3NFAA

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nfaA00
4CHNA 4IFYA 4ID1A 1ZBLA 3AA4A 1NK7A 3MEDA 4M3YA 2G8IA 1TGOA 4JRPA 4DU4A 1X1PA 3NF8A 3DM2A 1S9GA 1FK9A 3AO1A 3LWLA 3PY8A 1QS4A 1RT6A 4G1QA 4ID5A 1IH7A 3CM6A 3LP0A 4OGEA 4JS4A 4E7IA 3V9XA 3NGYA 3NF9A 1S1TA 3NH0A 1S1WA 1ZBFA 4C8LA 3PX6A 4DQPA 1REVA 1L3VA 1Z26A 2YNIA 3ZSOA 3AVLA 1WSGA 5HRNA 5J2MA 4HUGA 1QHTA 4YFUA 2I5JA 3WNFA 2KFZA 3C94A 4BDYA 4IDKA 4BE0A 4DQQA 4F8RA 3AVBA 1D9DA 1UOCA 3LP1A 1WSFA 3NH1A 1TL3A 4E1MA 1HPZA 1KFDA 2HNZA 4RW6A 1ITGA 2D5RA 3V9UA 5J2QA 1NOZA 1BISA 1F21A 2XY8A 1RBSA 2B4JA 3TANA 3AVIA 4NCAA 4Z4CA 2IS3A 5HRSA 4DLEA 4IKFA 4O55A 3TABA 4C8OA 5KTQA 3SNNA 2DTUA 3OS0A 3HPHA 3L2VA 1WSJA 2DFHA 1U45A 4J2AA 1BI4A 3KIOA 4MQ3A 4KI4A 1RT7A 1S1UA 1ZBUA 5CYMA 4CF9A 3FFIA 3VQ8A 3NHGA 2P5OA 1UWBA 1RT3A 2WOMA 3D45A 3O3FA 3THVA 3AVCA 2RN2A 4H4MA 4B9SA 3ISNC 4FM0A 1IKYA 2JGUA 1IKVA 2HHTA 3K5NA 2VWKA 3NGIA 3M8RA 4DSIA 4M42A 4KV8A 4DTRA 3OJUA 1I39A 2HHQA 1HYSA 1T7PA 4FJ7A 4GVMA 4WE1A 5CYQA 3KK2A 1WAJA 4CIGA 4C8KA 4FK2A 3ALYA 3DRSA 4I2QA 4C8NA 5JS2A 1RDCA 3L2RA 1RCHA 1HQUA 4FK0A 3AVFA 3DLRA 4DTJA 4B9VA 4CEFA 2VG5A 3KLHA 4ZHRA 1LWEA 1TK8A 3AA3A 3OJSA 2HNDA 4JS5A 1JXBA 4CJSA 4FZYA 4KREA 1HYVA 4CJRA 4K8XA 3OYKA 1JXEA 4ICLA 3RRHA 1C0UA 3SPYA 1BCMA 4E7JA 4M3WA 3QEIA 4FK4A 3NF6A 4FLUA 3QO9A 5KI6A 1KFSA 3MXIA 4HHTA 1X9MA 1KLNA 4DTUA 3V4IA 2OPPA 4E7KA 2O4IA 3TWHA 1TKZA 1NOYA 4BDZA 3BDPA 4DQSA 2FBYA 3JYTA 4KHSA 3RMBA 3ZSVA 3HVTA 3VQ6A 4Z4EA 1VSJA 1TK0A 1SV5A 1C1AA 4H4OA 3VQ9A 4CFBA 3L2QA 2D0AA 3CFPA 3ITHA 1QSLA 1U04A 3QERA 1T8EA 4FJXA 1ASWA 1WSIA 4CJ5A 1YTUA 5C24A 1BGXT 4DFKA 3C95A 4CEAA 4DTSA 4DTMA 3OY9A 1CXQA 4CF0A 3QEXA 4LH4A 2QK9A 1QSSA 1U48A 2LSNA 3A2FA 3VQDA 5KRTA 2FBVA 1RT1A 2E6MA 1BL3A 4M3RA 4FJGA 1T05A 1X9SA 1FKOA 4F3OA 1IO2A 3CFRA 3HSTB 5KGWA 4CESA 2FBTA 1SUQA 4KAZA 1NK8A 1NJZA 3CQ8A 1LW2A 3SZ2A 3G10A 3QNOA 1G15A 3QEPA 4DTNA 3UIQA 2YKMA 1NKCA 2HHVA 2G8KA 4DS4A 3RMDA 5CZ2A 4FW2A 1S9EA 1RT4A 2Z1GA 4DMNA 1N6QA 1VK0A 3OYGA 2BGGA 5JS1A 4M3TA 1WSEA 1SKSA 5C25A 2B5JA 2FC0A 2IOCA 4GMJB 4J2DA 3MECA 3ZT2A 4F2SA 3L3UA 3OS1A 1JLGA 3IRXA 4J2BA 4NCBA 1QE1A 1RILA 2HMIA 1UA0A 4B9MA 1JLBA 3I0RA 3C6UA 4AHUA 1C0TA 1B9DA 3S3MA 1RTJA 3ZCMA 1LAWA 2YNFA 4E7HA 1XI1A 3H08A 3LPTA 3B6OA 3PUFA 4CEOA 5KRSA 3MXMA 3AVGA 2ZE2A 2Z1HA 3E01A 4CF1A 2F8TA 2VG7A 2P1JA 4QAGA 1CLQA 1S1VA 3TI0A 2XY6A 3AV9A 1JLEA 4DSJA 1DTTA 2GBZA 1A5VA 4B3OA 1K6YA 4LSNA 5FROA 4N5SA 3HVRA 1CXUA 3ZT4A 1CZBA 1D5AA 1O1WA 3JSMA 2YNGA 4FM1A 2HHSA 4CF2A 4Z4IA 1EETA 1Q8IA 4NYNA 4OPKA 3EYZA 4CJFA 1RTIA 1VSHA 2R7YA 3RWUA 4CJVA 3L3VA 1RTHA 4NCGA 1LW0A 5HLFA 4FLWA 2G8WA 3G0ZA 3SYZA 1BI4B 1EX4A 1VSEA 2W42A 3LZIA 3DRRA 1JL1A 2Z1IA 4W5QA 4M3UA 3NFAA 3K59A 3KD5E 4HTUA 1XHXA 4DSFA 1I3AA 3VQ4A 4DTOA 3U3GA 1WSHA 2HHWA 4DLGA 1Z25A 4CIFA 1L3UA 4PUOA 3OYAA 4E7LA 4KHYA 4CK2A 2XY5A 3DYAA 4I2PA 3NGZA 1JLQA 1A5WA 3TAGA 3PO5A 3PV8A 5SWMA 1KSPA 4BDPA 2KTQA 1TKDA 4CJTA 3MXJA 4PWDA 2X6SA 3QIOA 5K14A 3IAYA 1BHLA 4DG1A 4KHNA 3TR8A 3OYDA 3T19A 2G8UA 3AVMA 1BIZA 1HNIA 3CM5A 3K5MA 4C8MA 1RNHA 1KLMA 1L3SA 1KVBA 1RBRA 3QLHA 3VN5A 4AHRA 1IKXA 2JLEA 2KW4A 3DMJA 3CG7A 4KI6A 4CHYA 3SQ0A 4UQGA 3LZJA 1SKRA 4CHQA 3SUNA 2EHGA 1VRTA 2E6LA 3I0SA 4FZZA 1VSKA 3PO4A 2QXFA 3HYFA 1BQNA 3AO3A 4CGGA 4NYFA 3M8QA 4DF8A 4FJHA 2AJQA 1WNSA 3S3OA 3DLKA 3DOKA 3DLGA 3ZSXA 3SV4A 1J53A 1RDAA 3SQ1A 1VSDA 3HL8A 3VQBA 3KLEA 1EP4A 1R0AA 4KTWA 4JLHA 4W5OA 3ZSZA 3SPZA 1X9WA 3DRPA 3ZSWA 4CECA 4B9LA 4FLYA 1KVAA 4M41A 3TAMA 2XHBA 4JRQA 4IBNA 4ELTA 1RTDA 4CJ3A 4CJKA 1TVRA 3HXMA 3LP3A 4FVMA 3K2PA 4KTZA 4IG0A 4H8KA 4CFDA 4ZTFA 3RMAA 3F73A 3QEWA 4RW7A 1ZYQA 3HK2A 2GUIA 3VA0A 3AVKA 2D0CA 3SI6A 3TAFA 3ZT1A 5E41A 3T1AA 2Q3SA 2IDOA 4DFPA 1NK9A 3SJJA 2XO7A 1RT5A 4DF4A 3QNNA 3WNGA 3DOLA 2XY7A 4B9TA 3AO4A 3AVHA 1A5XA 1DLOA 2OPRA 2IAJA 4FJIA 3OYFA 3VQ5A 3AA2A 1JLAA 4E3SA 3RR7A 2P51A 3NH2A 4L8RB 1NJYA 4CGIA 1TAUA 3SUQA 4FJ5A 1FXXA 3VQEA 2HVHA 1VSIA 3AO2A 3HT3A 3DLBA 1NKBA 1MU2A 4CK3A 3KTQA 4FJ9A 3EZ5A 3V9WA 4HCCA 1TKXA 4FLTA 1HJRA 4O4GA 3LDSA 4CE9A 2QKKA 4BACA 1KTQA 3P5JA 1HRHA 4DFJA 2G8VA 4Z4FA 4FYDA 3LP2A 4OGCA 1VRUA 2ATQA 3VA3A 3LAKA 3SUPA 1U4BA 1S1XA 1C1BA 2YV0X 3TAPA 4FM2A 5FRNA 3RRGA 5DMRA 1Q9YA 3HPGA 4AHSA 2HW3A 1UA1A 4OKKA 3K57A 4DU1A 1C6VA 3LAMA 3NBPA 2X74A 3O4NA 2ITGA 4OJRA 2XRIA 4EP5A 1T03A 4MFBA 4BWMA 3CFOA 4Z0UA 4KKOA 4W5RA 1U49A 4W5NA 3OYLA 3KKSA 3V1OA 3LANA 3M8PA 3HP6A 3AVAA 2Y1JA 4CHZA 1LV5A 1ZBHA 4DSLA 4PQUA 2OYQA 3LALA 4KHUA 1KRPA 4LD0A 4Q5VA 3M8SA 1KCFA 1LWCA 4KFBA 5J2NA 2YHBA 1S6PA 4E19A 1SL2A 5J1EA 3AA5X 1J5OA 2DFFA 1IG9A 3AO5A 3TAEA 4XIUA 4N56A 1JLCA 3DLHA 3AVJA 1D8YA 3AVNA 4N41A 3OYJA 4LSLA 2B6AA 4ELUA 4RW8A 2PY5A 2ZQBA 4Y1DA 3V9SA 2RKIA 4HVJA 1JL2A 4CJUA 3SUOA 2X78A 5FDLA 2GV9A 4F4KA 3MEEA 1L5UA 4CJQA 4M3XA 5J2PA 3QEVA 4RW9A 1DTQA 4HUEA 1D9FA 4B8CA 4OKEA 4CERA 1VSFA 1FKPA 3LPUA 3O4QA 3WNHA 2PYLA 2QKBA 1J54A 3IG1A 4AH9A 5SZTA 4FLZA 4DQIA 2WONA 4DFMA 4DTPA 3S9HA 3O3HA 3ZSQA 4KRFA 1TV6A 1GOBA 3I8DA 4CF8A 3T3FA 4ZTJA 2HHXA 1XC9A 4CHOA 3NF7A 4EZ6A 4HUFA 3HO1A 2DY4A 1TL1A 1GOCA 4KO0A 1IKWA 2RPIA 4Y1CA 1NK5A 1N5YA 4B9UA 3OS2A 1HYZA 3U3YA 3VQCA 1XHZA 2KZMA 2HNYA 4CGHA 4CFCA 4CJ4A 4R5PA 2PZSA 4O0JA 3D0PA 1QQCA 4DSKA 1YT3A 1L3TA 2Y1IA 5FRMA 3P83D 4CGJA 5C42A 4HCBA 3OVNA 3ZT3A 4OLBA 3VQAA 1LWFA 4RG8A 3O3GA 4M3ZA 1SKWA 1Q9XA 2HHUA 4ELVA 3ZSRA 1VSMA 3V9ZA 1RDDA 5HRRA 4B8AB 4AHCA 4CEQA 1TK5A 4EZ9A 2O4GA 4BWJA 5EU7A 3OYBA 3L2WA 3V81A 2A1RA 4I9QA 3KLGA 4DSEA 3HJFA 3SQ4A 4FJNA 4FXDA 1QTMA 4Z4GA 1NJXA 3F9KA 4QCLA 2PYJA 3C6TA 3PX4A 3V6DA 4CIEA 1XWLA 4AHTA 1SL1A 4N47A 4CFAA 3HM9A 1ASUA 5CZ1A 1W0HA 1CZ9A 1J9AA 4J2EA 1BIUA 5DK5A 4FJ8A 4TSXA 4I7FA 2EX3A 1UAXA 1RBTA 3S3NA 4RW4A 5HRPA 4W5TA 1BQMA 3KLFA 4FCYA 4CJLA 3NCIA 3OYMA 4CEZA 1RDBA 1S6QA 4CHPA 4PY5A 1LAVA 4E0DA 4FJJA 1VSLA 4CEDA 4DU3A 4OLAA 3PX0A 4F3TA 3CYMA 5I42A 2OPSA 3RTVA 4DQRA 4PA1A 3LWMA 3NE6A 4CGFA 4O0IA 4DS5A 1NKEA 4B9NA 4KHWA 5HP1A 1JKHA 2KQ2A 3OYNA 3EY1A 5I3UA 2HB5A 1KVCA 2ZD1A 3V1RA 4K8ZA 2OPQA 4LY7A 1HMVA 2OA8A 2OZMA 4KTQA 3QESA 2OZSA 4I9LA 2YHAA 3MEGA 4CJEA 3OYIA 3RMCA 1S5JA 2YKNA 2VWJA 3HP9A 3NAEA 3VQPA 3ZT0A 3K5LA 2Z1JA 3WNEA 2BDPA 4DWIA 1C0MA 1ASVA 4CEEA 4GW6A 3SCXA 3KKRA 3MAQA 4OKJA 3VQ7A 4KPYA 4Z4HA 4O44A 4FJKA 4IFVA 2E4LA 4FW1A 5HBMA 3VQQA 3ASMA 2FBXA 1SL0A 1TAQA 4KB1A 2F96A 2KZZA 4IG3A 1JLFA 2HVIA 3OYHA 1WLJA 1EXQA 2VG6A 3U6FA 2NUBA 1ZBIA 1QSYA 4LH5A 3QETA 2G8HA 3K5OA 4FLVA 1U47A 2RF2A 2KFNA 4FLXA 4E89A 4M45A 1WAFA 3OYCA 2A1SA 1TKTA 3IS9A 3SV3A 1BCOA 2IGIA 3DLEA 5HROA 1RBUA 3ZSYA 4CEBA 3DI6A 5CY4A 4EP4A 2G8FA 3TAQA 1HNVA 4AHVA 2BE2A 3HPOA 1HQEA 3NDKA 4FJLA 4N76A 4QOZB 5D3GA 3KK1A 2F8SA 2YNHA 2X6NA 4AILC 3KD1E 4FZXC 4B08A 4CK1A 3OYEA 1NJWA 1YTAA 3L2UA 2ETJA 2IC3A 3KJVA 3K58A 3BGRA 4BE2A 4DTXA 4BE1A 1B9FA 1NK6A 4KHQA 4CCHA 2P5GA 1EKEA 2BANA 1RT2A 4Q0BA 2DFEA 4YNQA 3ULDA 1WN7A 4O5BA 3SQ2A 1RBVA 3KLIA 4CGDA 4FJMA 3P1GA 1Y97A 3L8BA 4CJPA 2D0BA 5T7BA 3B6PA 5KGXA 4OVLA 3RR8A 4KB0A 3TARA 4OPJA 1W9HA 3V1QA 4E1NA 1NK0A 1GOAA 1YVUA 4F2RA 4CJWA 3QINA 3QIPA 1NK4A 3KK3A 1C1CA 1B92A
chains in the Genus database with same CATH superfamily
3AA4A 3MEDA 4JRPA 1EO1A 3NF8A 3DM2A 4ISGA 4LF8K 3THXB 3SBGA 4BG8A 4DR5K 3AO1A 3GE1A 4ID5A 3LP0A 3SAFA 2HBLA 1S1TA 1S1WA 4C8LA 3A5MC 1REVA 3J8AA 3M3ZA 3AVLA 4JHDB 2W6KA 5J2MA 1IBMK 1QHTA 4BDYA 3AVBA 1HKCA 3LP1A 2OTLN 1S3XA 2HBJA 3QMLA 4KH4A 2OTJN 3A5OC 1TL3A 4E1MA 1OH7A 2HNZA 4H5WA 3TSPA 1NOZA 4NCAA 5BRDA 3FR0A 4Z4CA 4IKFA 4DLEA 4C8OA 2JWLA 1BUPA 3HPHA 3L2VA 1WSJA 3C0BA 4BRIA 3KIOA 5AQLA 1S1UA 5CYMA 3FFIA 2HF4A 2CH5A 3O3FA 2EWSA 3AVCA 5EY4A 2P9IA 4FM0A 1OH8A 3NGIA 4M42A 3L6QA 2BTFA 1T7PA 4FJ7A 5IT9O 4GVMA 4WE1A 5CYQA 4C8KA 4CIGA 1Z6RA 3ALYA 3OW2M 3TU5A 5I9EB 3E9LA 4B9QA 4CEFA 2VG5A 3ZEUB 4ZHRA 4DV4K 2O8DA 4EAHD 1YJ9N 5F1XA 1JXBA 4CJSA 4FZYA 4K8XA 3SMSA 3RRHA 4FOEA 4E1JA 4FLUA 1KLNA 2PAVA 3OTOK 3V4IA 4E7KA 5BPMA 3TWHA 3BDPA 4BDZA 3MCPA 1TK0A 1IBLK 1S72N 1SV5A 4CFBA 3CFPA 2YHYA 2F4VK 1QSLA 1ASWA 4CJ5A 4JI2K 4IO8A 3G25A 4M7YA 4DTMA 3OY9A 4DR2K 4CF0A 3GDQA 4LH4A 2HHSA 5KRTA 4EIAA 1BL3A 3CJ1A 1NGBA 1HJOA 3N4PA 5A2QO 2P9SB 3HSTB 2FBTA 4KAZA 3QEPA 3QNOA 1NKCA 4DS4A 5CZ2A 1RT4A 2QWNA 2UUCK 4M3TA 1WSEA 4YOYA 1K8KA 5AQGA 3OS1A 3IRXA 1K8AO 1UA0A 1C0TA 5IWAK 3I8BA 3ZCMA 2V51B 4YOVA 2QI2A 4GY2B 5JLHA 1OH5A 2P1JA 4FSVA 4DR4K 1S1VA 5JVHL 1JLEA 3HSCA 1DTTA 1A5VA 1SS6A 1Y64A 1CZBA 1D5AA 1O1WA 3CCEN 4NLCA 1EETA 4OPKA 2R7YA 4CJVA 1RTHA 3VEZA 2Q1NA 2QWOA 3G0ZA 3SYZA 3ZX0A 2W42A 4M3UA 3OBYA 5AQTA 3KD5E 4HTUA 4OO1J 3VQ4A 4DTOA 1RDWX 3U3GA 1WSHA 2HHWA 4JEPA 4CIFA 5LL6Z 4E7LA 4CK2A 1E4GT 2XY5A 4JI4K 1QQOA 1A5WA 3HOTA 3PV8A 4BDPA 1ZC6A 4JK9A 2X6SA 1QVFM 5K14A 2V7ZA 3IAYA 3MWPA 1JCGA 3AVMA 1BIZA 1X3NA 4NXMK 1L3SA 4DCHA 1YUWA 1RBRA 4WYBA 4KI6A 1M1KO 4UQGA 3SUNA 2E6LA 3ZX3A 2WTUA 1QQNA 3HOSA 1BQNA 4DF8A 2FF3B 3DOKA 3DLGA 1VQPN 3ZSXA 3SV4A 1N32K 3VQBA 2CGJA 3DJCA 4JKGB 1R0AA 3BY5A 3ZSZA 5M1QA 4MO4A 1VQKN 4FWPA 3O8MA 2HHHK 4B9LA 1QHAA 3E66A 2O8FB 4ELTA 4A61A 3CQ8A 4CJKA 1RTDA 1C0GA 3ZETA 3RMAA 2O8BA 1HX1A 4RW7A 4DV2K 1BA1A 2D0CA 3ZT1A 4JI3K 1GLEG 2Q3SA 4DFPA 2QWMA 4YOTA 4CBUA 3FLCO 3SJJA 2XO7A 4G9ZA 3VGKA 2OANA 4NB4A 4XH5A 2XY7A 1DLOA 4FJIA 2VYPA 3VQ5A 3AA2A 1MA9B 2JWKA 3SUQA 3U8XA 3AO2A 4ILGB 3MX2A 3DLBA 5EXWA 3T69A 4HCCA 1TKXA 1HJRA 3LDSA 2QKKA 4BGBA 2G8VA 3LP2A 4OGCA 1IV0A 1NGIA 2ATQA 3SUPA 1S1XA 4BRFA 4LF6K 3DAWA 1Q9YA 3HPGA 3E9OA 4B1YB 4O8KA 1UA1A 4DU1A 1C6VA 3LAMA 3NBPA 3VERA 2X74A 3TTCA 2E1YA 4BRCA 3K0SA 4Z0UA 2PBDA 3LANA 3WUHA 2Y1JA 4DSLA 4DB3A 4DV7K 4DHYA 3AA5X 3TAEA 4ISFA 4BROA 2A40A 3AVJA 4JKHA 2WBNA 3AVNA 4H5NA 3OYJA 1YITN 2ZQBA 3O5BA 1NGFA 3WXMB 3VEOA 4BR0A 2GV9A 3MEEA 4MO5A 1VSFA 4AH9A 3IKMA 3S9HA 3I8DA 4ZTJA 3NF7A 4HUFA 3HO1A 4KO0A 4YDUC 3CC7N 2E5LK 3CCJN 4CGHA 2PZSA 5AQSA 1QQCA 1DKGD 1LWFA 2HHUA 4ELVA 3ZSRA 3V9ZA 4CEQA 1NGHA 2QWLA 4DSEA 3O9SA 4K25A 5E26A 4QCLA 1YI2N 3V6DA 1JJ2M 4CIEA 4GKJK 3O9UA 2KLAA 1SL1A 3HM9A 4CZMA 4FJ8A 5M1FA 1FJGK 1GLFO 4TSXA 2EX3A 5AQQA 4RW4A 5HRPA 4FCYA 4CJLA 3NCIA 1S6QA 1HKGA 1VSLA 4FWSA 3TTFA 4H0YB 3F5TA 3O1WA 4BR7A 4B3TK 1YVNA 4WFAL 2W41A 3VOVA 1NKEA 4KHWA 2HMPA 2F7TA 3EY1A 4ISEA 4XH4A 2ZD1A 2P9PB 2OPQA 4H0TB 2OA8A 4KTQA 3D2FA 2YHAA 3MEGA 2YKNA 3VQPA 4DWIA 5DM6L 3K5LA 2BDPA 1C0MA 4LFBK 2VGNA 5KQ8A 3W3DA 4Z4HA 5JVGL 3EKSA 3BF1A 4FJKA 2E4LA 4HWIA 1TAQA 2F96A 4IG3A 4PHTX 2HVIA 1EXQA 4YDUA 4GV6A 1NMDA 1ZBIA 1YHQN 3ENBA 3GL1A 2W6LA 3K5OA 1U47A 3CQYA 4BRDA 4BRLA 4E89A 2IGIA 3KVGA 3AGKA 3DLEA 1RBUA 3ZSYA 4CZEA 2O8CB 4DR3K 3HPOA 4FJLA 4DR7K 4RCHA 3KK1A 3UE5A 4B08A 4CK1A 3TPQA 3L2UA 2IC3A 1NGGA 1ILYA 2BANA 5AQFA 4Q0BA 2DFEA 4YNQA 1WN7A 5KQDA 1OVYA 4BVPA 4DUZK 3RSEA 2NRRA 4OVLA 3HI0A 2QTDA 3QIPA 3KK3A 1C1CA 3CM6A 1VQ5N 1WBDA 1R59O 2G8IA 1NMNA 1X1PA 1S9GA 3PY8A 2PFUA 1QS4A 3QICA 4G1QA 1HUXA 1IH7A 5AQWA 3V9XA 3NF9A 3NH0A 1VQ6N 4UY8O 3PX6A 3H45C 4AM7A 3QBXA 1E3MA 3G6EN 5GADP 3WNFA 5GIPA 2KFZA 1YXQA 3C94A 4F8RA 4BE0A 4DQQA 2A5XA 4DKWA 1WSFA 3CC2N 3NH1A 5C2DA 1VQON 1ITGA 2D5RA 5J2QA 3TANA 3AVIA 5HRSA 2E2NA 5KTQA 3SNNA 2DTUA 3OS0A 2DFHA 1U45A 1BI4A 4A59A 4CZLA 2F9WA 5FLXO 1ZBUA 3E1YA 2P5OA 3VQ8A 3NHGA 1RT3A 3D45A 2RN2A 5ADXH 3PIPL 1IKYA 3M8RA 3C7NA 4KV8A 3CJCA 3EL2A 1I39A 2Q36A 4YHHK 5AQXA 1Q7YO 2IIRA 1WAJA 4FK2A 4I2QA 4C8NA 5JS2A 3L2RA 1RDCA 3CIPA 4I6MA 3A0IX 4KH5A 5AQHA 3L4QA 4DTJA 4B9VA 4B3RK 4JD2A 5AQJA 1KC8O 3P38A 5AQNA 4BC5A 1QZ5A 5KPRA 5HL7L 3MN7A 5BREA 1BCMA 4M3WA 4FK4A 3MXIA 4HHTA 4KHPK 4B1WB 2VWBA 4DQSA 4KHSA 4RTFD 3VQ6A 4BRMA 4LF4K 2D0AA 3ITHA 3AGRA 3LDLA 1WSIA 5TKYA 1YTUA 3C95A 4C1NK 4BQZA 4IOXA 2LSNA 4M3RA 4AF1A 1XUPO 1FKOA 2Q2RA 3VETA 3FE1A 3BUZB 5GINA 5BN9A 3G71N 4CESA 1SUQA 3EZWA 3SZ2A 3G10A 3UIQA 1K8KB 1S9EA 5JMVA 2BGGA 5JS1A 5GAEP 4X64K 4JI7K 2HBKA 5CE3A 2IOCA 3L3UA 2ZJRL 1D4XA 1JLGA 5LJWA 1QE1A 1RILA 5LMUK 1B9DA 1BDGA 3IDHA 3S3MA 3J7AP 1RTJA 1LAWA 2YNFA 3H08A 3P31A 2UYTA 2ZE2A 2F8TA 4QAGA 5M1OA 1CLQA 2E1ZA 3TI0A 3AV9A 4M63C 4DSJA 1XMQK 4N5SA 1U2VB 4FM1A 3CI5A 3JAMO 2KKZA 3EEQA 1Q8IA 4NYNA 3EYZA 1QVGM 3RWUA 3L3VA 3FFKB 5HLFA 4FLWA 5AQMA 2G8WA 3THWA 2RE2A 1VSEA 4W5QA 4O8UA 2P9LB 3SBTA 1XHXA 1I3AA 3PSFA 2F9TA 2QM1A 4EHTA 1Z25A 1SQKA 4KHYA 3DYAA 1JLQA 1DEJA 1TKDA 3MXJA 4PWDA 1KAXA 3D7EO 4DG1A 3MWTA 2A6AA 1HNIA 3K5MA 1KLMA 4AHRA 3QLHA 2KW4A 3DMJA 3CG7A 3SQ0A 4PKHA 1GLDG 1SKRA 2EHGA 4JK8A 3I0SA 1VSKA 1IG8A 1IBKK 3UKRA 4BC3A 4BC4A 3VEWA 3SQ1A 2HSTA 3FZFA 3KLEA 3ULEB 3CXCM 4W5OA 1X9WA 3ZSWA 4FWQA 4CECA 3SJHA 4FLYA 3JXUA 2O8BB 1U6ZA 4WFBL 1TVRA 3LP3A 4KTZA 4H8KA 3CERA 4ZTFA 4BRAA 4IOCL 4FWRA 1NGAA 2GUIA 2HOEA 3SI6A 2GUPA 4K42A 5E41A 4IOAL 3O9RA 3T1HK 3T1AA 3QDKA 1NK9A 2ASMA 1VQNN 3MDQA 3LDNA 3SK3A 1RT5A 3IUCA 2H3GX 1XMOK 4BRHA 3QFUA 1A5XA 2OPRA 1KAYA 3VF2A 5GAHP 1JLAA 4E3SA 3RR7A 1SZ2A 3NH2A 4L8RB 2J4RA 1TAUA 1FXXA 3VQEA 1VSIA 3JS6A 4YOWA 3EZ5A 4BACA 4Z4FA 4JAXA 1N36K 4A5AA 1VRUA 4EZ6A 1U4BA 3RRGA 5DMRA 3MN6A 3EO3A 4AHSA 4OKKA 3K57A 3TSQA 4EP5A 2XRIA 4W5NA 4MFBA 3CCVN 3CFOA 4LC9B 4CW7B 1U49A 4JI5K 3V1OA 5HOOA 3HP6A 3AVAA 3NVMA 1ZBHA 3CJ7A 3LALA 4KHUA 3PLAA 4LD0A 4Q5VA 2GX9A 4B1UB 5J2NA 1SL2A 3R3LA 2DFFA 4LF7K 3AO5A 4XIUA 3TSUA 4N56A 4N41A 4LSLA 2B6AA 4ELUA 4O5FA 2PY5A 1BA0A 4HVJA 1JL2A 4CJUA 1KAZA 4IEEA 4IEIA 4F4KA 1L5UA 3ATUA 5J2PA 4QS9A 3L4IA 4BRGA 1D9FA 4OKEA 3THXA 1FKPA 3O4QA 3WNHA 1J54A 3IG1A 4DQIA 2UXBK 2WONA 4DTPA 4CBXA 3O3HA 1HNWK 4KRFA 1TV6A 4YY3K 2HHXA 2QWRA 2DY4A 1GOCA 1IKWA 2RPIA 1NK5A 4BR4A 2I7PA 1JCFA 1N5YA 3MX5A 3OS2A 3U3YA 3VQCA 2HNYA 4R5PA 4CFCA 3VMFB 1YT3A 3LDQA 1DGKN 5FRMA 5BN8A 4HCBA 1V4SA 3OVNA 3VF4A 1ZXOA 3O3GA 3O08A 4RG8A 4M3ZA 2CGKA 1VSMA 4AHCA 4EZ9A 2O4GA 3HJFA 5JICA 3J80O 3KLGA 4FXDA 2RHKA 1QTMA 3F9KA 2PYJA 1ASUA 5CZ1A 1CZ9A 3UKUA 1BIUA 2E20A 4DV5K 4W5TA 5H1SQ 1RDBA 4E0DA 4CEDA 4DU3A 1TUUA 4OLAA 3PX0A 4F3TA 5AQUA 3PIOL 5I42A 2OPSA 3RTVA 4DQRA 4H0VB 3GG4A 3K9JA 3NE6A 2A3ZA 1JKHA 2NRZA 5ELZA 2P9KA 5CR4A 2HB5A 2D4WA 3BEXA 1HMVA 5AZJA 2P9UB 2OZSA 1W97L 4CJEA 3RMCA 1S5JA 1NGEA 4GV3A 2E2PA 3ZT0A 2Z1JA 3WNEA 4CEEA 3SCXA 3D2EA 4PKIA 3N4QA 4IFVA 5AQRA 2KZZA 1JLFA 3OYHA 1WLJA 3GOIA 2VG6A 2NRHA 4C23A 2G8HA 2KFNA 5AQKA 4AM6A 1SAZA 4IFEA 4CEBA 2GEMA 4ILHA 2BUPA 3A8YA 3TAQA 1HNVA 2V52B 2YNHA 2X6NA 1ATNA 2FXUA 4FZXC 1NWKA 5EVZA 1NJWA 3BGRA 4BE2A 1WB9A 4KHQA 4Y0WA 4CGDA 3R9PA 3P1GA 4H5RA 1TUYA 4CZJA 5BPNA 3L8BA 1HPMA 3J7YP 1GLCG 4OPJA 1HKBA 4F2RA 1GOAA 1YVUA 4CJWA 3U9DA 2BH1A 1B92A 1ZBLA 1BU6O 3DXMB 5C10A 1NK7A 4BRNA 4K43A 3HZ6A 4DU4A 1FK9A 2A41A 5M1PA 4BQLA 1RT6A 3FZLA 3BZKA 4OGEA 4JS4A 4E7IA 1KQSM 4KH6A 4U7BA 1LCUA 1L3VA 4DQPA 1LOTB 2YNIA 1WSGA 5HRNA 4HUGA 1NG9A 3THYB 3QBWA 4GV9A 4CI6A 4IDKA 4WFNL 1D9DA 2O8EA 1HPZA 1KFDA 1BISA 1F21A 2XY8A 1RBSA 4YOUA 1WBBA 1TYQA 2IS3A 3EE8A 3TABA 1X9JA 4MQ3A 4KI4A 1GLBG 1RT7A 3LDPA 4CF9A 3HBTA 1UWBA 3THVA 4B9SA 1IKVA 2HHTA 3MK6A 2HHQA 1XC3A 4I6MB 1VQLN 3KK2A 4JD2B 4Z94A 3O1BA 1RCHA 1HQUA 4FK0A 4LF5K 3AVFA 1LWEA 5AZIA 1TK8A 3H3OB 1Q86O 4JS5A 4KREA 5EOYA 1HYVA 3D6RA 4WQ5C 1C0UA 3SPYA 4E7JA 3QEIA 4FPBA 2P9NA 4DTUA 4IZ9A 1CZAN 2E2OA 2OPPA 2O4IA 1NJIO 1TKZA 3O80A 3JYTA 3RMBA 1JCEA 3H1VX 4IJAA 5M1NA 2D0PA 4DFKA 2YI1A 4DTSA 4BRQA 2QK9A 3A2FA 2FBVA 2E6MA 4FJGA 2WC9A 1X9SA 3FZKA 3AAPA 3CFRA 5KGWA 3LM9A 4PQUA 1NK8A 1LW2A 1G15A 4EFHA 4BVOA 4DTNA 2HHVA 3EKUA 3CJ9A 3DWLA 4RWTA 3M6GA 4OPHA 4FW2A 3RMDA 3SMPA 2G8KA 4DMNA 1VK0A 3OYGA 1SKSA 4OPAA 2IVOA 5C25A 2VQFK 3MECA 4CD3A 3A5LC 1V4TA 1BO5O 4B9MA 3I0RA 3SAGA 3C6UA 3H3NO 3WQTA 4E7HA 1XI1A 3LPTA 3PUFA 4CEOA 4CF1A 2ZF5O 2NRXA 4WQ5A 4JKDA 3WEEA 2VGMA 4R79A 4B3OA 2W40A 4B1VA 3JSMA 2YNGA 4Z4IA 4ILJA 4CJFA 1VSHA 5BPLA 4NCGA 5AFUA 1LW0A 2WUSA 4DV3K 1EWRA 3LZIA 3DRRA 1JL1A 2Z1IA 5AR0A 3CMAN 3NFAA 3K59A 4DSFA 4A5BA 3LDOA 4DLGA 1L3UA 4PUOA 1NGDA 2P9IB 3NGZA 3PO5A 3DXKA 3QIOA 1EQYA 3F9MA 4JKEA 3K9KA 3MN9A 4KHNA 3TR8A 3OYDA 3CM5A 4C8MA 1RNHA 3W0LA 4CD1A 5AFUH 4EHUA 1KVBA 3HTVA 1IKXA 2JLEA 4CHYA 2ZWHA 3UKRB 4JKBA 3WXIA 2ASPA 4CHQA 3LZJA 2O8DB 1VRTA 2V7YA 4FZZA 3PO4A 2QXFA 3HYFA 4CGGA 4NYFA 4FJHA 2AJQA 1WNSA 3S3OA 1VHXA 3DLKA 3QB0A 1VSDA 5BRFA 3VEYA 1T6DA 1EP4A 4YORA 3A5NC 3CCQN 4KTWA 1GLAG 3CQXA 2FLOA 3SPZA 4BREA 3VGLA 1KVAA 2ZGYA 1NGCA 3VTIA 4IBNA 4QS8A 3WXJA 3K2PA 4IDHA 4CFDA 1BG3A 1C0FA 3F73A 3QEWA 1ZYQA 1GLLO 3VA0A 3B8AX 3TAFA 1MWKA 1T3VA 1OKJA 4IJNA 3P39A 4JN4A 4DF4A 3QNNA 3WNGA 3CPWM 3DOLA 1Q18A 3AO4A 3AVHA 3CCSN 4MDBA 4CGIA 4FJ5A 3ZLJA 3T7ZA 3QFPA 3V9WA 2E8AA 2GTDA 4O4GA 4CE9A 4FYDA 1HRHA 3VA3A 3LAKA 4CZHA 2YV0X 5FPEA 3TAPA 4FM2A 4OJRA 5JLFA 4BWMA 2O8CA 4KKOA 3BF3A 3KKSA 3M8PA 1YJWN 4CHZA 1N33K 3DLLL 2OYQA 1KRPA 1BWFO 4X62K 3M8SA 2GWKA 1S6PA 4E19A 5J1EA 1W2BM 2KHOA 4H5VA 2AP1A 3DLHA 4BRPA 4FWMA 4RW8A 2YJFA 4Y1DA 3SUOA 3WXKA 3Q7CA 4CJQA 5AQIA 2HF3A 3QEVA 4RW9A 4HUEA 4FVUA 4CERA 3C65A 4FLZA 2YJEA 4JYAK 3O4WA 3CJAA 3U9ZA 1GOBA 3T3FA 4CHOA 5EX5A 4B9UA 1HYZA 3ID6A 1XHZA 5BR9A 3GBTA 4QS7A 4IO9L 4CJ4A 2ZGZA 3D0PA 1L3TA 2Y1IA 1W7AA 4CGJA 1NGJA 3ZT3A 4OLBA 4PL8A 1XNRK 2YCHA 2ZM6K 1SKWA 1Q9XA 5CHIA 1TK5A 4WF9L 4BWJA 3V81A 5E84A 1XNQK 1NNEA 3SQ4A 1NJXA 2UUAK 3UKUB 4XH1A 3P4IA 4A62A 5AJ3K 2WFBA 1N8RO 1XWLA 4GVEA 4AHTA 4N47A 4CFAA 1M90O 1O13A 1W0HA 1VAZA 1J9AA 2QW9A 1RBTA 3CCMN 3S3NA 3KLFA 1BQMA 4CEZA 4CHPA 1VQ7N 1LAVA 3ZETB 2AA4A 3CYMA 2I7NA 2P9KB 4PA1A 3LWMA 5AZJB 4O0IA 4DS5A 3KWIA 4BY9C 3G4SN 4JV5K 2KQ2A 5B8HA 2CH6A 1BOTO 5I3UA 3MN5A 4JNEA 1KVCA 1HR0K 4K8ZA 4HTLA 1GLJO 3D2EB 2FSKA 2VWJA 3HP9A 3RVCA 1ASVA 4GW6A 3KKRA 4NO7A 4FPAA 3SAHA 4FW1A 3VQQA 3ASMA 2FBXA 1SL0A 2YHXA 3U6FA 1VQMN 2NUBA 3FZHA 5KPZA 2RF2A 5LY3A 1WAFA 4OX9K 1BCOA 3O9TA 4DV0K 1HNZK 2UUBK 2E88A 5HROA 5BR8K 4JI6K 1XQSC 3DI6A 4DR1K 4FWKA 4AHVA 4H0PA 4WCEL 2BE2A 3HM8A 1HQEA 3NDKA 2ZJQL 4N76A 5D3GA 1K9MO 4B3SK 3KJVA 3K58A 1NK6A 3WQUA 3TTDA 4DTXA 2OCEA 2P5GA 1EKEA 1YF5L 3ULDA 1RBVA 4BR9A 1Y97A 4KBOA 2D0BA 5F0XA 3B6PA 2ZJPL 4CJ7A 5KGXA 3RR8A 4PL7A 1W9HA 4E1NA 1NK0A 2GELA 1NJYA 3HT3A 4CHNA 4IFYA 4ID1A 3WT0A 4M3YA 3VTHA 1TGOA 3SLCA 1RDUA 3LWLA 1H1VA 3HRGA 3NGYA 1ZBFA 2VCPA 1Z26A 3ZSOA 2O8EB 4YFUA 2I5JA 3CMEN 4JHDA 1UOCA 1TYQB 1NU0A 1U2VA 4RW6A 3V9UA 4A57A 4BG9A 2B4JA 4O55A 3VF6A 3CPEA 4J2AA 3ENHA 1T6CA 2P9LA 3PSIA 4NLBA 1YIJN 1I94K 2WOMA 4C1NI 2D0OA 4H4MA 3ISNC 2JGUA 3K5NA 2VWKA 4DSIA 4DTRA 3OJUA 1HYSA 4J8FA 3AARA 4MDAA 2D1KA 3DRSA 5AZIB 1KXPA 3KK7A 3ATVA 3DLRA 3KLHA 1ATSA 3AA3A 3VEXA 3OJSA 2HNDA 3D2FB 3VEVA 4CJRA 4K0KK 3EN9A 2P9NB 3ZEUA 3OYKA 1JXEA 3ENOA 4ICLA 1Q81O 3OA9A 3NF6A 1KFSA 3QO9A 5KI6A 1ZBSA 1X9MA 5C15A 3ULEA 1NOYA 2FBYA 3L0QA 4DV6K 5C2FA 3ZSVA 1HLUA 3HVTA 4CBWA 4Z4EA 1VSJA 5AQVA 3BP8A 1C1AA 4H4OA 4FO0A 4L3QA 2ASOA 3VQ9A 3L2QA 2QEXN 1X3MA 1U04A 3QERA 1T8EA 4FJXA 4BR5A 3AAQA 2QA4N 5C24A 1BGXT 4NXNK 4FWOA 3CD6N 4CEAA 1CXQA 2Q0RA 3QEXA 1QSSA 1U48A 3VQDA 3NMUA 1RT1A 1T05A 4F3OA 1IO2A 4H0XB 1OVQA 1NJZA 2NNWA 2YKMA 5TKWA 4BR2A 1EWQA 2P9SA 3RSEB 2Z1GA 1N6QA 4H03B 5C12A 3CJBA 2B5JA 2FC0A 4GMJB 4J2DA 5FPMA 3ZT2A 4CZIA 1QZ6A 4F2SA 1ATRA 4J2BA 4WQ4C 4NCBA 1K73O 2HMIA 1JLBA 4AHUA 3MCAB 4JKFA 3I33A 2QXLA 3B6OA 4X66K 2UU9K 3OHRA 5KRSA 3WEEB 3AVGA 3MXMA 2Z1HA 3E01A 1VQ8N 2VG7A 5GAGP 5AQOA 2XY6A 2GBZA 4U67L 1K6YA 4FWNA 4LSNA 5FROA 3H6EA 2UXDK 4JKAA 3HVRA 1CXUA 3ZT4A 4CF2A 4B1XB 1WUAA 1RTIA 4CZFA 1QQMA 1BI4B 5FPDA 3M5RA 1EX4A 3DXKB 3OYAA 2IVNA 3TAGA 4I2PA 4JK7A 5SWMA 4AQYK 1KSPA 2KTQA 1RGIA 3C7NB 4BGAA 4CJTA 3VENA 2Q0UA 2UXCK 2YHWA 3T1YK 3IFRA 1BHLA 3T19A 2G8UA 3FZMA 4FL9A 3BZCA 3VN5A 3CCLN 1J6ZA 3H46O 1IJJA 4K41A 3KHYA 4PKGA 3AO3A 3M8QA 4WQ4A 5FPNA 3KWGA 4YOXA 2FSJA 1J53A 1RDAA 3HL8A 2QWQA 1P90A 4B3MK 4JLHA 4IXCA 3DRPA 3NVKA 3O9QA 1YAGA 1P8ZA 4JKGA 3Q7BA 4M41A 3TAMA 2XHBA 4JRQA 1HNXK 4CJ3A 3HXMA 4FVMA 4IG0A 3VESA 4A2BA 3HK2A 2QWPA 2NRWA 3AVKA 2O8FA 1MDUB 4GNIA 3CETA 2NLXA 2IDOA 4DR6K 1J5EK 2P9UA 4B9TA 3H1QA 2IAJA 4M7XA 2IVPA 3OYFA 2A42A 4BC2A 2P51A 2HVHA 1NKBA 1MU2A 4CK3A 3KTQA 4FJ9A 4FLTA 4DFJA 1KTQA 3P5JA 2Q31A 1C1BA 3J81O 5FRNA 2HW3A 3OBWA 3O4NA 2ITGA 1T03A 4DUYK 4CVNE 1OH6A 4F9OA 4W5RA 3OYLA 4DQ8A 3CCUN 4CZKA 4BRKA 1LV5A 3FGUA 5LJVA 1KCFA 1LWCA 3F2KA 4KFBA 1Z05A 2FSNA 3LM2A 1RFQA 2YHBA 3CCRN 1Q82O 5KPTA 5F2RA 1J5OA 1IG9A 1JLCA 3ID8A 1D8YA 3R6MA 4A2AA 3THWB 3V9SA 2RKIA 3VGMA 3R8EA 1T44A 2X78A 3O6WA 5FDLA 3DXMA 3E9PA 4MLHA 4M3XA 3WXLA 1DTQA 4B8CA 2PYLA 3LPUA 2QKBA 5SZTA 4DFMA 2NZTA 1E4FT 3CC4N 2Q97A 5AQPA 3ZSQA 4CF8A 1XC9A 4FOIA 2YX6A 4CZGA 1TL1A 5ADXA 3MMVA 4Y1CA 1FW6A 2DPNA 2KZMA 3THYA 4JI8K 4O0JA 2VQEK 4DSKA 1G99A 3P83D 5C42A 3VQAA 3CF5L 4DV1K 1RDDA 5HRRA 4B8AB 5M1KA 3I55N 3OYBA 3L2WA 4IWVA 5EU7A 5AQZA 2A1RA 4I9QA 4LFAK 4FJNA 4Z4GA 3C6TA 5BRHA 3PX4A 4LFCK 1YJNN 4JKCA 4J2EA 5DK5A 4H5TA 4I7FA 3C6AA 1UAXA 2ITMA 3J7ZO 3OYMA 3IMXA 3EE9A 4PY5A 4FJJA 1NLVA 1ESVA 5MLCQ 4GKKK 4JI1K 4CGFA 1KD1O 4B9NA 5C0YA 5HP1A 2FF6A 3OYNA 1N34K 3AY9A 3V1RA 4LY7A 3U4LA 3M1FA 3ZX2A 3QESA 2OZMA 4I9LA 1DT9A 3OYIA 3NAEA 2P9PA 4JI0K 1VQ9N 5AQYA 3MAQA 4OKJA 3VQ7A 4KPYA 4O44A 5HBMA 4KB1A 2NRVA 2HBMA 3C6HA 3LL3A 3VPZA 4MLEA 4B1ZA 1QSYA 4LH5A 3QETA 4FLVA 1NM1A 4FLXA 3KZBA 4M45A 3OYCA 2A1SA 1TKTA 3IS9A 1S22A 3SV3A 4FWLA 3I56N 4EP4A 2G8FA 5CY4A 4XEIA 4QOZB 2F8SA 4AILC 3KD1E 4LF9K 4H0OA 1VQ4N 4X65K 3OYEA 1NBWA 1YTAA 3CHWA 2ETJA 2NRTA 3S41A 5DM7L 4BE1A 1B9FA 1WOQA 4CCHA 1RT2A 3R1XA 4O5BA 3SQ2A 3KLIA 3UB5A 4FJMA 2GWJA 1MWMA 4CJPA 5GIOA 5LMNK 5T7BA 4KB0A 3ZYYX 3TARA 3V1QA 2CGLA 2E2QA 3QINA 1NK4A 4V19S
chains in the Genus database with same CATH topology
4CHNA 4IFYA 4ID1A 1ZBLA 3AA4A 1NK7A 3MEDA 4M3YA 2G8IA 1TGOA 4JRPA 4DU4A 1X1PA 3NF8A 3DM2A 1S9GA 1FK9A 3AO1A 3LWLA 3PY8A 1QS4A 1RT6A 4G1QA 4ID5A 1IH7A 3CM6A 3LP0A 4OGEA 4JS4A 4E7IA 3V9XA 3NGYA 3NF9A 1S1TA 3NH0A 1S1WA 1ZBFA 4C8LA 3PX6A 4DQPA 1REVA 1L3VA 1Z26A 2YNIA 3ZSOA 3AVLA 1WSGA 5HRNA 5J2MA 4HUGA 1QHTA 4YFUA 2I5JA 3WNFA 2KFZA 3C94A 4BDYA 4IDKA 4BE0A 4DQQA 4F8RA 3AVBA 1D9DA 1UOCA 3LP1A 1WSFA 3NH1A 1TL3A 4E1MA 1HPZA 1KFDA 2HNZA 4RW6A 1ITGA 2D5RA 3V9UA 5J2QA 1NOZA 1BISA 1F21A 2XY8A 1RBSA 2B4JA 3TANA 3AVIA 4NCAA 4Z4CA 2IS3A 5HRSA 4DLEA 4IKFA 4O55A 3TABA 4C8OA 5KTQA 3SNNA 2DTUA 3OS0A 3HPHA 3L2VA 1WSJA 2DFHA 1U45A 4J2AA 1BI4A 3KIOA 4MQ3A 4KI4A 1RT7A 1S1UA 1ZBUA 5CYMA 4CF9A 3FFIA 3VQ8A 3NHGA 2P5OA 1UWBA 1RT3A 2WOMA 3D45A 3O3FA 3THVA 3AVCA 2RN2A 4H4MA 4B9SA 3ISNC 4FM0A 1IKYA 2JGUA 1IKVA 2HHTA 3K5NA 2VWKA 3NGIA 3M8RA 4DSIA 4M42A 4KV8A 4DTRA 3OJUA 1I39A 2HHQA 1HYSA 1T7PA 4FJ7A 4GVMA 4WE1A 5CYQA 3KK2A 1WAJA 4CIGA 4C8KA 4FK2A 3ALYA 3DRSA 4I2QA 4C8NA 5JS2A 1RDCA 3L2RA 1RCHA 1HQUA 4FK0A 3AVFA 3DLRA 4DTJA 4B9VA 4CEFA 2VG5A 3KLHA 4ZHRA 1LWEA 1TK8A 3AA3A 3OJSA 2HNDA 4JS5A 1JXBA 4CJSA 4FZYA 4KREA 1HYVA 4CJRA 4K8XA 3OYKA 1JXEA 4ICLA 3RRHA 1C0UA 3SPYA 1BCMA 4E7JA 4M3WA 3QEIA 4FK4A 3NF6A 4FLUA 3QO9A 5KI6A 1KFSA 3MXIA 4HHTA 1X9MA 1KLNA 4DTUA 3V4IA 2OPPA 4E7KA 2O4IA 3TWHA 1TKZA 1NOYA 4BDZA 3BDPA 4DQSA 2FBYA 3JYTA 4KHSA 3RMBA 3ZSVA 3HVTA 3VQ6A 4Z4EA 1VSJA 1TK0A 1SV5A 1C1AA 4H4OA 3VQ9A 4CFBA 3L2QA 2D0AA 3CFPA 3ITHA 1QSLA 1U04A 3QERA 1T8EA 4FJXA 1ASWA 1WSIA 4CJ5A 1YTUA 5C24A 1BGXT 4DFKA 3C95A 4CEAA 4DTSA 4DTMA 3OY9A 1CXQA 4CF0A 3QEXA 4LH4A 2QK9A 1QSSA 1U48A 2LSNA 3A2FA 3VQDA 5KRTA 2FBVA 1RT1A 2E6MA 1BL3A 4M3RA 4FJGA 1T05A 1X9SA 1FKOA 4F3OA 1IO2A 3CFRA 3HSTB 5KGWA 4CESA 2FBTA 1SUQA 4KAZA 1NK8A 1NJZA 3CQ8A 1LW2A 3SZ2A 3G10A 3QNOA 1G15A 3QEPA 4DTNA 3UIQA 2YKMA 1NKCA 2HHVA 2G8KA 4DS4A 3RMDA 5CZ2A 4FW2A 1S9EA 1RT4A 2Z1GA 4DMNA 1N6QA 1VK0A 3OYGA 2BGGA 5JS1A 4M3TA 1WSEA 1SKSA 5C25A 2B5JA 2FC0A 2IOCA 4GMJB 4J2DA 3MECA 3ZT2A 4F2SA 3L3UA 3OS1A 1JLGA 3IRXA 4J2BA 4NCBA 1QE1A 1RILA 2HMIA 1UA0A 4B9MA 1JLBA 3I0RA 3C6UA 4AHUA 1C0TA 1B9DA 3S3MA 1RTJA 3ZCMA 1LAWA 2YNFA 4E7HA 1XI1A 3H08A 3LPTA 3B6OA 3PUFA 4CEOA 5KRSA 3MXMA 3AVGA 2ZE2A 2Z1HA 3E01A 4CF1A 2F8TA 2VG7A 2P1JA 4QAGA 1CLQA 1S1VA 3TI0A 2XY6A 3AV9A 1JLEA 4DSJA 1DTTA 2GBZA 1A5VA 4B3OA 1K6YA 4LSNA 5FROA 4N5SA 3HVRA 1CXUA 3ZT4A 1CZBA 1D5AA 1O1WA 3JSMA 2YNGA 4FM1A 2HHSA 4CF2A 4Z4IA 1EETA 1Q8IA 4NYNA 4OPKA 3EYZA 4CJFA 1RTIA 1VSHA 2R7YA 3RWUA 4CJVA 3L3VA 1RTHA 4NCGA 1LW0A 5HLFA 4FLWA 2G8WA 3G0ZA 3SYZA 1BI4B 1EX4A 1VSEA 2W42A 3LZIA 3DRRA 1JL1A 2Z1IA 4W5QA 4M3UA 3NFAA 3K59A 3KD5E 4HTUA 1XHXA 4DSFA 1I3AA 3VQ4A 4DTOA 3U3GA 1WSHA 2HHWA 4DLGA 1Z25A 4CIFA 1L3UA 4PUOA 3OYAA 4E7LA 4KHYA 4CK2A 2XY5A 3DYAA 4I2PA 3NGZA 1JLQA 1A5WA 3TAGA 3PO5A 3PV8A 5SWMA 1KSPA 4BDPA 2KTQA 1TKDA 4CJTA 3MXJA 4PWDA 2X6SA 3QIOA 5K14A 3IAYA 1BHLA 4DG1A 4KHNA 3TR8A 3OYDA 3T19A 2G8UA 3AVMA 1BIZA 1HNIA 3CM5A 3K5MA 4C8MA 1RNHA 1KLMA 1L3SA 1KVBA 1RBRA 3QLHA 3VN5A 4AHRA 1IKXA 2JLEA 2KW4A 3DMJA 3CG7A 4KI6A 4CHYA 3SQ0A 4UQGA 3LZJA 1SKRA 4CHQA 3SUNA 2EHGA 1VRTA 2E6LA 3I0SA 4FZZA 1VSKA 3PO4A 2QXFA 3HYFA 1BQNA 3AO3A 4CGGA 4NYFA 3M8QA 4DF8A 4FJHA 2AJQA 1WNSA 3S3OA 3DLKA 3DOKA 3DLGA 3ZSXA 3SV4A 1J53A 1RDAA 3SQ1A 1VSDA 3HL8A 3VQBA 3KLEA 1EP4A 1R0AA 4KTWA 4JLHA 4W5OA 3ZSZA 3SPZA 1X9WA 3DRPA 3ZSWA 4CECA 4B9LA 4FLYA 1KVAA 4M41A 3TAMA 2XHBA 4JRQA 4IBNA 4ELTA 1RTDA 4CJ3A 4CJKA 1TVRA 3HXMA 3LP3A 4FVMA 3K2PA 4KTZA 4IG0A 4H8KA 4CFDA 4ZTFA 3RMAA 3F73A 3QEWA 4RW7A 1ZYQA 3HK2A 2GUIA 3VA0A 3AVKA 2D0CA 3SI6A 3TAFA 3ZT1A 5E41A 3T1AA 2Q3SA 2IDOA 4DFPA 1NK9A 3SJJA 2XO7A 1RT5A 4DF4A 3QNNA 3WNGA 3DOLA 2XY7A 4B9TA 3AO4A 3AVHA 1A5XA 1DLOA 2OPRA 2IAJA 4FJIA 3OYFA 3VQ5A 3AA2A 1JLAA 4E3SA 3RR7A 2P51A 3NH2A 4L8RB 1NJYA 4CGIA 1TAUA 3SUQA 4FJ5A 1FXXA 3VQEA 2HVHA 1VSIA 3AO2A 3HT3A 3DLBA 1NKBA 1MU2A 4CK3A 3KTQA 4FJ9A 3EZ5A 3V9WA 4HCCA 1TKXA 4FLTA 1HJRA 4O4GA 3LDSA 4CE9A 2QKKA 4BACA 1KTQA 3P5JA 1HRHA 4DFJA 2G8VA 4Z4FA 4FYDA 3LP2A 4OGCA 1VRUA 2ATQA 3VA3A 3LAKA 3SUPA 1U4BA 1S1XA 1C1BA 2YV0X 3TAPA 4FM2A 5FRNA 3RRGA 5DMRA 1Q9YA 3HPGA 4AHSA 2HW3A 1UA1A 4OKKA 3K57A 4DU1A 1C6VA 3LAMA 3NBPA 2X74A 3O4NA 2ITGA 4OJRA 2XRIA 4EP5A 1T03A 4MFBA 4BWMA 3CFOA 4Z0UA 4KKOA 4W5RA 1U49A 4W5NA 3OYLA 3KKSA 3V1OA 3LANA 3M8PA 3HP6A 3AVAA 2Y1JA 4CHZA 1LV5A 1ZBHA 4DSLA 4PQUA 2OYQA 3LALA 4KHUA 1KRPA 4LD0A 4Q5VA 3M8SA 1KCFA 1LWCA 4KFBA 5J2NA 2YHBA 1S6PA 4E19A 1SL2A 5J1EA 3AA5X 1J5OA 2DFFA 1IG9A 3AO5A 3TAEA 4XIUA 4N56A 1JLCA 3DLHA 3AVJA 1D8YA 3AVNA 4N41A 3OYJA 4LSLA 2B6AA 4ELUA 4RW8A 2PY5A 2ZQBA 4Y1DA 3V9SA 2RKIA 4HVJA 1JL2A 4CJUA 3SUOA 2X78A 5FDLA 2GV9A 4F4KA 3MEEA 1L5UA 4CJQA 4M3XA 5J2PA 3QEVA 4RW9A 1DTQA 4HUEA 1D9FA 4B8CA 4OKEA 4CERA 1VSFA 1FKPA 3LPUA 3O4QA 3WNHA 2PYLA 2QKBA 1J54A 3IG1A 4AH9A 5SZTA 4FLZA 4DQIA 2WONA 4DFMA 4DTPA 3S9HA 3O3HA 3ZSQA 4KRFA 1TV6A 1GOBA 3I8DA 4CF8A 3T3FA 4ZTJA 2HHXA 1XC9A 4CHOA 3NF7A 4EZ6A 4HUFA 3HO1A 2DY4A 1TL1A 1GOCA 4KO0A 1IKWA 2RPIA 4Y1CA 1NK5A 1N5YA 4B9UA 3OS2A 1HYZA 3U3YA 3VQCA 1XHZA 2KZMA 2HNYA 4CGHA 4CFCA 4CJ4A 4R5PA 2PZSA 4O0JA 3D0PA 1QQCA 4DSKA 1YT3A 1L3TA 2Y1IA 5FRMA 3P83D 4CGJA 5C42A 4HCBA 3OVNA 3ZT3A 4OLBA 3VQAA 1LWFA 4RG8A 3O3GA 4M3ZA 1SKWA 1Q9XA 2HHUA 4ELVA 3ZSRA 1VSMA 3V9ZA 1RDDA 5HRRA 4B8AB 4AHCA 4CEQA 1TK5A 4EZ9A 2O4GA 4BWJA 5EU7A 3OYBA 3L2WA 3V81A 2A1RA 4I9QA 3KLGA 4DSEA 3HJFA 3SQ4A 4FJNA 4FXDA 1QTMA 4Z4GA 1NJXA 3F9KA 4QCLA 2PYJA 3C6TA 3PX4A 3V6DA 4CIEA 1XWLA 4AHTA 1SL1A 4N47A 4CFAA 3HM9A 1ASUA 5CZ1A 1W0HA 1CZ9A 1J9AA 4J2EA 1BIUA 5DK5A 4FJ8A 4TSXA 4I7FA 2EX3A 1UAXA 1RBTA 3S3NA 4RW4A 5HRPA 4W5TA 1BQMA 3KLFA 4FCYA 4CJLA 3NCIA 3OYMA 4CEZA 1RDBA 1S6QA 4CHPA 4PY5A 1LAVA 4E0DA 4FJJA 1VSLA 4CEDA 4DU3A 4OLAA 3PX0A 4F3TA 3CYMA 5I42A 2OPSA 3RTVA 4DQRA 4PA1A 3LWMA 3NE6A 4CGFA 4O0IA 4DS5A 1NKEA 4B9NA 4KHWA 5HP1A 1JKHA 2KQ2A 3OYNA 3EY1A 5I3UA 2HB5A 1KVCA 2ZD1A 3V1RA 4K8ZA 2OPQA 4LY7A 1HMVA 2OA8A 2OZMA 4KTQA 3QESA 2OZSA 4I9LA 2YHAA 3MEGA 4CJEA 3OYIA 3RMCA 1S5JA 2YKNA 2VWJA 3HP9A 3NAEA 3VQPA 3ZT0A 3K5LA 2Z1JA 3WNEA 2BDPA 4DWIA 1C0MA 1ASVA 4CEEA 4GW6A 3SCXA 3KKRA 3MAQA 4OKJA 3VQ7A 4KPYA 4Z4HA 4O44A 4FJKA 4IFVA 2E4LA 4FW1A 5HBMA 3VQQA 3ASMA 2FBXA 1SL0A 1TAQA 4KB1A 2F96A 2KZZA 4IG3A 1JLFA 2HVIA 3OYHA 1WLJA 1EXQA 2VG6A 3U6FA 2NUBA 1ZBIA 1QSYA 4LH5A 3QETA 2G8HA 3K5OA 4FLVA 1U47A 2RF2A 2KFNA 4FLXA 4E89A 4M45A 1WAFA 3OYCA 2A1SA 1TKTA 3IS9A 3SV3A 1BCOA 2IGIA 3DLEA 5HROA 1RBUA 3ZSYA 4CEBA 3DI6A 5CY4A 4EP4A 2G8FA 3TAQA 1HNVA 4AHVA 2BE2A 3HPOA 1HQEA 3NDKA 4FJLA 4N76A 4QOZB 5D3GA 3KK1A 2F8SA 2YNHA 2X6NA 4AILC 3KD1E 4FZXC 4B08A 4CK1A 3OYEA 1NJWA 1YTAA 3L2UA 2ETJA 2IC3A 3KJVA 3K58A 3BGRA 4BE2A 4DTXA 4BE1A 1B9FA 1NK6A 4KHQA 4CCHA 2P5GA 1EKEA 2BANA 1RT2A 4Q0BA 2DFEA 4YNQA 3ULDA 1WN7A 4O5BA 3SQ2A 1RBVA 3KLIA 4CGDA 4FJMA 3P1GA 1Y97A 3L8BA 4CJPA 2D0BA 5T7BA 3B6PA 5KGXA 4OVLA 3RR8A 4KB0A 3TARA 4OPJA 1W9HA 3V1QA 4E1NA 1NK0A 1GOAA 1YVUA 4F2RA 4CJWA 3QINA 3QIPA 1NK4A 3KK3A 1C1CA 1B92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHN A;  4IFY A;  4ID1 A;  1ZBL A;  3AA4 A;  1NK7 A;  3MED A;  4M3Y A;  2G8I A;  1TGO A;  4JRP A;  4DU4 A;  1X1P A;  3NF8 A;  3DM2 A;  1S9G A;  1FK9 A;  3AO1 A;  3LWL A;  3PY8 A;  1QS4 A;  1RT6 A;  4G1Q A;  4ID5 A;  1IH7 A;  3CM6 A;  3LP0 A;  4OGE A;  4JS4 A;  4E7I A;  3V9X A;  3NGY A;  3NF9 A;  1S1T A;  3NH0 A;  1S1W A;  1ZBF A;  4C8L A;  3PX6 A;  4DQP A;  1REV A;  1L3V A;  1Z26 A;  2YNI A;  3ZSO A;  3AVL A;  1WSG A;  5HRN A;  5J2M A;  4HUG A;  1QHT A;  4YFU A;  2I5J A;  3WNF A;  2KFZ A;  3C94 A;  4BDY A;  4IDK A;  4BE0 A;  4DQQ A;  4F8R A;  3AVB A;  1D9D A;  1UOC A;  3LP1 A;  1WSF A;  3NH1 A;  1TL3 A;  4E1M A;  1HPZ A;  1KFD A;  2HNZ A;  4RW6 A;  1ITG A;  2D5R A;  3V9U A;  5J2Q A;  1NOZ A;  1BIS A;  1F21 A;  2XY8 A;  1RBS A;  2B4J A;  3TAN A;  3AVI A;  4NCA A;  4Z4C A;  2IS3 A;  5HRS A;  4DLE A;  4IKF A;  4O55 A;  3TAB A;  4C8O A;  5KTQ A;  3SNN A;  2DTU A;  3OS0 A;  3HPH A;  3L2V A;  1WSJ A;  2DFH A;  1U45 A;  4J2A A;  1BI4 A;  3KIO A;  4MQ3 A;  4KI4 A;  1RT7 A;  1S1U A;  1ZBU A;  5CYM A;  4CF9 A;  3FFI A;  3VQ8 A;  3NHG A;  2P5O A;  1UWB A;  1RT3 A;  2WOM A;  3D45 A;  3O3F A;  3THV A;  3AVC A;  2RN2 A;  4H4M A;  4B9S A;  3ISN C;  4FM0 A;  1IKY A;  2JGU A;  1IKV A;  2HHT A;  3K5N A;  2VWK A;  3NGI A;  3M8R A;  4DSI A;  4M42 A;  4KV8 A;  4DTR A;  3OJU A;  1I39 A;  2HHQ A;  1HYS A;  1T7P A;  4FJ7 A;  4GVM A;  4WE1 A;  5CYQ A;  3KK2 A;  1WAJ A;  4CIG A;  4C8K A;  4FK2 A;  3ALY A;  3DRS A;  4I2Q A;  4C8N A;  5JS2 A;  1RDC A;  3L2R A;  1RCH A;  1HQU A;  4FK0 A;  3AVF A;  3DLR A;  4DTJ A;  4B9V A;  4CEF A;  2VG5 A;  3KLH A;  4ZHR A;  1LWE A;  1TK8 A;  3AA3 A;  3OJS A;  2HND A;  4JS5 A;  1JXB A;  4CJS A;  4FZY A;  4KRE A;  1HYV A;  4CJR A;  4K8X A;  3OYK A;  1JXE A;  4ICL A;  3RRH A;  1C0U A;  3SPY A;  1BCM A;  4E7J A;  4M3W A;  3QEI A;  4FK4 A;  3NF6 A;  4FLU A;  3QO9 A;  5KI6 A;  1KFS A;  3MXI A;  4HHT A;  1X9M A;  1KLN A;  4DTU A;  3V4I A;  2OPP A;  4E7K A;  2O4I A;  3TWH A;  1TKZ A;  1NOY A;  4BDZ A;  3BDP A;  4DQS A;  2FBY A;  3JYT A;  4KHS A;  3RMB A;  3ZSV A;  3HVT A;  3VQ6 A;  4Z4E A;  1VSJ A;  1TK0 A;  1SV5 A;  1C1A A;  4H4O A;  3VQ9 A;  4CFB A;  3L2Q A;  2D0A A;  3CFP A;  3ITH A;  1QSL A;  1U04 A;  3QER A;  1T8E A;  4FJX A;  1ASW A;  1WSI A;  4CJ5 A;  1YTU A;  5C24 A;  1BGX T;  4DFK A;  3C95 A;  4CEA A;  4DTS A;  4DTM A;  3OY9 A;  1CXQ A;  4CF0 A;  3QEX A;  4LH4 A;  2QK9 A;  1QSS A;  1U48 A;  2LSN A;  3A2F A;  3VQD A;  5KRT A;  2FBV A;  1RT1 A;  2E6M A;  1BL3 A;  4M3R A;  4FJG A;  1T05 A;  1X9S A;  1FKO A;  4F3O A;  1IO2 A;  3CFR A;  3HST B;  5KGW A;  4CES A;  2FBT A;  1SUQ A;  4KAZ A;  1NK8 A;  1NJZ A;  3CQ8 A;  1LW2 A;  3SZ2 A;  3G10 A;  3QNO A;  1G15 A;  3QEP A;  4DTN A;  3UIQ A;  2YKM A;  1NKC A;  2HHV A;  2G8K A;  4DS4 A;  3RMD A;  5CZ2 A;  4FW2 A;  1S9E A;  1RT4 A;  2Z1G A;  4DMN A;  1N6Q A;  1VK0 A;  3OYG A;  2BGG A;  5JS1 A;  4M3T A;  1WSE A;  1SKS A;  5C25 A;  2B5J A;  2FC0 A;  2IOC A;  4GMJ B;  4J2D A;  3MEC A;  3ZT2 A;  4F2S A;  3L3U A;  3OS1 A;  1JLG A;  3IRX A;  4J2B A;  4NCB A;  1QE1 A;  1RIL A;  2HMI A;  1UA0 A;  4B9M A;  1JLB A;  3I0R A;  3C6U A;  4AHU A;  1C0T A;  1B9D A;  3S3M A;  1RTJ A;  3ZCM A;  1LAW A;  2YNF A;  4E7H A;  1XI1 A;  3H08 A;  3LPT A;  3B6O A;  3PUF A;  4CEO A;  5KRS A;  3MXM A;  3AVG A;  2ZE2 A;  2Z1H A;  3E01 A;  4CF1 A;  2F8T A;  2VG7 A;  2P1J A;  4QAG A;  1CLQ A;  1S1V A;  3TI0 A;  2XY6 A;  3AV9 A;  1JLE A;  4DSJ A;  1DTT A;  2GBZ A;  1A5V A;  4B3O A;  1K6Y A;  4LSN A;  5FRO A;  4N5S A;  3HVR A;  1CXU A;  3ZT4 A;  1CZB A;  1D5A A;  1O1W A;  3JSM A;  2YNG A;  4FM1 A;  2HHS A;  4CF2 A;  4Z4I A;  1EET A;  1Q8I A;  4NYN A;  4OPK A;  3EYZ A;  4CJF A;  1RTI A;  1VSH A;  2R7Y A;  3RWU A;  4CJV A;  3L3V A;  1RTH A;  4NCG A;  1LW0 A;  5HLF A;  4FLW A;  2G8W A;  3G0Z A;  3SYZ A;  1BI4 B;  1EX4 A;  1VSE A;  2W42 A;  3LZI A;  3DRR A;  1JL1 A;  2Z1I A;  4W5Q A;  4M3U A;  3NFA A;  3K59 A;  3KD5 E;  4HTU A;  1XHX A;  4DSF A;  1I3A A;  3VQ4 A;  4DTO A;  3U3G A;  1WSH A;  2HHW A;  4DLG A;  1Z25 A;  4CIF A;  1L3U A;  4PUO A;  3OYA A;  4E7L A;  4KHY A;  4CK2 A;  2XY5 A;  3DYA A;  4I2P A;  3NGZ A;  1JLQ A;  1A5W A;  3TAG A;  3PO5 A;  3PV8 A;  5SWM A;  1KSP A;  4BDP A;  2KTQ A;  1TKD A;  4CJT A;  3MXJ A;  4PWD A;  2X6S A;  3QIO A;  5K14 A;  3IAY A;  1BHL A;  4DG1 A;  4KHN A;  3TR8 A;  3OYD A;  3T19 A;  2G8U A;  3AVM A;  1BIZ A;  1HNI A;  3CM5 A;  3K5M A;  4C8M A;  1RNH A;  1KLM A;  1L3S A;  1KVB A;  1RBR A;  3QLH A;  3VN5 A;  4AHR A;  1IKX A;  2JLE A;  2KW4 A;  3DMJ A;  3CG7 A;  4KI6 A;  4CHY A;  3SQ0 A;  4UQG A;  3LZJ A;  1SKR A;  4CHQ A;  3SUN A;  2EHG A;  1VRT A;  2E6L A;  3I0S A;  4FZZ A;  1VSK A;  3PO4 A;  2QXF A;  3HYF A;  1BQN A;  3AO3 A;  4CGG A;  4NYF A;  3M8Q A;  4DF8 A;  4FJH A;  2AJQ A;  1WNS A;  3S3O A;  3DLK A;  3DOK A;  3DLG A;  3ZSX A;  3SV4 A;  1J53 A;  1RDA A;  3SQ1 A;  1VSD A;  3HL8 A;  3VQB A;  3KLE A;  1EP4 A;  1R0A A;  4KTW A;  4JLH A;  4W5O A;  3ZSZ A;  3SPZ A;  1X9W A;  3DRP A;  3ZSW A;  4CEC A;  4B9L A;  4FLY A;  1KVA A;  4M41 A;  3TAM A;  2XHB A;  4JRQ A;  4IBN A;  4ELT A;  1RTD A;  4CJ3 A;  4CJK A;  1TVR A;  3HXM A;  3LP3 A;  4FVM A;  3K2P A;  4KTZ A;  4IG0 A;  4H8K A;  4CFD A;  4ZTF A;  3RMA A;  3F73 A;  3QEW A;  4RW7 A;  1ZYQ A;  3HK2 A;  2GUI A;  3VA0 A;  3AVK A;  2D0C A;  3SI6 A;  3TAF A;  3ZT1 A;  5E41 A;  3T1A A;  2Q3S A;  2IDO A;  4DFP A;  1NK9 A;  3SJJ A;  2XO7 A;  1RT5 A;  4DF4 A;  3QNN A;  3WNG A;  3DOL A;  2XY7 A;  4B9T A;  3AO4 A;  3AVH A;  1A5X A;  1DLO A;  2OPR A;  2IAJ A;  4FJI A;  3OYF A;  3VQ5 A;  3AA2 A;  1JLA A;  4E3S A;  3RR7 A;  2P51 A;  3NH2 A;  4L8R B;  1NJY A;  4CGI A;  1TAU A;  3SUQ A;  4FJ5 A;  1FXX A;  3VQE A;  2HVH A;  1VSI A;  3AO2 A;  3HT3 A;  3DLB A;  1NKB A;  1MU2 A;  4CK3 A;  3KTQ A;  4FJ9 A;  3EZ5 A;  3V9W A;  4HCC A;  1TKX A;  4FLT A;  1HJR A;  4O4G A;  3LDS A;  4CE9 A;  2QKK A;  4BAC A;  1KTQ A;  3P5J A;  1HRH A;  4DFJ A;  2G8V A;  4Z4F A;  4FYD A;  3LP2 A;  4OGC A;  1VRU A;  2ATQ A;  3VA3 A;  3LAK A;  3SUP A;  1U4B A;  1S1X A;  1C1B A;  2YV0 X;  3TAP A;  4FM2 A;  5FRN A;  3RRG A;  5DMR A;  1Q9Y A;  3HPG A;  4AHS A;  2HW3 A;  1UA1 A;  4OKK A;  3K57 A;  4DU1 A;  1C6V A;  3LAM A;  3NBP A;  2X74 A;  3O4N A;  2ITG A;  4OJR A;  2XRI A;  4EP5 A;  1T03 A;  4MFB A;  4BWM A;  3CFO A;  4Z0U A;  4KKO A;  4W5R A;  1U49 A;  4W5N A;  3OYL A;  3KKS A;  3V1O A;  3LAN A;  3M8P A;  3HP6 A;  3AVA A;  2Y1J A;  4CHZ A;  1LV5 A;  1ZBH A;  4DSL A;  4PQU A;  2OYQ A;  3LAL A;  4KHU A;  1KRP A;  4LD0 A;  4Q5V A;  3M8S A;  1KCF A;  1LWC A;  4KFB A;  5J2N A;  2YHB A;  1S6P A;  4E19 A;  1SL2 A;  5J1E A;  3AA5 X;  1J5O A;  2DFF A;  1IG9 A;  3AO5 A;  3TAE A;  4XIU A;  4N56 A;  1JLC A;  3DLH A;  3AVJ A;  1D8Y A;  3AVN A;  4N41 A;  3OYJ A;  4LSL A;  2B6A A;  4ELU A;  4RW8 A;  2PY5 A;  2ZQB A;  4Y1D A;  3V9S A;  2RKI A;  4HVJ A;  1JL2 A;  4CJU A;  3SUO A;  2X78 A;  5FDL A;  2GV9 A;  4F4K A;  3MEE A;  1L5U A;  4CJQ A;  4M3X A;  5J2P A;  3QEV A;  4RW9 A;  1DTQ A;  4HUE A;  1D9F A;  4B8C A;  4OKE A;  4CER A;  1VSF A;  1FKP A;  3LPU A;  3O4Q A;  3WNH A;  2PYL A;  2QKB A;  1J54 A;  3IG1 A;  4AH9 A;  5SZT A;  4FLZ A;  4DQI A;  2WON A;  4DFM A;  4DTP A;  3S9H A;  3O3H A;  3ZSQ A;  4KRF A;  1TV6 A;  1GOB A;  3I8D A;  4CF8 A;  3T3F A;  4ZTJ A;  2HHX A;  1XC9 A;  4CHO A;  3NF7 A;  4EZ6 A;  4HUF A;  3HO1 A;  2DY4 A;  1TL1 A;  1GOC A;  4KO0 A;  1IKW A;  2RPI A;  4Y1C A;  1NK5 A;  1N5Y A;  4B9U A;  3OS2 A;  1HYZ A;  3U3Y A;  3VQC A;  1XHZ A;  2KZM A;  2HNY A;  4CGH A;  4CFC A;  4CJ4 A;  4R5P A;  2PZS A;  4O0J A;  3D0P A;  1QQC A;  4DSK A;  1YT3 A;  1L3T A;  2Y1I A;  5FRM A;  3P83 D;  4CGJ A;  5C42 A;  4HCB A;  3OVN A;  3ZT3 A;  4OLB A;  3VQA A;  1LWF A;  4RG8 A;  3O3G A;  4M3Z A;  1SKW A;  1Q9X A;  2HHU A;  4ELV A;  3ZSR A;  1VSM A;  3V9Z A;  1RDD A;  5HRR A;  4B8A B;  4AHC A;  4CEQ A;  1TK5 A;  4EZ9 A;  2O4G A;  4BWJ A;  5EU7 A;  3OYB A;  3L2W A;  3V81 A;  2A1R A;  4I9Q A;  3KLG A;  4DSE A;  3HJF A;  3SQ4 A;  4FJN A;  4FXD A;  1QTM A;  4Z4G A;  1NJX A;  3F9K A;  4QCL A;  2PYJ A;  3C6T A;  3PX4 A;  3V6D A;  4CIE A;  1XWL A;  4AHT A;  1SL1 A;  4N47 A;  4CFA A;  3HM9 A;  1ASU A;  5CZ1 A;  1W0H A;  1CZ9 A;  1J9A A;  4J2E A;  1BIU A;  5DK5 A;  4FJ8 A;  4TSX A;  4I7F A;  2EX3 A;  1UAX A;  1RBT A;  3S3N A;  4RW4 A;  5HRP A;  4W5T A;  1BQM A;  3KLF A;  4FCY A;  4CJL A;  3NCI A;  3OYM A;  4CEZ A;  1RDB A;  1S6Q A;  4CHP A;  4PY5 A;  1LAV A;  4E0D A;  4FJJ A;  1VSL A;  4CED A;  4DU3 A;  4OLA A;  3PX0 A;  4F3T A;  3CYM A;  5I42 A;  2OPS A;  3RTV A;  4DQR A;  4PA1 A;  3LWM A;  3NE6 A;  4CGF A;  4O0I A;  4DS5 A;  1NKE A;  4B9N A;  4KHW A;  5HP1 A;  1JKH A;  2KQ2 A;  3OYN A;  3EY1 A;  5I3U A;  2HB5 A;  1KVC A;  2ZD1 A;  3V1R A;  4K8Z A;  2OPQ A;  4LY7 A;  1HMV A;  2OA8 A;  2OZM A;  4KTQ A;  3QES A;  2OZS A;  4I9L A;  2YHA A;  3MEG A;  4CJE A;  3OYI A;  3RMC A;  1S5J A;  2YKN A;  2VWJ A;  3HP9 A;  3NAE A;  3VQP A;  3ZT0 A;  3K5L A;  2Z1J A;  3WNE A;  2BDP A;  4DWI A;  1C0M A;  1ASV A;  4CEE A;  4GW6 A;  3SCX A;  3KKR A;  3MAQ A;  4OKJ A;  3VQ7 A;  4KPY A;  4Z4H A;  4O44 A;  4FJK A;  4IFV A;  2E4L A;  4FW1 A;  5HBM A;  3VQQ A;  3ASM A;  2FBX A;  1SL0 A;  1TAQ A;  4KB1 A;  2F96 A;  2KZZ A;  4IG3 A;  1JLF A;  2HVI A;  3OYH A;  1WLJ A;  1EXQ A;  2VG6 A;  3U6F A;  2NUB A;  1ZBI A;  1QSY A;  4LH5 A;  3QET A;  2G8H A;  3K5O A;  4FLV A;  1U47 A;  2RF2 A;  2KFN A;  4FLX A;  4E89 A;  4M45 A;  1WAF A;  3OYC A;  2A1S A;  1TKT A;  3IS9 A;  3SV3 A;  1BCO A;  2IGI A;  3DLE A;  5HRO A;  1RBU A;  3ZSY A;  4CEB A;  3DI6 A;  5CY4 A;  4EP4 A;  2G8F A;  3TAQ A;  1HNV A;  4AHV A;  2BE2 A;  3HPO A;  1HQE A;  3NDK A;  4FJL A;  4N76 A;  4QOZ B;  5D3G A;  3KK1 A;  2F8S A;  2YNH A;  2X6N A;  4AIL C;  3KD1 E;  4FZX C;  4B08 A;  4CK1 A;  3OYE A;  1NJW A;  1YTA A;  3L2U A;  2ETJ A;  2IC3 A;  3KJV A;  3K58 A;  3BGR A;  4BE2 A;  4DTX A;  4BE1 A;  1B9F A;  1NK6 A;  4KHQ A;  4CCH A;  2P5G A;  1EKE A;  2BAN A;  1RT2 A;  4Q0B A;  2DFE A;  4YNQ A;  3ULD A;  1WN7 A;  4O5B A;  3SQ2 A;  1RBV A;  3KLI A;  4CGD A;  4FJM A;  3P1G A;  1Y97 A;  3L8B A;  4CJP A;  2D0B A;  5T7B A;  3B6P A;  5KGX A;  4OVL A;  3RR8 A;  4KB0 A;  3TAR A;  4OPJ A;  1W9H A;  3V1Q A;  4E1N A;  1NK0 A;  1GOA A;  1YVU A;  4F2R A;  4CJW A;  3QIN A;  3QIP A;  1NK4 A;  3KK3 A;  1C1C A;  1B92 A; 
#chains in the Genus database with same CATH topology
 3AA4 A;  3MED A;  4JRP A;  1EO1 A;  3NF8 A;  3DM2 A;  4ISG A;  4LF8 K;  3THX B;  3SBG A;  4BG8 A;  4DR5 K;  3AO1 A;  3GE1 A;  4ID5 A;  3LP0 A;  3SAF A;  2HBL A;  1S1T A;  1S1W A;  4C8L A;  3A5M C;  1REV A;  3J8A A;  3M3Z A;  3AVL A;  4JHD B;  2W6K A;  5J2M A;  1IBM K;  1QHT A;  4BDY A;  3AVB A;  1HKC A;  3LP1 A;  2OTL N;  1S3X A;  2HBJ A;  3QML A;  4KH4 A;  2OTJ N;  3A5O C;  1TL3 A;  4E1M A;  1OH7 A;  2HNZ A;  4H5W A;  3TSP A;  1NOZ A;  4NCA A;  5BRD A;  3FR0 A;  4Z4C A;  4IKF A;  4DLE A;  4C8O A;  2JWL A;  1BUP A;  3HPH A;  3L2V A;  1WSJ A;  3C0B A;  4BRI A;  3KIO A;  5AQL A;  1S1U A;  5CYM A;  3FFI A;  2HF4 A;  2CH5 A;  3O3F A;  2EWS A;  3AVC A;  5EY4 A;  2P9I A;  4FM0 A;  1OH8 A;  3NGI A;  4M42 A;  3L6Q A;  2BTF A;  1T7P A;  4FJ7 A;  5IT9 O;  4GVM A;  4WE1 A;  5CYQ A;  4C8K A;  4CIG A;  1Z6R A;  3ALY A;  3OW2 M;  3TU5 A;  5I9E B;  3E9L A;  4B9Q A;  4CEF A;  2VG5 A;  3ZEU B;  4ZHR A;  4DV4 K;  2O8D A;  4EAH D;  1YJ9 N;  5F1X A;  1JXB A;  4CJS A;  4FZY A;  4K8X A;  3SMS A;  3RRH A;  4FOE A;  4E1J A;  4FLU A;  1KLN A;  2PAV A;  3OTO K;  3V4I A;  4E7K A;  5BPM A;  3TWH A;  3BDP A;  4BDZ A;  3MCP A;  1TK0 A;  1IBL K;  1S72 N;  1SV5 A;  4CFB A;  3CFP A;  2YHY A;  2F4V K;  1QSL A;  1ASW A;  4CJ5 A;  4JI2 K;  4IO8 A;  3G25 A;  4M7Y A;  4DTM A;  3OY9 A;  4DR2 K;  4CF0 A;  3GDQ A;  4LH4 A;  2HHS A;  5KRT A;  4EIA A;  1BL3 A;  3CJ1 A;  1NGB A;  1HJO A;  3N4P A;  5A2Q O;  2P9S B;  3HST B;  2FBT A;  4KAZ A;  3QEP A;  3QNO A;  1NKC A;  4DS4 A;  5CZ2 A;  1RT4 A;  2QWN A;  2UUC K;  4M3T A;  1WSE A;  4YOY A;  1K8K A;  5AQG A;  3OS1 A;  3IRX A;  1K8A O;  1UA0 A;  1C0T A;  5IWA K;  3I8B A;  3ZCM A;  2V51 B;  4YOV A;  2QI2 A;  4GY2 B;  5JLH A;  1OH5 A;  2P1J A;  4FSV A;  4DR4 K;  1S1V A;  5JVH L;  1JLE A;  3HSC A;  1DTT A;  1A5V A;  1SS6 A;  1Y64 A;  1CZB A;  1D5A A;  1O1W A;  3CCE N;  4NLC A;  1EET A;  4OPK A;  2R7Y A;  4CJV A;  1RTH A;  3VEZ A;  2Q1N A;  2QWO A;  3G0Z A;  3SYZ A;  3ZX0 A;  2W42 A;  4M3U A;  3OBY A;  5AQT A;  3KD5 E;  4HTU A;  4OO1 J;  3VQ4 A;  4DTO A;  1RDW X;  3U3G A;  1WSH A;  2HHW A;  4JEP A;  4CIF A;  5LL6 Z;  4E7L A;  4CK2 A;  1E4G T;  2XY5 A;  4JI4 K;  1QQO A;  1A5W A;  3HOT A;  3PV8 A;  4BDP A;  1ZC6 A;  4JK9 A;  2X6S A;  1QVF M;  5K14 A;  2V7Z A;  3IAY A;  3MWP A;  1JCG A;  3AVM A;  1BIZ A;  1X3N A;  4NXM K;  1L3S A;  4DCH A;  1YUW A;  1RBR A;  4WYB A;  4KI6 A;  1M1K O;  4UQG A;  3SUN A;  2E6L A;  3ZX3 A;  2WTU A;  1QQN A;  3HOS A;  1BQN A;  4DF8 A;  2FF3 B;  3DOK A;  3DLG A;  1VQP N;  3ZSX A;  3SV4 A;  1N32 K;  3VQB A;  2CGJ A;  3DJC A;  4JKG B;  1R0A A;  3BY5 A;  3ZSZ A;  5M1Q A;  4MO4 A;  1VQK N;  4FWP A;  3O8M A;  2HHH K;  4B9L A;  1QHA A;  3E66 A;  2O8F B;  4ELT A;  4A61 A;  3CQ8 A;  4CJK A;  1RTD A;  1C0G A;  3ZET A;  3RMA A;  2O8B A;  1HX1 A;  4RW7 A;  4DV2 K;  1BA1 A;  2D0C A;  3ZT1 A;  4JI3 K;  1GLE G;  2Q3S A;  4DFP A;  2QWM A;  4YOT A;  4CBU A;  3FLC O;  3SJJ A;  2XO7 A;  4G9Z A;  3VGK A;  2OAN A;  4NB4 A;  4XH5 A;  2XY7 A;  1DLO A;  4FJI A;  2VYP A;  3VQ5 A;  3AA2 A;  1MA9 B;  2JWK A;  3SUQ A;  3U8X A;  3AO2 A;  4ILG B;  3MX2 A;  3DLB A;  5EXW A;  3T69 A;  4HCC A;  1TKX A;  1HJR A;  3LDS A;  2QKK A;  4BGB A;  2G8V A;  3LP2 A;  4OGC A;  1IV0 A;  1NGI A;  2ATQ A;  3SUP A;  1S1X A;  4BRF A;  4LF6 K;  3DAW A;  1Q9Y A;  3HPG A;  3E9O A;  4B1Y B;  4O8K A;  1UA1 A;  4DU1 A;  1C6V A;  3LAM A;  3NBP A;  3VER A;  2X74 A;  3TTC A;  2E1Y A;  4BRC A;  3K0S A;  4Z0U A;  2PBD A;  3LAN A;  3WUH A;  2Y1J A;  4DSL A;  4DB3 A;  4DV7 K;  4DHY A;  3AA5 X;  3TAE A;  4ISF A;  4BRO A;  2A40 A;  3AVJ A;  4JKH A;  2WBN A;  3AVN A;  4H5N A;  3OYJ A;  1YIT N;  2ZQB A;  3O5B A;  1NGF A;  3WXM B;  3VEO A;  4BR0 A;  2GV9 A;  3MEE A;  4MO5 A;  1VSF A;  4AH9 A;  3IKM A;  3S9H A;  3I8D A;  4ZTJ A;  3NF7 A;  4HUF A;  3HO1 A;  4KO0 A;  4YDU C;  3CC7 N;  2E5L K;  3CCJ N;  4CGH A;  2PZS A;  5AQS A;  1QQC A;  1DKG D;  1LWF A;  2HHU A;  4ELV A;  3ZSR A;  3V9Z A;  4CEQ A;  1NGH A;  2QWL A;  4DSE A;  3O9S A;  4K25 A;  5E26 A;  4QCL A;  1YI2 N;  3V6D A;  1JJ2 M;  4CIE A;  4GKJ K;  3O9U A;  2KLA A;  1SL1 A;  3HM9 A;  4CZM A;  4FJ8 A;  5M1F A;  1FJG K;  1GLF O;  4TSX A;  2EX3 A;  5AQQ A;  4RW4 A;  5HRP A;  4FCY A;  4CJL A;  3NCI A;  1S6Q A;  1HKG A;  1VSL A;  4FWS A;  3TTF A;  4H0Y B;  3F5T A;  3O1W A;  4BR7 A;  4B3T K;  1YVN A;  4WFA L;  2W41 A;  3VOV A;  1NKE A;  4KHW A;  2HMP A;  2F7T A;  3EY1 A;  4ISE A;  4XH4 A;  2ZD1 A;  2P9P B;  2OPQ A;  4H0T B;  2OA8 A;  4KTQ A;  3D2F A;  2YHA A;  3MEG A;  2YKN A;  3VQP A;  4DWI A;  5DM6 L;  3K5L A;  2BDP A;  1C0M A;  4LFB K;  2VGN A;  5KQ8 A;  3W3D A;  4Z4H A;  5JVG L;  3EKS A;  3BF1 A;  4FJK A;  2E4L A;  4HWI A;  1TAQ A;  2F96 A;  4IG3 A;  4PHT X;  2HVI A;  1EXQ A;  4YDU A;  4GV6 A;  1NMD A;  1ZBI A;  1YHQ N;  3ENB A;  3GL1 A;  2W6L A;  3K5O A;  1U47 A;  3CQY A;  4BRD A;  4BRL A;  4E89 A;  2IGI A;  3KVG A;  3AGK A;  3DLE A;  1RBU A;  3ZSY A;  4CZE A;  2O8C B;  4DR3 K;  3HPO A;  4FJL A;  4DR7 K;  4RCH A;  3KK1 A;  3UE5 A;  4B08 A;  4CK1 A;  3TPQ A;  3L2U A;  2IC3 A;  1NGG A;  1ILY A;  2BAN A;  5AQF A;  4Q0B A;  2DFE A;  4YNQ A;  1WN7 A;  5KQD A;  1OVY A;  4BVP A;  4DUZ K;  3RSE A;  2NRR A;  4OVL A;  3HI0 A;  2QTD A;  3QIP A;  3KK3 A;  1C1C A;  3CM6 A;  1VQ5 N;  1WBD A;  1R59 O;  2G8I A;  1NMN A;  1X1P A;  1S9G A;  3PY8 A;  2PFU A;  1QS4 A;  3QIC A;  4G1Q A;  1HUX A;  1IH7 A;  5AQW A;  3V9X A;  3NF9 A;  3NH0 A;  1VQ6 N;  4UY8 O;  3PX6 A;  3H45 C;  4AM7 A;  3QBX A;  1E3M A;  3G6E N;  5GAD P;  3WNF A;  5GIP A;  2KFZ A;  1YXQ A;  3C94 A;  4F8R A;  4BE0 A;  4DQQ A;  2A5X A;  4DKW A;  1WSF A;  3CC2 N;  3NH1 A;  5C2D A;  1VQO N;  1ITG A;  2D5R A;  5J2Q A;  3TAN A;  3AVI A;  5HRS A;  2E2N A;  5KTQ A;  3SNN A;  2DTU A;  3OS0 A;  2DFH A;  1U45 A;  1BI4 A;  4A59 A;  4CZL A;  2F9W A;  5FLX O;  1ZBU A;  3E1Y A;  2P5O A;  3VQ8 A;  3NHG A;  1RT3 A;  3D45 A;  2RN2 A;  5ADX H;  3PIP L;  1IKY A;  3M8R A;  3C7N A;  4KV8 A;  3CJC A;  3EL2 A;  1I39 A;  2Q36 A;  4YHH K;  5AQX A;  1Q7Y O;  2IIR A;  1WAJ A;  4FK2 A;  4I2Q A;  4C8N A;  5JS2 A;  3L2R A;  1RDC A;  3CIP A;  4I6M A;  3A0I X;  4KH5 A;  5AQH A;  3L4Q A;  4DTJ A;  4B9V A;  4B3R K;  4JD2 A;  5AQJ A;  1KC8 O;  3P38 A;  5AQN A;  4BC5 A;  1QZ5 A;  5KPR A;  5HL7 L;  3MN7 A;  5BRE A;  1BCM A;  4M3W A;  4FK4 A;  3MXI A;  4HHT A;  4KHP K;  4B1W B;  2VWB A;  4DQS A;  4KHS A;  4RTF D;  3VQ6 A;  4BRM A;  4LF4 K;  2D0A A;  3ITH A;  3AGR A;  3LDL A;  1WSI A;  5TKY A;  1YTU A;  3C95 A;  4C1N K;  4BQZ A;  4IOX A;  2LSN A;  4M3R A;  4AF1 A;  1XUP O;  1FKO A;  2Q2R A;  3VET A;  3FE1 A;  3BUZ B;  5GIN A;  5BN9 A;  3G71 N;  4CES A;  1SUQ A;  3EZW A;  3SZ2 A;  3G10 A;  3UIQ A;  1K8K B;  1S9E A;  5JMV A;  2BGG A;  5JS1 A;  5GAE P;  4X64 K;  4JI7 K;  2HBK A;  5CE3 A;  2IOC A;  3L3U A;  2ZJR L;  1D4X A;  1JLG A;  5LJW A;  1QE1 A;  1RIL A;  5LMU K;  1B9D A;  1BDG A;  3IDH A;  3S3M A;  3J7A P;  1RTJ A;  1LAW A;  2YNF A;  3H08 A;  3P31 A;  2UYT A;  2ZE2 A;  2F8T A;  4QAG A;  5M1O A;  1CLQ A;  2E1Z A;  3TI0 A;  3AV9 A;  4M63 C;  4DSJ A;  1XMQ K;  4N5S A;  1U2V B;  4FM1 A;  3CI5 A;  3JAM O;  2KKZ A;  3EEQ A;  1Q8I A;  4NYN A;  3EYZ A;  1QVG M;  3RWU A;  3L3V A;  3FFK B;  5HLF A;  4FLW A;  5AQM A;  2G8W A;  3THW A;  2RE2 A;  1VSE A;  4W5Q A;  4O8U A;  2P9L B;  3SBT A;  1XHX A;  1I3A A;  3PSF A;  2F9T A;  2QM1 A;  4EHT A;  1Z25 A;  1SQK A;  4KHY A;  3DYA A;  1JLQ A;  1DEJ A;  1TKD A;  3MXJ A;  4PWD A;  1KAX A;  3D7E O;  4DG1 A;  3MWT A;  2A6A A;  1HNI A;  3K5M A;  1KLM A;  4AHR A;  3QLH A;  2KW4 A;  3DMJ A;  3CG7 A;  3SQ0 A;  4PKH A;  1GLD G;  1SKR A;  2EHG A;  4JK8 A;  3I0S A;  1VSK A;  1IG8 A;  1IBK K;  3UKR A;  4BC3 A;  4BC4 A;  3VEW A;  3SQ1 A;  2HST A;  3FZF A;  3KLE A;  3ULE B;  3CXC M;  4W5O A;  1X9W A;  3ZSW A;  4FWQ A;  4CEC A;  3SJH A;  4FLY A;  3JXU A;  2O8B B;  1U6Z A;  4WFB L;  1TVR A;  3LP3 A;  4KTZ A;  4H8K A;  3CER A;  4ZTF A;  4BRA A;  4IOC L;  4FWR A;  1NGA A;  2GUI A;  2HOE A;  3SI6 A;  2GUP A;  4K42 A;  5E41 A;  4IOA L;  3O9R A;  3T1H K;  3T1A A;  3QDK A;  1NK9 A;  2ASM A;  1VQN N;  3MDQ A;  3LDN A;  3SK3 A;  1RT5 A;  3IUC A;  2H3G X;  1XMO K;  4BRH A;  3QFU A;  1A5X A;  2OPR A;  1KAY A;  3VF2 A;  5GAH P;  1JLA A;  4E3S A;  3RR7 A;  1SZ2 A;  3NH2 A;  4L8R B;  2J4R A;  1TAU A;  1FXX A;  3VQE A;  1VSI A;  3JS6 A;  4YOW A;  3EZ5 A;  4BAC A;  4Z4F A;  4JAX A;  1N36 K;  4A5A A;  1VRU A;  4EZ6 A;  1U4B A;  3RRG A;  5DMR A;  3MN6 A;  3EO3 A;  4AHS A;  4OKK A;  3K57 A;  3TSQ A;  4EP5 A;  2XRI A;  4W5N A;  4MFB A;  3CCV N;  3CFO A;  4LC9 B;  4CW7 B;  1U49 A;  4JI5 K;  3V1O A;  5HOO A;  3HP6 A;  3AVA A;  3NVM A;  1ZBH A;  3CJ7 A;  3LAL A;  4KHU A;  3PLA A;  4LD0 A;  4Q5V A;  2GX9 A;  4B1U B;  5J2N A;  1SL2 A;  3R3L A;  2DFF A;  4LF7 K;  3AO5 A;  4XIU A;  3TSU A;  4N56 A;  4N41 A;  4LSL A;  2B6A A;  4ELU A;  4O5F A;  2PY5 A;  1BA0 A;  4HVJ A;  1JL2 A;  4CJU A;  1KAZ A;  4IEE A;  4IEI A;  4F4K A;  1L5U A;  3ATU A;  5J2P A;  4QS9 A;  3L4I A;  4BRG A;  1D9F A;  4OKE A;  3THX A;  1FKP A;  3O4Q A;  3WNH A;  1J54 A;  3IG1 A;  4DQI A;  2UXB K;  2WON A;  4DTP A;  4CBX A;  3O3H A;  1HNW K;  4KRF A;  1TV6 A;  4YY3 K;  2HHX A;  2QWR A;  2DY4 A;  1GOC A;  1IKW A;  2RPI A;  1NK5 A;  4BR4 A;  2I7P A;  1JCF A;  1N5Y A;  3MX5 A;  3OS2 A;  3U3Y A;  3VQC A;  2HNY A;  4R5P A;  4CFC A;  3VMF B;  1YT3 A;  3LDQ A;  1DGK N;  5FRM A;  5BN8 A;  4HCB A;  1V4S A;  3OVN A;  3VF4 A;  1ZXO A;  3O3G A;  3O08 A;  4RG8 A;  4M3Z A;  2CGK A;  1VSM A;  4AHC A;  4EZ9 A;  2O4G A;  3HJF A;  5JIC A;  3J80 O;  3KLG A;  4FXD A;  2RHK A;  1QTM A;  3F9K A;  2PYJ A;  1ASU A;  5CZ1 A;  1CZ9 A;  3UKU A;  1BIU A;  2E20 A;  4DV5 K;  4W5T A;  5H1S Q;  1RDB A;  4E0D A;  4CED A;  4DU3 A;  1TUU A;  4OLA A;  3PX0 A;  4F3T A;  5AQU A;  3PIO L;  5I42 A;  2OPS A;  3RTV A;  4DQR A;  4H0V B;  3GG4 A;  3K9J A;  3NE6 A;  2A3Z A;  1JKH A;  2NRZ A;  5ELZ A;  2P9K A;  5CR4 A;  2HB5 A;  2D4W A;  3BEX A;  1HMV A;  5AZJ A;  2P9U B;  2OZS A;  1W97 L;  4CJE A;  3RMC A;  1S5J A;  1NGE A;  4GV3 A;  2E2P A;  3ZT0 A;  2Z1J A;  3WNE A;  4CEE A;  3SCX A;  3D2E A;  4PKI A;  3N4Q A;  4IFV A;  5AQR A;  2KZZ A;  1JLF A;  3OYH A;  1WLJ A;  3GOI A;  2VG6 A;  2NRH A;  4C23 A;  2G8H A;  2KFN A;  5AQK A;  4AM6 A;  1SAZ A;  4IFE A;  4CEB A;  2GEM A;  4ILH A;  2BUP A;  3A8Y A;  3TAQ A;  1HNV A;  2V52 B;  2YNH A;  2X6N A;  1ATN A;  2FXU A;  4FZX C;  1NWK A;  5EVZ A;  1NJW A;  3BGR A;  4BE2 A;  1WB9 A;  4KHQ A;  4Y0W A;  4CGD A;  3R9P A;  3P1G A;  4H5R A;  1TUY A;  4CZJ A;  5BPN A;  3L8B A;  1HPM A;  3J7Y P;  1GLC G;  4OPJ A;  1HKB A;  4F2R A;  1GOA A;  1YVU A;  4CJW A;  3U9D A;  2BH1 A;  1B92 A;  1ZBL A;  1BU6 O;  3DXM B;  5C10 A;  1NK7 A;  4BRN A;  4K43 A;  3HZ6 A;  4DU4 A;  1FK9 A;  2A41 A;  5M1P A;  4BQL A;  1RT6 A;  3FZL A;  3BZK A;  4OGE A;  4JS4 A;  4E7I A;  1KQS M;  4KH6 A;  4U7B A;  1LCU A;  1L3V A;  4DQP A;  1LOT B;  2YNI A;  1WSG A;  5HRN A;  4HUG A;  1NG9 A;  3THY B;  3QBW A;  4GV9 A;  4CI6 A;  4IDK A;  4WFN L;  1D9D A;  2O8E A;  1HPZ A;  1KFD A;  1BIS A;  1F21 A;  2XY8 A;  1RBS A;  4YOU A;  1WBB A;  1TYQ A;  2IS3 A;  3EE8 A;  3TAB A;  1X9J A;  4MQ3 A;  4KI4 A;  1GLB G;  1RT7 A;  3LDP A;  4CF9 A;  3HBT A;  1UWB A;  3THV A;  4B9S A;  1IKV A;  2HHT A;  3MK6 A;  2HHQ A;  1XC3 A;  4I6M B;  1VQL N;  3KK2 A;  4JD2 B;  4Z94 A;  3O1B A;  1RCH A;  1HQU A;  4FK0 A;  4LF5 K;  3AVF A;  1LWE A;  5AZI A;  1TK8 A;  3H3O B;  1Q86 O;  4JS5 A;  4KRE A;  5EOY A;  1HYV A;  3D6R A;  4WQ5 C;  1C0U A;  3SPY A;  4E7J A;  3QEI A;  4FPB A;  2P9N A;  4DTU A;  4IZ9 A;  1CZA N;  2E2O A;  2OPP A;  2O4I A;  1NJI O;  1TKZ A;  3O80 A;  3JYT A;  3RMB A;  1JCE A;  3H1V X;  4IJA A;  5M1N A;  2D0P A;  4DFK A;  2YI1 A;  4DTS A;  4BRQ A;  2QK9 A;  3A2F A;  2FBV A;  2E6M A;  4FJG A;  2WC9 A;  1X9S A;  3FZK A;  3AAP A;  3CFR A;  5KGW A;  3LM9 A;  4PQU A;  1NK8 A;  1LW2 A;  1G15 A;  4EFH A;  4BVO A;  4DTN A;  2HHV A;  3EKU A;  3CJ9 A;  3DWL A;  4RWT A;  3M6G A;  4OPH A;  4FW2 A;  3RMD A;  3SMP A;  2G8K A;  4DMN A;  1VK0 A;  3OYG A;  1SKS A;  4OPA A;  2IVO A;  5C25 A;  2VQF K;  3MEC A;  4CD3 A;  3A5L C;  1V4T A;  1BO5 O;  4B9M A;  3I0R A;  3SAG A;  3C6U A;  3H3N O;  3WQT A;  4E7H A;  1XI1 A;  3LPT A;  3PUF A;  4CEO A;  4CF1 A;  2ZF5 O;  2NRX A;  4WQ5 A;  4JKD A;  3WEE A;  2VGM A;  4R79 A;  4B3O A;  2W40 A;  4B1V A;  3JSM A;  2YNG A;  4Z4I A;  4ILJ A;  4CJF A;  1VSH A;  5BPL A;  4NCG A;  5AFU A;  1LW0 A;  2WUS A;  4DV3 K;  1EWR A;  3LZI A;  3DRR A;  1JL1 A;  2Z1I A;  5AR0 A;  3CMA N;  3NFA A;  3K59 A;  4DSF A;  4A5B A;  3LDO A;  4DLG A;  1L3U A;  4PUO A;  1NGD A;  2P9I B;  3NGZ A;  3PO5 A;  3DXK A;  3QIO A;  1EQY A;  3F9M A;  4JKE A;  3K9K A;  3MN9 A;  4KHN A;  3TR8 A;  3OYD A;  3CM5 A;  4C8M A;  1RNH A;  3W0L A;  4CD1 A;  5AFU H;  4EHU A;  1KVB A;  3HTV A;  1IKX A;  2JLE A;  4CHY A;  2ZWH A;  3UKR B;  4JKB A;  3WXI A;  2ASP A;  4CHQ A;  3LZJ A;  2O8D B;  1VRT A;  2V7Y A;  4FZZ A;  3PO4 A;  2QXF A;  3HYF A;  4CGG A;  4NYF A;  4FJH A;  2AJQ A;  1WNS A;  3S3O A;  1VHX A;  3DLK A;  3QB0 A;  1VSD A;  5BRF A;  3VEY A;  1T6D A;  1EP4 A;  4YOR A;  3A5N C;  3CCQ N;  4KTW A;  1GLA G;  3CQX A;  2FLO A;  3SPZ A;  4BRE A;  3VGL A;  1KVA A;  2ZGY A;  1NGC A;  3VTI A;  4IBN A;  4QS8 A;  3WXJ A;  3K2P A;  4IDH A;  4CFD A;  1BG3 A;  1C0F A;  3F73 A;  3QEW A;  1ZYQ A;  1GLL O;  3VA0 A;  3B8A X;  3TAF A;  1MWK A;  1T3V A;  1OKJ A;  4IJN A;  3P39 A;  4JN4 A;  4DF4 A;  3QNN A;  3WNG A;  3CPW M;  3DOL A;  1Q18 A;  3AO4 A;  3AVH A;  3CCS N;  4MDB A;  4CGI A;  4FJ5 A;  3ZLJ A;  3T7Z A;  3QFP A;  3V9W A;  2E8A A;  2GTD A;  4O4G A;  4CE9 A;  4FYD A;  1HRH A;  3VA3 A;  3LAK A;  4CZH A;  2YV0 X;  5FPE A;  3TAP A;  4FM2 A;  4OJR A;  5JLF A;  4BWM A;  2O8C A;  4KKO A;  3BF3 A;  3KKS A;  3M8P A;  1YJW N;  4CHZ A;  1N33 K;  3DLL L;  2OYQ A;  1KRP A;  1BWF O;  4X62 K;  3M8S A;  2GWK A;  1S6P A;  4E19 A;  5J1E A;  1W2B M;  2KHO A;  4H5V A;  2AP1 A;  3DLH A;  4BRP A;  4FWM A;  4RW8 A;  2YJF A;  4Y1D A;  3SUO A;  3WXK A;  3Q7C A;  4CJQ A;  5AQI A;  2HF3 A;  3QEV A;  4RW9 A;  4HUE A;  4FVU A;  4CER A;  3C65 A;  4FLZ A;  2YJE A;  4JYA K;  3O4W A;  3CJA A;  3U9Z A;  1GOB A;  3T3F A;  4CHO A;  5EX5 A;  4B9U A;  1HYZ A;  3ID6 A;  1XHZ A;  5BR9 A;  3GBT A;  4QS7 A;  4IO9 L;  4CJ4 A;  2ZGZ A;  3D0P A;  1L3T A;  2Y1I A;  1W7A A;  4CGJ A;  1NGJ A;  3ZT3 A;  4OLB A;  4PL8 A;  1XNR K;  2YCH A;  2ZM6 K;  1SKW A;  1Q9X A;  5CHI A;  1TK5 A;  4WF9 L;  4BWJ A;  3V81 A;  5E84 A;  1XNQ K;  1NNE A;  3SQ4 A;  1NJX A;  2UUA K;  3UKU B;  4XH1 A;  3P4I A;  4A62 A;  5AJ3 K;  2WFB A;  1N8R O;  1XWL A;  4GVE A;  4AHT A;  4N47 A;  4CFA A;  1M90 O;  1O13 A;  1W0H A;  1VAZ A;  1J9A A;  2QW9 A;  1RBT A;  3CCM N;  3S3N A;  3KLF A;  1BQM A;  4CEZ A;  4CHP A;  1VQ7 N;  1LAV A;  3ZET B;  2AA4 A;  3CYM A;  2I7N A;  2P9K B;  4PA1 A;  3LWM A;  5AZJ B;  4O0I A;  4DS5 A;  3KWI A;  4BY9 C;  3G4S N;  4JV5 K;  2KQ2 A;  5B8H A;  2CH6 A;  1BOT O;  5I3U A;  3MN5 A;  4JNE A;  1KVC A;  1HR0 K;  4K8Z A;  4HTL A;  1GLJ O;  3D2E B;  2FSK A;  2VWJ A;  3HP9 A;  3RVC A;  1ASV A;  4GW6 A;  3KKR A;  4NO7 A;  4FPA A;  3SAH A;  4FW1 A;  3VQQ A;  3ASM A;  2FBX A;  1SL0 A;  2YHX A;  3U6F A;  1VQM N;  2NUB A;  3FZH A;  5KPZ A;  2RF2 A;  5LY3 A;  1WAF A;  4OX9 K;  1BCO A;  3O9T A;  4DV0 K;  1HNZ K;  2UUB K;  2E88 A;  5HRO A;  5BR8 K;  4JI6 K;  1XQS C;  3DI6 A;  4DR1 K;  4FWK A;  4AHV A;  4H0P A;  4WCE L;  2BE2 A;  3HM8 A;  1HQE A;  3NDK A;  2ZJQ L;  4N76 A;  5D3G A;  1K9M O;  4B3S K;  3KJV A;  3K58 A;  1NK6 A;  3WQU A;  3TTD A;  4DTX A;  2OCE A;  2P5G A;  1EKE A;  1YF5 L;  3ULD A;  1RBV A;  4BR9 A;  1Y97 A;  4KBO A;  2D0B A;  5F0X A;  3B6P A;  2ZJP L;  4CJ7 A;  5KGX A;  3RR8 A;  4PL7 A;  1W9H A;  4E1N A;  1NK0 A;  2GEL A;  1NJY A;  3HT3 A;  4CHN A;  4IFY A;  4ID1 A;  3WT0 A;  4M3Y A;  3VTH A;  1TGO A;  3SLC A;  1RDU A;  3LWL A;  1H1V A;  3HRG A;  3NGY A;  1ZBF A;  2VCP A;  1Z26 A;  3ZSO A;  2O8E B;  4YFU A;  2I5J A;  3CME N;  4JHD A;  1UOC A;  1TYQ B;  1NU0 A;  1U2V A;  4RW6 A;  3V9U A;  4A57 A;  4BG9 A;  2B4J A;  4O55 A;  3VF6 A;  3CPE A;  4J2A A;  3ENH A;  1T6C A;  2P9L A;  3PSI A;  4NLB A;  1YIJ N;  1I94 K;  2WOM A;  4C1N I;  2D0O A;  4H4M A;  3ISN C;  2JGU A;  3K5N A;  2VWK A;  4DSI A;  4DTR A;  3OJU A;  1HYS A;  4J8F A;  3AAR A;  4MDA A;  2D1K A;  3DRS A;  5AZI B;  1KXP A;  3KK7 A;  3ATV A;  3DLR A;  3KLH A;  1ATS A;  3AA3 A;  3VEX A;  3OJS A;  2HND A;  3D2F B;  3VEV A;  4CJR A;  4K0K K;  3EN9 A;  2P9N B;  3ZEU A;  3OYK A;  1JXE A;  3ENO A;  4ICL A;  1Q81 O;  3OA9 A;  3NF6 A;  1KFS A;  3QO9 A;  5KI6 A;  1ZBS A;  1X9M A;  5C15 A;  3ULE A;  1NOY A;  2FBY A;  3L0Q A;  4DV6 K;  5C2F A;  3ZSV A;  1HLU A;  3HVT A;  4CBW A;  4Z4E A;  1VSJ A;  5AQV A;  3BP8 A;  1C1A A;  4H4O A;  4FO0 A;  4L3Q A;  2ASO A;  3VQ9 A;  3L2Q A;  2QEX N;  1X3M A;  1U04 A;  3QER A;  1T8E A;  4FJX A;  4BR5 A;  3AAQ A;  2QA4 N;  5C24 A;  1BGX T;  4NXN K;  4FWO A;  3CD6 N;  4CEA A;  1CXQ A;  2Q0R A;  3QEX A;  1QSS A;  1U48 A;  3VQD A;  3NMU A;  1RT1 A;  1T05 A;  4F3O A;  1IO2 A;  4H0X B;  1OVQ A;  1NJZ A;  2NNW A;  2YKM A;  5TKW A;  4BR2 A;  1EWQ A;  2P9S A;  3RSE B;  2Z1G A;  1N6Q A;  4H03 B;  5C12 A;  3CJB A;  2B5J A;  2FC0 A;  4GMJ B;  4J2D A;  5FPM A;  3ZT2 A;  4CZI A;  1QZ6 A;  4F2S A;  1ATR A;  4J2B A;  4WQ4 C;  4NCB A;  1K73 O;  2HMI A;  1JLB A;  4AHU A;  3MCA B;  4JKF A;  3I33 A;  2QXL A;  3B6O A;  4X66 K;  2UU9 K;  3OHR A;  5KRS A;  3WEE B;  3AVG A;  3MXM A;  2Z1H A;  3E01 A;  1VQ8 N;  2VG7 A;  5GAG P;  5AQO A;  2XY6 A;  2GBZ A;  4U67 L;  1K6Y A;  4FWN A;  4LSN A;  5FRO A;  3H6E A;  2UXD K;  4JKA A;  3HVR A;  1CXU A;  3ZT4 A;  4CF2 A;  4B1X B;  1WUA A;  1RTI A;  4CZF A;  1QQM A;  1BI4 B;  5FPD A;  3M5R A;  1EX4 A;  3DXK B;  3OYA A;  2IVN A;  3TAG A;  4I2P A;  4JK7 A;  5SWM A;  4AQY K;  1KSP A;  2KTQ A;  1RGI A;  3C7N B;  4BGA A;  4CJT A;  3VEN A;  2Q0U A;  2UXC K;  2YHW A;  3T1Y K;  3IFR A;  1BHL A;  3T19 A;  2G8U A;  3FZM A;  4FL9 A;  3BZC A;  3VN5 A;  3CCL N;  1J6Z A;  3H46 O;  1IJJ A;  4K41 A;  3KHY A;  4PKG A;  3AO3 A;  3M8Q A;  4WQ4 A;  5FPN A;  3KWG A;  4YOX A;  2FSJ A;  1J53 A;  1RDA A;  3HL8 A;  2QWQ A;  1P90 A;  4B3M K;  4JLH A;  4IXC A;  3DRP A;  3NVK A;  3O9Q A;  1YAG A;  1P8Z A;  4JKG A;  3Q7B A;  4M41 A;  3TAM A;  2XHB A;  4JRQ A;  1HNX K;  4CJ3 A;  3HXM A;  4FVM A;  4IG0 A;  3VES A;  4A2B A;  3HK2 A;  2QWP A;  2NRW A;  3AVK A;  2O8F A;  1MDU B;  4GNI A;  3CET A;  2NLX A;  2IDO A;  4DR6 K;  1J5E K;  2P9U A;  4B9T A;  3H1Q A;  2IAJ A;  4M7X A;  2IVP A;  3OYF A;  2A42 A;  4BC2 A;  2P51 A;  2HVH A;  1NKB A;  1MU2 A;  4CK3 A;  3KTQ A;  4FJ9 A;  4FLT A;  4DFJ A;  1KTQ A;  3P5J A;  2Q31 A;  1C1B A;  3J81 O;  5FRN A;  2HW3 A;  3OBW A;  3O4N A;  2ITG A;  1T03 A;  4DUY K;  4CVN E;  1OH6 A;  4F9O A;  4W5R A;  3OYL A;  4DQ8 A;  3CCU N;  4CZK A;  4BRK A;  1LV5 A;  3FGU A;  5LJV A;  1KCF A;  1LWC A;  3F2K A;  4KFB A;  1Z05 A;  2FSN A;  3LM2 A;  1RFQ A;  2YHB A;  3CCR N;  1Q82 O;  5KPT A;  5F2R A;  1J5O A;  1IG9 A;  1JLC A;  3ID8 A;  1D8Y A;  3R6M A;  4A2A A;  3THW B;  3V9S A;  2RKI A;  3VGM A;  3R8E A;  1T44 A;  2X78 A;  3O6W A;  5FDL A;  3DXM A;  3E9P A;  4MLH A;  4M3X A;  3WXL A;  1DTQ A;  4B8C A;  2PYL A;  3LPU A;  2QKB A;  5SZT A;  4DFM A;  2NZT A;  1E4F T;  3CC4 N;  2Q97 A;  5AQP A;  3ZSQ A;  4CF8 A;  1XC9 A;  4FOI A;  2YX6 A;  4CZG A;  1TL1 A;  5ADX A;  3MMV A;  4Y1C A;  1FW6 A;  2DPN A;  2KZM A;  3THY A;  4JI8 K;  4O0J A;  2VQE K;  4DSK A;  1G99 A;  3P83 D;  5C42 A;  3VQA A;  3CF5 L;  4DV1 K;  1RDD A;  5HRR A;  4B8A B;  5M1K A;  3I55 N;  3OYB A;  3L2W A;  4IWV A;  5EU7 A;  5AQZ A;  2A1R A;  4I9Q A;  4LFA K;  4FJN A;  4Z4G A;  3C6T A;  5BRH A;  3PX4 A;  4LFC K;  1YJN N;  4JKC A;  4J2E A;  5DK5 A;  4H5T A;  4I7F A;  3C6A A;  1UAX A;  2ITM A;  3J7Z O;  3OYM A;  3IMX A;  3EE9 A;  4PY5 A;  4FJJ A;  1NLV A;  1ESV A;  5MLC Q;  4GKK K;  4JI1 K;  4CGF A;  1KD1 O;  4B9N A;  5C0Y A;  5HP1 A;  2FF6 A;  3OYN A;  1N34 K;  3AY9 A;  3V1R A;  4LY7 A;  3U4L A;  3M1F A;  3ZX2 A;  3QES A;  2OZM A;  4I9L A;  1DT9 A;  3OYI A;  3NAE A;  2P9P A;  4JI0 K;  1VQ9 N;  5AQY A;  3MAQ A;  4OKJ A;  3VQ7 A;  4KPY A;  4O44 A;  5HBM A;  4KB1 A;  2NRV A;  2HBM A;  3C6H A;  3LL3 A;  3VPZ A;  4MLE A;  4B1Z A;  1QSY A;  4LH5 A;  3QET A;  4FLV A;  1NM1 A;  4FLX A;  3KZB A;  4M45 A;  3OYC A;  2A1S A;  1TKT A;  3IS9 A;  1S22 A;  3SV3 A;  4FWL A;  3I56 N;  4EP4 A;  2G8F A;  5CY4 A;  4XEI A;  4QOZ B;  2F8S A;  4AIL C;  3KD1 E;  4LF9 K;  4H0O A;  1VQ4 N;  4X65 K;  3OYE A;  1NBW A;  1YTA A;  3CHW A;  2ETJ A;  2NRT A;  3S41 A;  5DM7 L;  4BE1 A;  1B9F A;  1WOQ A;  4CCH A;  1RT2 A;  3R1X A;  4O5B A;  3SQ2 A;  3KLI A;  3UB5 A;  4FJM A;  2GWJ A;  1MWM A;  4CJP A;  5GIO A;  5LMN K;  5T7B A;  4KB0 A;  3ZYY X;  3TAR A;  3V1Q A;  2CGL A;  2E2Q A;  3QIN A;  1NK4 A;  4V19 S; 
#chains in the Genus database with same CATH homology
 4CHN A;  4IFY A;  4ID1 A;  1ZBL A;  3AA4 A;  1NK7 A;  3MED A;  4M3Y A;  2G8I A;  1TGO A;  4JRP A;  4DU4 A;  1X1P A;  3NF8 A;  3DM2 A;  1S9G A;  1FK9 A;  3AO1 A;  3LWL A;  3PY8 A;  1QS4 A;  1RT6 A;  4G1Q A;  4ID5 A;  1IH7 A;  3CM6 A;  3LP0 A;  4OGE A;  4JS4 A;  4E7I A;  3V9X A;  3NGY A;  3NF9 A;  1S1T A;  3NH0 A;  1S1W A;  1ZBF A;  4C8L A;  3PX6 A;  4DQP A;  1REV A;  1L3V A;  1Z26 A;  2YNI A;  3ZSO A;  3AVL A;  1WSG A;  5HRN A;  5J2M A;  4HUG A;  1QHT A;  4YFU A;  2I5J A;  3WNF A;  2KFZ A;  3C94 A;  4BDY A;  4IDK A;  4BE0 A;  4DQQ A;  4F8R A;  3AVB A;  1D9D A;  1UOC A;  3LP1 A;  1WSF A;  3NH1 A;  1TL3 A;  4E1M A;  1HPZ A;  1KFD A;  2HNZ A;  4RW6 A;  1ITG A;  2D5R A;  3V9U A;  5J2Q A;  1NOZ A;  1BIS A;  1F21 A;  2XY8 A;  1RBS A;  2B4J A;  3TAN A;  3AVI A;  4NCA A;  4Z4C A;  2IS3 A;  5HRS A;  4DLE A;  4IKF A;  4O55 A;  3TAB A;  4C8O A;  5KTQ A;  3SNN A;  2DTU A;  3OS0 A;  3HPH A;  3L2V A;  1WSJ A;  2DFH A;  1U45 A;  4J2A A;  1BI4 A;  3KIO A;  4MQ3 A;  4KI4 A;  1RT7 A;  1S1U A;  1ZBU A;  5CYM A;  4CF9 A;  3FFI A;  3VQ8 A;  3NHG A;  2P5O A;  1UWB A;  1RT3 A;  2WOM A;  3D45 A;  3O3F A;  3THV A;  3AVC A;  2RN2 A;  4H4M A;  4B9S A;  3ISN C;  4FM0 A;  1IKY A;  2JGU A;  1IKV A;  2HHT A;  3K5N A;  2VWK A;  3NGI A;  3M8R A;  4DSI A;  4M42 A;  4KV8 A;  4DTR A;  3OJU A;  1I39 A;  2HHQ A;  1HYS A;  1T7P A;  4FJ7 A;  4GVM A;  4WE1 A;  5CYQ A;  3KK2 A;  1WAJ A;  4CIG A;  4C8K A;  4FK2 A;  3ALY A;  3DRS A;  4I2Q A;  4C8N A;  5JS2 A;  1RDC A;  3L2R A;  1RCH A;  1HQU A;  4FK0 A;  3AVF A;  3DLR A;  4DTJ A;  4B9V A;  4CEF A;  2VG5 A;  3KLH A;  4ZHR A;  1LWE A;  1TK8 A;  3AA3 A;  3OJS A;  2HND A;  4JS5 A;  1JXB A;  4CJS A;  4FZY A;  4KRE A;  1HYV A;  4CJR A;  4K8X A;  3OYK A;  1JXE A;  4ICL A;  3RRH A;  1C0U A;  3SPY A;  1BCM A;  4E7J A;  4M3W A;  3QEI A;  4FK4 A;  3NF6 A;  4FLU A;  3QO9 A;  5KI6 A;  1KFS A;  3MXI A;  4HHT A;  1X9M A;  1KLN A;  4DTU A;  3V4I A;  2OPP A;  4E7K A;  2O4I A;  3TWH A;  1TKZ A;  1NOY A;  4BDZ A;  3BDP A;  4DQS A;  2FBY A;  3JYT A;  4KHS A;  3RMB A;  3ZSV A;  3HVT A;  3VQ6 A;  4Z4E A;  1VSJ A;  1TK0 A;  1SV5 A;  1C1A A;  4H4O A;  3VQ9 A;  4CFB A;  3L2Q A;  2D0A A;  3CFP A;  3ITH A;  1QSL A;  1U04 A;  3QER A;  1T8E A;  4FJX A;  1ASW A;  1WSI A;  4CJ5 A;  1YTU A;  5C24 A;  1BGX T;  4DFK A;  3C95 A;  4CEA A;  4DTS A;  4DTM A;  3OY9 A;  1CXQ A;  4CF0 A;  3QEX A;  4LH4 A;  2QK9 A;  1QSS A;  1U48 A;  2LSN A;  3A2F A;  3VQD A;  5KRT A;  2FBV A;  1RT1 A;  2E6M A;  1BL3 A;  4M3R A;  4FJG A;  1T05 A;  1X9S A;  1FKO A;  4F3O A;  1IO2 A;  3CFR A;  3HST B;  5KGW A;  4CES A;  2FBT A;  1SUQ A;  4KAZ A;  1NK8 A;  1NJZ A;  3CQ8 A;  1LW2 A;  3SZ2 A;  3G10 A;  3QNO A;  1G15 A;  3QEP A;  4DTN A;  3UIQ A;  2YKM A;  1NKC A;  2HHV A;  2G8K A;  4DS4 A;  3RMD A;  5CZ2 A;  4FW2 A;  1S9E A;  1RT4 A;  2Z1G A;  4DMN A;  1N6Q A;  1VK0 A;  3OYG A;  2BGG A;  5JS1 A;  4M3T A;  1WSE A;  1SKS A;  5C25 A;  2B5J A;  2FC0 A;  2IOC A;  4GMJ B;  4J2D A;  3MEC A;  3ZT2 A;  4F2S A;  3L3U A;  3OS1 A;  1JLG A;  3IRX A;  4J2B A;  4NCB A;  1QE1 A;  1RIL A;  2HMI A;  1UA0 A;  4B9M A;  1JLB A;  3I0R A;  3C6U A;  4AHU A;  1C0T A;  1B9D A;  3S3M A;  1RTJ A;  3ZCM A;  1LAW A;  2YNF A;  4E7H A;  1XI1 A;  3H08 A;  3LPT A;  3B6O A;  3PUF A;  4CEO A;  5KRS A;  3MXM A;  3AVG A;  2ZE2 A;  2Z1H A;  3E01 A;  4CF1 A;  2F8T A;  2VG7 A;  2P1J A;  4QAG A;  1CLQ A;  1S1V A;  3TI0 A;  2XY6 A;  3AV9 A;  1JLE A;  4DSJ A;  1DTT A;  2GBZ A;  1A5V A;  4B3O A;  1K6Y A;  4LSN A;  5FRO A;  4N5S A;  3HVR A;  1CXU A;  3ZT4 A;  1CZB A;  1D5A A;  1O1W A;  3JSM A;  2YNG A;  4FM1 A;  2HHS A;  4CF2 A;  4Z4I A;  1EET A;  1Q8I A;  4NYN A;  4OPK A;  3EYZ A;  4CJF A;  1RTI A;  1VSH A;  2R7Y A;  3RWU A;  4CJV A;  3L3V A;  1RTH A;  4NCG A;  1LW0 A;  5HLF A;  4FLW A;  2G8W A;  3G0Z A;  3SYZ A;  1BI4 B;  1EX4 A;  1VSE A;  2W42 A;  3LZI A;  3DRR A;  1JL1 A;  2Z1I A;  4W5Q A;  4M3U A;  3NFA A;  3K59 A;  3KD5 E;  4HTU A;  1XHX A;  4DSF A;  1I3A A;  3VQ4 A;  4DTO A;  3U3G A;  1WSH A;  2HHW A;  4DLG A;  1Z25 A;  4CIF A;  1L3U A;  4PUO A;  3OYA A;  4E7L A;  4KHY A;  4CK2 A;  2XY5 A;  3DYA A;  4I2P A;  3NGZ A;  1JLQ A;  1A5W A;  3TAG A;  3PO5 A;  3PV8 A;  5SWM A;  1KSP A;  4BDP A;  2KTQ A;  1TKD A;  4CJT A;  3MXJ A;  4PWD A;  2X6S A;  3QIO A;  5K14 A;  3IAY A;  1BHL A;  4DG1 A;  4KHN A;  3TR8 A;  3OYD A;  3T19 A;  2G8U A;  3AVM A;  1BIZ A;  1HNI A;  3CM5 A;  3K5M A;  4C8M A;  1RNH A;  1KLM A;  1L3S A;  1KVB A;  1RBR A;  3QLH A;  3VN5 A;  4AHR A;  1IKX A;  2JLE A;  2KW4 A;  3DMJ A;  3CG7 A;  4KI6 A;  4CHY A;  3SQ0 A;  4UQG A;  3LZJ A;  1SKR A;  4CHQ A;  3SUN A;  2EHG A;  1VRT A;  2E6L A;  3I0S A;  4FZZ A;  1VSK A;  3PO4 A;  2QXF A;  3HYF A;  1BQN A;  3AO3 A;  4CGG A;  4NYF A;  3M8Q A;  4DF8 A;  4FJH A;  2AJQ A;  1WNS A;  3S3O A;  3DLK A;  3DOK A;  3DLG A;  3ZSX A;  3SV4 A;  1J53 A;  1RDA A;  3SQ1 A;  1VSD A;  3HL8 A;  3VQB A;  3KLE A;  1EP4 A;  1R0A A;  4KTW A;  4JLH A;  4W5O A;  3ZSZ A;  3SPZ A;  1X9W A;  3DRP A;  3ZSW A;  4CEC A;  4B9L A;  4FLY A;  1KVA A;  4M41 A;  3TAM A;  2XHB A;  4JRQ A;  4IBN A;  4ELT A;  1RTD A;  4CJ3 A;  4CJK A;  1TVR A;  3HXM A;  3LP3 A;  4FVM A;  3K2P A;  4KTZ A;  4IG0 A;  4H8K A;  4CFD A;  4ZTF A;  3RMA A;  3F73 A;  3QEW A;  4RW7 A;  1ZYQ A;  3HK2 A;  2GUI A;  3VA0 A;  3AVK A;  2D0C A;  3SI6 A;  3TAF A;  3ZT1 A;  5E41 A;  3T1A A;  2Q3S A;  2IDO A;  4DFP A;  1NK9 A;  3SJJ A;  2XO7 A;  1RT5 A;  4DF4 A;  3QNN A;  3WNG A;  3DOL A;  2XY7 A;  4B9T A;  3AO4 A;  3AVH A;  1A5X A;  1DLO A;  2OPR A;  2IAJ A;  4FJI A;  3OYF A;  3VQ5 A;  3AA2 A;  1JLA A;  4E3S A;  3RR7 A;  2P51 A;  3NH2 A;  4L8R B;  1NJY A;  4CGI A;  1TAU A;  3SUQ A;  4FJ5 A;  1FXX A;  3VQE A;  2HVH A;  1VSI A;  3AO2 A;  3HT3 A;  3DLB A;  1NKB A;  1MU2 A;  4CK3 A;  3KTQ A;  4FJ9 A;  3EZ5 A;  3V9W A;  4HCC A;  1TKX A;  4FLT A;  1HJR A;  4O4G A;  3LDS A;  4CE9 A;  2QKK A;  4BAC A;  1KTQ A;  3P5J A;  1HRH A;  4DFJ A;  2G8V A;  4Z4F A;  4FYD A;  3LP2 A;  4OGC A;  1VRU A;  2ATQ A;  3VA3 A;  3LAK A;  3SUP A;  1U4B A;  1S1X A;  1C1B A;  2YV0 X;  3TAP A;  4FM2 A;  5FRN A;  3RRG A;  5DMR A;  1Q9Y A;  3HPG A;  4AHS A;  2HW3 A;  1UA1 A;  4OKK A;  3K57 A;  4DU1 A;  1C6V A;  3LAM A;  3NBP A;  2X74 A;  3O4N A;  2ITG A;  4OJR A;  2XRI A;  4EP5 A;  1T03 A;  4MFB A;  4BWM A;  3CFO A;  4Z0U A;  4KKO A;  4W5R A;  1U49 A;  4W5N A;  3OYL A;  3KKS A;  3V1O A;  3LAN A;  3M8P A;  3HP6 A;  3AVA A;  2Y1J A;  4CHZ A;  1LV5 A;  1ZBH A;  4DSL A;  4PQU A;  2OYQ A;  3LAL A;  4KHU A;  1KRP A;  4LD0 A;  4Q5V A;  3M8S A;  1KCF A;  1LWC A;  4KFB A;  5J2N A;  2YHB A;  1S6P A;  4E19 A;  1SL2 A;  5J1E A;  3AA5 X;  1J5O A;  2DFF A;  1IG9 A;  3AO5 A;  3TAE A;  4XIU A;  4N56 A;  1JLC A;  3DLH A;  3AVJ A;  1D8Y A;  3AVN A;  4N41 A;  3OYJ A;  4LSL A;  2B6A A;  4ELU A;  4RW8 A;  2PY5 A;  2ZQB A;  4Y1D A;  3V9S A;  2RKI A;  4HVJ A;  1JL2 A;  4CJU A;  3SUO A;  2X78 A;  5FDL A;  2GV9 A;  4F4K A;  3MEE A;  1L5U A;  4CJQ A;  4M3X A;  5J2P A;  3QEV A;  4RW9 A;  1DTQ A;  4HUE A;  1D9F A;  4B8C A;  4OKE A;  4CER A;  1VSF A;  1FKP A;  3LPU A;  3O4Q A;  3WNH A;  2PYL A;  2QKB A;  1J54 A;  3IG1 A;  4AH9 A;  5SZT A;  4FLZ A;  4DQI A;  2WON A;  4DFM A;  4DTP A;  3S9H A;  3O3H A;  3ZSQ A;  4KRF A;  1TV6 A;  1GOB A;  3I8D A;  4CF8 A;  3T3F A;  4ZTJ A;  2HHX A;  1XC9 A;  4CHO A;  3NF7 A;  4EZ6 A;  4HUF A;  3HO1 A;  2DY4 A;  1TL1 A;  1GOC A;  4KO0 A;  1IKW A;  2RPI A;  4Y1C A;  1NK5 A;  1N5Y A;  4B9U A;  3OS2 A;  1HYZ A;  3U3Y A;  3VQC A;  1XHZ A;  2KZM A;  2HNY A;  4CGH A;  4CFC A;  4CJ4 A;  4R5P A;  2PZS A;  4O0J A;  3D0P A;  1QQC A;  4DSK A;  1YT3 A;  1L3T A;  2Y1I A;  5FRM A;  3P83 D;  4CGJ A;  5C42 A;  4HCB A;  3OVN A;  3ZT3 A;  4OLB A;  3VQA A;  1LWF A;  4RG8 A;  3O3G A;  4M3Z A;  1SKW A;  1Q9X A;  2HHU A;  4ELV A;  3ZSR A;  1VSM A;  3V9Z A;  1RDD A;  5HRR A;  4B8A B;  4AHC A;  4CEQ A;  1TK5 A;  4EZ9 A;  2O4G A;  4BWJ A;  5EU7 A;  3OYB A;  3L2W A;  3V81 A;  2A1R A;  4I9Q A;  3KLG A;  4DSE A;  3HJF A;  3SQ4 A;  4FJN A;  4FXD A;  1QTM A;  4Z4G A;  1NJX A;  3F9K A;  4QCL A;  2PYJ A;  3C6T A;  3PX4 A;  3V6D A;  4CIE A;  1XWL A;  4AHT A;  1SL1 A;  4N47 A;  4CFA A;  3HM9 A;  1ASU A;  5CZ1 A;  1W0H A;  1CZ9 A;  1J9A A;  4J2E A;  1BIU A;  5DK5 A;  4FJ8 A;  4TSX A;  4I7F A;  2EX3 A;  1UAX A;  1RBT A;  3S3N A;  4RW4 A;  5HRP A;  4W5T A;  1BQM A;  3KLF A;  4FCY A;  4CJL A;  3NCI A;  3OYM A;  4CEZ A;  1RDB A;  1S6Q A;  4CHP A;  4PY5 A;  1LAV A;  4E0D A;  4FJJ A;  1VSL A;  4CED A;  4DU3 A;  4OLA A;  3PX0 A;  4F3T A;  3CYM A;  5I42 A;  2OPS A;  3RTV A;  4DQR A;  4PA1 A;  3LWM A;  3NE6 A;  4CGF A;  4O0I A;  4DS5 A;  1NKE A;  4B9N A;  4KHW A;  5HP1 A;  1JKH A;  2KQ2 A;  3OYN A;  3EY1 A;  5I3U A;  2HB5 A;  1KVC A;  2ZD1 A;  3V1R A;  4K8Z A;  2OPQ A;  4LY7 A;  1HMV A;  2OA8 A;  2OZM A;  4KTQ A;  3QES A;  2OZS A;  4I9L A;  2YHA A;  3MEG A;  4CJE A;  3OYI A;  3RMC A;  1S5J A;  2YKN A;  2VWJ A;  3HP9 A;  3NAE A;  3VQP A;  3ZT0 A;  3K5L A;  2Z1J A;  3WNE A;  2BDP A;  4DWI A;  1C0M A;  1ASV A;  4CEE A;  4GW6 A;  3SCX A;  3KKR A;  3MAQ A;  4OKJ A;  3VQ7 A;  4KPY A;  4Z4H A;  4O44 A;  4FJK A;  4IFV A;  2E4L A;  4FW1 A;  5HBM A;  3VQQ A;  3ASM A;  2FBX A;  1SL0 A;  1TAQ A;  4KB1 A;  2F96 A;  2KZZ A;  4IG3 A;  1JLF A;  2HVI A;  3OYH A;  1WLJ A;  1EXQ A;  2VG6 A;  3U6F A;  2NUB A;  1ZBI A;  1QSY A;  4LH5 A;  3QET A;  2G8H A;  3K5O A;  4FLV A;  1U47 A;  2RF2 A;  2KFN A;  4FLX A;  4E89 A;  4M45 A;  1WAF A;  3OYC A;  2A1S A;  1TKT A;  3IS9 A;  3SV3 A;  1BCO A;  2IGI A;  3DLE A;  5HRO A;  1RBU A;  3ZSY A;  4CEB A;  3DI6 A;  5CY4 A;  4EP4 A;  2G8F A;  3TAQ A;  1HNV A;  4AHV A;  2BE2 A;  3HPO A;  1HQE A;  3NDK A;  4FJL A;  4N76 A;  4QOZ B;  5D3G A;  3KK1 A;  2F8S A;  2YNH A;  2X6N A;  4AIL C;  3KD1 E;  4FZX C;  4B08 A;  4CK1 A;  3OYE A;  1NJW A;  1YTA A;  3L2U A;  2ETJ A;  2IC3 A;  3KJV A;  3K58 A;  3BGR A;  4BE2 A;  4DTX A;  4BE1 A;  1B9F A;  1NK6 A;  4KHQ A;  4CCH A;  2P5G A;  1EKE A;  2BAN A;  1RT2 A;  4Q0B A;  2DFE A;  4YNQ A;  3ULD A;  1WN7 A;  4O5B A;  3SQ2 A;  1RBV A;  3KLI A;  4CGD A;  4FJM A;  3P1G A;  1Y97 A;  3L8B A;  4CJP A;  2D0B A;  5T7B A;  3B6P A;  5KGX A;  4OVL A;  3RR8 A;  4KB0 A;  3TAR A;  4OPJ A;  1W9H A;  3V1Q A;  4E1N A;  1NK0 A;  1GOA A;  1YVU A;  4F2R A;  4CJW A;  3QIN A;  3QIP A;  1NK4 A;  3KK3 A;  1C1C A;  1B92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...