQA 4DS4A 1K6YA 2G8UA 4DSLA 3TAGA 5D3GA 4G1QA 3NE6A 4CESA 1T03A 3DYAA 3LP2A 2X6SA 3SV4A 1C0UA 5HLFA 1HPZA 2HVIA 2F8SA 1CLQA 1SKSA 3KD1E 1LW2A 1QQCA 3U6FA 3NH1A 2HB5A 2BANA 4LD0A 1EETA 4E1MA 4TSXA 1RT6A 2D0BA 3HT3A 1JKHA 4M3RA 1NJWA 2HHVA 1WAJA 4DU3A 1S1UA 2XRIA 4CF1A 1ZBIA 1RT1A 4HVJA 1S1TA 1Q9YA 1KRPA 1BQMA 4KRFA 2YV0X 3DM2A 3BDPA 1BI4A 3TANA 1IKWA 3AVJA 4GVMA 1U45A 4CHQA 3AVLA 3DI6A 2XO7A 4Y1DA 4F2SA 1BL3A 3SQ1A 1WSEA 3LPUA 1Z25A 2P51A 4BACA 4FLVA 4DSKA 3VA3A 3L2VA 4FLYA 2KW4A 3M8QA 1KVAA 4O44A 4CGJA 4RW6A 4IFVA 2D5RA 3NGIA 4CEQA 3P1GA 3OYBA 1U49A 2I5JA 2P5GA 2OPQA 3NGYA 2X78A 3P83D 2WOMA 3VQAA 2VWJA 2E6LA 1TK5A 1GOBA 1YVUA 3WNEA 3NCIA 5HP1A 3IAYA 1TKZA 1IG9A 4FCYA 3V1QA 2B4JA 3VQ8A 3V9XA 4DFPA 1HQUA 4CK1A 4NCBA 1Q9XA 2YKNA 3QETA 4MFBA 4CEEA 1U48A 1QS4A 1WLJA 3LALA 4ID1A 4FJLA 1DLOA 2KQ2A 3M8PA 4CJSA 3NH2A 1VSLA 1WN7A 3OYEA 4Z4GA 1JLAA 3NFAA 4CHZA 4N56A 4I2QA 2IC3A 1L3TA 4IDKA 2YHAA 2B5JA 1C1BA 4C8MA 3H08A 4AHTA 1TKTA 4CCHA 3LPTA 1KTQA 2QK9A 1YTUA 4ZTJA 4EZ9A 1D9FA 1TK0A 4HUFA 4I7FA 1LWCA 3K5MA 3NAEA 2XY5A 5FRNA 1WAFA 4LSLA 1KCFA 3JSMA 4HHTA 1UWBA 4KPYA 1XC9A 3P5JA 4M3XA 4CGFA 1ASUA 1I39A 3ZSYA 1LWEA 1BCOA 1KFDA 2DFHA 1B92A 1VSEA 3AO3A 3OJSA 1C1CA 5FDLA 3ZSWA 2W42A 3WNGA 3I0SA 3O4QA 4CFCA 3SUOA 4BDPA 1CZ9A 2OYQA 4DWIA 4ELUA 4I2PA 2Z1GA 4CJWA 3NGZA 3SCXA 1TKDA 5KRSA 3QNNA 3NF9A 3ZSXA 4BE1A 3QEPA 3KLGA 2G8HA 3ZSRA 5KTQA 4DLGA 1U04A 3C6UA 3LP0A 4GMJB 3SPYA 3S3OA 5T7BA 1Y97A 3BGRA 3OYJA 1F21A 3QO9A 2IDOA 5C25A 3OJUA 3WNHA 4DFKA 1W9HA 2EX3A 2YNFA 3AA3A 5J2MA 1DTQA 3O4NA 3SUQA 3E01A 1VRTA 3KLIA 2OPRA 1J9AA 2ZD1A 4W5NA 4E3SA 1KFSA 3AVMA 3DOLA 3RMDA 1JLCA 4FLZA 4ICLA 1B9FA 4FJ8A 3AVGA 1JLGA 2PYLA 1TK8A 3T19A 4BDYA 1TL1A 1XWLA 2OA8A 3L2WA 1NK0A 4F3OA 1WNSA 4NYFA 4Y1CA 3HJFA 3V1RA 4FW2A 4K8ZA 2G8FA 4N76A 5KRTA 4FZXC 4FJNA 1RILA 3CM6A 3AO1A 3I0RA 1LWFA 1NOZA 4BE2A 4AHVA 3QNOA 3HYFA 1IKVA 3OYLA 3S9HA 1N5YA 4DSIA 4CJQA 3MXIA 1RBTA 1FXXA 4N47A 4DQQA 3MEEA 2A1RA 3K5LA 3ALYA 1G15A 2BDPA 4OLBA 1KSPA 1RBRA 2FC0A 1RNHA 4CE9A 4CJTA 5JS2A 1T7PA 4FJIA 4N5SA 1JLEA 3OYAA 3G0ZA 1ZBLA 4IKFA 2R7YA 4K8XA 4OLAA 3PX4A 2Z1JA 3TABA 2ZE2A 4O0IA 5J2NA 1S6PA 1FK9A 3OS2A 3U3GA 1FKPA 5HBMA 1Q8IA 3IS9A 1VSHA 5HRNA 3I8DA 4FJXA 1N6QA 4DTXA 1NK7A 3RWUA 1SV5A 1VRUA 1SKWA 5FRMA 4B9VA 5KGWA 2KTQA 3AO5A 1YTAA 3QLHA 3CFRA 4FZYA 1VSMA 2A1SA 1WSGA 3F9KA 3TAMA 3MAQA 4AILC 2G8KA 4CHNA 3CFOA 4CGGA 3OYMA 1LAWA 2F8TA 4C8KA 4CJVA 1KLNA 1EKEA 1ZYQA 3AO2A 3KLHA 3TWHA 2Z1IA 4E7HA 4J2DA 2QKBA 2B6AA 1JLFA 1S6QA 2RKIA 3B6PA 4DTUA 4Z4FA 3C94A 3SV3A 1LAVA 4F8RA 1FKOA 4IG0A 1HQEA 4M45A 3HO1A 3C95A 2KFZA 1HYVA 2IAJA 4CJ3A 4PA1A 1X9WA 3AVFA 2HHWA 1TVRA 4OGEA
chains in the Genus database with same CATH superfamily
1XC3A 3AVBA 3QEIA 3HM9A 1R59O 3DRRA 4I6MB 5SZTA 4FK0A 2OPSA 4NLBA 4KBOA 4O5FA 5EY4A 2HHWA 3LWLA 3T1HK 2P9PB 4RTFD 1TL3A 3HPOA 4Z4IA 1S1WA 3U3YA 4DTNA 3CJBA 4B3MK 4CZEA 3T7ZA 4OPKA 2VWKA 2FBVA 1TV6A 1ESVA 3CQXA 2FLOA 3D2EA 4YHHK 3HOTA 3CG7A 2A41A 3MECA 4B9LA 1TAQA 3SQ4A 3OYHA 1V4TA 2JLEA 3F73A 3KHYA 4JI8K 3L3VA 5FLXO 3SYZA 3TTDA 1HPMA 1HJRA 1K8AO 3HXMA 1Q86O 5HRSA 1U47A 4MO5A 4CZJA 3A2FA 3QERA 4KAZA 4RW8A 2F7TA 2KZMA 5BN8A 3HZ6A 1DTTA 4B9TA 1UAXA 2NLXA 4N41A 3RR7A 4CJEA 1NBWA 3R3LA 3O3GA 4BC2A 5J2QA 1HKCA 5HL7L 4B9MA 3K58A 2Q1NA 2KZZA 4CZGA 3CCEN 2V51B 1NK9A 3EY1A 4PQUA 3HPGA 1ATSA 1NGFA 3LDQA 3EKUA 4QAGA 4OX9K 2YKMA 3QEWA 4CJRA 2CGKA 1BDGA 4DTRA 1XNRK 4YOWA 2G8WA 4FM0A 1KVCA 2Q31A 1S9EA 4BR0A 4A57A 5M1FA 4ELTA 4X62K 5LMUK 2KKZA 3MXMA 1ILYA 2XY6A 4CBXA 1TUYA 3Q7CA 2HNZA 5CZ1A 4YFUA 1YVNA 4CFDA 1RCHA 4DTOA 3D7EO 4IG3A 1MU2A 4OKKA 4JYAK 3L3UA 1UOCA 1N32K 1TYQB 4BC3A 4E7IA 4WQ5C 3AVIA 1QSLA 4H03B 3CCVN 2H3GX 4LH4A 4PWDA 2Y1IA 4M3ZA 3FR0A 4R79A 1ZXOA 2FBXA 4LFBK 1RBSA 4WYBA 3OYNA 2UXCK 3ZEUB 3UKRB 5LY3A 1O13A 2PAVA 3A0IX 3SZ2A 3O3FA 4CFBA 1NGGA 1NGBA 3A5OC 3RVCA 3UB5A 2HHSA 4FXDA 2NRHA 3O9TA 4RW4A 3CD6N 3THYA 1FJGK 1XMQK 1E4GT 1RDCA 3T1AA 4KREA 3THXA 4UY8O 2E6MA 3HPHA 1KVBA 1WSFA 1BGXT 1D4XA 4RW7A 4RW9A 2E4LA 3V4IA 3TSQA 4KHSA 2Q0RA 2P9LB 4K0KK 4FOIA 4CEBA 4CZLA 4FZZA 2JWLA 3CQ8A 3AA2A 5LJVA 3AVHA 4M7XA 3VGKA 2DY4A 1C0MA 3IMXA 1NMDA 4H0PA 4LSNA 4BE0A 2Y1JA 4KV8A 4GV3A 3HP9A 4V19S 3KJVA 2HHXA 3DMJA 3VTHA 2A5XA 3K59A 3HVTA 1RT3A 4E0DA 5C42A 4IOCL 3CCUN 3PLAA 4CERA 3M8RA 1W0HA 1Q18A 1BA1A 2DFEA 1L3SA 4C8LA 1RBUA 4NLCA 4FJJA 3JS6A 4FLWA 3LP1A 4FWMA 2YHXA 3O5BA 4CEZA 1HKBA 3QEVA 5TKYA 4BREA 1VSIA 4Z4HA 1QSSA 5GAHP 4DTMA 1NK4A 1BHLA 5C12A 1BIUA 3F5TA 1OH8A 1IO2A 3KK1A 1TAUA 3LM2A 5AQLA 5BRHA 3N4QA 4FJ9A 4FYDA 4YDUC 4H4OA 5MLCQ 1J53A 1ZBUA 1JL1A 5IWAK 1IBMK 3LP3A 2QWPA 2OPPA 3PX6A 2E8AA 4CK3A 1VAZA 4BG8A 5KPTA 4FM2A 2GUPA 5HROA 4FJMA 3PSFA 5CHIA 1GOAA 1I94K 2O8BB 3ID8A 5EOYA 1TKXA 1JLQA 2GV9A 3NF7A 2FF3B 3O9UA 3QESA 4EP5A 3P38A 4K41A 1C6VA 1SL2A 3LZIA 2RF2A 1VQ9N 1HYSA 3HSTB 3R1XA 2BUPA 2P9SA 4FJ5A 3MWTA 2Z1HA 3OYKA 2NNWA 2IVNA 3WQUA 3SQ2A 3CC4N 1E3MA 1CXQA 4PUOA 4JKFA 5FROA 3SBTA 4EHUA 4JRQA 3LM9A 2OZMA 3NF8A 5IT9O 1KQSM 5AZIA 4J8FA 4JV5K 5ADXA 1RFQA 5H1SQ 3VEXA 3O9QA 5ADXH 3MX5A 1C0UA 4JI2K 1HPZA 1SKSA 1LW2A 4BRPA 2RHKA 1N33K 3E9PA 3HRGA 3ZLJA 2VQEK 1RT6A 2D0BA 3QB0A 4M3RA 3HT3A 2UYTA 4DU3A 1S1UA 1RT1A 1Q9YA 4FO0A 1BQMA 3DM2A 3TANA 3C0BA 3AVJA 3OW2M 4B1UB 4DR2K 4FLVA 4BACA 4DUYK 4B1YB 4FLYA 4A61A 5C2DA 3OYBA 3GBTA 3NGYA 4FCYA 3V1QA 2B4JA 4CK1A 1Q9XA 2YKNA 4LF6K 1QS4A 3M1FA 3R6MA 1VSLA 4DV7K 1TUUA 1L3TA 4JKGB 4AHTA 4C8MA 1TKTA 1D9FA 1TK0A 4HUFA 4X64K 5FRNA 3VENA 3KWGA 2KLAA 3HBTA 4Z94A 4JI5K 2OANA 3JSMA 4CD3A 4HHTA 5AQRA 1XC9A 1E4FT 4KPYA 4A5AA 4CGFA 1ASUA 1LWEA 2DFHA 4DV2K 1B92A 1VSEA 4BRAA 3AO3A 3K9KA 5FDLA 3ENOA 5GIPA 4BDPA 4JI6K 4MLHA 4BE1A 3KLGA 2G8HA 3ZSRA 4AQYK 3HTVA 4DLGA 3C6UA 5JVHL 5AQGA 5M1OA 3TTFA 1F21A 3ZETA 2IDOA 5C25A 3OJUA 2JWKA 4DFKA 4FWRA 3DXMA 5J2MA 3H3OB 3U4LA 3KLIA 5BREA 3KVGA 2QEXN 3H1VX 3DOLA 3RMDA 1JLCA 1BG3A 1B9FA 3WEEA 4EAHD 1JLGA 2PYLA 1DEJA 1TL1A 4CBUA 5AQHA 3BEXA 4NYFA 3CI5A 4K8ZA 4N76A 1GLBG 1RILA 2RE2A 2ZJRL 1LWFA 4AHVA 3BP8A 3H6EA 4CJQA 2A1RA 1RBTA 1OH5A 3MEEA 1NNEA 3K5LA 3EEQA 2CH5A 4U67L 1KSPA 5ELZA 1RNHA 5JS2A 5AZJB 5KQ8A 4K8XA 3TABA 5J2NA 5BRFA 4FWNA 3SMPA 1FKPA 1GLLO 5HBMA 3CIPA 2QWLA 2HHHK 1SKWA 1ZBSA 3CCSN 1QQMA 5F0XA 1WSGA 3F9KA 3TAMA 3MAQA 3CFOA 1S72N 3TSUA 4B1VA 1KLNA 1EKEA 1ZYQA 3AO2A 5CE3A 3KLHA 4JK8A 2Q2RA 3B6PA 3HO1A 5BPNA 5AQNA 4H5TA 3UE5A 3GG4A 4J2AA 1YJ9N 4J2BA 3MN5A 3M6GA 2FBTA 3ZT3A 3VEVA 4FL9A 1T3VA 3TI0A 2ZQBA 1HNWK 4NCGA 1VSDA 4WE1A 4FM1A 1XHZA 1NLVA 5AQFA 2G8VA 4G9ZA 1JJ2M 2BTFA 1EP4A 4E7KA 4LH5A 2J4RA 2IVPA 3BY5A 4BRCA 4IWVA 3KTQA 1C0TA 4Y0WA 4CJKA 1WBDA 2E2PA 4JKDA 3DLKA 4KO0A 1QQNA 1BQNA 3FLCO 1ASWA 1RT7A 4LC9B 4KTQA 3K2PA 2ITMA 3ZX0A 1QSYA 4FJGA 3ZCMA 3N4PA 1LV5A 2E88A 4A5BA 1RTDA 4KHUA 1VSKA 1SL0A 3DLRA 4ELVA 1IBLK 4HCBA 4IZ9A 1J6ZA 4OJRA 1RT2A 4AHRA 3HP6A 2FSKA 2JGUA 1K9MO 1GLEG 1YJWN 5CYMA 2XY8A 3L2QA 1YAGA 1L5UA 1RTHA 2UUCK 5CR4A 4JKAA 1Z6RA 4BR4A 4AM7A 3F9MA 4BR7A 3B6OA 3OYGA 3B8AX 3FE1A 3TAQA 1WSJA 4BC5A 2UUAK 1YIJN 4KHPK 2F96A 3MXJA 4F3TA 2CH6A 2PZSA 3ZSZA 4NXNK 2P9NA 5JICA 4IDHA 5AQWA 4CJFA 4AM6A 3AGRA 4E7JA 3NF6A 1GLFO 4IJNA 4FPAA 3IDHA 1D8YA 1VQPN 4OPJA 2KFNA 4YOTA 1GLDG 3QDKA 4CF0A 1VSFA 3QIPA 4DSJA 4ILJA 1KD1O 1X9SA 2QWQA 4JI0K 3SK3A 4F9OA 1J54A 2Q0UA 4FVUA 4X65K 4YOXA 2O8DB 4CW7B 3HL8A 3RRGA 4QCLA 2DPNA 4DMNA 4UQGA 3OYCA 4W5OA 3CM5A 4DV3K 3K9JA 2W41A 1T05A 1LOTB 4GKKK 2DFFA 5C2FA 4RCHA 1EX4A 1JXBA 2IS3A 3H1QA 3ATUA 4DF4A 4H5WA 5I42A 3UIQA 4L3QA 1IV0A 4DQSA 4ISEA 3EE9A 4KI4A 4FSVA 3SQ0A 5HRRA 4XH4A 1NMNA 3DWLA 3J7ZO 2EWSA 3PO4A 3V9UA 4DR3K 2W6LA 4L8RB 3P39A 4IFYA 3VQ9A 3WNFA 4JS4A 3V6DA 2YNGA 2PY5A 4LF9K 4Q5VA 3S3MA 2D0PA 1EO1A 2FF6A 1NGIA 4QS9A 3SMSA 4E1NA 1A5WA 2ITGA 1BIZA 3CCMN 1HX1A 3CJ1A 3U9ZA 1XHXA 2I7NA 4JKHA 1DT9A 1NK5A 2D0CA 4FK2A 4HUGA 4B8AB 2HNDA 1T8EA 4E19A 2RN2A 2ZGYA 3V9SA 5BR9A 3D2EB 4WFBL 1IBKK 3R9PA 4PKGA 1MWMA 3LDPA 3E9OA 3NDKA 4H4MA 3CMAN 1EQYA 3ZSVA 2GUIA 1VQ4N 1HLUA 3VQBA 5AQSA 4ZTFA 3O80A 5AQUA 1KLMA 5AR0A 2BE2A 1REVA 3O9SA 1UA1A 5C24A 2OTLN 1G99A 4JS5A 4XIUA 4CF2A 2O4GA 2QKKA 1SKRA 3O1WA 4M3UA 4U7BA 1BISA 3NHGA 3NVKA 3QMLA 4KHWA 3VQCA 4GVEA 4KFBA 1SUQA 3GE1A 2QW9A 2WONA 4YORA 3VERA 1CXUA 3FZMA 4BGBA 4KTWA 1RDUA 4W5RA 4AH9A 4C1NK 3FZFA 1ZBHA 2E2NA 5KGXA 5JVGL 3VQ5A 1QQOA 4JNEA 4DB3A 1S3XA 3BZKA 3DLHA 3CYMA 1K8KA 1NGJA 2FSJA 4RG8A 1X9MA 3RRHA 3D45A 3PO5A 4F4KA 4KHYA 2D1KA 4DQRA 2QXFA 3AA4A 1QHTA 2ASMA 3L8BA 3VQ7A 4WCEL 4HUEA 4QS7A 2YNIA 3ZSQA 4CGHA 2QWOA 1ATRA 3T3FA 2UXBK 2HHTA 4JHDA 4CJ5A 3OYFA 2O8CA 3OYIA 1X1PA 2RPIA 4H5RA 3VGMA 4EP4A 5DMRA 3AY9A 4R5PA 4DR6K 2V52B 1K6YA 4DS4A 3O8MA 3NE6A 3DXKA 3W3DA 4CESA 5HLFA 4C23A 4H0VB 4BRDA 1Q81O 1CLQA 3KD1E 3CCRN 4CD1A 1JKHA 1WAJA 3MN7A 4CF1A 1S1TA 3THYB 4DHYA 1BI4A 1IKWA 2Q97A 3THXB 1Z05A 4Y1DA 3I55N 3M5RA 1WSEA 2W40A 1Z25A 1BA0A 3AAQA 3I8BA 3LDLA 3CXCM 3VA3A 3L2VA 1KVAA 4O44A 3QBXA 4RW6A 4WF9L 3UKUA 5AQKA 1U49A 3JXUA 5E26A 2P5GA 3VEOA 3VQAA 2WOMA 4FWSA 1TK5A 3WNEA 3NCIA 3IAYA 1TKZA 5FPDA 1IG9A 3VQ8A 3V9XA 1HQUA 4NCBA 5EX5A 3QETA 3BF1A 1NGHA 4CEEA 1U48A 1WLJA 5GINA 1NGAA 1WN7A 4JN4A 1JLAA 3NFAA 4CHZA 4N56A 3UKUB 4I2QA 1M90O 2YHAA 2B5JA 4CCHA 2QK9A 4FWOA 1NU0A 3K5MA 3L4IA 1OVQA 4LSLA 2PFUA 5TKWA 5BPLA 1KCFA 4B3RK 1BU6O 1VQKN 3SAFA 1BCOA 1KFDA 1C1CA 2OYQA 1YXQA 3I0SA 3CCQN 4BY9C 3NGZA 3ULEA 5KRSA 3QNNA 1T6DA 2E1YA 1U04A 1Y97A 3QO9A 1IJJA 3WNHA 1DTQA 1BWFO 1J9AA 1KFSA 3PIPL 2P9KA 4FJ8A 1NG9A 5C10A 1MWKA 1TK8A 4YOVA 3L2WA 1NK0A 4F3OA 2ZM6K 1WNSA 2WUSA 4H5NA 3I0RA 2PBDA 4BE2A 2HBJA 3HYFA 1N5YA 3S9HA 2P9KB 3Q7BA 3MXIA 4N47A 3CJAA 3ALYA 2HBKA 3VEYA 1VQ5N 5AQQA 2ZJQL 1JLEA 3VMFB 1ZBLA 2FSNA 3VF2A 4IKFA 3CERA 2P9SB 2ZE2A 4BGAA 1FK9A 4DKWA 3OS2A 3IS9A 4CZKA 1SV5A 2KTQA 1YTAA 3QLHA 1QZ5A 3O1BA 4FWQA 2P9UA 3C7NA 4IOXA 3DJCA 4JI4K 5AZIB 4C8KA 3CQYA 4J2DA 1JLFA 4DTUA 3SV3A 1LAVA 3CPEA 4IG0A 4M45A 2UXDK 3C6HA 5JLFA 3FZLA 1L3VA 1OH7A 2I7PA 3U3GA 4BQZA 4PY5A 2O8FA 1DGKN 1JL2A 4K43A 4CJ7A 3C6AA 4OVLA 4YNQA 3EKSA 5AQZA 4WFNL 1ASVA 4DLEA 4O55A 2CGLA 4K42A 5M1NA 4C8OA 3CPWM 3LZJA 4FPBA 3QBWA 4M41A 2A3ZA 2HMIA 3IG1A 3CMEN 4B9NA 2AJQA 1Q82O 2G8IA 4DR7K 5AQIA 5EVZA 3TAFA 3G4SN 3LDNA 1SQKA 3DLLL 3T1YK 4JK7A 3F2KA 5KI6A 1NK8A 2X6NA 4FJHA 4JKCA 4O5BA 3C65A 3DRSA 5CY4A 4DV4K 1WSIA 5BR8K 4BC4A 5LJWA 2D0OA 2F9WA 3RMAA 4BRQA 4KTZA 2YHBA 4NYNA 4JI3K 1ITGA 4EHTA 1RTJA 3H46O 3AVCA 2IIRA 3J8AA 4DG1A 4X66K 3AVAA 1NK6A 4CECA 4DQ8A 4NCAA 4CEFA 5SWMA 4DFMA 4LF5K 4CHOA 5B8HA 3ZETB 3CFPA 3VA0A 4M42A 3DXMB 4ZHRA 1QTMA 3CJCA 3BF3A 4BRNA 4JLHA 4DU4A 4B9QA 4RWTA 3THWA 1TGOA 1HR0K 3WEEB 3HOSA 4KH6A 3O9RA 4YY3K 5DM6L 3DLBA 1SAZA 4FOEA 4B1XB 3ISNC 2FBYA 1GOCA 2GBZA 1A5VA 4M7YA 1RT5A 1OH6A 4I9LA 4EZ6A 3K5NA 1N34K 4Z4EA 4LFCK 4KHNA 4FLXA 5KQDA 1EWRA 1WSHA 2P9IA 3E9LA 3RSEA 4DQIA 3VETA 1NJYA 3TAEA 2BGGA 4KKOA 4QOZB 1NKEA 4AHUA 3MEDA 3PX0A 1D5AA 5J2PA 3O4WA 1U2VA 1H1VA 1YITN 3OS0A 3SUNA 4C1NI 4IEIA 2ZWHA 1XUPO 3MDQA 5AQOA 1UA0A 2O8EA 3PSIA 1VQMN 3PUFA 3FFKB 3DOKA 1FW6A 1EXQA 3DRPA 3MEGA 1NM1A 1YT3A 1XI1A 1XMOK 1NJXA 4CZMA 1U4BA 2OTJN 1SL1A 1C1AA 5C0YA 1ATNA 4BRKA 5GAEP 3D2FA 3RMBA 4KB1A 1LW0A 3TTCA 3WT0A 2NRTA 1S5JA 3QINA 4FK4A 4YOUA 4FLTA 1MA9B 3BZCA 4FLUA 4FWKA 1KXPA 3KKRA 3P4IA 3H45C 5M1KA 3VN5A 3ZT0A 2IVOA 3BUZB 4CJPA 1QVGM 4XH1A 2IGIA 1JXEA 3U8XA 1RTIA 3OTOK 3I33A 4BRIA 3JYTA 3AV9A 3DLEA 3ZX3A 3HVRA 1B9DA 5AQMA 2NRXA 4BRFA 1MDUB 3WXKA 4CIEA 3S41A 1J5EK 2E5LK 3MCAB 5DK5A 2WBNA 4CJ4A 4HCCA 1P8ZA 4DV5K 4JD2A 5AQVA 3HK2A 3ZT4A 4BRGA 3L6QA 1J5OA 2OCEA 2ZJPL 3QEXA 2CGJA 3C6TA 4KHQA 3L2UA 3TU5A 2VGMA 5A2QO 3IRXA 3AA5X 3VOVA 3W0LA 2GWKA 3VQ4A 1NKCA 3AVKA 3LAKA 4FW1A 4JD2B 1LCUA 3M3ZA 3OVNA 4AHCA 1HNIA 1NKBA 4LFAK 2QXLA 2QM1A 2VG7A 3V9ZA 4EIAA 3LAMA 4OO1J 4ISFA 3D6RA 4FJKA 2YNHA 3P31A 2VG6A 2P9NB 4CGDA 1Q7YO 4DFJA 1X9JA 4BROA 1S9GA 4BWJA 4OKEA 1NGCA 3WXJA 2QI2A 3VQEA 3KK2A 4ILHA 1HYZA 1JCGA 4CZFA 3PY8A 1RDDA 1HRHA 4IOAL 2HSTA 3PV8A 4DS5A 2KHOA 1O1WA 4CJUA 4BDZA 3CC7N 1ZBFA 1OVYA 1VK0A 3KLEA 3MN6A 3G10A 4HTLA 1WUAA 5KPRA 4FJ7A 2ATQA 3L4QA 4DR1K 2G8UA 4DSLA 5GAGP 4G1QA 4CBWA 1T03A 3SLCA 3DYAA 3LP2A 2X6SA 3SV4A 3E66A 4AF1A 5JLHA 2F8SA 1WOQA 1QQCA 1N36K 3U6FA 3NH1A 1VQLN 1EETA 1U6ZA 1NJWA 2HHVA 2QWRA 4PKHA 4I6MA 2WTUA 1ZBIA 5JMVA 5HOOA 3OBWA 4HVJA 3KWIA 4KRFA 1KRPA 2YV0X 4CZHA 4DV1K 1U45A 3AVLA 2P9PA 2XO7A 4F2SA 1BL3A 4DSKA 2KW4A 3M8QA 1KC8O 4CGJA 3NGIA 4IFVA 2D5RA 4LF4K 3CJ9A 2I5JA 2V7YA 2OPQA 2X78A 2NRWA 1W97L 2GTDA 4DFPA 2GWJA 2QWMA 1BO5O 3VPZA 4FJLA 4ID1A 1DLOA 3NH2A 3OYEA 4A62A 5GADP 1VQ7N 4IDKA 5EXWA 2AA4A 5AQJA 3VGLA 1YUWA 1YTUA 4O8KA 4I7FA 2NRZA 1UWBA 3P5JA 1I39A 3ZSYA 1QZ6A 4DUZK 4PKIA 4MO4A 4HWIA 3ZSWA 3WNGA 4CFCA 3SUOA 4NXMK 1CZ9A 4ELUA 4I2PA 2Z1GA 4CJWA 3SCXA 3NF9A 3QEPA 5KTQA 3I56N 5AQTA 4GMJB 3LP0A 5T7BA 2YJFA 5FPNA 4A2AA 4GKJK 2EX3A 2YNFA 3O4NA 3SUQA 1VRTA 1W2BM 4GY2B 2GX9A 3U9DA 4ICLA 3AVGA 5AJ3K 3T19A 1XWLA 3L0QA 3GDQA 1XNQK 2YI1A 4Y1CA 2HF3A 4FW2A 5KRTA 4FZXC 2VGNA 1NOZA 5LL6Z 3QNOA 1IKVA 4XEIA 3OYLA 2YX6A 4IEEA 4QS8A 1K73O 1TYQA 2QTDA 3AARA 1RBRA 4CE9A 5GIOA 3KK7A 1K8KB 3EE8A 3G0ZA 3ZEUA 3UKRA 1NGDA 2R7YA 4B1ZA 3PX4A 2UUBK 1S6PA 1GLCG 3A5LC 3VEZA 2VCPA 4B9VA 4JHDB 3CFRA 2O8CB 1VSMA 3VF4A 2A1SA 2HF4A 2A42A 3PIOL 4AILC 2NZTA 4CHNA 2P9LA 4CJVA 3OBYA 3DXKB 3TWHA 2Z1IA 4E7HA 2QKBA 1S6QA 3C94A 2AP1A 4F8RA 2KFZA 1VQ8N 1HQEA 3C95A 1HYVA 2IAJA 4CJ3A 4PA1A 1X9WA 4JKEA 3AVFA 1TVRA 1RBVA 3G25A 4MQ3A 4BR9A 3SNNA 4MLEA 1HJOA 2E1ZA 1T44A 2D0AA 4AHSA 3DLGA 1BI4B 5FPEA 4M3TA 3SAHA 5K14A 1NJIO 4CJLA 3ZT1A 2HW3A 3QFUA 1X3MA 3V9WA 4FVMA 3M8SA 4DQPA 4KI6A 3V1OA 5F2RA 2P5OA 1VQON 3FZKA 4W5TA 5AQPA 1KAYA 5E84A 1M1KO 4O4GA 3DAWA 5LMNK 1HNXK 2E2QA 3LDOA 2YHYA 5AFUA 3J7AP 3WXIA 4OGCA 2VG5A 4DV6K 1IH7A 5AFUH 1Z26A 1R0AA 3KLFA 4DCHA 4A2BA 4IXCA 4C8NA 4WQ4A 1WB9A 1X3NA 3HI0A 3G6EN 5J1EA 1S1XA 1C0GA 4I9QA 3VTIA 2ZGZA 4CFAA 1A5XA 3ULEB 4DR5K 4CIGA 3WXMB 2HHQA 3MK6A 4MDAA 3OS1A 4HTUA 1EWQA 4LF7K 1KAZA 1NOYA 1HNVA 4JI1K 4BRHA 3L2RA 3VF6A 4E7LA 2O8BA 4BVOA 3LWMA 1S1VA 4CF9A 3WXLA 2F4VK 5M1PA 1QE1A 4H0YB 3O08A 4KH5A 4PL8A 2QA4N 1XQSC 3FZHA 1GLAG 3SI6A 2O4IA 1IG8A 4BRMA 4CI6A 3RTVA 1KAXA 3GL1A 2P1JA 2VYPA 2FXUA 3GOIA 2Q3SA 4CEOA 3MMVA 2XHBA 2F9TA 3O6WA 1NWKA 2HMPA 3V81A 4CHYA 4W5QA 3SPZA 4CF8A 3EL2A 3IFRA 4OKJA 4E89A 4BQLA 2HNYA 4B9SA 1RGIA 5EU7A 3J7YP 3KD5E 3FGUA 3VQPA 4Z4CA 3K57A 1CZBA 2LSNA 4B08A 4B9UA 4DTJA 4DTPA 4DF8A 2NRRA 1QVFM 1CZAN 3RR8A 4DTSA 4IO9L 4CZIA 4DV0K 2XY7A 4F2RA 2VWBA 1YJNN 3D0PA 3OA9A 5CYQA 3VQDA 4B1WB 4B3OA 4XH5A 3VESA 2P9UB 3C7NB 3VQQA 2NUBA 3TAPA 3A5NC 3MWPA 4ID5A 4JKBA 3KIOA 5CZ2A 3ITHA 3LL3A 4DSFA 4GV9A 2X74A 1ZC6A 5F1XA 3OY9A 4CEAA 2WC9A 3MN9A 4Q0BA 1RDBA 3EZ5A 2O8FB 5E41A 1P90A 3VQ6A 1HNZK 4JKGA 3THVA 2VQFK 2PYJA 3ZYYX 5C15A 3NBPA 3AVNA 4EFHA 4KB0A 4CGIA 4CEDA 3CJ7A 2HVHA 1BCMA 3OYDA 3KK3A 3K0SA 1I3AA 4Z0UA 3H3NO 4GNIA 5BPMA 4H0OA 2EHGA 4IO8A 4CIFA 3O3HA 4WFAL 4M3YA 3AO4A 4GV6A 3LDSA 4YOYA 4K25A 4ILGB 1HMVA 3TSPA 2WFBA 2HHUA 3ASMA 4B3TK 1RDWX 4A59A 4B8CA 3CETA 1RT4A 3TR8A 1NJZA 3ID6A 4H8KA 2IOCA 1L3UA 3WUHA 4WQ5A 4DSEA 3QIOA 4PHTX 1RDAA 4LY7A 4IBNA 4BR2A 1IKXA 5HRPA 2OZSA 2ETJA 2HOEA 4MDBA 3IUCA 1D9DA 4CHPA 5I3UA 3FFIA 3NH0A 5I9EB 3ULDA 2ASOA 3LANA 4NO7A 4JRPA 1SS6A 2YJEA 3K5OA 1GLJO 2HBLA 2V7ZA 5AQYA 4GW6A 4H0XB 1VSJA 3EZWA 3SBGA 3OHRA 5KPZA 3SJJA 5FPMA 3S3NA 3KZBA 3THWB 3J81O 5DM7L 2UU9K 3HM8A 5AZJA 4IFEA 3RMCA 3ZSOA 1JLBA 4BVPA 4O0JA 4PL7A 4BWMA 3T69A 4DU1A 3TARA 4J2EA 3QFPA 3SUPA 4H0TB 1YF5L 4CK2A 4KH4A 3EYZA 5JS1A 3KKSA 1IKYA 2DTUA 3ZT2A 3SAGA 2BH1A 1WBBA 4M3WA 2A6AA 2P9IB 3TAGA 1VHXA 3RSEB 5D3GA 1DKGD 1BOTO 2HVIA 2ASPA 1Y64A 2GELA 3WQTA 2HB5A 2BANA 4LD0A 3J80O 1U2VB 2ZF5O 3JAMO 4E1MA 4TSXA 3CHWA 3ZX2A 4DR4K 1QHAA 2XRIA 4B3SK 2O8EB 3BDPA 4OPAA 4IJAA 4GVMA 4CHQA 3MX2A 3EN9A 1VQ6N 3DI6A 4JI7K 2E2OA 3EO3A 3SQ1A 3CC2N 1HKGA 3LPUA 2P51A 4E1JA 4CEQA 2HBMA 3P1GA 3P83D 2VWJA 3ENBA 2E6LA 1GOBA 1YVUA 5HP1A 3D2FB 4YDUA 4MFBA 4H5VA 3LALA 2KQ2A 3M8PA 3AGKA 4ISGA 4CJSA 4Z4GA 2IC3A 1V4SA 1C1BA 3H08A 3G71N 3LPTA 1KTQA 4ZTJA 4EZ9A 2XY5A 1LWCA 3NAEA 1VQNN 1WAFA 3AAPA 3MCPA 1W7AA 1T6CA 2D4WA 4O8UA 4M3XA 1HUXA 3OJSA 4NB4A 2W42A 4DWIA 3O4QA 2Q36A 3CF5L 1TKDA 2E20A 4LF8K 3ZSXA 3SPYA 3E1YA 3S3OA 3BGRA 3OYJA 5AQXA 3CCLN 2A40A 1C0FA 1W9HA 3AA3A 4FWLA 4CVNE 3E01A 2OPRA 2ZD1A 3NMUA 4W5NA 4E3SA 3AVMA 4FLZA 1N8RO 4BDYA 2OA8A 3R8EA 3ATVA 1OKJA 3HJFA 1SZ2A 3V1RA 2NRVA 2G8FA 5M1QA 4FJNA 3CM6A 4BRLA 2W6KA 3AO1A 4FWPA 2QWNA 4DSIA 3HSCA 3QICA 1FXXA 4DQQA 4JK9A 5BRDA 1S22A 2O8DA 3A8YA 2YHWA 1YI2N 1G15A 4WQ4C 3CCJN 2BDPA 4OLBA 2FC0A 4CJTA 1YHQN 1T7PA 4FJIA 4N5SA 3OYAA 5BN9A 4JAXA 4OLAA 2Z1JA 1NGEA 4O0IA 3TPQA 1Q8IA 4BG9A 1VSHA 5HRNA 3I8DA 4M63C 4FJXA 1N6QA 4DTXA 1NK7A 3VEWA 1VRUA 3RWUA 4JEPA 5FRMA 5KGWA 2GEMA 3AO5A 4FZYA 3IKMA 4BR5A 1JCEA 1JCFA 2G8KA 1BUPA 4CGGA 3OYMA 2YCHA 1LAWA 2F8TA 3SJHA 2B6AA 2RKIA 3ENHA 4Z4FA 1FKOA 3A5MC 4OPHA 3NVMA 4OGEA
chains in the Genus database with same CATH topology
1RBVA 4MQ3A 4PY5A 3AVBA 1JL2A 4J2AA 3QEIA 3SNNA 3HM9A 4J2BA 2FBTA 3DRRA 4OVLA 3ZT3A 5SZTA 4YNQA 4FK0A 3TI0A 2OPSA 1ASVA 2D0AA 2ZQBA 4O55A 4AHSA 4DLEA 3DLGA 1BI4B 4M3TA 4NCGA 1VSDA 4WE1A 5K14A 4CJLA 3LWLA 4FM1A 1XHZA 3ZT1A 2G8VA 4C8OA 2BGGA 2HW3A 1EP4A 3LZJA 4E7KA 4LH5A 1TL3A 3HPOA 4M41A 2HMIA 3IG1A 2AJQA 3V9WA 4B9NA 4Z4IA 4FVMA 3M8SA 1S1WA 3U3YA 3KTQA 4DQPA 2G8IA 4DTNA 1C0TA 4KI6A 3V1OA 4CJKA 4OPKA 2VWKA 3TAFA 2FBVA 2P5OA 1TV6A 3DLKA 4KO0A 1BQNA 4W5TA 1ASWA 3CG7A 3MECA 1RT7A 4KTQA 4B9LA 1TAQA 4O4GA 3SQ4A 5KI6A 3OYHA 2JLEA 2X6NA 3F73A 4O5BA 1NK8A 4FJHA 3K2PA 3DRSA 3L3VA 1QSYA 5CY4A 3SYZA 4FJGA 3ZCMA 1LV5A 1HJRA 4KHUA 1RTDA 1WSIA 3HXMA 1VSKA 5HRSA 1U47A 4OGCA 1SL0A 2VG5A 3DLRA 1IH7A 3A2FA 1Z26A 3QERA 4KAZA 4RW8A 4ELVA 1R0AA 2KZMA 3KLFA 4HCBA 1DTTA 4C8NA 3RMAA 4OJRA 4B9TA 1RT2A 1UAXA 4KTZA 4AHRA 4N41A 5J1EA 3RR7A 1S1XA 2YHBA 3HP6A 4NYNA 4CJEA 4I9QA 4CFAA 1ITGA 1RTJA 1A5XA 3O3GA 2JGUA 5J2QA 5CYMA 2XY8A 3L2QA 3AVCA 4B9MA 3K58A 2KZZA 1L5UA 1RTHA 4DG1A 3AVAA 4CIGA 1NK6A 2HHQA 4CECA 4NCAA 4CEFA 5SWMA 3OYGA 3B6OA 4DFMA 1NK9A 3EY1A 4PQUA 3OS1A 3HPGA 4HTUA 3TAQA 1WSJA 4CHOA 1NOYA 4QAGA 1HNVA 1L3VA 2F96A 3MXJA 3CFPA 2YKMA 3L2RA 4CJRA 3VA0A 3QEWA 4M42A 4ZHRA 4E7LA 4DTRA 1QTMA 4F3TA 2PZSA 2G8WA 3LWMA 1S1VA 3ZSZA 4CF9A 4FM0A 4JLHA 1KVCA 4DU4A 1QE1A 1S9EA 1TGOA 4CJFA 4E7JA 4ELTA 3NF6A 3SI6A 2O4IA 3DLBA 3MXMA 3RTVA 3ISNC 1D8YA 2FBYA 2P1JA 1GOCA 4OPJA 2GBZA 2XY6A 2KFNA 2Q3SA 4CEOA 2HNZA 5CZ1A 4CF0A 1A5VA 4YFUA 1VSFA 2XHBA 3QIPA 4CFDA 4DSJA 3V81A 1RT5A 1X9SA 1RCHA 4I9LA 4DTOA 3K5NA 4EZ6A 4IG3A 1MU2A 4CHYA 4OKKA 4W5QA 3SPZA 4CF8A 4Z4EA 3L3UA 1J54A 4KHNA 4OKJA 1UOCA 4E89A 4FLXA 4E7IA 2HNYA 4B9SA 3HL8A 3RRGA 3AVIA 5EU7A 1QSLA 1WSHA 3KD5E 4QCLA 3VQPA 4DMNA 4Z4CA 4UQGA 4LH4A 3K57A 1CZBA 4PWDA 2Y1IA 4DQIA 4M3ZA 2LSNA 4B08A 2FBXA 4DTJA 1RBSA 3OYNA 4DTPA 3OYCA 4KKOA 4W5OA 3CM5A 4DF8A 3TAEA 1NKEA 3RR8A 4QOZB 4DTSA 4AHUA 3MEDA 1T05A 3SZ2A 3O3FA 3PX0A 1D5AA 5J2PA 4CFBA 2XY7A 4F2RA 2DFFA 3OS0A 3SUNA 3D0PA 2HHSA 4FXDA 4B9UA 1EX4A 1JXBA 5CYQA 3VQDA 2IS3A 4RW4A 4DF4A 1UA0A 4B3OA 5I42A 3PUFA 3UIQA 3DOKA 1RDCA 3T1AA 4KREA 4DQSA 3VQQA 2E6MA 2NUBA 3HPHA 1EXQA 1KVBA 1BGXT 1WSFA 3DRPA 3MEGA 4RW7A 3TAPA 4RW9A 4ID5A 2E4LA 3V4IA 4KI4A 3SQ0A 3KIOA 1YT3A 4KHSA 5HRRA 1XI1A 5CZ2A 1NJXA 3ITHA 4DSFA 1U4BA 2X74A 4CEBA 1SL1A 3OY9A 1C1AA 4FZZA 3CQ8A 3PO4A 4CEAA 3V9UA 3AA2A 4L8RB 3AVHA 3RMBA 2DY4A 4IFYA 4Q0BA 1C0MA 1RDBA 3VQ9A 3WNFA 4KB1A 3EZ5A 4JS4A 3V6DA 1LW0A 2YNGA 5E41A 4LSNA 4BE0A 2Y1JA 4Q5VA 4KV8A 3S3MA 2PY5A 3HP9A 3VQ6A 3KJVA 2HHXA 1S5JA 3DMJA 3QINA 3THVA 4FK4A 4FLTA 2PYJA 3K59A 4E1NA 1A5WA 2ITGA 4FLUA 1BIZA 3HVTA 1RT3A 3KKRA 3NBPA 3AVNA 4E0DA 5C42A 4KB0A 3VN5A 4CGIA 3ZT0A 4CJPA 1XHXA 4CEDA 2HVHA 2IGIA 1JXEA 1BCMA 4CERA 3OYDA 3KK3A 1NJYA 1RTIA 3M8RA 1I3AA 1W0HA 2D0CA 1NK5A 4FK2A 2DFEA 1L3SA 4Z0UA 4HUGA 4C8LA 4B8AB 2HNDA 1RBUA 1T8EA 4E19A 3JYTA 2EHGA 2RN2A 4CIFA 3AV9A 3O3HA 3DLEA 3V9SA 4FJJA 4FLWA 4M3YA 3AO4A 3HVRA 1B9DA 3LDSA 3LP1A 3NDKA 4H4MA 1HMVA 4CIEA 2HHUA 3ASMA 3ZSVA 2GUIA 4CEZA 5DK5A 3VQBA 3QEVA 4B8CA 4Z4HA 1VSIA 1QSSA 4ZTFA 1RT4A 4CJ4A 4HCCA 1KLMA 3TR8A 4DTMA 1NK4A 2BE2A 1BHLA 1REVA 1NJZA 4H8KA 1BIUA 3HK2A 1UA1A 5C24A 2IOCA 3ZT4A 1L3UA 1IO2A 1J5OA 3KK1A 1TAUA 3QEXA 4JS5A 3QIOA 4XIUA 4DSEA 3C6TA 1RDAA 4KHQA 4LY7A 3L2UA 4IBNA 4CF2A 2O4GA 1IKXA 5HRPA 2QKKA 2ETJA 2OZSA 3IRXA 1SKRA 4M3UA 3AA5X 4FJ9A 4FYDA 3VQ4A 1NKCA 1BISA 3NHGA 4H4OA 1D9DA 1J53A 3AVKA 1ZBUA 1JL1A 4CHPA 5I3UA 3LAKA 4KHWA 3FFIA 4FW1A 3VQCA 3LP3A 1SUQA 4KFBA 3NH0A 2OPPA 2WONA 3LANA 3OVNA 3ULDA 3PX6A 4AHCA 1HNIA 1NKBA 4CK3A 1CXUA 4JRPA 4FM2A 5HROA 4FJMA 3K5OA 2VG7A 3V9ZA 1GOAA 4GW6A 4KTWA 3LAMA 4W5RA 4AH9A 1VSJA 1ZBHA 5KGXA 4FJKA 3VQ5A 3SJJA 2YNHA 1TKXA 1JLQA 2GV9A 2VG6A 3NF7A 4CGDA 3S3NA 3DLHA 3QESA 3CYMA 4DFJA 4RG8A 3ZSOA 4EP5A 3RRHA 3RMCA 1X9MA 1C6VA 3D45A 3PO5A 1S9GA 1SL2A 4BWJA 1JLBA 4OKEA 3LZIA 4F4KA 4KHYA 2RF2A 1HYSA 4O0JA 4DQRA 3HSTB 4BWMA 4FJ5A 2QXFA 3VQEA 3KK2A 1HYZA 2Z1HA 4DU1A 3TARA 3AA4A 1QHTA 3OYKA 3L8BA 3VQ7A 3PY8A 4HUEA 3SQ2A 1RDDA 4J2EA 1CXQA 2YNIA 3ZSQA 4CGHA 1HRHA 3SUPA 3PV8A 4DS5A 4PUOA 4CK2A 1O1WA 4CJUA 4BDZA 3EYZA 3T3FA 3KKSA 2HHTA 4CJ5A 5JS1A 3OYFA 5FROA 3OYIA 1IKYA 1X1PA 1ZBFA 2RPIA 4JRQA 2DTUA 1VK0A 3KLEA 4EP4A 3ZT2A 5DMRA 2OZMA 3G10A 3NF8A 4R5PA 4FJ7A 4M3WA 2ATQA 4DS4A 1K6YA 2G8UA 4DSLA 3TAGA 5D3GA 4G1QA 3NE6A 4CESA 1T03A 3DYAA 3LP2A 2X6SA 3SV4A 1C0UA 5HLFA 1HPZA 2HVIA 2F8SA 1CLQA 1SKSA 3KD1E 1LW2A 1QQCA 3U6FA 3NH1A 2HB5A 2BANA 4LD0A 1EETA 4E1MA 4TSXA 1RT6A 2D0BA 3HT3A 1JKHA 4M3RA 1NJWA 2HHVA 1WAJA 4DU3A 1S1UA 2XRIA 4CF1A 1ZBIA 1RT1A 4HVJA 1S1TA 1Q9YA 1KRPA 1BQMA 4KRFA 2YV0X 3DM2A 3BDPA 1BI4A 3TANA 1IKWA 3AVJA 4GVMA 1U45A 4CHQA 3AVLA 3DI6A 2XO7A 4Y1DA 4F2SA 1BL3A 3SQ1A 1WSEA 3LPUA 1Z25A 2P51A 4BACA 4FLVA 4DSKA 3VA3A 3L2VA 4FLYA 2KW4A 3M8QA 1KVAA 4O44A 4CGJA 4RW6A 4IFVA 2D5RA 3NGIA 4CEQA 3P1GA 3OYBA 1U49A 2I5JA 2P5GA 2OPQA 3NGYA 2X78A 3P83D 2WOMA 3VQAA 2VWJA 2E6LA 1TK5A 1GOBA 1YVUA 3WNEA 3NCIA 5HP1A 3IAYA 1TKZA 1IG9A 4FCYA 3V1QA 2B4JA 3VQ8A 3V9XA 4DFPA 1HQUA 4CK1A 4NCBA 1Q9XA 2YKNA 3QETA 4MFBA 4CEEA 1U48A 1QS4A 1WLJA 3LALA 4ID1A 4FJLA 1DLOA 2KQ2A 3M8PA 4CJSA 3NH2A 1VSLA 1WN7A 3OYEA 4Z4GA 1JLAA 3NFAA 4CHZA 4N56A 4I2QA 2IC3A 1L3TA 4IDKA 2YHAA 2B5JA 1C1BA 4C8MA 3H08A 4AHTA 1TKTA 4CCHA 3LPTA 1KTQA 2QK9A 1YTUA 4ZTJA 4EZ9A 1D9FA 1TK0A 4HUFA 4I7FA 1LWCA 3K5MA 3NAEA 2XY5A 5FRNA 1WAFA 4LSLA 1KCFA 3JSMA 4HHTA 1UWBA 4KPYA 1XC9A 3P5JA 4M3XA 4CGFA 1ASUA 1I39A 3ZSYA 1LWEA 1BCOA 1KFDA 2DFHA 1B92A 1VSEA 3AO3A 3OJSA 1C1CA 5FDLA 3ZSWA 2W42A 3WNGA 3I0SA 3O4QA 4CFCA 3SUOA 4BDPA 1CZ9A 2OYQA 4DWIA 4ELUA 4I2PA 2Z1GA 4CJWA 3NGZA 3SCXA 1TKDA 5KRSA 3QNNA 3NF9A 3ZSXA 4BE1A 3QEPA 3KLGA 2G8HA 3ZSRA 5KTQA 4DLGA 1U04A 3C6UA 3LP0A 4GMJB 3SPYA 3S3OA 5T7BA 1Y97A 3BGRA 3OYJA 1F21A 3QO9A 2IDOA 5C25A 3OJUA 3WNHA 4DFKA 1W9HA 2EX3A 2YNFA 3AA3A 5J2MA 1DTQA 3O4NA 3SUQA 3E01A 1VRTA 3KLIA 2OPRA 1J9AA 2ZD1A 4W5NA 4E3SA 1KFSA 3AVMA 3DOLA 3RMDA 1JLCA 4FLZA 4ICLA 1B9FA 4FJ8A 3AVGA 1JLGA 2PYLA 1TK8A 3T19A 4BDYA 1TL1A 1XWLA 2OA8A 3L2WA 1NK0A 4F3OA 1WNSA 4NYFA 4Y1CA 3HJFA 3V1RA 4FW2A 4K8ZA 2G8FA 4N76A 5KRTA 4FZXC 4FJNA 1RILA 3CM6A 3AO1A 3I0RA 1LWFA 1NOZA 4BE2A 4AHVA 3QNOA 3HYFA 1IKVA 3OYLA 3S9HA 1N5YA 4DSIA 4CJQA 3MXIA 1RBTA 1FXXA 4N47A 4DQQA 3MEEA 2A1RA 3K5LA 3ALYA 1G15A 2BDPA 4OLBA 1KSPA 1RBRA 2FC0A 1RNHA 4CE9A 4CJTA 5JS2A 1T7PA 4FJIA 4N5SA 1JLEA 3OYAA 3G0ZA 1ZBLA 4IKFA 2R7YA 4K8XA 4OLAA 3PX4A 2Z1JA 3TABA 2ZE2A 4O0IA 5J2NA 1S6PA 1FK9A 3OS2A 3U3GA 1FKPA 5HBMA 1Q8IA 3IS9A 1VSHA 5HRNA 3I8DA 4FJXA 1N6QA 4DTXA 1NK7A 3RWUA 1SV5A 1VRUA 1SKWA 5FRMA 4B9VA 5KGWA 2KTQA 3AO5A 1YTAA 3QLHA 3CFRA 4FZYA 1VSMA 2A1SA 1WSGA 3F9KA 3TAMA 3MAQA 4AILC 2G8KA 4CHNA 3CFOA 4CGGA 3OYMA 1LAWA 2F8TA 4C8KA 4CJVA 1KLNA 1EKEA 1ZYQA 3AO2A 3KLHA 3TWHA 2Z1IA 4E7HA 4J2DA 2QKBA 2B6AA 1JLFA 1S6QA 2RKIA 3B6PA 4DTUA 4Z4FA 3C94A 3SV3A 1LAVA 4F8RA 1FKOA 4IG0A 1HQEA 4M45A 3HO1A 3C95A 2KFZA 1HYVA 2IAJA 4CJ3A 4PA1A 1X9WA 3AVFA 2HHWA 1TVRA 4OGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBV A;  4MQ3 A;  4PY5 A;  3AVB A;  1JL2 A;  4J2A A;  3QEI A;  3SNN A;  3HM9 A;  4J2B A;  2FBT A;  3DRR A;  4OVL A;  3ZT3 A;  5SZT A;  4YNQ A;  4FK0 A;  3TI0 A;  2OPS A;  1ASV A;  2D0A A;  2ZQB A;  4O55 A;  4AHS A;  4DLE A;  3DLG A;  1BI4 B;  4M3T A;  4NCG A;  1VSD A;  4WE1 A;  5K14 A;  4CJL A;  3LWL A;  4FM1 A;  1XHZ A;  3ZT1 A;  2G8V A;  4C8O A;  2BGG A;  2HW3 A;  1EP4 A;  3LZJ A;  4E7K A;  4LH5 A;  1TL3 A;  3HPO A;  4M41 A;  2HMI A;  3IG1 A;  2AJQ A;  3V9W A;  4B9N A;  4Z4I A;  4FVM A;  3M8S A;  1S1W A;  3U3Y A;  3KTQ A;  4DQP A;  2G8I A;  4DTN A;  1C0T A;  4KI6 A;  3V1O A;  4CJK A;  4OPK A;  2VWK A;  3TAF A;  2FBV A;  2P5O A;  1TV6 A;  3DLK A;  4KO0 A;  1BQN A;  4W5T A;  1ASW A;  3CG7 A;  3MEC A;  1RT7 A;  4KTQ A;  4B9L A;  1TAQ A;  4O4G A;  3SQ4 A;  5KI6 A;  3OYH A;  2JLE A;  2X6N A;  3F73 A;  4O5B A;  1NK8 A;  4FJH A;  3K2P A;  3DRS A;  3L3V A;  1QSY A;  5CY4 A;  3SYZ A;  4FJG A;  3ZCM A;  1LV5 A;  1HJR A;  4KHU A;  1RTD A;  1WSI A;  3HXM A;  1VSK A;  5HRS A;  1U47 A;  4OGC A;  1SL0 A;  2VG5 A;  3DLR A;  1IH7 A;  3A2F A;  1Z26 A;  3QER A;  4KAZ A;  4RW8 A;  4ELV A;  1R0A A;  2KZM A;  3KLF A;  4HCB A;  1DTT A;  4C8N A;  3RMA A;  4OJR A;  4B9T A;  1RT2 A;  1UAX A;  4KTZ A;  4AHR A;  4N41 A;  5J1E A;  3RR7 A;  1S1X A;  2YHB A;  3HP6 A;  4NYN A;  4CJE A;  4I9Q A;  4CFA A;  1ITG A;  1RTJ A;  1A5X A;  3O3G A;  2JGU A;  5J2Q A;  5CYM A;  2XY8 A;  3L2Q A;  3AVC A;  4B9M A;  3K58 A;  2KZZ A;  1L5U A;  1RTH A;  4DG1 A;  3AVA A;  4CIG A;  1NK6 A;  2HHQ A;  4CEC A;  4NCA A;  4CEF A;  5SWM A;  3OYG A;  3B6O A;  4DFM A;  1NK9 A;  3EY1 A;  4PQU A;  3OS1 A;  3HPG A;  4HTU A;  3TAQ A;  1WSJ A;  4CHO A;  1NOY A;  4QAG A;  1HNV A;  1L3V A;  2F96 A;  3MXJ A;  3CFP A;  2YKM A;  3L2R A;  4CJR A;  3VA0 A;  3QEW A;  4M42 A;  4ZHR A;  4E7L A;  4DTR A;  1QTM A;  4F3T A;  2PZS A;  2G8W A;  3LWM A;  1S1V A;  3ZSZ A;  4CF9 A;  4FM0 A;  4JLH A;  1KVC A;  4DU4 A;  1QE1 A;  1S9E A;  1TGO A;  4CJF A;  4E7J A;  4ELT A;  3NF6 A;  3SI6 A;  2O4I A;  3DLB A;  3MXM A;  3RTV A;  3ISN C;  1D8Y A;  2FBY A;  2P1J A;  1GOC A;  4OPJ A;  2GBZ A;  2XY6 A;  2KFN A;  2Q3S A;  4CEO A;  2HNZ A;  5CZ1 A;  4CF0 A;  1A5V A;  4YFU A;  1VSF A;  2XHB A;  3QIP A;  4CFD A;  4DSJ A;  3V81 A;  1RT5 A;  1X9S A;  1RCH A;  4I9L A;  4DTO A;  3K5N A;  4EZ6 A;  4IG3 A;  1MU2 A;  4CHY A;  4OKK A;  4W5Q A;  3SPZ A;  4CF8 A;  4Z4E A;  3L3U A;  1J54 A;  4KHN A;  4OKJ A;  1UOC A;  4E89 A;  4FLX A;  4E7I A;  2HNY A;  4B9S A;  3HL8 A;  3RRG A;  3AVI A;  5EU7 A;  1QSL A;  1WSH A;  3KD5 E;  4QCL A;  3VQP A;  4DMN A;  4Z4C A;  4UQG A;  4LH4 A;  3K57 A;  1CZB A;  4PWD A;  2Y1I A;  4DQI A;  4M3Z A;  2LSN A;  4B08 A;  2FBX A;  4DTJ A;  1RBS A;  3OYN A;  4DTP A;  3OYC A;  4KKO A;  4W5O A;  3CM5 A;  4DF8 A;  3TAE A;  1NKE A;  3RR8 A;  4QOZ B;  4DTS A;  4AHU A;  3MED A;  1T05 A;  3SZ2 A;  3O3F A;  3PX0 A;  1D5A A;  5J2P A;  4CFB A;  2XY7 A;  4F2R A;  2DFF A;  3OS0 A;  3SUN A;  3D0P A;  2HHS A;  4FXD A;  4B9U A;  1EX4 A;  1JXB A;  5CYQ A;  3VQD A;  2IS3 A;  4RW4 A;  4DF4 A;  1UA0 A;  4B3O A;  5I42 A;  3PUF A;  3UIQ A;  3DOK A;  1RDC A;  3T1A A;  4KRE A;  4DQS A;  3VQQ A;  2E6M A;  2NUB A;  3HPH A;  1EXQ A;  1KVB A;  1BGX T;  1WSF A;  3DRP A;  3MEG A;  4RW7 A;  3TAP A;  4RW9 A;  4ID5 A;  2E4L A;  3V4I A;  4KI4 A;  3SQ0 A;  3KIO A;  1YT3 A;  4KHS A;  5HRR A;  1XI1 A;  5CZ2 A;  1NJX A;  3ITH A;  4DSF A;  1U4B A;  2X74 A;  4CEB A;  1SL1 A;  3OY9 A;  1C1A A;  4FZZ A;  3CQ8 A;  3PO4 A;  4CEA A;  3V9U A;  3AA2 A;  4L8R B;  3AVH A;  3RMB A;  2DY4 A;  4IFY A;  4Q0B A;  1C0M A;  1RDB A;  3VQ9 A;  3WNF A;  4KB1 A;  3EZ5 A;  4JS4 A;  3V6D A;  1LW0 A;  2YNG A;  5E41 A;  4LSN A;  4BE0 A;  2Y1J A;  4Q5V A;  4KV8 A;  3S3M A;  2PY5 A;  3HP9 A;  3VQ6 A;  3KJV A;  2HHX A;  1S5J A;  3DMJ A;  3QIN A;  3THV A;  4FK4 A;  4FLT A;  2PYJ A;  3K59 A;  4E1N A;  1A5W A;  2ITG A;  4FLU A;  1BIZ A;  3HVT A;  1RT3 A;  3KKR A;  3NBP A;  3AVN A;  4E0D A;  5C42 A;  4KB0 A;  3VN5 A;  4CGI A;  3ZT0 A;  4CJP A;  1XHX A;  4CED A;  2HVH A;  2IGI A;  1JXE A;  1BCM A;  4CER A;  3OYD A;  3KK3 A;  1NJY A;  1RTI A;  3M8R A;  1I3A A;  1W0H A;  2D0C A;  1NK5 A;  4FK2 A;  2DFE A;  1L3S A;  4Z0U A;  4HUG A;  4C8L A;  4B8A B;  2HND A;  1RBU A;  1T8E A;  4E19 A;  3JYT A;  2EHG A;  2RN2 A;  4CIF A;  3AV9 A;  3O3H A;  3DLE A;  3V9S A;  4FJJ A;  4FLW A;  4M3Y A;  3AO4 A;  3HVR A;  1B9D A;  3LDS A;  3LP1 A;  3NDK A;  4H4M A;  1HMV A;  4CIE A;  2HHU A;  3ASM A;  3ZSV A;  2GUI A;  4CEZ A;  5DK5 A;  3VQB A;  3QEV A;  4B8C A;  4Z4H A;  1VSI A;  1QSS A;  4ZTF A;  1RT4 A;  4CJ4 A;  4HCC A;  1KLM A;  3TR8 A;  4DTM A;  1NK4 A;  2BE2 A;  1BHL A;  1REV A;  1NJZ A;  4H8K A;  1BIU A;  3HK2 A;  1UA1 A;  5C24 A;  2IOC A;  3ZT4 A;  1L3U A;  1IO2 A;  1J5O A;  3KK1 A;  1TAU A;  3QEX A;  4JS5 A;  3QIO A;  4XIU A;  4DSE A;  3C6T A;  1RDA A;  4KHQ A;  4LY7 A;  3L2U A;  4IBN A;  4CF2 A;  2O4G A;  1IKX A;  5HRP A;  2QKK A;  2ETJ A;  2OZS A;  3IRX A;  1SKR A;  4M3U A;  3AA5 X;  4FJ9 A;  4FYD A;  3VQ4 A;  1NKC A;  1BIS A;  3NHG A;  4H4O A;  1D9D A;  1J53 A;  3AVK A;  1ZBU A;  1JL1 A;  4CHP A;  5I3U A;  3LAK A;  4KHW A;  3FFI A;  4FW1 A;  3VQC A;  3LP3 A;  1SUQ A;  4KFB A;  3NH0 A;  2OPP A;  2WON A;  3LAN A;  3OVN A;  3ULD A;  3PX6 A;  4AHC A;  1HNI A;  1NKB A;  4CK3 A;  1CXU A;  4JRP A;  4FM2 A;  5HRO A;  4FJM A;  3K5O A;  2VG7 A;  3V9Z A;  1GOA A;  4GW6 A;  4KTW A;  3LAM A;  4W5R A;  4AH9 A;  1VSJ A;  1ZBH A;  5KGX A;  4FJK A;  3VQ5 A;  3SJJ A;  2YNH A;  1TKX A;  1JLQ A;  2GV9 A;  2VG6 A;  3NF7 A;  4CGD A;  3S3N A;  3DLH A;  3QES A;  3CYM A;  4DFJ A;  4RG8 A;  3ZSO A;  4EP5 A;  3RRH A;  3RMC A;  1X9M A;  1C6V A;  3D45 A;  3PO5 A;  1S9G A;  1SL2 A;  4BWJ A;  1JLB A;  4OKE A;  3LZI A;  4F4K A;  4KHY A;  2RF2 A;  1HYS A;  4O0J A;  4DQR A;  3HST B;  4BWM A;  4FJ5 A;  2QXF A;  3VQE A;  3KK2 A;  1HYZ A;  2Z1H A;  4DU1 A;  3TAR A;  3AA4 A;  1QHT A;  3OYK A;  3L8B A;  3VQ7 A;  3PY8 A;  4HUE A;  3SQ2 A;  1RDD A;  4J2E A;  1CXQ A;  2YNI A;  3ZSQ A;  4CGH A;  1HRH A;  3SUP A;  3PV8 A;  4DS5 A;  4PUO A;  4CK2 A;  1O1W A;  4CJU A;  4BDZ A;  3EYZ A;  3T3F A;  3KKS A;  2HHT A;  4CJ5 A;  5JS1 A;  3OYF A;  5FRO A;  3OYI A;  1IKY A;  1X1P A;  1ZBF A;  2RPI A;  4JRQ A;  2DTU A;  1VK0 A;  3KLE A;  4EP4 A;  3ZT2 A;  5DMR A;  2OZM A;  3G10 A;  3NF8 A;  4R5P A;  4FJ7 A;  4M3W A;  2ATQ A;  4DS4 A;  1K6Y A;  2G8U A;  4DSL A;  3TAG A;  5D3G A;  4G1Q A;  3NE6 A;  4CES A;  1T03 A;  3DYA A;  3LP2 A;  2X6S A;  3SV4 A;  1C0U A;  5HLF A;  1HPZ A;  2HVI A;  2F8S A;  1CLQ A;  1SKS A;  3KD1 E;  1LW2 A;  1QQC A;  3U6F A;  3NH1 A;  2HB5 A;  2BAN A;  4LD0 A;  1EET A;  4E1M A;  4TSX A;  1RT6 A;  2D0B A;  3HT3 A;  1JKH A;  4M3R A;  1NJW A;  2HHV A;  1WAJ A;  4DU3 A;  1S1U A;  2XRI A;  4CF1 A;  1ZBI A;  1RT1 A;  4HVJ A;  1S1T A;  1Q9Y A;  1KRP A;  1BQM A;  4KRF A;  2YV0 X;  3DM2 A;  3BDP A;  1BI4 A;  3TAN A;  1IKW A;  3AVJ A;  4GVM A;  1U45 A;  4CHQ A;  3AVL A;  3DI6 A;  2XO7 A;  4Y1D A;  4F2S A;  1BL3 A;  3SQ1 A;  1WSE A;  3LPU A;  1Z25 A;  2P51 A;  4BAC A;  4FLV A;  4DSK A;  3VA3 A;  3L2V A;  4FLY A;  2KW4 A;  3M8Q A;  1KVA A;  4O44 A;  4CGJ A;  4RW6 A;  4IFV A;  2D5R A;  3NGI A;  4CEQ A;  3P1G A;  3OYB A;  1U49 A;  2I5J A;  2P5G A;  2OPQ A;  3NGY A;  2X78 A;  3P83 D;  2WOM A;  3VQA A;  2VWJ A;  2E6L A;  1TK5 A;  1GOB A;  1YVU A;  3WNE A;  3NCI A;  5HP1 A;  3IAY A;  1TKZ A;  1IG9 A;  4FCY A;  3V1Q A;  2B4J A;  3VQ8 A;  3V9X A;  4DFP A;  1HQU A;  4CK1 A;  4NCB A;  1Q9X A;  2YKN A;  3QET A;  4MFB A;  4CEE A;  1U48 A;  1QS4 A;  1WLJ A;  3LAL A;  4ID1 A;  4FJL A;  1DLO A;  2KQ2 A;  3M8P A;  4CJS A;  3NH2 A;  1VSL A;  1WN7 A;  3OYE A;  4Z4G A;  1JLA A;  3NFA A;  4CHZ A;  4N56 A;  4I2Q A;  2IC3 A;  1L3T A;  4IDK A;  2YHA A;  2B5J A;  1C1B A;  4C8M A;  3H08 A;  4AHT A;  1TKT A;  4CCH A;  3LPT A;  1KTQ A;  2QK9 A;  1YTU A;  4ZTJ A;  4EZ9 A;  1D9F A;  1TK0 A;  4HUF A;  4I7F A;  1LWC A;  3K5M A;  3NAE A;  2XY5 A;  5FRN A;  1WAF A;  4LSL A;  1KCF A;  3JSM A;  4HHT A;  1UWB A;  4KPY A;  1XC9 A;  3P5J A;  4M3X A;  4CGF A;  1ASU A;  1I39 A;  3ZSY A;  1LWE A;  1BCO A;  1KFD A;  2DFH A;  1B92 A;  1VSE A;  3AO3 A;  3OJS A;  1C1C A;  5FDL A;  3ZSW A;  2W42 A;  3WNG A;  3I0S A;  3O4Q A;  4CFC A;  3SUO A;  4BDP A;  1CZ9 A;  2OYQ A;  4DWI A;  4ELU A;  4I2P A;  2Z1G A;  4CJW A;  3NGZ A;  3SCX A;  1TKD A;  5KRS A;  3QNN A;  3NF9 A;  3ZSX A;  4BE1 A;  3QEP A;  3KLG A;  2G8H A;  3ZSR A;  5KTQ A;  4DLG A;  1U04 A;  3C6U A;  3LP0 A;  4GMJ B;  3SPY A;  3S3O A;  5T7B A;  1Y97 A;  3BGR A;  3OYJ A;  1F21 A;  3QO9 A;  2IDO A;  5C25 A;  3OJU A;  3WNH A;  4DFK A;  1W9H A;  2EX3 A;  2YNF A;  3AA3 A;  5J2M A;  1DTQ A;  3O4N A;  3SUQ A;  3E01 A;  1VRT A;  3KLI A;  2OPR A;  1J9A A;  2ZD1 A;  4W5N A;  4E3S A;  1KFS A;  3AVM A;  3DOL A;  3RMD A;  1JLC A;  4FLZ A;  4ICL A;  1B9F A;  4FJ8 A;  3AVG A;  1JLG A;  2PYL A;  1TK8 A;  3T19 A;  4BDY A;  1TL1 A;  1XWL A;  2OA8 A;  3L2W A;  1NK0 A;  4F3O A;  1WNS A;  4NYF A;  4Y1C A;  3HJF A;  3V1R A;  4FW2 A;  4K8Z A;  2G8F A;  4N76 A;  5KRT A;  4FZX C;  4FJN A;  1RIL A;  3CM6 A;  3AO1 A;  3I0R A;  1LWF A;  1NOZ A;  4BE2 A;  4AHV A;  3QNO A;  3HYF A;  1IKV A;  3OYL A;  3S9H A;  1N5Y A;  4DSI A;  4CJQ A;  3MXI A;  1RBT A;  1FXX A;  4N47 A;  4DQQ A;  3MEE A;  2A1R A;  3K5L A;  3ALY A;  1G15 A;  2BDP A;  4OLB A;  1KSP A;  1RBR A;  2FC0 A;  1RNH A;  4CE9 A;  4CJT A;  5JS2 A;  1T7P A;  4FJI A;  4N5S A;  1JLE A;  3OYA A;  3G0Z A;  1ZBL A;  4IKF A;  2R7Y A;  4K8X A;  4OLA A;  3PX4 A;  2Z1J A;  3TAB A;  2ZE2 A;  4O0I A;  5J2N A;  1S6P A;  1FK9 A;  3OS2 A;  3U3G A;  1FKP A;  5HBM A;  1Q8I A;  3IS9 A;  1VSH A;  5HRN A;  3I8D A;  4FJX A;  1N6Q A;  4DTX A;  1NK7 A;  3RWU A;  1SV5 A;  1VRU A;  1SKW A;  5FRM A;  4B9V A;  5KGW A;  2KTQ A;  3AO5 A;  1YTA A;  3QLH A;  3CFR A;  4FZY A;  1VSM A;  2A1S A;  1WSG A;  3F9K A;  3TAM A;  3MAQ A;  4AIL C;  2G8K A;  4CHN A;  3CFO A;  4CGG A;  3OYM A;  1LAW A;  2F8T A;  4C8K A;  4CJV A;  1KLN A;  1EKE A;  1ZYQ A;  3AO2 A;  3KLH A;  3TWH A;  2Z1I A;  4E7H A;  4J2D A;  2QKB A;  2B6A A;  1JLF A;  1S6Q A;  2RKI A;  3B6P A;  4DTU A;  4Z4F A;  3C94 A;  3SV3 A;  1LAV A;  4F8R A;  1FKO A;  4IG0 A;  1HQE A;  4M45 A;  3HO1 A;  3C95 A;  2KFZ A;  1HYV A;  2IAJ A;  4CJ3 A;  4PA1 A;  1X9W A;  3AVF A;  2HHW A;  1TVR A;  4OGE A; 
#chains in the Genus database with same CATH topology
 1XC3 A;  3AVB A;  3QEI A;  3HM9 A;  1R59 O;  3DRR A;  4I6M B;  5SZT A;  4FK0 A;  2OPS A;  4NLB A;  4KBO A;  4O5F A;  5EY4 A;  2HHW A;  3LWL A;  3T1H K;  2P9P B;  4RTF D;  1TL3 A;  3HPO A;  4Z4I A;  1S1W A;  3U3Y A;  4DTN A;  3CJB A;  4B3M K;  4CZE A;  3T7Z A;  4OPK A;  2VWK A;  2FBV A;  1TV6 A;  1ESV A;  3CQX A;  2FLO A;  3D2E A;  4YHH K;  3HOT A;  3CG7 A;  2A41 A;  3MEC A;  4B9L A;  1TAQ A;  3SQ4 A;  3OYH A;  1V4T A;  2JLE A;  3F73 A;  3KHY A;  4JI8 K;  3L3V A;  5FLX O;  3SYZ A;  3TTD A;  1HPM A;  1HJR A;  1K8A O;  3HXM A;  1Q86 O;  5HRS A;  1U47 A;  4MO5 A;  4CZJ A;  3A2F A;  3QER A;  4KAZ A;  4RW8 A;  2F7T A;  2KZM A;  5BN8 A;  3HZ6 A;  1DTT A;  4B9T A;  1UAX A;  2NLX A;  4N41 A;  3RR7 A;  4CJE A;  1NBW A;  3R3L A;  3O3G A;  4BC2 A;  5J2Q A;  1HKC A;  5HL7 L;  4B9M A;  3K58 A;  2Q1N A;  2KZZ A;  4CZG A;  3CCE N;  2V51 B;  1NK9 A;  3EY1 A;  4PQU A;  3HPG A;  1ATS A;  1NGF A;  3LDQ A;  3EKU A;  4QAG A;  4OX9 K;  2YKM A;  3QEW A;  4CJR A;  2CGK A;  1BDG A;  4DTR A;  1XNR K;  4YOW A;  2G8W A;  4FM0 A;  1KVC A;  2Q31 A;  1S9E A;  4BR0 A;  4A57 A;  5M1F A;  4ELT A;  4X62 K;  5LMU K;  2KKZ A;  3MXM A;  1ILY A;  2XY6 A;  4CBX A;  1TUY A;  3Q7C A;  2HNZ A;  5CZ1 A;  4YFU A;  1YVN A;  4CFD A;  1RCH A;  4DTO A;  3D7E O;  4IG3 A;  1MU2 A;  4OKK A;  4JYA K;  3L3U A;  1UOC A;  1N32 K;  1TYQ B;  4BC3 A;  4E7I A;  4WQ5 C;  3AVI A;  1QSL A;  4H03 B;  3CCV N;  2H3G X;  4LH4 A;  4PWD A;  2Y1I A;  4M3Z A;  3FR0 A;  4R79 A;  1ZXO A;  2FBX A;  4LFB K;  1RBS A;  4WYB A;  3OYN A;  2UXC K;  3ZEU B;  3UKR B;  5LY3 A;  1O13 A;  2PAV A;  3A0I X;  3SZ2 A;  3O3F A;  4CFB A;  1NGG A;  1NGB A;  3A5O C;  3RVC A;  3UB5 A;  2HHS A;  4FXD A;  2NRH A;  3O9T A;  4RW4 A;  3CD6 N;  3THY A;  1FJG K;  1XMQ K;  1E4G T;  1RDC A;  3T1A A;  4KRE A;  3THX A;  4UY8 O;  2E6M A;  3HPH A;  1KVB A;  1WSF A;  1BGX T;  1D4X A;  4RW7 A;  4RW9 A;  2E4L A;  3V4I A;  3TSQ A;  4KHS A;  2Q0R A;  2P9L B;  4K0K K;  4FOI A;  4CEB A;  4CZL A;  4FZZ A;  2JWL A;  3CQ8 A;  3AA2 A;  5LJV A;  3AVH A;  4M7X A;  3VGK A;  2DY4 A;  1C0M A;  3IMX A;  1NMD A;  4H0P A;  4LSN A;  4BE0 A;  2Y1J A;  4KV8 A;  4GV3 A;  3HP9 A;  4V19 S;  3KJV A;  2HHX A;  3DMJ A;  3VTH A;  2A5X A;  3K59 A;  3HVT A;  1RT3 A;  4E0D A;  5C42 A;  4IOC L;  3CCU N;  3PLA A;  4CER A;  3M8R A;  1W0H A;  1Q18 A;  1BA1 A;  2DFE A;  1L3S A;  4C8L A;  1RBU A;  4NLC A;  4FJJ A;  3JS6 A;  4FLW A;  3LP1 A;  4FWM A;  2YHX A;  3O5B A;  4CEZ A;  1HKB A;  3QEV A;  5TKY A;  4BRE A;  1VSI A;  4Z4H A;  1QSS A;  5GAH P;  4DTM A;  1NK4 A;  1BHL A;  5C12 A;  1BIU A;  3F5T A;  1OH8 A;  1IO2 A;  3KK1 A;  1TAU A;  3LM2 A;  5AQL A;  5BRH A;  3N4Q A;  4FJ9 A;  4FYD A;  4YDU C;  4H4O A;  5MLC Q;  1J53 A;  1ZBU A;  1JL1 A;  5IWA K;  1IBM K;  3LP3 A;  2QWP A;  2OPP A;  3PX6 A;  2E8A A;  4CK3 A;  1VAZ A;  4BG8 A;  5KPT A;  4FM2 A;  2GUP A;  5HRO A;  4FJM A;  3PSF A;  5CHI A;  1GOA A;  1I94 K;  2O8B B;  3ID8 A;  5EOY A;  1TKX A;  1JLQ A;  2GV9 A;  3NF7 A;  2FF3 B;  3O9U A;  3QES A;  4EP5 A;  3P38 A;  4K41 A;  1C6V A;  1SL2 A;  3LZI A;  2RF2 A;  1VQ9 N;  1HYS A;  3HST B;  3R1X A;  2BUP A;  2P9S A;  4FJ5 A;  3MWT A;  2Z1H A;  3OYK A;  2NNW A;  2IVN A;  3WQU A;  3SQ2 A;  3CC4 N;  1E3M A;  1CXQ A;  4PUO A;  4JKF A;  5FRO A;  3SBT A;  4EHU A;  4JRQ A;  3LM9 A;  2OZM A;  3NF8 A;  5IT9 O;  1KQS M;  5AZI A;  4J8F A;  4JV5 K;  5ADX A;  1RFQ A;  5H1S Q;  3VEX A;  3O9Q A;  5ADX H;  3MX5 A;  1C0U A;  4JI2 K;  1HPZ A;  1SKS A;  1LW2 A;  4BRP A;  2RHK A;  1N33 K;  3E9P A;  3HRG A;  3ZLJ A;  2VQE K;  1RT6 A;  2D0B A;  3QB0 A;  4M3R A;  3HT3 A;  2UYT A;  4DU3 A;  1S1U A;  1RT1 A;  1Q9Y A;  4FO0 A;  1BQM A;  3DM2 A;  3TAN A;  3C0B A;  3AVJ A;  3OW2 M;  4B1U B;  4DR2 K;  4FLV A;  4BAC A;  4DUY K;  4B1Y B;  4FLY A;  4A61 A;  5C2D A;  3OYB A;  3GBT A;  3NGY A;  4FCY A;  3V1Q A;  2B4J A;  4CK1 A;  1Q9X A;  2YKN A;  4LF6 K;  1QS4 A;  3M1F A;  3R6M A;  1VSL A;  4DV7 K;  1TUU A;  1L3T A;  4JKG B;  4AHT A;  4C8M A;  1TKT A;  1D9F A;  1TK0 A;  4HUF A;  4X64 K;  5FRN A;  3VEN A;  3KWG A;  2KLA A;  3HBT A;  4Z94 A;  4JI5 K;  2OAN A;  3JSM A;  4CD3 A;  4HHT A;  5AQR A;  1XC9 A;  1E4F T;  4KPY A;  4A5A A;  4CGF A;  1ASU A;  1LWE A;  2DFH A;  4DV2 K;  1B92 A;  1VSE A;  4BRA A;  3AO3 A;  3K9K A;  5FDL A;  3ENO A;  5GIP A;  4BDP A;  4JI6 K;  4MLH A;  4BE1 A;  3KLG A;  2G8H A;  3ZSR A;  4AQY K;  3HTV A;  4DLG A;  3C6U A;  5JVH L;  5AQG A;  5M1O A;  3TTF A;  1F21 A;  3ZET A;  2IDO A;  5C25 A;  3OJU A;  2JWK A;  4DFK A;  4FWR A;  3DXM A;  5J2M A;  3H3O B;  3U4L A;  3KLI A;  5BRE A;  3KVG A;  2QEX N;  3H1V X;  3DOL A;  3RMD A;  1JLC A;  1BG3 A;  1B9F A;  3WEE A;  4EAH D;  1JLG A;  2PYL A;  1DEJ A;  1TL1 A;  4CBU A;  5AQH A;  3BEX A;  4NYF A;  3CI5 A;  4K8Z A;  4N76 A;  1GLB G;  1RIL A;  2RE2 A;  2ZJR L;  1LWF A;  4AHV A;  3BP8 A;  3H6E A;  4CJQ A;  2A1R A;  1RBT A;  1OH5 A;  3MEE A;  1NNE A;  3K5L A;  3EEQ A;  2CH5 A;  4U67 L;  1KSP A;  5ELZ A;  1RNH A;  5JS2 A;  5AZJ B;  5KQ8 A;  4K8X A;  3TAB A;  5J2N A;  5BRF A;  4FWN A;  3SMP A;  1FKP A;  1GLL O;  5HBM A;  3CIP A;  2QWL A;  2HHH K;  1SKW A;  1ZBS A;  3CCS N;  1QQM A;  5F0X A;  1WSG A;  3F9K A;  3TAM A;  3MAQ A;  3CFO A;  1S72 N;  3TSU A;  4B1V A;  1KLN A;  1EKE A;  1ZYQ A;  3AO2 A;  5CE3 A;  3KLH A;  4JK8 A;  2Q2R A;  3B6P A;  3HO1 A;  5BPN A;  5AQN A;  4H5T A;  3UE5 A;  3GG4 A;  4J2A A;  1YJ9 N;  4J2B A;  3MN5 A;  3M6G A;  2FBT A;  3ZT3 A;  3VEV A;  4FL9 A;  1T3V A;  3TI0 A;  2ZQB A;  1HNW K;  4NCG A;  1VSD A;  4WE1 A;  4FM1 A;  1XHZ A;  1NLV A;  5AQF A;  2G8V A;  4G9Z A;  1JJ2 M;  2BTF A;  1EP4 A;  4E7K A;  4LH5 A;  2J4R A;  2IVP A;  3BY5 A;  4BRC A;  4IWV A;  3KTQ A;  1C0T A;  4Y0W A;  4CJK A;  1WBD A;  2E2P A;  4JKD A;  3DLK A;  4KO0 A;  1QQN A;  1BQN A;  3FLC O;  1ASW A;  1RT7 A;  4LC9 B;  4KTQ A;  3K2P A;  2ITM A;  3ZX0 A;  1QSY A;  4FJG A;  3ZCM A;  3N4P A;  1LV5 A;  2E88 A;  4A5B A;  1RTD A;  4KHU A;  1VSK A;  1SL0 A;  3DLR A;  4ELV A;  1IBL K;  4HCB A;  4IZ9 A;  1J6Z A;  4OJR A;  1RT2 A;  4AHR A;  3HP6 A;  2FSK A;  2JGU A;  1K9M O;  1GLE G;  1YJW N;  5CYM A;  2XY8 A;  3L2Q A;  1YAG A;  1L5U A;  1RTH A;  2UUC K;  5CR4 A;  4JKA A;  1Z6R A;  4BR4 A;  4AM7 A;  3F9M A;  4BR7 A;  3B6O A;  3OYG A;  3B8A X;  3FE1 A;  3TAQ A;  1WSJ A;  4BC5 A;  2UUA K;  1YIJ N;  4KHP K;  2F96 A;  3MXJ A;  4F3T A;  2CH6 A;  2PZS A;  3ZSZ A;  4NXN K;  2P9N A;  5JIC A;  4IDH A;  5AQW A;  4CJF A;  4AM6 A;  3AGR A;  4E7J A;  3NF6 A;  1GLF O;  4IJN A;  4FPA A;  3IDH A;  1D8Y A;  1VQP N;  4OPJ A;  2KFN A;  4YOT A;  1GLD G;  3QDK A;  4CF0 A;  1VSF A;  3QIP A;  4DSJ A;  4ILJ A;  1KD1 O;  1X9S A;  2QWQ A;  4JI0 K;  3SK3 A;  4F9O A;  1J54 A;  2Q0U A;  4FVU A;  4X65 K;  4YOX A;  2O8D B;  4CW7 B;  3HL8 A;  3RRG A;  4QCL A;  2DPN A;  4DMN A;  4UQG A;  3OYC A;  4W5O A;  3CM5 A;  4DV3 K;  3K9J A;  2W41 A;  1T05 A;  1LOT B;  4GKK K;  2DFF A;  5C2F A;  4RCH A;  1EX4 A;  1JXB A;  2IS3 A;  3H1Q A;  3ATU A;  4DF4 A;  4H5W A;  5I42 A;  3UIQ A;  4L3Q A;  1IV0 A;  4DQS A;  4ISE A;  3EE9 A;  4KI4 A;  4FSV A;  3SQ0 A;  5HRR A;  4XH4 A;  1NMN A;  3DWL A;  3J7Z O;  2EWS A;  3PO4 A;  3V9U A;  4DR3 K;  2W6L A;  4L8R B;  3P39 A;  4IFY A;  3VQ9 A;  3WNF A;  4JS4 A;  3V6D A;  2YNG A;  2PY5 A;  4LF9 K;  4Q5V A;  3S3M A;  2D0P A;  1EO1 A;  2FF6 A;  1NGI A;  4QS9 A;  3SMS A;  4E1N A;  1A5W A;  2ITG A;  1BIZ A;  3CCM N;  1HX1 A;  3CJ1 A;  3U9Z A;  1XHX A;  2I7N A;  4JKH A;  1DT9 A;  1NK5 A;  2D0C A;  4FK2 A;  4HUG A;  4B8A B;  2HND A;  1T8E A;  4E19 A;  2RN2 A;  2ZGY A;  3V9S A;  5BR9 A;  3D2E B;  4WFB L;  1IBK K;  3R9P A;  4PKG A;  1MWM A;  3LDP A;  3E9O A;  3NDK A;  4H4M A;  3CMA N;  1EQY A;  3ZSV A;  2GUI A;  1VQ4 N;  1HLU A;  3VQB A;  5AQS A;  4ZTF A;  3O80 A;  5AQU A;  1KLM A;  5AR0 A;  2BE2 A;  1REV A;  3O9S A;  1UA1 A;  5C24 A;  2OTL N;  1G99 A;  4JS5 A;  4XIU A;  4CF2 A;  2O4G A;  2QKK A;  1SKR A;  3O1W A;  4M3U A;  4U7B A;  1BIS A;  3NHG A;  3NVK A;  3QML A;  4KHW A;  3VQC A;  4GVE A;  4KFB A;  1SUQ A;  3GE1 A;  2QW9 A;  2WON A;  4YOR A;  3VER A;  1CXU A;  3FZM A;  4BGB A;  4KTW A;  1RDU A;  4W5R A;  4AH9 A;  4C1N K;  3FZF A;  1ZBH A;  2E2N A;  5KGX A;  5JVG L;  3VQ5 A;  1QQO A;  4JNE A;  4DB3 A;  1S3X A;  3BZK A;  3DLH A;  3CYM A;  1K8K A;  1NGJ A;  2FSJ A;  4RG8 A;  1X9M A;  3RRH A;  3D45 A;  3PO5 A;  4F4K A;  4KHY A;  2D1K A;  4DQR A;  2QXF A;  3AA4 A;  1QHT A;  2ASM A;  3L8B A;  3VQ7 A;  4WCE L;  4HUE A;  4QS7 A;  2YNI A;  3ZSQ A;  4CGH A;  2QWO A;  1ATR A;  3T3F A;  2UXB K;  2HHT A;  4JHD A;  4CJ5 A;  3OYF A;  2O8C A;  3OYI A;  1X1P A;  2RPI A;  4H5R A;  3VGM A;  4EP4 A;  5DMR A;  3AY9 A;  4R5P A;  4DR6 K;  2V52 B;  1K6Y A;  4DS4 A;  3O8M A;  3NE6 A;  3DXK A;  3W3D A;  4CES A;  5HLF A;  4C23 A;  4H0V B;  4BRD A;  1Q81 O;  1CLQ A;  3KD1 E;  3CCR N;  4CD1 A;  1JKH A;  1WAJ A;  3MN7 A;  4CF1 A;  1S1T A;  3THY B;  4DHY A;  1BI4 A;  1IKW A;  2Q97 A;  3THX B;  1Z05 A;  4Y1D A;  3I55 N;  3M5R A;  1WSE A;  2W40 A;  1Z25 A;  1BA0 A;  3AAQ A;  3I8B A;  3LDL A;  3CXC M;  3VA3 A;  3L2V A;  1KVA A;  4O44 A;  3QBX A;  4RW6 A;  4WF9 L;  3UKU A;  5AQK A;  1U49 A;  3JXU A;  5E26 A;  2P5G A;  3VEO A;  3VQA A;  2WOM A;  4FWS A;  1TK5 A;  3WNE A;  3NCI A;  3IAY A;  1TKZ A;  5FPD A;  1IG9 A;  3VQ8 A;  3V9X A;  1HQU A;  4NCB A;  5EX5 A;  3QET A;  3BF1 A;  1NGH A;  4CEE A;  1U48 A;  1WLJ A;  5GIN A;  1NGA A;  1WN7 A;  4JN4 A;  1JLA A;  3NFA A;  4CHZ A;  4N56 A;  3UKU B;  4I2Q A;  1M90 O;  2YHA A;  2B5J A;  4CCH A;  2QK9 A;  4FWO A;  1NU0 A;  3K5M A;  3L4I A;  1OVQ A;  4LSL A;  2PFU A;  5TKW A;  5BPL A;  1KCF A;  4B3R K;  1BU6 O;  1VQK N;  3SAF A;  1BCO A;  1KFD A;  1C1C A;  2OYQ A;  1YXQ A;  3I0S A;  3CCQ N;  4BY9 C;  3NGZ A;  3ULE A;  5KRS A;  3QNN A;  1T6D A;  2E1Y A;  1U04 A;  1Y97 A;  3QO9 A;  1IJJ A;  3WNH A;  1DTQ A;  1BWF O;  1J9A A;  1KFS A;  3PIP L;  2P9K A;  4FJ8 A;  1NG9 A;  5C10 A;  1MWK A;  1TK8 A;  4YOV A;  3L2W A;  1NK0 A;  4F3O A;  2ZM6 K;  1WNS A;  2WUS A;  4H5N A;  3I0R A;  2PBD A;  4BE2 A;  2HBJ A;  3HYF A;  1N5Y A;  3S9H A;  2P9K B;  3Q7B A;  3MXI A;  4N47 A;  3CJA A;  3ALY A;  2HBK A;  3VEY A;  1VQ5 N;  5AQQ A;  2ZJQ L;  1JLE A;  3VMF B;  1ZBL A;  2FSN A;  3VF2 A;  4IKF A;  3CER A;  2P9S B;  2ZE2 A;  4BGA A;  1FK9 A;  4DKW A;  3OS2 A;  3IS9 A;  4CZK A;  1SV5 A;  2KTQ A;  1YTA A;  3QLH A;  1QZ5 A;  3O1B A;  4FWQ A;  2P9U A;  3C7N A;  4IOX A;  3DJC A;  4JI4 K;  5AZI B;  4C8K A;  3CQY A;  4J2D A;  1JLF A;  4DTU A;  3SV3 A;  1LAV A;  3CPE A;  4IG0 A;  4M45 A;  2UXD K;  3C6H A;  5JLF A;  3FZL A;  1L3V A;  1OH7 A;  2I7P A;  3U3G A;  4BQZ A;  4PY5 A;  2O8F A;  1DGK N;  1JL2 A;  4K43 A;  4CJ7 A;  3C6A A;  4OVL A;  4YNQ A;  3EKS A;  5AQZ A;  4WFN L;  1ASV A;  4DLE A;  4O55 A;  2CGL A;  4K42 A;  5M1N A;  4C8O A;  3CPW M;  3LZJ A;  4FPB A;  3QBW A;  4M41 A;  2A3Z A;  2HMI A;  3IG1 A;  3CME N;  4B9N A;  2AJQ A;  1Q82 O;  2G8I A;  4DR7 K;  5AQI A;  5EVZ A;  3TAF A;  3G4S N;  3LDN A;  1SQK A;  3DLL L;  3T1Y K;  4JK7 A;  3F2K A;  5KI6 A;  1NK8 A;  2X6N A;  4FJH A;  4JKC A;  4O5B A;  3C65 A;  3DRS A;  5CY4 A;  4DV4 K;  1WSI A;  5BR8 K;  4BC4 A;  5LJW A;  2D0O A;  2F9W A;  3RMA A;  4BRQ A;  4KTZ A;  2YHB A;  4NYN A;  4JI3 K;  1ITG A;  4EHT A;  1RTJ A;  3H46 O;  3AVC A;  2IIR A;  3J8A A;  4DG1 A;  4X66 K;  3AVA A;  1NK6 A;  4CEC A;  4DQ8 A;  4NCA A;  4CEF A;  5SWM A;  4DFM A;  4LF5 K;  4CHO A;  5B8H A;  3ZET B;  3CFP A;  3VA0 A;  4M42 A;  3DXM B;  4ZHR A;  1QTM A;  3CJC A;  3BF3 A;  4BRN A;  4JLH A;  4DU4 A;  4B9Q A;  4RWT A;  3THW A;  1TGO A;  1HR0 K;  3WEE B;  3HOS A;  4KH6 A;  3O9R A;  4YY3 K;  5DM6 L;  3DLB A;  1SAZ A;  4FOE A;  4B1X B;  3ISN C;  2FBY A;  1GOC A;  2GBZ A;  1A5V A;  4M7Y A;  1RT5 A;  1OH6 A;  4I9L A;  4EZ6 A;  3K5N A;  1N34 K;  4Z4E A;  4LFC K;  4KHN A;  4FLX A;  5KQD A;  1EWR A;  1WSH A;  2P9I A;  3E9L A;  3RSE A;  4DQI A;  3VET A;  1NJY A;  3TAE A;  2BGG A;  4KKO A;  4QOZ B;  1NKE A;  4AHU A;  3MED A;  3PX0 A;  1D5A A;  5J2P A;  3O4W A;  1U2V A;  1H1V A;  1YIT N;  3OS0 A;  3SUN A;  4C1N I;  4IEI A;  2ZWH A;  1XUP O;  3MDQ A;  5AQO A;  1UA0 A;  2O8E A;  3PSI A;  1VQM N;  3PUF A;  3FFK B;  3DOK A;  1FW6 A;  1EXQ A;  3DRP A;  3MEG A;  1NM1 A;  1YT3 A;  1XI1 A;  1XMO K;  1NJX A;  4CZM A;  1U4B A;  2OTJ N;  1SL1 A;  1C1A A;  5C0Y A;  1ATN A;  4BRK A;  5GAE P;  3D2F A;  3RMB A;  4KB1 A;  1LW0 A;  3TTC A;  3WT0 A;  2NRT A;  1S5J A;  3QIN A;  4FK4 A;  4YOU A;  4FLT A;  1MA9 B;  3BZC A;  4FLU A;  4FWK A;  1KXP A;  3KKR A;  3P4I A;  3H45 C;  5M1K A;  3VN5 A;  3ZT0 A;  2IVO A;  3BUZ B;  4CJP A;  1QVG M;  4XH1 A;  2IGI A;  1JXE A;  3U8X A;  1RTI A;  3OTO K;  3I33 A;  4BRI A;  3JYT A;  3AV9 A;  3DLE A;  3ZX3 A;  3HVR A;  1B9D A;  5AQM A;  2NRX A;  4BRF A;  1MDU B;  3WXK A;  4CIE A;  3S41 A;  1J5E K;  2E5L K;  3MCA B;  5DK5 A;  2WBN A;  4CJ4 A;  4HCC A;  1P8Z A;  4DV5 K;  4JD2 A;  5AQV A;  3HK2 A;  3ZT4 A;  4BRG A;  3L6Q A;  1J5O A;  2OCE A;  2ZJP L;  3QEX A;  2CGJ A;  3C6T A;  4KHQ A;  3L2U A;  3TU5 A;  2VGM A;  5A2Q O;  3IRX A;  3AA5 X;  3VOV A;  3W0L A;  2GWK A;  3VQ4 A;  1NKC A;  3AVK A;  3LAK A;  4FW1 A;  4JD2 B;  1LCU A;  3M3Z A;  3OVN A;  4AHC A;  1HNI A;  1NKB A;  4LFA K;  2QXL A;  2QM1 A;  2VG7 A;  3V9Z A;  4EIA A;  3LAM A;  4OO1 J;  4ISF A;  3D6R A;  4FJK A;  2YNH A;  3P31 A;  2VG6 A;  2P9N B;  4CGD A;  1Q7Y O;  4DFJ A;  1X9J A;  4BRO A;  1S9G A;  4BWJ A;  4OKE A;  1NGC A;  3WXJ A;  2QI2 A;  3VQE A;  3KK2 A;  4ILH A;  1HYZ A;  1JCG A;  4CZF A;  3PY8 A;  1RDD A;  1HRH A;  4IOA L;  2HST A;  3PV8 A;  4DS5 A;  2KHO A;  1O1W A;  4CJU A;  4BDZ A;  3CC7 N;  1ZBF A;  1OVY A;  1VK0 A;  3KLE A;  3MN6 A;  3G10 A;  4HTL A;  1WUA A;  5KPR A;  4FJ7 A;  2ATQ A;  3L4Q A;  4DR1 K;  2G8U A;  4DSL A;  5GAG P;  4G1Q A;  4CBW A;  1T03 A;  3SLC A;  3DYA A;  3LP2 A;  2X6S A;  3SV4 A;  3E66 A;  4AF1 A;  5JLH A;  2F8S A;  1WOQ A;  1QQC A;  1N36 K;  3U6F A;  3NH1 A;  1VQL N;  1EET A;  1U6Z A;  1NJW A;  2HHV A;  2QWR A;  4PKH A;  4I6M A;  2WTU A;  1ZBI A;  5JMV A;  5HOO A;  3OBW A;  4HVJ A;  3KWI A;  4KRF A;  1KRP A;  2YV0 X;  4CZH A;  4DV1 K;  1U45 A;  3AVL A;  2P9P A;  2XO7 A;  4F2S A;  1BL3 A;  4DSK A;  2KW4 A;  3M8Q A;  1KC8 O;  4CGJ A;  3NGI A;  4IFV A;  2D5R A;  4LF4 K;  3CJ9 A;  2I5J A;  2V7Y A;  2OPQ A;  2X78 A;  2NRW A;  1W97 L;  2GTD A;  4DFP A;  2GWJ A;  2QWM A;  1BO5 O;  3VPZ A;  4FJL A;  4ID1 A;  1DLO A;  3NH2 A;  3OYE A;  4A62 A;  5GAD P;  1VQ7 N;  4IDK A;  5EXW A;  2AA4 A;  5AQJ A;  3VGL A;  1YUW A;  1YTU A;  4O8K A;  4I7F A;  2NRZ A;  1UWB A;  3P5J A;  1I39 A;  3ZSY A;  1QZ6 A;  4DUZ K;  4PKI A;  4MO4 A;  4HWI A;  3ZSW A;  3WNG A;  4CFC A;  3SUO A;  4NXM K;  1CZ9 A;  4ELU A;  4I2P A;  2Z1G A;  4CJW A;  3SCX A;  3NF9 A;  3QEP A;  5KTQ A;  3I56 N;  5AQT A;  4GMJ B;  3LP0 A;  5T7B A;  2YJF A;  5FPN A;  4A2A A;  4GKJ K;  2EX3 A;  2YNF A;  3O4N A;  3SUQ A;  1VRT A;  1W2B M;  4GY2 B;  2GX9 A;  3U9D A;  4ICL A;  3AVG A;  5AJ3 K;  3T19 A;  1XWL A;  3L0Q A;  3GDQ A;  1XNQ K;  2YI1 A;  4Y1C A;  2HF3 A;  4FW2 A;  5KRT A;  4FZX C;  2VGN A;  1NOZ A;  5LL6 Z;  3QNO A;  1IKV A;  4XEI A;  3OYL A;  2YX6 A;  4IEE A;  4QS8 A;  1K73 O;  1TYQ A;  2QTD A;  3AAR A;  1RBR A;  4CE9 A;  5GIO A;  3KK7 A;  1K8K B;  3EE8 A;  3G0Z A;  3ZEU A;  3UKR A;  1NGD A;  2R7Y A;  4B1Z A;  3PX4 A;  2UUB K;  1S6P A;  1GLC G;  3A5L C;  3VEZ A;  2VCP A;  4B9V A;  4JHD B;  3CFR A;  2O8C B;  1VSM A;  3VF4 A;  2A1S A;  2HF4 A;  2A42 A;  3PIO L;  4AIL C;  2NZT A;  4CHN A;  2P9L A;  4CJV A;  3OBY A;  3DXK B;  3TWH A;  2Z1I A;  4E7H A;  2QKB A;  1S6Q A;  3C94 A;  2AP1 A;  4F8R A;  2KFZ A;  1VQ8 N;  1HQE A;  3C95 A;  1HYV A;  2IAJ A;  4CJ3 A;  4PA1 A;  1X9W A;  4JKE A;  3AVF A;  1TVR A;  1RBV A;  3G25 A;  4MQ3 A;  4BR9 A;  3SNN A;  4MLE A;  1HJO A;  2E1Z A;  1T44 A;  2D0A A;  4AHS A;  3DLG A;  1BI4 B;  5FPE A;  4M3T A;  3SAH A;  5K14 A;  1NJI O;  4CJL A;  3ZT1 A;  2HW3 A;  3QFU A;  1X3M A;  3V9W A;  4FVM A;  3M8S A;  4DQP A;  4KI6 A;  3V1O A;  5F2R A;  2P5O A;  1VQO N;  3FZK A;  4W5T A;  5AQP A;  1KAY A;  5E84 A;  1M1K O;  4O4G A;  3DAW A;  5LMN K;  1HNX K;  2E2Q A;  3LDO A;  2YHY A;  5AFU A;  3J7A P;  3WXI A;  4OGC A;  2VG5 A;  4DV6 K;  1IH7 A;  5AFU H;  1Z26 A;  1R0A A;  3KLF A;  4DCH A;  4A2B A;  4IXC A;  4C8N A;  4WQ4 A;  1WB9 A;  1X3N A;  3HI0 A;  3G6E N;  5J1E A;  1S1X A;  1C0G A;  4I9Q A;  3VTI A;  2ZGZ A;  4CFA A;  1A5X A;  3ULE B;  4DR5 K;  4CIG A;  3WXM B;  2HHQ A;  3MK6 A;  4MDA A;  3OS1 A;  4HTU A;  1EWQ A;  4LF7 K;  1KAZ A;  1NOY A;  1HNV A;  4JI1 K;  4BRH A;  3L2R A;  3VF6 A;  4E7L A;  2O8B A;  4BVO A;  3LWM A;  1S1V A;  4CF9 A;  3WXL A;  2F4V K;  5M1P A;  1QE1 A;  4H0Y B;  3O08 A;  4KH5 A;  4PL8 A;  2QA4 N;  1XQS C;  3FZH A;  1GLA G;  3SI6 A;  2O4I A;  1IG8 A;  4BRM A;  4CI6 A;  3RTV A;  1KAX A;  3GL1 A;  2P1J A;  2VYP A;  2FXU A;  3GOI A;  2Q3S A;  4CEO A;  3MMV A;  2XHB A;  2F9T A;  3O6W A;  1NWK A;  2HMP A;  3V81 A;  4CHY A;  4W5Q A;  3SPZ A;  4CF8 A;  3EL2 A;  3IFR A;  4OKJ A;  4E89 A;  4BQL A;  2HNY A;  4B9S A;  1RGI A;  5EU7 A;  3J7Y P;  3KD5 E;  3FGU A;  3VQP A;  4Z4C A;  3K57 A;  1CZB A;  2LSN A;  4B08 A;  4B9U A;  4DTJ A;  4DTP A;  4DF8 A;  2NRR A;  1QVF M;  1CZA N;  3RR8 A;  4DTS A;  4IO9 L;  4CZI A;  4DV0 K;  2XY7 A;  4F2R A;  2VWB A;  1YJN N;  3D0P A;  3OA9 A;  5CYQ A;  3VQD A;  4B1W B;  4B3O A;  4XH5 A;  3VES A;  2P9U B;  3C7N B;  3VQQ A;  2NUB A;  3TAP A;  3A5N C;  3MWP A;  4ID5 A;  4JKB A;  3KIO A;  5CZ2 A;  3ITH A;  3LL3 A;  4DSF A;  4GV9 A;  2X74 A;  1ZC6 A;  5F1X A;  3OY9 A;  4CEA A;  2WC9 A;  3MN9 A;  4Q0B A;  1RDB A;  3EZ5 A;  2O8F B;  5E41 A;  1P90 A;  3VQ6 A;  1HNZ K;  4JKG A;  3THV A;  2VQF K;  2PYJ A;  3ZYY X;  5C15 A;  3NBP A;  3AVN A;  4EFH A;  4KB0 A;  4CGI A;  4CED A;  3CJ7 A;  2HVH A;  1BCM A;  3OYD A;  3KK3 A;  3K0S A;  1I3A A;  4Z0U A;  3H3N O;  4GNI A;  5BPM A;  4H0O A;  2EHG A;  4IO8 A;  4CIF A;  3O3H A;  4WFA L;  4M3Y A;  3AO4 A;  4GV6 A;  3LDS A;  4YOY A;  4K25 A;  4ILG B;  1HMV A;  3TSP A;  2WFB A;  2HHU A;  3ASM A;  4B3T K;  1RDW X;  4A59 A;  4B8C A;  3CET A;  1RT4 A;  3TR8 A;  1NJZ A;  3ID6 A;  4H8K A;  2IOC A;  1L3U A;  3WUH A;  4WQ5 A;  4DSE A;  3QIO A;  4PHT X;  1RDA A;  4LY7 A;  4IBN A;  4BR2 A;  1IKX A;  5HRP A;  2OZS A;  2ETJ A;  2HOE A;  4MDB A;  3IUC A;  1D9D A;  4CHP A;  5I3U A;  3FFI A;  3NH0 A;  5I9E B;  3ULD A;  2ASO A;  3LAN A;  4NO7 A;  4JRP A;  1SS6 A;  2YJE A;  3K5O A;  1GLJ O;  2HBL A;  2V7Z A;  5AQY A;  4GW6 A;  4H0X B;  1VSJ A;  3EZW A;  3SBG A;  3OHR A;  5KPZ A;  3SJJ A;  5FPM A;  3S3N A;  3KZB A;  3THW B;  3J81 O;  5DM7 L;  2UU9 K;  3HM8 A;  5AZJ A;  4IFE A;  3RMC A;  3ZSO A;  1JLB A;  4BVP A;  4O0J A;  4PL7 A;  4BWM A;  3T69 A;  4DU1 A;  3TAR A;  4J2E A;  3QFP A;  3SUP A;  4H0T B;  1YF5 L;  4CK2 A;  4KH4 A;  3EYZ A;  5JS1 A;  3KKS A;  1IKY A;  2DTU A;  3ZT2 A;  3SAG A;  2BH1 A;  1WBB A;  4M3W A;  2A6A A;  2P9I B;  3TAG A;  1VHX A;  3RSE B;  5D3G A;  1DKG D;  1BOT O;  2HVI A;  2ASP A;  1Y64 A;  2GEL A;  3WQT A;  2HB5 A;  2BAN A;  4LD0 A;  3J80 O;  1U2V B;  2ZF5 O;  3JAM O;  4E1M A;  4TSX A;  3CHW A;  3ZX2 A;  4DR4 K;  1QHA A;  2XRI A;  4B3S K;  2O8E B;  3BDP A;  4OPA A;  4IJA A;  4GVM A;  4CHQ A;  3MX2 A;  3EN9 A;  1VQ6 N;  3DI6 A;  4JI7 K;  2E2O A;  3EO3 A;  3SQ1 A;  3CC2 N;  1HKG A;  3LPU A;  2P51 A;  4E1J A;  4CEQ A;  2HBM A;  3P1G A;  3P83 D;  2VWJ A;  3ENB A;  2E6L A;  1GOB A;  1YVU A;  5HP1 A;  3D2F B;  4YDU A;  4MFB A;  4H5V A;  3LAL A;  2KQ2 A;  3M8P A;  3AGK A;  4ISG A;  4CJS A;  4Z4G A;  2IC3 A;  1V4S A;  1C1B A;  3H08 A;  3G71 N;  3LPT A;  1KTQ A;  4ZTJ A;  4EZ9 A;  2XY5 A;  1LWC A;  3NAE A;  1VQN N;  1WAF A;  3AAP A;  3MCP A;  1W7A A;  1T6C A;  2D4W A;  4O8U A;  4M3X A;  1HUX A;  3OJS A;  4NB4 A;  2W42 A;  4DWI A;  3O4Q A;  2Q36 A;  3CF5 L;  1TKD A;  2E20 A;  4LF8 K;  3ZSX A;  3SPY A;  3E1Y A;  3S3O A;  3BGR A;  3OYJ A;  5AQX A;  3CCL N;  2A40 A;  1C0F A;  1W9H A;  3AA3 A;  4FWL A;  4CVN E;  3E01 A;  2OPR A;  2ZD1 A;  3NMU A;  4W5N A;  4E3S A;  3AVM A;  4FLZ A;  1N8R O;  4BDY A;  2OA8 A;  3R8E A;  3ATV A;  1OKJ A;  3HJF A;  1SZ2 A;  3V1R A;  2NRV A;  2G8F A;  5M1Q A;  4FJN A;  3CM6 A;  4BRL A;  2W6K A;  3AO1 A;  4FWP A;  2QWN A;  4DSI A;  3HSC A;  3QIC A;  1FXX A;  4DQQ A;  4JK9 A;  5BRD A;  1S22 A;  2O8D A;  3A8Y A;  2YHW A;  1YI2 N;  1G15 A;  4WQ4 C;  3CCJ N;  2BDP A;  4OLB A;  2FC0 A;  4CJT A;  1YHQ N;  1T7P A;  4FJI A;  4N5S A;  3OYA A;  5BN9 A;  4JAX A;  4OLA A;  2Z1J A;  1NGE A;  4O0I A;  3TPQ A;  1Q8I A;  4BG9 A;  1VSH A;  5HRN A;  3I8D A;  4M63 C;  4FJX A;  1N6Q A;  4DTX A;  1NK7 A;  3VEW A;  1VRU A;  3RWU A;  4JEP A;  5FRM A;  5KGW A;  2GEM A;  3AO5 A;  4FZY A;  3IKM A;  4BR5 A;  1JCE A;  1JCF A;  2G8K A;  1BUP A;  4CGG A;  3OYM A;  2YCH A;  1LAW A;  2F8T A;  3SJH A;  2B6A A;  2RKI A;  3ENH A;  4Z4F A;  1FKO A;  3A5M C;  4OPH A;  3NVM A;  4OGE A; 
#chains in the Genus database with same CATH homology
 1RBV A;  4MQ3 A;  4PY5 A;  3AVB A;  1JL2 A;  4J2A A;  3QEI A;  3SNN A;  3HM9 A;  4J2B A;  2FBT A;  3DRR A;  4OVL A;  3ZT3 A;  5SZT A;  4YNQ A;  4FK0 A;  3TI0 A;  2OPS A;  1ASV A;  2D0A A;  2ZQB A;  4O55 A;  4AHS A;  4DLE A;  3DLG A;  1BI4 B;  4M3T A;  4NCG A;  1VSD A;  4WE1 A;  5K14 A;  4CJL A;  3LWL A;  4FM1 A;  1XHZ A;  3ZT1 A;  2G8V A;  4C8O A;  2BGG A;  2HW3 A;  1EP4 A;  3LZJ A;  4E7K A;  4LH5 A;  1TL3 A;  3HPO A;  4M41 A;  2HMI A;  3IG1 A;  2AJQ A;  3V9W A;  4B9N A;  4Z4I A;  4FVM A;  3M8S A;  1S1W A;  3U3Y A;  3KTQ A;  4DQP A;  2G8I A;  4DTN A;  1C0T A;  4KI6 A;  3V1O A;  4CJK A;  4OPK A;  2VWK A;  3TAF A;  2FBV A;  2P5O A;  1TV6 A;  3DLK A;  4KO0 A;  1BQN A;  4W5T A;  1ASW A;  3CG7 A;  3MEC A;  1RT7 A;  4KTQ A;  4B9L A;  1TAQ A;  4O4G A;  3SQ4 A;  5KI6 A;  3OYH A;  2JLE A;  2X6N A;  3F73 A;  4O5B A;  1NK8 A;  4FJH A;  3K2P A;  3DRS A;  3L3V A;  1QSY A;  5CY4 A;  3SYZ A;  4FJG A;  3ZCM A;  1LV5 A;  1HJR A;  4KHU A;  1RTD A;  1WSI A;  3HXM A;  1VSK A;  5HRS A;  1U47 A;  4OGC A;  1SL0 A;  2VG5 A;  3DLR A;  1IH7 A;  3A2F A;  1Z26 A;  3QER A;  4KAZ A;  4RW8 A;  4ELV A;  1R0A A;  2KZM A;  3KLF A;  4HCB A;  1DTT A;  4C8N A;  3RMA A;  4OJR A;  4B9T A;  1RT2 A;  1UAX A;  4KTZ A;  4AHR A;  4N41 A;  5J1E A;  3RR7 A;  1S1X A;  2YHB A;  3HP6 A;  4NYN A;  4CJE A;  4I9Q A;  4CFA A;  1ITG A;  1RTJ A;  1A5X A;  3O3G A;  2JGU A;  5J2Q A;  5CYM A;  2XY8 A;  3L2Q A;  3AVC A;  4B9M A;  3K58 A;  2KZZ A;  1L5U A;  1RTH A;  4DG1 A;  3AVA A;  4CIG A;  1NK6 A;  2HHQ A;  4CEC A;  4NCA A;  4CEF A;  5SWM A;  3OYG A;  3B6O A;  4DFM A;  1NK9 A;  3EY1 A;  4PQU A;  3OS1 A;  3HPG A;  4HTU A;  3TAQ A;  1WSJ A;  4CHO A;  1NOY A;  4QAG A;  1HNV A;  1L3V A;  2F96 A;  3MXJ A;  3CFP A;  2YKM A;  3L2R A;  4CJR A;  3VA0 A;  3QEW A;  4M42 A;  4ZHR A;  4E7L A;  4DTR A;  1QTM A;  4F3T A;  2PZS A;  2G8W A;  3LWM A;  1S1V A;  3ZSZ A;  4CF9 A;  4FM0 A;  4JLH A;  1KVC A;  4DU4 A;  1QE1 A;  1S9E A;  1TGO A;  4CJF A;  4E7J A;  4ELT A;  3NF6 A;  3SI6 A;  2O4I A;  3DLB A;  3MXM A;  3RTV A;  3ISN C;  1D8Y A;  2FBY A;  2P1J A;  1GOC A;  4OPJ A;  2GBZ A;  2XY6 A;  2KFN A;  2Q3S A;  4CEO A;  2HNZ A;  5CZ1 A;  4CF0 A;  1A5V A;  4YFU A;  1VSF A;  2XHB A;  3QIP A;  4CFD A;  4DSJ A;  3V81 A;  1RT5 A;  1X9S A;  1RCH A;  4I9L A;  4DTO A;  3K5N A;  4EZ6 A;  4IG3 A;  1MU2 A;  4CHY A;  4OKK A;  4W5Q A;  3SPZ A;  4CF8 A;  4Z4E A;  3L3U A;  1J54 A;  4KHN A;  4OKJ A;  1UOC A;  4E89 A;  4FLX A;  4E7I A;  2HNY A;  4B9S A;  3HL8 A;  3RRG A;  3AVI A;  5EU7 A;  1QSL A;  1WSH A;  3KD5 E;  4QCL A;  3VQP A;  4DMN A;  4Z4C A;  4UQG A;  4LH4 A;  3K57 A;  1CZB A;  4PWD A;  2Y1I A;  4DQI A;  4M3Z A;  2LSN A;  4B08 A;  2FBX A;  4DTJ A;  1RBS A;  3OYN A;  4DTP A;  3OYC A;  4KKO A;  4W5O A;  3CM5 A;  4DF8 A;  3TAE A;  1NKE A;  3RR8 A;  4QOZ B;  4DTS A;  4AHU A;  3MED A;  1T05 A;  3SZ2 A;  3O3F A;  3PX0 A;  1D5A A;  5J2P A;  4CFB A;  2XY7 A;  4F2R A;  2DFF A;  3OS0 A;  3SUN A;  3D0P A;  2HHS A;  4FXD A;  4B9U A;  1EX4 A;  1JXB A;  5CYQ A;  3VQD A;  2IS3 A;  4RW4 A;  4DF4 A;  1UA0 A;  4B3O A;  5I42 A;  3PUF A;  3UIQ A;  3DOK A;  1RDC A;  3T1A A;  4KRE A;  4DQS A;  3VQQ A;  2E6M A;  2NUB A;  3HPH A;  1EXQ A;  1KVB A;  1BGX T;  1WSF A;  3DRP A;  3MEG A;  4RW7 A;  3TAP A;  4RW9 A;  4ID5 A;  2E4L A;  3V4I A;  4KI4 A;  3SQ0 A;  3KIO A;  1YT3 A;  4KHS A;  5HRR A;  1XI1 A;  5CZ2 A;  1NJX A;  3ITH A;  4DSF A;  1U4B A;  2X74 A;  4CEB A;  1SL1 A;  3OY9 A;  1C1A A;  4FZZ A;  3CQ8 A;  3PO4 A;  4CEA A;  3V9U A;  3AA2 A;  4L8R B;  3AVH A;  3RMB A;  2DY4 A;  4IFY A;  4Q0B A;  1C0M A;  1RDB A;  3VQ9 A;  3WNF A;  4KB1 A;  3EZ5 A;  4JS4 A;  3V6D A;  1LW0 A;  2YNG A;  5E41 A;  4LSN A;  4BE0 A;  2Y1J A;  4Q5V A;  4KV8 A;  3S3M A;  2PY5 A;  3HP9 A;  3VQ6 A;  3KJV A;  2HHX A;  1S5J A;  3DMJ A;  3QIN A;  3THV A;  4FK4 A;  4FLT A;  2PYJ A;  3K59 A;  4E1N A;  1A5W A;  2ITG A;  4FLU A;  1BIZ A;  3HVT A;  1RT3 A;  3KKR A;  3NBP A;  3AVN A;  4E0D A;  5C42 A;  4KB0 A;  3VN5 A;  4CGI A;  3ZT0 A;  4CJP A;  1XHX A;  4CED A;  2HVH A;  2IGI A;  1JXE A;  1BCM A;  4CER A;  3OYD A;  3KK3 A;  1NJY A;  1RTI A;  3M8R A;  1I3A A;  1W0H A;  2D0C A;  1NK5 A;  4FK2 A;  2DFE A;  1L3S A;  4Z0U A;  4HUG A;  4C8L A;  4B8A B;  2HND A;  1RBU A;  1T8E A;  4E19 A;  3JYT A;  2EHG A;  2RN2 A;  4CIF A;  3AV9 A;  3O3H A;  3DLE A;  3V9S A;  4FJJ A;  4FLW A;  4M3Y A;  3AO4 A;  3HVR A;  1B9D A;  3LDS A;  3LP1 A;  3NDK A;  4H4M A;  1HMV A;  4CIE A;  2HHU A;  3ASM A;  3ZSV A;  2GUI A;  4CEZ A;  5DK5 A;  3VQB A;  3QEV A;  4B8C A;  4Z4H A;  1VSI A;  1QSS A;  4ZTF A;  1RT4 A;  4CJ4 A;  4HCC A;  1KLM A;  3TR8 A;  4DTM A;  1NK4 A;  2BE2 A;  1BHL A;  1REV A;  1NJZ A;  4H8K A;  1BIU A;  3HK2 A;  1UA1 A;  5C24 A;  2IOC A;  3ZT4 A;  1L3U A;  1IO2 A;  1J5O A;  3KK1 A;  1TAU A;  3QEX A;  4JS5 A;  3QIO A;  4XIU A;  4DSE A;  3C6T A;  1RDA A;  4KHQ A;  4LY7 A;  3L2U A;  4IBN A;  4CF2 A;  2O4G A;  1IKX A;  5HRP A;  2QKK A;  2ETJ A;  2OZS A;  3IRX A;  1SKR A;  4M3U A;  3AA5 X;  4FJ9 A;  4FYD A;  3VQ4 A;  1NKC A;  1BIS A;  3NHG A;  4H4O A;  1D9D A;  1J53 A;  3AVK A;  1ZBU A;  1JL1 A;  4CHP A;  5I3U A;  3LAK A;  4KHW A;  3FFI A;  4FW1 A;  3VQC A;  3LP3 A;  1SUQ A;  4KFB A;  3NH0 A;  2OPP A;  2WON A;  3LAN A;  3OVN A;  3ULD A;  3PX6 A;  4AHC A;  1HNI A;  1NKB A;  4CK3 A;  1CXU A;  4JRP A;  4FM2 A;  5HRO A;  4FJM A;  3K5O A;  2VG7 A;  3V9Z A;  1GOA A;  4GW6 A;  4KTW A;  3LAM A;  4W5R A;  4AH9 A;  1VSJ A;  1ZBH A;  5KGX A;  4FJK A;  3VQ5 A;  3SJJ A;  2YNH A;  1TKX A;  1JLQ A;  2GV9 A;  2VG6 A;  3NF7 A;  4CGD A;  3S3N A;  3DLH A;  3QES A;  3CYM A;  4DFJ A;  4RG8 A;  3ZSO A;  4EP5 A;  3RRH A;  3RMC A;  1X9M A;  1C6V A;  3D45 A;  3PO5 A;  1S9G A;  1SL2 A;  4BWJ A;  1JLB A;  4OKE A;  3LZI A;  4F4K A;  4KHY A;  2RF2 A;  1HYS A;  4O0J A;  4DQR A;  3HST B;  4BWM A;  4FJ5 A;  2QXF A;  3VQE A;  3KK2 A;  1HYZ A;  2Z1H A;  4DU1 A;  3TAR A;  3AA4 A;  1QHT A;  3OYK A;  3L8B A;  3VQ7 A;  3PY8 A;  4HUE A;  3SQ2 A;  1RDD A;  4J2E A;  1CXQ A;  2YNI A;  3ZSQ A;  4CGH A;  1HRH A;  3SUP A;  3PV8 A;  4DS5 A;  4PUO A;  4CK2 A;  1O1W A;  4CJU A;  4BDZ A;  3EYZ A;  3T3F A;  3KKS A;  2HHT A;  4CJ5 A;  5JS1 A;  3OYF A;  5FRO A;  3OYI A;  1IKY A;  1X1P A;  1ZBF A;  2RPI A;  4JRQ A;  2DTU A;  1VK0 A;  3KLE A;  4EP4 A;  3ZT2 A;  5DMR A;  2OZM A;  3G10 A;  3NF8 A;  4R5P A;  4FJ7 A;  4M3W A;  2ATQ A;  4DS4 A;  1K6Y A;  2G8U A;  4DSL A;  3TAG A;  5D3G A;  4G1Q A;  3NE6 A;  4CES A;  1T03 A;  3DYA A;  3LP2 A;  2X6S A;  3SV4 A;  1C0U A;  5HLF A;  1HPZ A;  2HVI A;  2F8S A;  1CLQ A;  1SKS A;  3KD1 E;  1LW2 A;  1QQC A;  3U6F A;  3NH1 A;  2HB5 A;  2BAN A;  4LD0 A;  1EET A;  4E1M A;  4TSX A;  1RT6 A;  2D0B A;  3HT3 A;  1JKH A;  4M3R A;  1NJW A;  2HHV A;  1WAJ A;  4DU3 A;  1S1U A;  2XRI A;  4CF1 A;  1ZBI A;  1RT1 A;  4HVJ A;  1S1T A;  1Q9Y A;  1KRP A;  1BQM A;  4KRF A;  2YV0 X;  3DM2 A;  3BDP A;  1BI4 A;  3TAN A;  1IKW A;  3AVJ A;  4GVM A;  1U45 A;  4CHQ A;  3AVL A;  3DI6 A;  2XO7 A;  4Y1D A;  4F2S A;  1BL3 A;  3SQ1 A;  1WSE A;  3LPU A;  1Z25 A;  2P51 A;  4BAC A;  4FLV A;  4DSK A;  3VA3 A;  3L2V A;  4FLY A;  2KW4 A;  3M8Q A;  1KVA A;  4O44 A;  4CGJ A;  4RW6 A;  4IFV A;  2D5R A;  3NGI A;  4CEQ A;  3P1G A;  3OYB A;  1U49 A;  2I5J A;  2P5G A;  2OPQ A;  3NGY A;  2X78 A;  3P83 D;  2WOM A;  3VQA A;  2VWJ A;  2E6L A;  1TK5 A;  1GOB A;  1YVU A;  3WNE A;  3NCI A;  5HP1 A;  3IAY A;  1TKZ A;  1IG9 A;  4FCY A;  3V1Q A;  2B4J A;  3VQ8 A;  3V9X A;  4DFP A;  1HQU A;  4CK1 A;  4NCB A;  1Q9X A;  2YKN A;  3QET A;  4MFB A;  4CEE A;  1U48 A;  1QS4 A;  1WLJ A;  3LAL A;  4ID1 A;  4FJL A;  1DLO A;  2KQ2 A;  3M8P A;  4CJS A;  3NH2 A;  1VSL A;  1WN7 A;  3OYE A;  4Z4G A;  1JLA A;  3NFA A;  4CHZ A;  4N56 A;  4I2Q A;  2IC3 A;  1L3T A;  4IDK A;  2YHA A;  2B5J A;  1C1B A;  4C8M A;  3H08 A;  4AHT A;  1TKT A;  4CCH A;  3LPT A;  1KTQ A;  2QK9 A;  1YTU A;  4ZTJ A;  4EZ9 A;  1D9F A;  1TK0 A;  4HUF A;  4I7F A;  1LWC A;  3K5M A;  3NAE A;  2XY5 A;  5FRN A;  1WAF A;  4LSL A;  1KCF A;  3JSM A;  4HHT A;  1UWB A;  4KPY A;  1XC9 A;  3P5J A;  4M3X A;  4CGF A;  1ASU A;  1I39 A;  3ZSY A;  1LWE A;  1BCO A;  1KFD A;  2DFH A;  1B92 A;  1VSE A;  3AO3 A;  3OJS A;  1C1C A;  5FDL A;  3ZSW A;  2W42 A;  3WNG A;  3I0S A;  3O4Q A;  4CFC A;  3SUO A;  4BDP A;  1CZ9 A;  2OYQ A;  4DWI A;  4ELU A;  4I2P A;  2Z1G A;  4CJW A;  3NGZ A;  3SCX A;  1TKD A;  5KRS A;  3QNN A;  3NF9 A;  3ZSX A;  4BE1 A;  3QEP A;  3KLG A;  2G8H A;  3ZSR A;  5KTQ A;  4DLG A;  1U04 A;  3C6U A;  3LP0 A;  4GMJ B;  3SPY A;  3S3O A;  5T7B A;  1Y97 A;  3BGR A;  3OYJ A;  1F21 A;  3QO9 A;  2IDO A;  5C25 A;  3OJU A;  3WNH A;  4DFK A;  1W9H A;  2EX3 A;  2YNF A;  3AA3 A;  5J2M A;  1DTQ A;  3O4N A;  3SUQ A;  3E01 A;  1VRT A;  3KLI A;  2OPR A;  1J9A A;  2ZD1 A;  4W5N A;  4E3S A;  1KFS A;  3AVM A;  3DOL A;  3RMD A;  1JLC A;  4FLZ A;  4ICL A;  1B9F A;  4FJ8 A;  3AVG A;  1JLG A;  2PYL A;  1TK8 A;  3T19 A;  4BDY A;  1TL1 A;  1XWL A;  2OA8 A;  3L2W A;  1NK0 A;  4F3O A;  1WNS A;  4NYF A;  4Y1C A;  3HJF A;  3V1R A;  4FW2 A;  4K8Z A;  2G8F A;  4N76 A;  5KRT A;  4FZX C;  4FJN A;  1RIL A;  3CM6 A;  3AO1 A;  3I0R A;  1LWF A;  1NOZ A;  4BE2 A;  4AHV A;  3QNO A;  3HYF A;  1IKV A;  3OYL A;  3S9H A;  1N5Y A;  4DSI A;  4CJQ A;  3MXI A;  1RBT A;  1FXX A;  4N47 A;  4DQQ A;  3MEE A;  2A1R A;  3K5L A;  3ALY A;  1G15 A;  2BDP A;  4OLB A;  1KSP A;  1RBR A;  2FC0 A;  1RNH A;  4CE9 A;  4CJT A;  5JS2 A;  1T7P A;  4FJI A;  4N5S A;  1JLE A;  3OYA A;  3G0Z A;  1ZBL A;  4IKF A;  2R7Y A;  4K8X A;  4OLA A;  3PX4 A;  2Z1J A;  3TAB A;  2ZE2 A;  4O0I A;  5J2N A;  1S6P A;  1FK9 A;  3OS2 A;  3U3G A;  1FKP A;  5HBM A;  1Q8I A;  3IS9 A;  1VSH A;  5HRN A;  3I8D A;  4FJX A;  1N6Q A;  4DTX A;  1NK7 A;  3RWU A;  1SV5 A;  1VRU A;  1SKW A;  5FRM A;  4B9V A;  5KGW A;  2KTQ A;  3AO5 A;  1YTA A;  3QLH A;  3CFR A;  4FZY A;  1VSM A;  2A1S A;  1WSG A;  3F9K A;  3TAM A;  3MAQ A;  4AIL C;  2G8K A;  4CHN A;  3CFO A;  4CGG A;  3OYM A;  1LAW A;  2F8T A;  4C8K A;  4CJV A;  1KLN A;  1EKE A;  1ZYQ A;  3AO2 A;  3KLH A;  3TWH A;  2Z1I A;  4E7H A;  4J2D A;  2QKB A;  2B6A A;  1JLF A;  1S6Q A;  2RKI A;  3B6P A;  4DTU A;  4Z4F A;  3C94 A;  3SV3 A;  1LAV A;  4F8R A;  1FKO A;  4IG0 A;  1HQE A;  4M45 A;  3HO1 A;  3C95 A;  2KFZ A;  1HYV A;  2IAJ A;  4CJ3 A;  4PA1 A;  1X9W A;  3AVF A;  2HHW A;  1TVR A;  4OGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...