3NFCA

Crystal structure of e.coli mazf toxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
94
Chain Sequence
YVPDMGDLIWVDFDHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of E. coli MazF Toxin
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords PemK-like protein 1
total genus 24
structure length 94
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nfcA00
3G7ZA 1UB4A 1X75C 5CR2A 5HK0A 5CQYA 4ELYC 5CKEA 5CKBA 5CKHA 3JRZA 4VUBA 5CCAA 5CK9A 2KMTA 4OF1A 5DLOA 5CO7A 4MZTA 4HKEA 4MZPA 5CQXA 1NE8A 4ME7A 1VUBA 3JSCA 3TCJA 4MDXA 4ELZC 5HKCA 5CKDA 3HPWA 3NFCA 2VUBA 2C06A 1M1FA 2MF2A 3VUBA 5HK3A 5CKFA 4MZMA
chains in the Genus database with same CATH superfamily
1FWZA 4R55A 2FYKA 4TVRA 5FWCA 5LJ3h 4DBFA 2EGEA 3G6EQ 3G1JA 3J81E 4ZGDB 3NGPA 1Y96A 3PNWC 2OTLT 3JCMf 2EYQA 2XDPA 2D8JA 1YHQT 1WZOA 3NMZC 5GAOl 3LWHA 1WJQA 3CCUT 5CQYA 4E47A 4RTVA 5J39A 2XD0A 4KULA 4M75G 2EKHA 2RK1A 4QW2A 1KQ2A 3EAEA 2V1RA 1VQ5T 1ARKA 2LC4A 4JLGA 2M0OA 4JUVA 2X3WD 1YBYA 3MEUA 1RAIB 4GY5A 2WSCE 2EFIA 5I2MA 1NJIU 1D1AA 2JMAA 1HD3A 1VIFA 4A4HA 5CR2A 2AZSA 2RQTA 4OMQA 5GANe 4ESRA 2KNBB 3VRZA 2Z0WA 1AEYA 4N4GA 4C92B 2QA4T 1X01A 4KH1B 2QDLA 3HSBA 2LX7A 5KYNA 3QBYA 1VQNA 2VASA 4RTYA 1ZUUA 1PRLC 3CPWS 4F7UA 1NYFA 4XK8E 1XOVA 3P8DA 2GBQA 1BIBA 1QP3A 1ZBXA 1YITT 1I8FA 2FRYA 5GMKh 1VQ8T 2QQSA 3TU4K 1UJ0A 2EPDA 4C8QG 1VQLA 1JO8A 3CCLA 2GNCA 4FT4A 1V76A 2O31A 2VV5A 4BDYA 1VQ6T 4M75E 3RDVA 3CCQT 1HSQA 4ZTFA 4RTXA 3L42A 4XQ3A 1ABOA 1K9AA 3L2VA 1LPLA 1BI1A 2PVGB 5IXBA 3GPLA 1YCSB 3ULRB 5LL6S 1N5ZA 4JZ3A 1YI2T 4MMLA 1M1GA 2QEXA 4ELZC 3LH0A 2K5IA 2I0NA 2PNIA 1F1BB 1PM3A 1T3LA 3OQ5A 1KIKA 2EWNA 2QYZA 4AFZC 1Q7YR 1UB4A 4M7AC 4M7DA 1PG5B 2ZZDA 4PLLA 2CP7A 1NEGA 1I0CA 3CCVQ 3MPUB 1UTIA 3I56T 2DO3A 4E7KA 3REAB 3PIPA 1K8AU 3JCMd 3FLGA 1RUWA 2J05A 3CC4Q 3TSZA 4X9DA 1QW1A 1IB8A 2FHDA 2CSQA 2FEIA 2KT8A 2ROTA 2KR3A 2CZ6B 1UGVA 3HRUA 5GAMe 3CCLT 4XTWA 4PJOF 3RESA 2K2VA 1YI2A 2M0YA 3CPFA 3C4SA 3RKWA 4XU1A 1IHVA 2X4WA 3JCMX 3JCMh 3X28B 4OMNA 3M4GA 1I5LA 6AT1B 3OW2S 1R8OB 2VGNA 3OYCA 3JCMQ 4CC2A 1AHJB 2I2LA 1SKUB 2BTTA 2DXCA 1M1KR 4L6V5 3OYDA 1GCQA 2DMOA 4M78E 5KCOA 2FG0A 4Y28E 1RAHB 4ME7A 2FPEA 4C5IA 4QQ6A 2FB7A 1AT1B 2DL4A 2EKOA 2F5KA 4QVCA 4M78B 3INZA 3RERA 3HTRA 1G8XA 4J7FA 5KYXA 1QVFP 3CC7Q 1T0JA 3M9QA 1U5SA 1WQ7A 2M9UA 5CKHA 3C12A 2EQUA 4LDVA 2KMTA 4N0AC 1C6VX 1NG2A 1M3CA 1WGSA 2ED0A 2YWWA 4ZGJB 4E7JA 1D0ZA 3DB4A 2RJCA 2O4XB 3OBWA 2AIRB 2HL3A 3PMIA 1KD1U 4FYYB 3GNFB 2DX1A 1X75C 2K3YA 1QVGP 3JB9F 2RN8A 2XDBA 4C92F 3OSVA 4B9WA 2OTLA 1ZUYA 3HFOA 1VQNQ 1G3SA 1K0SA 8AT1B 3KBGA 1S72A 1KD1R 3MO8A 2CT3A 2KE9A 3RMQA 2XI9A 2ABLA 4KRTA 3E1SA 3RKYA 2X3XD 1I1JA 1X2QA 3M0SA 1N8RR 1WXBA 1QCFA 4M7AF 1H3HA 4DBHA 1MV0B 4N4HA 2HSEB 2A28A 1K73R 4HXJA 3M0UA 2B86A 2DERA 4LN2A 3G4ST 1EX4A 1I5OB 1WHHA 1KD1C 1KK7A 2JNGA 2HQHA 3QZ9B 1LNXA 4PFOA 2XDDA 2KEAA 4XU0A 1YI2Q 1B34B 2HCKA 5CCAA 4RG2A 3EG0A 4M75B 5J26A 2JJ9A 2DZ9A 5IHKA 5D6XA 2LCSA 1VQ9Q 3V7RA 1QWFA 4AFSC 1Q7YU 2HKNA 1TH7A 1X2KA 4A4EA 1ZSZB 3ZL7C 5GAN3 1UG1A 3JCMc 5GAN7 1SG5A 2QASA 5GANj 2VB6A 3JSCA 3RBBB 2KXCA 4ANJA 2A36A 1YITA 4CC4B 4M77B 1AD5A 2YUPA 2L3QA 5KYWA 1TU0B 1YHQQ 2XMFA 3JCMb 3CCJT 3QWYA 1JXOA 2D0NA 1VQNT 2FPDA 3D7SB 4KGVB 3NTIA 3QJ6A 1S1NA 3LH5A 2X35A 2AKLA 4OGEA 1X69A 2SEMA 1NEBA 2YUNA 3G7ZA 3EHQA 4E7ZA 5CIUA 1VIEA 1M2OA 4J6XA 2QGFB 4J9CA 2KBTA 4F04B 4HVUA 5D6YA 3EH1A 1MMNA 1PHTA 3FRNA 5A2QE 2PVOB 5GAN4 3EGXB 2OX7A 1AWXA 1WJRA 3WVEB 3CCVT 5IN1A 3CCST 3EFSA 1VQ5A 3J7AF 3CC7T 1WLPB 2D6FA 2NLUA 1FXXA 1VQMA 2MCNA 4BI8B 3EFOA 4M75C 4PJOG 2MAMA 4J6WA 1YHQA 3THKA 1MNEA 4FSXA 4C0ZA 3FDRA 1ZSZA 1RI0A 2FRWA 2QDYB 1WDXA 2MK5A 2IG0A 2JVVA 3I55Q 1M1KC 2E6NA 3A5ZB 4M7DE 2X4YA 3QKJA 2JS0A 2LX9A 2DL3A 1W2BA 3MHXA 2YDLA 3OYIA 1Q86C 4M75D 2CZ7B 3ER0A 1M5Q1 4PNOA 2NUPB 2VKNA 1VQ6Q 4IUVA 1LOJA 2DZCA 1QKXA 1IGUA 2K79A 2O9SA 3JB9J 2EYYA 4DEXA 5A0DA 1WA7A 3GBQA 3H9NA 3HFNA 2RPNA 2RH2A 3C95A 1OULA 1OX8A 3HP9A 5LJ3e 1QWEA 3L2UA 1PWTA 3LGLA 2CH4A 3CXCA 4HVWA 3JRZA 3MCAB 4O5VA 4C0DB 1MMAA 1OPLA 3CCJA 5CQXA 4ZN3A 4JJCA 2R57A 5LJ5f 2FPFA 4GLKA 3MP8A 4M77G 5C0MA 3CC2T 2EVRA 1D09B 2YLCA 4BACA 5KH6A 2X9HA 2CP5A 3CMET 2FVUA 4JRQA 1M3AA 2DTIA 2RI2A 4IUTA 3VU3C 1VQ7Q 1I4K1 2XICA 4DOWA 3OYMA 1UHCA 1BU1A 3QG1A 3CQTA 4HCCA 2F1LA 3EHRA 5LJ3d 2DIQA 4DA4A 1JEGA 3JCMJ 4M7AG 2KRNA 1V1CA 3S6WA 2ECZA 5I11A 1UE9A 2DFUA 2LRQA 3VYGA 4AG1C 4QQGA 4C0GA 2J06A 4JJNK 3DLLA 2FL7A 4D8KA 1TS9A 4WCIA 3JCMP 1H8KA 3META 4M78D 5LJ3g 1D3BA 4RMOA 4HKEA 5GMKj 3G6ET 5HKCA 4J9DA 2V8JA 3HHTB 2LQ8A 1JJ2P 1WHMA 4OMOA 1RAEB 4OMPA 2JTMA 4EMKB 2GF7A 3JV3A 2KRMA 1S72Q 1M90R 3EGDA 1VQ7A 1R0CB 1NZ9A 3V8LA 5GMKe 1SRMA 2RD1A 4C5EA 1AZEA 4M7DF 2GQVA 1TG0A 2HQEA 2L5QA 2RB6A 1K76A 1E6GA 3NFCA 2YUOA 1X43A 5GJVB 3OW2P 1NBEB 2QTVA 5GAMd 1VQ6A 4Q5WA 1VQ4T 2BZXA 4IUQA 3MKDA 3QDFA 1VQLT 4A63B 2RMOA 1ACMB 3GLXA 2HMAA 1K8AR 1BYMA 4GBQA 3WXMB 3OYKA 3SWNA 1WHKA 4UC4A 3H0IA 4FW1A 3RIRA 3VUZA 1TXQA 2LCLA 1PSFA 1K73C 2PQWA 2E5QA 1WYXA 2OTLQ 1MUZA 2H3EB 2RJDA 1JJ2A 2HNIA 5IT9E 3CBMA 3FJPA 2LT1A 3VS0A 1HK9A 2VYTA 2QQAA 2L2PA 4NS5A 2EGAA 1D0YA 3PIOA 5KYUA 1Q81C 3SB2A 7AT1B 2E12A 3UWNA 3OA6A 1Y7XA 5LJ3j 1U3OA 2EAYA 4F7UB 4IKFA 4M7AE 3CXCS 3OYGA 1VQLQ 4MMKA 1ZHIA 2XK0A 4IIOA 4C92G 1NLPC 4E7LA 3GIBA 1G3YA 2R5AA 3Q1JA 4RKUE 2ATCB 3CPWA 4PJOB 2QAZA 2DLPA 1GCQC 3LYIA 2CP6A 2AHJB 1SPKA 1M90C 3MEAA 1N9RA 2YRDA 2M1HA 4HT9A 1TUDA 4PFPA 1KQSS 4LNPA 3QHSA 2E3IA 1M8MA 4RUGA 2YRVA 3CMAA 1OZ2A 2JN0A 1FX7A 2YUQA 3EFOB 2ZPIB 4PJOD 1ZUKA 4JPBW 1K1ZA 1PKSA 4OMMA 2GQIA 2DILA 3CD6A 4C92D 1JB0E 4D6WA 5GANh 3FEOA 3X20B 2RK2A 1A0NB 5LJ5h 2WACA 1TUCA 5AT1B 1BCOA 1UGPB 3CCRQ 4J9IA 4PFZA 4M75F 4C8QF 1M30A 1ZA2B 4AFQC 1IREB 3C94A 2ZPGB 2H3JA 1YFNA 5C6SA 4M7DC 3PVQA 2BIVA 1Q82C 4OB1B 4QVDA 1PNJA 3S3NA 4ZGEB 3MP6A 5I21A 2RQVA 4ATOA 3R6NA 3M54A 2EQMA 2HKQB 1QQJA 2A08A 5GAN5 1H92A 4J9HA 5D6WA 1YJ9T 2KRSA 3CC4A 2XU8A 1D3BB 4JDSA 1QVGA 2G3RA 2SRCA 4PJOE 1WNLA 2HEQA 1Y96B 3CCQA 1YJWT 1FYNA 4OMLA 1K4US 4RTZA 2QA4Q 3HL8A 1VQ8A 3A8LB 3GP8A 4ELYC 4BE0A 4LUDA 1M27C 5DLOA 2COYA 1GCPA 4QT7A 3CCUQ 3JB9G 4JZ4A 1M8VA 1JBMA 4RTTA 3J80E 2FZGB 3OW2A 3M0QA 2DTHA 2ED1A 2VUBA 2RHXA 4JRIA 3M5AA 2MF2A 4FU6A 3QO3A 3LW5E 1QLYA 2NUTB 2NWMA 2RHZA 4RCCA 4M7AD 1K73U 1N27A 3CCET 1W1FA 4M75A 4CC7A 1WI7A 2DVJA 5IH2A 3X25B 2AK5A 2LTOA 1YJNA 1NPRA 5FU6C 3CCRA 4A4GA 4M78G 2KDSA 1WHLA 2KYBA 1SEMA 1CSKA 2BZ8A 4KBMB 2RI5A 4BDZA 3F70A 1NYGA 2A37A 3MEWA 1K8AC 3OYYA 3CCUA 3E2UA 1AWWA 2P0QA 1UECA 4M77F 4JS4A 3VS4A 1EZZB 4Y91A 1KQSA 1W70A 2CSIA 4J83A 3BE3A 4J9GA 1WX6A 5HK0A 5KYYB 1U06A 2RI3A 2P0KA 4AMCA 3EH2A 1PRMC 4M7AA 3UPUA 4EPCA 1Q95G 4L5GA 3VKIA 2PUOB 1ZSZC 4ZN1A 1YNZA 3OSSC 3EG9B 1V29B 2LP5A 2O4XA 2FO0A 1YIJT 3PFSA 4BY6C 1UGRB 1RABB 2KT1A 3O5ZA 2CKKA 4MDXA 1OZ3A 1G83A 4Z88A 3OS2A 5GAOp 3CCLQ 1KQSP 5GAOq 1C0MA 1UGQB 4FYVB 3DB3A 3OYBA 4C8QB 4M78A 4N0AA 4X9CA 1D1BA 1C1AA 5IHIA 5M9OA 4Z8AA 3CCEA 1VQKA 4RTWA 2E70A 4PL6A 2HL5C 2P4RA 3DLMA 4J9FA 5DLQE 2LZ6B 4IIMA 2MMPA 2EJ9A 4CI0C 4MZPA 3GOXA 1Y57A 1UFFA 2DYBA 1BIAA 2DJQA 2Y4XA 1FMVA 3FJ5A 5L23A 3OYNA 3PT9A 1UUEA 4L59A 4C0DC 3CMEQ 1IGQA 1Z9QA 3HKSA 1NLOC 3EGUA 2OTJA 4XTYA 3VYHB 2GCXA 2XKOC 4FIBA 2DRKA 5CVIA 4Z89A 3CCMT 3G71A 3V8JA 1OQKA 4KGZB 1KSWA 1BCMA 4F17A 4HT8A 4XTUA 2JM9A 4PJOA 4FW2A 2QQ9A 1W2BS 2RQWA 4E7SA 1YIJQ 1AZGB 3QJYA 3VJPA 5A0LA 1VQOT 2A3LA 2GGRA 4BUGA 5EC7A 2V1QA 1UEBA 4M7DB 2LDMA 2GTJA 3L2RA 2C06A 3QSUA 4BD3A 1YN8A 1VQOQ 1Z9ZA 3X26B 2AKKA 2QQRA 3N5BB 2CP3A 3E9FA 1KFZA 5AYFA 2D0QB 5I2SA 1OPKA 1VQ9A 4CRIA 2CS7A 1WJSA 3JCMg 1VUBA 3OYJA 2LJ1A 4JRKA 5GMKl 3HPWA 4LDUA 3T9NA 2CGHA 4J7IA 1IRXA 1M2VB 1M2VA 2XIDA 3I55A 2LQKA 4HA8A 2K7AA 2EJFA 2L3RA 3CMAT 2PZ1A 3UATA 4JRPA 2J7IA 4AT1B 4EMKC 2LNVA 3SWNB 3TREA 2HZYA 1UHFA 3BY7A 1TOVA 2FZCB 1Q81U 2NUZA 1JQQA 3L1AA 2MWPA 3FC3A 2J6OA 2VVKA 4B9XA 2YHTA 1WQWA 2ZAEA 2HAXA 1VA7A 1VQPT 2E3HA 2KK4A 4V2SA 5CK9A 2DD4A 5FRMA 2KI7A 4J6YA 4DBRA 3TEEA 2LQWA 5KYXB 4J9EA 1Y07A 3NTHA 4M77E 2DAQA 3QDRB 4KH0B 2AZVA 4DOVA 4II1A 2P0PA 4C5GA 4EMKA 3UA7A 1MGQA 1IXDA 2E64A 4C8QE 3SDZA 3OB9A 1Q7YC 2JM8A 4J5YA 5D7UA 3KXTA 4OF1A 3P8HA 4YTLA 1QCNA 2RA2A 2V26A 5GANf 5L8RE 3UT1A 3CEYA 3CMAQ 1BI2A 1GBQA 2KQWA 5J3BA 3SFMA 5GAMj 1QP2A 4EDUA 2COZA 1PD1A 2P84A 2DEUA 2DRMA 4AFUC 2EQJA 3M0TA 1GXIE 4A54A 4AG2C 2MPXC 4C0FA 3CCJQ 5FU7B 3UDCA 4DEYA 2RJEA 1VQOA 1QCOA 3OS5A 1Q82U 4FM4B 3M53A 2LNHB 4F16A 1VQ4A 3A98A 2VXFA 3OS0A 4EIKA 1QMCA 5IHNA 4E6RA 2MWOA 4J9BA 2JTEA 3CCSA 2OJ2A 3QWXX 3JB9H 3A1PA 3GF5A 2CYZB 3VS7A 1T3SA 3I35A 5KE3A 3M56A 4M4ZA 3CCRT 1N8RU 3JCMV 2VXEA 1GRIA 3FB9A 3OYLA 2HBWA 3CCMA 5LJ5g 1TTHB 2YLBA 1SHFA 4LD6A 2FZKB 2MI6A 3DKMA 1SHGA 1I81A 1QVFA 4A4FA 2CUDA 2A0FB 1TUGB 1XTDA 4EMHA 2K57A 3EG1A 4JS5A 5KYYA 1CKAA 3G71T 2DKGA 3JCMW 3L2ZA 4MZTA 2DBMA 3VS5A 3I56Q 1UDLA 2JXBA 2E41A 2DETA 1RADB 2CP0A 3VS1A 3S3OA 3EG3A 1B07A 1YJNQ 3OS1A 1ZQ1A 1EIFA 4BI4A 3LWIA 3OYEA 1YJWA 4P5NA 2RHIA 1RAFB 1ZLMA 2K9GA 2RHYA 1JRIA 4FT2A 1CKBA 2DXUA 4M78C 1QVGS 2Y90A 2CZ0B 3SWNC 1JJ2S 2ZCFB 1QKWA 4C5HA 2EBPA 5KYUB 1W2BP 2JUFA 2L0AA 3CCQQ 3VRYA 1RL2A 3VS2A 3CXCP 4HCZA 3M0PA 1K9MC 2LQNA 3EGXA 1OOTA 1Q81R 1E7OA 3WVDB 3A8HB 2JOYA 3V8KA 1G5VA 2DNUA 2RHUA 3QIIA 3O8VA 4PKCC 4JJBA 1FMKA 2JT4A 4IUPA 3I55T 2G6FX 3NTKA 5GJWB 3OMCA 3LX7A 5GAN2 4PJNA 2M16A 2BKDN 1GL5A 2MIOA 3SEMA 1VYVA 1KHIA 2W10A 4BY6B 1VQ9T 5GMKm 4F7UG 1K9MR 3M59A 1QVFS 4HCKA 1M4ZA 3ME9A 3TVTA 5KE2A 4NL2A 3AHUA 2RJFA 4M77D 3QYGB 2EQIA 2QI2A 2DK3A 4J8OA 2DXBA 1M3BA 3MJXA 1VQKQ 4C8QA 4XAXB 1OU8A 1VQMT 4PJOC 1ZX6A 2B8AA 4OB3B 2JS2A 4LUEA 3M57A 2K4YA 3R6OA 1TSFA 2D1XA 2HD0A 2J6KA 3EG9A 5FU7C 5KYWB 2X4XA 4OVAA 2CP2A 1NJIR 1RLPC 2H8HA 2DL5A 1UJYA 3TCJA 2KSSA 2QEXQ 1U8RA 3OY9A 5GAN8 1PKTA 3CD6Q 2DL8A 4A4KA 3QXEB 1R0BG 2COWA 4M7DG 2E6ZA 5LJ5j 4M7AB 1O75A 1IHWA 3JB9I 3V7CA 1Y0MA 1W4SA 2ZPBB 2D9TA 4BE1A 5FW9A 3E9GA 3A8GB 4ORZA 5FU6B 4F14A 3RUXA 5CO7A 4PK4A 1PC0A 3U23A 2M51A 4XTZA 2CH4W 5FROA 1BB9A 1D1CA 2F2XA 1YWOA 4RG8A 3I5SA 2EJGA 4LXCA 4XU2A 4NOYA 4C92E 1PD0A 1GFCA 2O9VA 1B34A 1WXTA 2MOXA 4LDXA 2DD5A 2QQBA 2J6FA 2JMCA 2E1HA 5GMKi 1BBZA 1JXMA 1WHGA 1Y71A 3NHNA 2DXTA 2DF6A 2LT4A 2L8DA 2YXYA 1FMWA 3OBYA 2C0OA 1E6HA 3AT1B 3G4SQ 3L2WA 1Q86R 1Q82R 1RLQC 3OYHA 1KG1A 1G2BA 1IO6A 3BDUA 4QKUA 3V7SA 4KUDK 1KJWA 2QG9B 1XQHA 3RKXA 4WTOB 2KROA 3UA6A 5GANg 1BI0A 2EIFA 3M55A 3CBPA 5EG2A 3RR6A 2PVDB 1Q86U 3G6EA 3P8BB 1VQ5Q 2LJ0A 2YRCA 3HRSA 5CKDA 4KGXB 2HDAA 1M1KU 5GAMf 3URGA 2QEXT 3X24B 3CCMQ 1VOMA 2W0ZA 2O88A 1NJIC 2VGMA 1SSFA 1ZBJA 5CKEA 2CREA 3MP1A 1DJ7B 4FSSA 4E2FB 4M7DD 4JLIA 4LD9K 2ENMA 2RNAA 2O01E 3CCSQ 2DJZA 1N9SA 1J3TA 3VS3A 2DA9A 3ZFJA 1X6GA 3VS6A 1N8RC 3QPHA 2F69A 1X27A 3M58A 1YWPA 4D8DA 1B3QA 4FYWB 2DVEA 4RCBA 5GAOm 2VC8A 1LVKA 3G71Q 3C0CA 1AOJA 4HVVA 4KT0E 3M0RA 1RI9A 2KXDA 4FL6A 3OYFA 3PMTA 3E19A 1G3WA 3H8ZA 1YJNT 4BB7A 5A0GA 2V8KA 2XHCA 2X51A 1WFWA 3CC2Q 5GAOn 2JTFA 1U1SA 2QK0A 3RMSA 3S3MA 1G3TA 5LJ3f 2C0IA 1AVZC 5DY9A 2F2VA 1XJWB 2QA4A 2IPOB 3KUFA 2E10A 1VQPQ 2RF0A 4VUBA 2X4JA 4FCYA 4N4IA 2OAUA 4CC3A 3LGFA 5LJ5e 2KVQG 4DBQA 1W6XA 5I22A 4E7IA 4XTVA 2ZPEB 4PLIA 2LCCA 2OAWA 2PU9B 2DPPB 4C8QD 1AWOA 2DE0X 1GBRA 3ZEHA 1KQ1A 1HYOA 1BI3A 3BFMA 4OP0A 4XTXA 1BKBA 1SRLA 1MMDA 4EMGA 4IUUA 1PSEA 1P92A 1QVPA 3GNGA 4BE2A 2F5TX 3CC4T 2WSEE 2E4HA 2EQKA 2P4TA 3PVLA 4KUIA 1YJ9A 2RQUA 3VV0A 1K9MU 4C8QC 4C92C 1SF9A 3PE0A 5IAYA 1OX9A 2NYSA 4NL3A 1TWBA 4LDWA 4GLMA 4O6JA 2XG8D 3I9QA 4A53A 2CT4A 3OYAA 2CUBA 3CPWP 2EW3A 2CZ1B 2DYIA 3I5RA 1OU9A 5GAOr 2KYMA 2L89A 4PJMA 4R0KA 5GAMh 1NPPA 2ESWA 2HQXA 2BE9B 3H41A 2OTJT 3CCEQ 2C0TA 4C92A 3CD6T 1MMGA 2JW4A 4Y92A 2K5FA 1WPYA 3REBB 5KCHA 3QYHB 2DM1A 5GANd 3TSWA 1OI1A 1M9SA 1B7TA 2QTXA 2HBPA 5GAN6 2O2OA 1X6OA 1VYTA 2OI3A 4QVZA 4F7UE 3CC2A 5FWBA 2WSFE 4F7UF 3JAME 2KY9A 3OMGA 4PJLA 3SHWA 1RAGB 2GTOA 4R56A 4X34A 9ATCB 4MZMA 2BE7D 2EYWA 2JZ2A 2QGGA 3EGDB 2E65A 1OEBA 2K3XA 3FIFA 1K0XA 1VYUA 4RTUA 2R5MA 4E7HA 2BUDA 2K6DA 1VQPA 5FRNA 1XNIA 3H0FA 5CAIA 2HSPA 3LLRA 3RNJA 3EFRA 3A8OB 2RO0A 2RM4A 4Z02A 1O9SA 1U1TA 2GFAA 1N6AA 1UGSB 2DBKA 2YSQA 2L3PA 3H0HA 3MEVA 3IQLA 3CBOA 2ROLA 4DQ2A 1LCKA 4ZNXA 1KHCA 3NPFA 4OB0B 1BK2A 2CDTA 4BI3A 2LMJA 1VQ8Q 1AWJA 5ECAA 4FYXB 3JB9D 4M77A 4HCBA 5HY6A 1ABQA 2E5KA 2EGCA 2RQRA 2M02A 2IVWA 3CC7A 1S72T 1YCYA 1NE8A 1OV3A 1KC8R 1VQMQ 2VWFA 2DL7A 1SSHA 2L3SA 4WF2A 2LJ3A 2QXFA 1HJDA 1I07A 1H641 2ZPHB 3PTAA 5CKFA 1WXUA 1VQ7T 2GFUA 3UF4A 3A8MB 5GAMg 5IXFA 1M90U 3ZBDA 4PJJA 2R58A 4OMFB 5FLXE 3ASKA 2AT1B 5CKBA 1LJOA 3JCMe 4M77C 3EG2A 2EYZA 1MHNA 3M4YA 3CCVA 4MDWA 2IIMA 1WHJA 3PGGA 4X1VA 4ZTJA 1X6BA 4LDYA 1OYXA 3VUBA 3QUIA 2DIGA 3QZ5B 5LJ5d 1KC8C 3SD4A 2K2MA 4OGCA 3BW1A 2OTJQ 5DM7R 2ZPFB 1NM7A 1WIEA 2PUKB 5HCKA 1RAAB 1YJ9Q 3KFVA 1EFNA 2KAFA 1ZSGA 2NUPA 2PTKA 2LVMA 3TQ7P 4OB2B 4M78F 1YITQ 1H3ZA 4K11A 2BZYA 2K3BA 1PCXA 3CMEA 2V8IA 3HRTA 3L2QA 4QQDA 1VQKT 2KGTA 1MNDA 1YP5A 1ZA1B 4LE9A 1R77A 1RACB 4XU3A 1YJWQ 1GFDA 1VQ4Q 2YT6A 2DEQA 5HK3A 1KC8U 1IZ6A 2DTOA 1HXDA 2EYXA 4IURA 1JU5C 2NUTA 8ATCB 2MYSA 3G4SA 3I56A 2A7YA 4B6MA 1YIJA 2D8HA 2K5LA 3H6ZA 4JJDA 1D0XA 1T0HA 3BDLA 2ZGWA 1M1FA 2Y4YA 2F2WA 1MV3A
chains in the Genus database with same CATH topology
1M5Q1 1FWZA 4PNOA 5M9OA 4R55A 1B34A 3CCEA 1VQKA 2FYKA 2E70A 4IUVA 2DD5A 1LOJA 2QQBA 4PL6A 4LDXA 4TVRA 2E1HA 5GMKi 5LJ3h 3DLMA 5DLQE 1Y71A 2DZCA 2MMPA 2EJ9A 4CI0C 4MZPA 2DXTA 3J81E 3GOXA 2LT4A 3JB9J 4ZGDB 1BIAA 2L8DA 1Y96A 5A0DA 3OBYA 3PNWC 3HFNA 2OTLT 2Y4XA 3JCMf 3L2WA 2EYQA 2XDPA 3OYNA 2RH2A 3C95A 3PT9A 4L59A 4C0DC 3OYHA 1YHQT 3HP9A 5LJ3e 3L2UA 3BDUA 5GAOl 1KG1A 3LWHA 1WJQA 3V7SA 3CCUT 3LGLA 5CQYA 4E47A 3CXCA 4KUDK 1XQHA 5J39A 3RKXA 3HKSA 3JRZA 3MCAB 4O5VA 4KULA 4M75G 2XD0A 2RK1A 5GANg 1BI0A 2EIFA 3M55A 4QW2A 4XTYA 4C0DB 1KQ2A 2OTJA 3EAEA 3VYHB 2GCXA 2XKOC 3CBPA 5EG2A 1Q86U 2PVDB 3CCJA 3G6EA 4FIBA 5CQXA 1VQ5T 3P8BB 4ZN3A 2LC4A 4JLGA 2M0OA 3HRSA 5CVIA 2R57A 5CKDA 5LJ5f 4GLKA 3CCMT 3MP8A 3G71A 4JUVA 4M77G 3V8JA 5C0MA 3CC2T 1YBYA 1M1KU 3MEUA 5GAMf 2YLCA 4GY5A 4BACA 2WSCE 2EFIA 5I2MA 1NJIU 3URGA 5KH6A 2QEXT 4HT8A 4XTUA 3X24B 2FVUA 3CMET 4JRQA 1VIFA 2DTIA 2RI2A 4IUTA 4A4HA 5CR2A 1NJIC 2VGMA 1VQ8T 5GANe 3VU3C 1SSFA 4PJOA 1I4K1 2QQ9A 5CKEA 3MP1A 2XICA 4DOWA 3OYMA 1W2BS 1DJ7B 3QG1A 4M7DD 4N4GA 4C92B 4JLIA 2QA4T 4HCCA 4LD9K 1X01A 2O01E 5A0LA 3QJYA 3VJPA 5LJ3d 3HSBA 1VQOT 2A3LA 2DJZA 4BUGA 1N9SA 1UEBA 4M7DB 2LDMA 2DIQA 4DA4A 3QBYA 3L2RA 3JCMJ 2C06A 4M7AG 3ZFJA 1VQNA 3QSUA 3S6WA 4BD3A 1N8RC 3QPHA 3CPWS 2F69A 3M58A 4F7UA 2LRQA 3VYGA 2DVEA 4QQGA 3X26B 4C0GA 4XK8E 4RCBA 5GAOm 2QQRA 2VC8A 4JJNK 1XOVA 3N5BB 3E9FA 2FL7A 3DLLA 3P8DA 4KT0E 3JCMP 5AYFA 2D0QB 3META 4M78D 1D3BA 1BIBA 5I2SA 1QP3A 5LJ3g 1ZBXA 4RMOA 1VQ9A 4FL6A 4CRIA 1YITT 3OYFA 4HKEA 2CS7A 3PMTA 3E19A 1G3WA 1I8FA 1WJSA 3JCMg 1VUBA 5GMKh 3H8ZA 5GMKj 3G6ET 4BB7A 2QQSA 5A0GA 3OYJA 5HKCA 1YJNT 3TU4K 2V8KA 2XHCA 4JRKA 4C8QG 2V8JA 1VQLA 5GMKl 3HPWA 3HHTB 2LQ8A 4LDUA 3T9NA 3CCLA 2CGHA 4FT4A 4J7IA 5GAOn 2VV5A 4BDYA 1VQ6T 2JTFA 4M75E 3CCQT 1U1SA 4ZTFA 2XIDA 3RMSA 3I55A 2JTMA 1G3TA 2LQKA 3L42A 4HA8A 4EMKB 4XQ3A 5LJ3f 2GF7A 5DY9A 2EJFA 2L3RA 2QA4A 3CMAT 3KUFA 3L2VA 1VQ7A 1BI1A 4JRPA 2E10A 1NZ9A 2PVGB 3V8LA 5GMKe 3GPLA 4VUBA 2RD1A 5LL6S 4C5EA 4EMKC 4M7DF 2GQVA 1YI2T 2LNVA 2X4JA 2HQEA 3SWNB 4MMLA 4N4IA 3TREA 2OAUA 1M1GA 2QEXA 3BY7A 2L5QA 3LGFA 4ELZC 5LJ5e 3LH0A 1Q81U 2K5IA 2KVQG 2RB6A 3NFCA 5GAMd 1VQ6A 3L1AA 2MWPA 4Q5WA 3FC3A 1VQ4T 4E7IA 4IUQA 4XTVA 3OQ5A 2EWNA 4B9XA 1VQLT 2YHTA 2ZPEB 3GLXA 1UB4A 1WQWA 4PLIA 4M7AC 4M7DA 2HAXA 2LCCA 1BYMA 2PU9B 2DPPB 4C8QD 3WXMB 2ZZDA 4PLLA 1VQPT 3OYKA 3SWNA 2KK4A 3ZEHA 1KQ1A 4V2SA 5CK9A 2DD4A 5FRMA 4J6YA 4UC4A 1BI3A 3TEEA 3RIRA 3BFMA 4OP0A 1Y07A 1BKBA 4XTXA 3VUZA 3NTHA 4M77E 4EMGA 2DAQA 3QDRB 3I56T 4IUUA 2DO3A 4E7KA 2LCLA 4DOVA 1PSEA 1PSFA 4II1A 3PIPA 1P92A 1K8AU 1QVPA 2P0PA 3GNGA 4C5GA 4EMKA 2F5TX 3JCMd 2PQWA 4BE2A 3S3MA 2E5QA 3CC4T 2WSEE 2EQKA 2P4TA 3FLGA 1MGQA 4KUIA 1YJ9A 3VV0A 1K9MU 2RJDA 4X9DA 1JJ2A 1QW1A 2E64A 2HNIA 3CBMA 4C8QC 5IT9E 4C8QE 3FJPA 2FHDA 4C92C 2LT1A 3SDZA 3OB9A 1Q7YC 1HK9A 5IAYA 2CZ6B 2VYTA 2QQAA 3HRUA 4J5YA 5GAMe 4NS5A 3KXTA 4OF1A 4NL3A 3PIOA 3CCLT 4XTWA 4LDWA 3P8HA 4PJOF 4YTLA 3RESA 1Q81C 2K2VA 4O6JA 2XG8D 3SB2A 1YI2A 3CPFA 3RKWA 3C4SA 4A53A 2E12A 4XU1A 3UWNA 2RA2A 3OA6A 3OYAA 1Y7XA 2X4WA 5L8RE 3JCMh 3JCMX 5GANf 3X28B 5LJ3j 2EAYA 3UT1A 3M4GA 3CEYA 2CZ1B 1BI2A 4F7UB 1I5LA 5GAOr 4IKFA 3OW2S 4M7AE 2KQWA 3CXCS 1R8OB 2L89A 2VGNA 3OYGA 3OYCA 3JCMQ 5GAMh 4MMKA 5J3BA 1AHJB 2I2LA 1QP2A 3SFMA 4EDUA 5GAMj 1NPPA 1ZHIA 2DXCA 2HQXA 2XK0A 4L6V5 3OYDA 2EQJA 2OTJT 1GXIE 4C92G 4A54A 4E7LA 4M78E 4C92A 3CD6T 5KCOA 4C0FA 4Y28E 3GIBA 5FU7B 3UDCA 1G3YA 2RJEA 2R5AA 3Q1JA 4ME7A 4RKUE 1VQOA 3OS5A 4C5IA 4QQ6A 3CPWA 2FB7A 4FM4B 1Q82U 3M53A 4PJOB 1VQ4A 2VXFA 3OS0A 3LYIA 2EKOA 2F5KA 2K5FA 2AHJB 1WPYA 4QVCA 2MWOA 1M90C 4M78B 3QYHB 3MEAA 3INZA 5KCHA 5GANd 3CCSA 3RERA 1N9RA 4J7FA 3JB9H 1OI1A 2M1HA 1M9SA 4HT9A 3GF5A 2CYZB 2QTXA 3M9QA 1KQSS 5KE3A 2HBPA 3M56A 3QHSA 1WQ7A 5GAN6 2M9UA 5CKHA 3C12A 3CCRT 1X6OA 2EQUA 4LDVA 2YRVA 3JCMV 1N8RU 2KMTA 3CMAA 1OZ2A 2VXEA 4N0AC 4QVZA 4F7UE 1WGSA 3FB9A 2JN0A 1FX7A 3OYLA 3CC2A 3CCMA 4ZGJB 5LJ5g 2ZPIB 4PJOD 2YLBA 4LD6A 4E7JA 2MI6A 3DB4A 2RJCA 3DKMA 2O4XB 3OBWA 2WSFE 4F7UF 3JAME 2KY9A 1I81A 3CD6A 3OMGA 1QVFA 3PMIA 4R56A 4X9CA 4X34A 4A4FA 4C92D 1JB0E 4D6WA 5GANh 3FEOA 4MZMA 3X20B 1KD1U 2RK2A 5LJ5h 2WACA 1XTDA 4EMHA 2K57A 2JZ2A 3GNFB 1X75C 2K3YA 3JB9F 2XDBA 2E65A 2K3XA 1UGPB 4C92F 3FIFA 3OSVA 4M75F 4JS5A 4C8QF 4B9WA 2OTLA 3G71T 2DKGA 2R5MA 1IREB 4E7HA 3C94A 2BUDA 3HFOA 3JCMW 1G3SA 3L2ZA 2ZPGB 2H3JA 4MZTA 1VQPA 5FRNA 3KBGA 1S72A 1XNIA 5C6SA 3MO8A 5CAIA 3LLRA 4M7DC 2BIVA 3EFRA 3A8OB 1Q82C 4OB1B 2RO0A 2RM4A 2E41A 4Z02A 4QVDA 1O9SA 3RMQA 1U1TA 3S3NA 2GFAA 3S3OA 1N6AA 4ZGEB 1UGSB 2XI9A 3OS1A 3RKYA 3E1SA 1ZQ1A 1EIFA 3MP6A 4BI4A 3MEVA 5I21A 4ATOA 3M54A 3CBOA 2EQMA 3LWIA 4M7AF 3OYEA 5GAN5 4N4HA 1YJWA 5D6WA 4P5NA 2RHIA 4DQ2A 1YJ9T 3CC4A 2XU8A 2RHYA 1D3BB 1JRIA 4FT2A 2DXUA 4JDSA 4M78C 1QVGA 1QVGS 2Y90A 2CZ0B 2G3RA 3SWNC 1KHCA 4OB0B 1JJ2S 4PJOE 2ZCFB 1WNLA 4BI3A 1Y96B 4C5HA 3CCQA 1YJWT 3G4ST 3JB9D 1KD1C 2JUFA 4M77A 2JNGA 3HL8A 1VQ8A 4HCBA 3A8LB 5HY6A 3QZ9B 1LNXA 3GP8A 2XDDA 4ELYC 4BE0A 4XU0A 1RL2A 1B34B 4HCZA 5CCAA 1K9MC 5DLOA 4RG2A 4M75B 5J26A 2IVWA 3CC7A 3JB9G 1S72T 1YCYA 1NE8A 1M8VA 1JBMA 3J80E 3WVDB 2DZ9A 3OW2A 3A8HB 2JOYA 4WF2A 2QXFA 5D6XA 2DTHA 2VUBA 3V8KA 1G5VA 2RHXA 4JRIA 3M5AA 2MF2A 3V7RA 4FU6A 3QO3A 2RHUA 1H641 2ZPHB 3PTAA 5CKFA 3QIIA 1Q7YU 1VQ7T 2GFUA 3LW5E 3O8VA 4PKCC 1TH7A 3A8MB 5GAMg 1M90U 3ZBDA 4IUPA 4A4EA 2R58A 3I55T 4OMFB 5FLXE 2RHZA 3NTKA 3ASKA 4RCCA 4M7AD 3OMCA 5CKBA 1K73U 1LJOA 1N27A 3JCMe 3LX7A 5GAN3 4M75A 3CCET 5GAN2 4M77C 2M16A 2BKDN 3JCMc 1MHNA 5GAN7 3M4YA 5GANj 3CCVA 3X25B 4MDWA 3JSCA 2LTOA 1YJNA 1KHIA 1NPRA 3PGGA 5FU6C 4BY6B 4ZTJA 1YITA 3CCRA 4M77B 1VQ9T 4LDYA 5GMKm 4F7UG 1OYXA 1QVFS 3M59A 3VUBA 4A4GA 4M78G 3QUIA 2DIGA 3QZ5B 1M4ZA 2KDSA 3ME9A 5LJ5d 5KE2A 4NL2A 3AHUA 1KC8C 3SD4A 4OGCA 2RJFA 3JCMb 3CCJT 3BW1A 4KBMB 4M77D 2RI5A 3QYGB 4BDZA 3F70A 2QI2A 2DK3A 5DM7R 1VQNT 4J8OA 2DXBA 2ZPFB 3MEWA 1K8AC 3NTIA 3OYYA 3CCUA 2PUKB 4C8QA 3QJ6A 4XAXB 1VQMT 2X35A 2P0QA 2KAFA 2LVMA 4OB2B 4PJOC 4OGEA 4M78F 2B8AA 4M77F 4JS4A 4OB3B 1H3ZA 4Y91A 3G7ZA 1KQSA 3M57A 1VIEA 2K4YA 4J83A 5CIUA 4J6XA 3R6OA 5HK0A 3CMEA 2HD0A 2RI3A 2P0KA 5D6YA 2V8IA 3FRNA 3HRTA 5A2QE 2PVOB 5FU7C 5GAN4 3L2QA 2X4XA 4OVAA 4M7AA 4QQDA 1VQKT 1WJRA 3WVEB 3CCVT 3UPUA 3TCJA 2KSSA 5IN1A 3CCST 1U8RA 3EFSA 4XU3A 4EPCA 3OY9A 1VQ5A 4L5GA 5GAN8 3CC7T 3VKIA 3J7AF 4A4KA 2PUOB 2D6FA 3QXEB 2NLUA 2DEQA 1FXXA 5HK3A 4M7DG 1VQMA 2E6ZA 1KC8U 4BI8B 4ZN1A 5LJ5j 4M7AB 1O75A 1IZ6A 3OSSC 4M75C 2MAMA 4PJOG 1V29B 2DTOA 4J6WA 3V7CA 2O4XA 1W4SA 3JB9I 1YIJT 2ZPBB 1YHQA 3PFSA 4C92E 4FSXA 4C0ZA 2D9TA 3FDRA 1RI0A 1HXDA 2QDYB 4BE1A 4IURA 3E9GA 3A8GB 5FU6B 1UGRB 2IG0A 2JVVA 4BY6C 3RUXA 3G4SA 5CO7A 3I56A 2A7YA 2CKKA 1K73C 2E6NA 1M1KC 1YIJA 3A5ZB 4MDXA 1OZ3A 4M7DE 2K5LA 4XTZA 2X4YA 3H6ZA 3OS2A 3QKJA 2LX9A 5FROA 5GAOp 3BDLA 2ZGWA 4RG8A 5GAOq 1W2BA 1M1FA 2Y4YA 2EJGA 1UGQB 3MHXA 3OYIA 4M75D 1Q86C 3DB3A 4NOYA 4XU2A 3OYBA 4C8QB 4M78A 2CZ7B 4N0AA 3ER0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7Z A;  1UB4 A;  1X75 C;  5CR2 A;  5HK0 A;  5CQY A;  4ELY C;  5CKE A;  5CKB A;  5CKH A;  3JRZ A;  4VUB A;  5CCA A;  5CK9 A;  2KMT A;  4OF1 A;  5DLO A;  5CO7 A;  4MZT A;  4HKE A;  4MZP A;  5CQX A;  1NE8 A;  4ME7 A;  1VUB A;  3JSC A;  3TCJ A;  4MDX A;  4ELZ C;  5HKC A;  5CKD A;  3HPW A;  3NFC A;  2VUB A;  2C06 A;  1M1F A;  2MF2 A;  3VUB A;  5HK3 A;  5CKF A;  4MZM A; 
#chains in the Genus database with same CATH topology
 1FWZ A;  4R55 A;  2FYK A;  4TVR A;  5FWC A;  5LJ3 h;  4DBF A;  2EGE A;  3G6E Q;  3G1J A;  3J81 E;  4ZGD B;  3NGP A;  1Y96 A;  3PNW C;  2OTL T;  3JCM f;  2EYQ A;  2XDP A;  2D8J A;  1YHQ T;  1WZO A;  3NMZ C;  5GAO l;  3LWH A;  1WJQ A;  3CCU T;  5CQY A;  4E47 A;  4RTV A;  5J39 A;  2XD0 A;  4KUL A;  4M75 G;  2EKH A;  2RK1 A;  4QW2 A;  1KQ2 A;  3EAE A;  2V1R A;  1VQ5 T;  1ARK A;  2LC4 A;  4JLG A;  2M0O A;  4JUV A;  2X3W D;  1YBY A;  3MEU A;  1RAI B;  4GY5 A;  2WSC E;  2EFI A;  5I2M A;  1NJI U;  1D1A A;  2JMA A;  1HD3 A;  1VIF A;  4A4H A;  5CR2 A;  2AZS A;  2RQT A;  4OMQ A;  5GAN e;  4ESR A;  2KNB B;  3VRZ A;  2Z0W A;  1AEY A;  4N4G A;  4C92 B;  2QA4 T;  1X01 A;  4KH1 B;  2QDL A;  3HSB A;  2LX7 A;  5KYN A;  3QBY A;  1VQN A;  2VAS A;  4RTY A;  1ZUU A;  1PRL C;  3CPW S;  4F7U A;  1NYF A;  4XK8 E;  1XOV A;  3P8D A;  2GBQ A;  1BIB A;  1QP3 A;  1ZBX A;  1YIT T;  1I8F A;  2FRY A;  5GMK h;  1VQ8 T;  2QQS A;  3TU4 K;  1UJ0 A;  2EPD A;  4C8Q G;  1VQL A;  1JO8 A;  3CCL A;  2GNC A;  4FT4 A;  1V76 A;  2O31 A;  2VV5 A;  4BDY A;  1VQ6 T;  4M75 E;  3RDV A;  3CCQ T;  1HSQ A;  4ZTF A;  4RTX A;  3L42 A;  4XQ3 A;  1ABO A;  1K9A A;  3L2V A;  1LPL A;  1BI1 A;  2PVG B;  5IXB A;  3GPL A;  1YCS B;  3ULR B;  5LL6 S;  1N5Z A;  4JZ3 A;  1YI2 T;  4MML A;  1M1G A;  2QEX A;  4ELZ C;  3LH0 A;  2K5I A;  2I0N A;  2PNI A;  1F1B B;  1PM3 A;  1T3L A;  3OQ5 A;  1KIK A;  2EWN A;  2QYZ A;  4AFZ C;  1Q7Y R;  1UB4 A;  4M7A C;  4M7D A;  1PG5 B;  2ZZD A;  4PLL A;  2CP7 A;  1NEG A;  1I0C A;  3CCV Q;  3MPU B;  1UTI A;  3I56 T;  2DO3 A;  4E7K A;  3REA B;  3PIP A;  1K8A U;  3JCM d;  3FLG A;  1RUW A;  2J05 A;  3CC4 Q;  3TSZ A;  4X9D A;  1QW1 A;  1IB8 A;  2FHD A;  2CSQ A;  2FEI A;  2KT8 A;  2ROT A;  2KR3 A;  2CZ6 B;  1UGV A;  3HRU A;  5GAM e;  3CCL T;  4XTW A;  4PJO F;  3RES A;  2K2V A;  1YI2 A;  2M0Y A;  3CPF A;  3C4S A;  3RKW A;  4XU1 A;  1IHV A;  2X4W A;  3JCM X;  3JCM h;  3X28 B;  4OMN A;  3M4G A;  1I5L A;  6AT1 B;  3OW2 S;  1R8O B;  2VGN A;  3OYC A;  3JCM Q;  4CC2 A;  1AHJ B;  2I2L A;  1SKU B;  2BTT A;  2DXC A;  1M1K R;  4L6V 5;  3OYD A;  1GCQ A;  2DMO A;  4M78 E;  5KCO A;  2FG0 A;  4Y28 E;  1RAH B;  4ME7 A;  2FPE A;  4C5I A;  4QQ6 A;  2FB7 A;  1AT1 B;  2DL4 A;  2EKO A;  2F5K A;  4QVC A;  4M78 B;  3INZ A;  3RER A;  3HTR A;  1G8X A;  4J7F A;  5KYX A;  1QVF P;  3CC7 Q;  1T0J A;  3M9Q A;  1U5S A;  1WQ7 A;  2M9U A;  5CKH A;  3C12 A;  2EQU A;  4LDV A;  2KMT A;  4N0A C;  1C6V X;  1NG2 A;  1M3C A;  1WGS A;  2ED0 A;  2YWW A;  4ZGJ B;  4E7J A;  1D0Z A;  3DB4 A;  2RJC A;  2O4X B;  3OBW A;  2AIR B;  2HL3 A;  3PMI A;  1KD1 U;  4FYY B;  3GNF B;  2DX1 A;  1X75 C;  2K3Y A;  1QVG P;  3JB9 F;  2RN8 A;  2XDB A;  4C92 F;  3OSV A;  4B9W A;  2OTL A;  1ZUY A;  3HFO A;  1VQN Q;  1G3S A;  1K0S A;  8AT1 B;  3KBG A;  1S72 A;  1KD1 R;  3MO8 A;  2CT3 A;  2KE9 A;  3RMQ A;  2XI9 A;  2ABL A;  4KRT A;  3E1S A;  3RKY A;  2X3X D;  1I1J A;  1X2Q A;  3M0S A;  1N8R R;  1WXB A;  1QCF A;  4M7A F;  1H3H A;  4DBH A;  1MV0 B;  4N4H A;  2HSE B;  2A28 A;  1K73 R;  4HXJ A;  3M0U A;  2B86 A;  2DER A;  4LN2 A;  3G4S T;  1EX4 A;  1I5O B;  1WHH A;  1KD1 C;  1KK7 A;  2JNG A;  2HQH A;  3QZ9 B;  1LNX A;  4PFO A;  2XDD A;  2KEA A;  4XU0 A;  1YI2 Q;  1B34 B;  2HCK A;  5CCA A;  4RG2 A;  3EG0 A;  4M75 B;  5J26 A;  2JJ9 A;  2DZ9 A;  5IHK A;  5D6X A;  2LCS A;  1VQ9 Q;  3V7R A;  1QWF A;  4AFS C;  1Q7Y U;  2HKN A;  1TH7 A;  1X2K A;  4A4E A;  1ZSZ B;  3ZL7 C;  5GAN 3;  1UG1 A;  3JCM c;  5GAN 7;  1SG5 A;  2QAS A;  5GAN j;  2VB6 A;  3JSC A;  3RBB B;  2KXC A;  4ANJ A;  2A36 A;  1YIT A;  4CC4 B;  4M77 B;  1AD5 A;  2YUP A;  2L3Q A;  5KYW A;  1TU0 B;  1YHQ Q;  2XMF A;  3JCM b;  3CCJ T;  3QWY A;  1JXO A;  2D0N A;  1VQN T;  2FPD A;  3D7S B;  4KGV B;  3NTI A;  3QJ6 A;  1S1N A;  3LH5 A;  2X35 A;  2AKL A;  4OGE A;  1X69 A;  2SEM A;  1NEB A;  2YUN A;  3G7Z A;  3EHQ A;  4E7Z A;  5CIU A;  1VIE A;  1M2O A;  4J6X A;  2QGF B;  4J9C A;  2KBT A;  4F04 B;  4HVU A;  5D6Y A;  3EH1 A;  1MMN A;  1PHT A;  3FRN A;  5A2Q E;  2PVO B;  5GAN 4;  3EGX B;  2OX7 A;  1AWX A;  1WJR A;  3WVE B;  3CCV T;  5IN1 A;  3CCS T;  3EFS A;  1VQ5 A;  3J7A F;  3CC7 T;  1WLP B;  2D6F A;  2NLU A;  1FXX A;  1VQM A;  2MCN A;  4BI8 B;  3EFO A;  4M75 C;  4PJO G;  2MAM A;  4J6W A;  1YHQ A;  3THK A;  1MNE A;  4FSX A;  4C0Z A;  3FDR A;  1ZSZ A;  1RI0 A;  2FRW A;  2QDY B;  1WDX A;  2MK5 A;  2IG0 A;  2JVV A;  3I55 Q;  1M1K C;  2E6N A;  3A5Z B;  4M7D E;  2X4Y A;  3QKJ A;  2JS0 A;  2LX9 A;  2DL3 A;  1W2B A;  3MHX A;  2YDL A;  3OYI A;  1Q86 C;  4M75 D;  2CZ7 B;  3ER0 A;  1M5Q 1;  4PNO A;  2NUP B;  2VKN A;  1VQ6 Q;  4IUV A;  1LOJ A;  2DZC A;  1QKX A;  1IGU A;  2K79 A;  2O9S A;  3JB9 J;  2EYY A;  4DEX A;  5A0D A;  1WA7 A;  3GBQ A;  3H9N A;  3HFN A;  2RPN A;  2RH2 A;  3C95 A;  1OUL A;  1OX8 A;  3HP9 A;  5LJ3 e;  1QWE A;  3L2U A;  1PWT A;  3LGL A;  2CH4 A;  3CXC A;  4HVW A;  3JRZ A;  3MCA B;  4O5V A;  4C0D B;  1MMA A;  1OPL A;  3CCJ A;  5CQX A;  4ZN3 A;  4JJC A;  2R57 A;  5LJ5 f;  2FPF A;  4GLK A;  3MP8 A;  4M77 G;  5C0M A;  3CC2 T;  2EVR A;  1D09 B;  2YLC A;  4BAC A;  5KH6 A;  2X9H A;  2CP5 A;  3CME T;  2FVU A;  4JRQ A;  1M3A A;  2DTI A;  2RI2 A;  4IUT A;  3VU3 C;  1VQ7 Q;  1I4K 1;  2XIC A;  4DOW A;  3OYM A;  1UHC A;  1BU1 A;  3QG1 A;  3CQT A;  4HCC A;  2F1L A;  3EHR A;  5LJ3 d;  2DIQ A;  4DA4 A;  1JEG A;  3JCM J;  4M7A G;  2KRN A;  1V1C A;  3S6W A;  2ECZ A;  5I11 A;  1UE9 A;  2DFU A;  2LRQ A;  3VYG A;  4AG1 C;  4QQG A;  4C0G A;  2J06 A;  4JJN K;  3DLL A;  2FL7 A;  4D8K A;  1TS9 A;  4WCI A;  3JCM P;  1H8K A;  3MET A;  4M78 D;  5LJ3 g;  1D3B A;  4RMO A;  4HKE A;  5GMK j;  3G6E T;  5HKC A;  4J9D A;  2V8J A;  3HHT B;  2LQ8 A;  1JJ2 P;  1WHM A;  4OMO A;  1RAE B;  4OMP A;  2JTM A;  4EMK B;  2GF7 A;  3JV3 A;  2KRM A;  1S72 Q;  1M90 R;  3EGD A;  1VQ7 A;  1R0C B;  1NZ9 A;  3V8L A;  5GMK e;  1SRM A;  2RD1 A;  4C5E A;  1AZE A;  4M7D F;  2GQV A;  1TG0 A;  2HQE A;  2L5Q A;  2RB6 A;  1K76 A;  1E6G A;  3NFC A;  2YUO A;  1X43 A;  5GJV B;  3OW2 P;  1NBE B;  2QTV A;  5GAM d;  1VQ6 A;  4Q5W A;  1VQ4 T;  2BZX A;  4IUQ A;  3MKD A;  3QDF A;  1VQL T;  4A63 B;  2RMO A;  1ACM B;  3GLX A;  2HMA A;  1K8A R;  1BYM A;  4GBQ A;  3WXM B;  3OYK A;  3SWN A;  1WHK A;  4UC4 A;  3H0I A;  4FW1 A;  3RIR A;  3VUZ A;  1TXQ A;  2LCL A;  1PSF A;  1K73 C;  2PQW A;  2E5Q A;  1WYX A;  2OTL Q;  1MUZ A;  2H3E B;  2RJD A;  1JJ2 A;  2HNI A;  5IT9 E;  3CBM A;  3FJP A;  2LT1 A;  3VS0 A;  1HK9 A;  2VYT A;  2QQA A;  2L2P A;  4NS5 A;  2EGA A;  1D0Y A;  3PIO A;  5KYU A;  1Q81 C;  3SB2 A;  7AT1 B;  2E12 A;  3UWN A;  3OA6 A;  1Y7X A;  5LJ3 j;  1U3O A;  2EAY A;  4F7U B;  4IKF A;  4M7A E;  3CXC S;  3OYG A;  1VQL Q;  4MMK A;  1ZHI A;  2XK0 A;  4IIO A;  4C92 G;  1NLP C;  4E7L A;  3GIB A;  1G3Y A;  2R5A A;  3Q1J A;  4RKU E;  2ATC B;  3CPW A;  4PJO B;  2QAZ A;  2DLP A;  1GCQ C;  3LYI A;  2CP6 A;  2AHJ B;  1SPK A;  1M90 C;  3MEA A;  1N9R A;  2YRD A;  2M1H A;  4HT9 A;  1TUD A;  4PFP A;  1KQS S;  4LNP A;  3QHS A;  2E3I A;  1M8M A;  4RUG A;  2YRV A;  3CMA A;  1OZ2 A;  2JN0 A;  1FX7 A;  2YUQ A;  3EFO B;  2ZPI B;  4PJO D;  1ZUK A;  4JPB W;  1K1Z A;  1PKS A;  4OMM A;  2GQI A;  2DIL A;  3CD6 A;  4C92 D;  1JB0 E;  4D6W A;  5GAN h;  3FEO A;  3X20 B;  2RK2 A;  1A0N B;  5LJ5 h;  2WAC A;  1TUC A;  5AT1 B;  1BCO A;  1UGP B;  3CCR Q;  4J9I A;  4PFZ A;  4M75 F;  4C8Q F;  1M30 A;  1ZA2 B;  4AFQ C;  1IRE B;  3C94 A;  2ZPG B;  2H3J A;  1YFN A;  5C6S A;  4M7D C;  3PVQ A;  2BIV A;  1Q82 C;  4OB1 B;  4QVD A;  1PNJ A;  3S3N A;  4ZGE B;  3MP6 A;  5I21 A;  2RQV A;  4ATO A;  3R6N A;  3M54 A;  2EQM A;  2HKQ B;  1QQJ A;  2A08 A;  5GAN 5;  1H92 A;  4J9H A;  5D6W A;  1YJ9 T;  2KRS A;  3CC4 A;  2XU8 A;  1D3B B;  4JDS A;  1QVG A;  2G3R A;  2SRC A;  4PJO E;  1WNL A;  2HEQ A;  1Y96 B;  3CCQ A;  1YJW T;  1FYN A;  4OML A;  1K4U S;  4RTZ A;  2QA4 Q;  3HL8 A;  1VQ8 A;  3A8L B;  3GP8 A;  4ELY C;  4BE0 A;  4LUD A;  1M27 C;  5DLO A;  2COY A;  1GCP A;  4QT7 A;  3CCU Q;  3JB9 G;  4JZ4 A;  1M8V A;  1JBM A;  4RTT A;  3J80 E;  2FZG B;  3OW2 A;  3M0Q A;  2DTH A;  2ED1 A;  2VUB A;  2RHX A;  4JRI A;  3M5A A;  2MF2 A;  4FU6 A;  3QO3 A;  3LW5 E;  1QLY A;  2NUT B;  2NWM A;  2RHZ A;  4RCC A;  4M7A D;  1K73 U;  1N27 A;  3CCE T;  1W1F A;  4M75 A;  4CC7 A;  1WI7 A;  2DVJ A;  5IH2 A;  3X25 B;  2AK5 A;  2LTO A;  1YJN A;  1NPR A;  5FU6 C;  3CCR A;  4A4G A;  4M78 G;  2KDS A;  1WHL A;  2KYB A;  1SEM A;  1CSK A;  2BZ8 A;  4KBM B;  2RI5 A;  4BDZ A;  3F70 A;  1NYG A;  2A37 A;  3MEW A;  1K8A C;  3OYY A;  3CCU A;  3E2U A;  1AWW A;  2P0Q A;  1UEC A;  4M77 F;  4JS4 A;  3VS4 A;  1EZZ B;  4Y91 A;  1KQS A;  1W70 A;  2CSI A;  4J83 A;  3BE3 A;  4J9G A;  1WX6 A;  5HK0 A;  5KYY B;  1U06 A;  2RI3 A;  2P0K A;  4AMC A;  3EH2 A;  1PRM C;  4M7A A;  3UPU A;  4EPC A;  1Q95 G;  4L5G A;  3VKI A;  2PUO B;  1ZSZ C;  4ZN1 A;  1YNZ A;  3OSS C;  3EG9 B;  1V29 B;  2LP5 A;  2O4X A;  2FO0 A;  1YIJ T;  3PFS A;  4BY6 C;  1UGR B;  1RAB B;  2KT1 A;  3O5Z A;  2CKK A;  4MDX A;  1OZ3 A;  1G83 A;  4Z88 A;  3OS2 A;  5GAO p;  3CCL Q;  1KQS P;  5GAO q;  1C0M A;  1UGQ B;  4FYV B;  3DB3 A;  3OYB A;  4C8Q B;  4M78 A;  4N0A A;  4X9C A;  1D1B A;  1C1A A;  5IHI A;  5M9O A;  4Z8A A;  3CCE A;  1VQK A;  4RTW A;  2E70 A;  4PL6 A;  2HL5 C;  2P4R A;  3DLM A;  4J9F A;  5DLQ E;  2LZ6 B;  4IIM A;  2MMP A;  2EJ9 A;  4CI0 C;  4MZP A;  3GOX A;  1Y57 A;  1UFF A;  2DYB A;  1BIA A;  2DJQ A;  2Y4X A;  1FMV A;  3FJ5 A;  5L23 A;  3OYN A;  3PT9 A;  1UUE A;  4L59 A;  4C0D C;  3CME Q;  1IGQ A;  1Z9Q A;  3HKS A;  1NLO C;  3EGU A;  2OTJ A;  4XTY A;  3VYH B;  2GCX A;  2XKO C;  4FIB A;  2DRK A;  5CVI A;  4Z89 A;  3CCM T;  3G71 A;  3V8J A;  1OQK A;  4KGZ B;  1KSW A;  1BCM A;  4F17 A;  4HT8 A;  4XTU A;  2JM9 A;  4PJO A;  4FW2 A;  2QQ9 A;  1W2B S;  2RQW A;  4E7S A;  1YIJ Q;  1AZG B;  3QJY A;  3VJP A;  5A0L A;  1VQO T;  2A3L A;  2GGR A;  4BUG A;  5EC7 A;  2V1Q A;  1UEB A;  4M7D B;  2LDM A;  2GTJ A;  3L2R A;  2C06 A;  3QSU A;  4BD3 A;  1YN8 A;  1VQO Q;  1Z9Z A;  3X26 B;  2AKK A;  2QQR A;  3N5B B;  2CP3 A;  3E9F A;  1KFZ A;  5AYF A;  2D0Q B;  5I2S A;  1OPK A;  1VQ9 A;  4CRI A;  2CS7 A;  1WJS A;  3JCM g;  1VUB A;  3OYJ A;  2LJ1 A;  4JRK A;  5GMK l;  3HPW A;  4LDU A;  3T9N A;  2CGH A;  4J7I A;  1IRX A;  1M2V B;  1M2V A;  2XID A;  3I55 A;  2LQK A;  4HA8 A;  2K7A A;  2EJF A;  2L3R A;  3CMA T;  2PZ1 A;  3UAT A;  4JRP A;  2J7I A;  4AT1 B;  4EMK C;  2LNV A;  3SWN B;  3TRE A;  2HZY A;  1UHF A;  3BY7 A;  1TOV A;  2FZC B;  1Q81 U;  2NUZ A;  1JQQ A;  3L1A A;  2MWP A;  3FC3 A;  2J6O A;  2VVK A;  4B9X A;  2YHT A;  1WQW A;  2ZAE A;  2HAX A;  1VA7 A;  1VQP T;  2E3H A;  2KK4 A;  4V2S A;  5CK9 A;  2DD4 A;  5FRM A;  2KI7 A;  4J6Y A;  4DBR A;  3TEE A;  2LQW A;  5KYX B;  4J9E A;  1Y07 A;  3NTH A;  4M77 E;  2DAQ A;  3QDR B;  4KH0 B;  2AZV A;  4DOV A;  4II1 A;  2P0P A;  4C5G A;  4EMK A;  3UA7 A;  1MGQ A;  1IXD A;  2E64 A;  4C8Q E;  3SDZ A;  3OB9 A;  1Q7Y C;  2JM8 A;  4J5Y A;  5D7U A;  3KXT A;  4OF1 A;  3P8H A;  4YTL A;  1QCN A;  2RA2 A;  2V26 A;  5GAN f;  5L8R E;  3UT1 A;  3CEY A;  3CMA Q;  1BI2 A;  1GBQ A;  2KQW A;  5J3B A;  3SFM A;  5GAM j;  1QP2 A;  4EDU A;  2COZ A;  1PD1 A;  2P84 A;  2DEU A;  2DRM A;  4AFU C;  2EQJ A;  3M0T A;  1GXI E;  4A54 A;  4AG2 C;  2MPX C;  4C0F A;  3CCJ Q;  5FU7 B;  3UDC A;  4DEY A;  2RJE A;  1VQO A;  1QCO A;  3OS5 A;  1Q82 U;  4FM4 B;  3M53 A;  2LNH B;  4F16 A;  1VQ4 A;  3A98 A;  2VXF A;  3OS0 A;  4EIK A;  1QMC A;  5IHN A;  4E6R A;  2MWO A;  4J9B A;  2JTE A;  3CCS A;  2OJ2 A;  3QWX X;  3JB9 H;  3A1P A;  3GF5 A;  2CYZ B;  3VS7 A;  1T3S A;  3I35 A;  5KE3 A;  3M56 A;  4M4Z A;  3CCR T;  1N8R U;  3JCM V;  2VXE A;  1GRI A;  3FB9 A;  3OYL A;  2HBW A;  3CCM A;  5LJ5 g;  1TTH B;  2YLB A;  1SHF A;  4LD6 A;  2FZK B;  2MI6 A;  3DKM A;  1SHG A;  1I81 A;  1QVF A;  4A4F A;  2CUD A;  2A0F B;  1TUG B;  1XTD A;  4EMH A;  2K57 A;  3EG1 A;  4JS5 A;  5KYY A;  1CKA A;  3G71 T;  2DKG A;  3JCM W;  3L2Z A;  4MZT A;  2DBM A;  3VS5 A;  3I56 Q;  1UDL A;  2JXB A;  2E41 A;  2DET A;  1RAD B;  2CP0 A;  3VS1 A;  3S3O A;  3EG3 A;  1B07 A;  1YJN Q;  3OS1 A;  1ZQ1 A;  1EIF A;  4BI4 A;  3LWI A;  3OYE A;  1YJW A;  4P5N A;  2RHI A;  1RAF B;  1ZLM A;  2K9G A;  2RHY A;  1JRI A;  4FT2 A;  1CKB A;  2DXU A;  4M78 C;  1QVG S;  2Y90 A;  2CZ0 B;  3SWN C;  1JJ2 S;  2ZCF B;  1QKW A;  4C5H A;  2EBP A;  5KYU B;  1W2B P;  2JUF A;  2L0A A;  3CCQ Q;  3VRY A;  1RL2 A;  3VS2 A;  3CXC P;  4HCZ A;  3M0P A;  1K9M C;  2LQN A;  3EGX A;  1OOT A;  1Q81 R;  1E7O A;  3WVD B;  3A8H B;  2JOY A;  3V8K A;  1G5V A;  2DNU A;  2RHU A;  3QII A;  3O8V A;  4PKC C;  4JJB A;  1FMK A;  2JT4 A;  4IUP A;  3I55 T;  2G6F X;  3NTK A;  5GJW B;  3OMC A;  3LX7 A;  5GAN 2;  4PJN A;  2M16 A;  2BKD N;  1GL5 A;  2MIO A;  3SEM A;  1VYV A;  1KHI A;  2W10 A;  4BY6 B;  1VQ9 T;  5GMK m;  4F7U G;  1K9M R;  3M59 A;  1QVF S;  4HCK A;  1M4Z A;  3ME9 A;  3TVT A;  5KE2 A;  4NL2 A;  3AHU A;  2RJF A;  4M77 D;  3QYG B;  2EQI A;  2QI2 A;  2DK3 A;  4J8O A;  2DXB A;  1M3B A;  3MJX A;  1VQK Q;  4C8Q A;  4XAX B;  1OU8 A;  1VQM T;  4PJO C;  1ZX6 A;  2B8A A;  4OB3 B;  2JS2 A;  4LUE A;  3M57 A;  2K4Y A;  3R6O A;  1TSF A;  2D1X A;  2HD0 A;  2J6K A;  3EG9 A;  5FU7 C;  5KYW B;  2X4X A;  4OVA A;  2CP2 A;  1NJI R;  1RLP C;  2H8H A;  2DL5 A;  1UJY A;  3TCJ A;  2KSS A;  2QEX Q;  1U8R A;  3OY9 A;  5GAN 8;  1PKT A;  3CD6 Q;  2DL8 A;  4A4K A;  3QXE B;  1R0B G;  2COW A;  4M7D G;  2E6Z A;  5LJ5 j;  4M7A B;  1O75 A;  1IHW A;  3JB9 I;  3V7C A;  1Y0M A;  1W4S A;  2ZPB B;  2D9T A;  4BE1 A;  5FW9 A;  3E9G A;  3A8G B;  4ORZ A;  5FU6 B;  4F14 A;  3RUX A;  5CO7 A;  4PK4 A;  1PC0 A;  3U23 A;  2M51 A;  4XTZ A;  2CH4 W;  5FRO A;  1BB9 A;  1D1C A;  2F2X A;  1YWO A;  4RG8 A;  3I5S A;  2EJG A;  4LXC A;  4XU2 A;  4NOY A;  4C92 E;  1PD0 A;  1GFC A;  2O9V A;  1B34 A;  1WXT A;  2MOX A;  4LDX A;  2DD5 A;  2QQB A;  2J6F A;  2JMC A;  2E1H A;  5GMK i;  1BBZ A;  1JXM A;  1WHG A;  1Y71 A;  3NHN A;  2DXT A;  2DF6 A;  2LT4 A;  2L8D A;  2YXY A;  1FMW A;  3OBY A;  2C0O A;  1E6H A;  3AT1 B;  3G4S Q;  3L2W A;  1Q86 R;  1Q82 R;  1RLQ C;  3OYH A;  1KG1 A;  1G2B A;  1IO6 A;  3BDU A;  4QKU A;  3V7S A;  4KUD K;  1KJW A;  2QG9 B;  1XQH A;  3RKX A;  4WTO B;  2KRO A;  3UA6 A;  5GAN g;  1BI0 A;  2EIF A;  3M55 A;  3CBP A;  5EG2 A;  3RR6 A;  2PVD B;  1Q86 U;  3G6E A;  3P8B B;  1VQ5 Q;  2LJ0 A;  2YRC A;  3HRS A;  5CKD A;  4KGX B;  2HDA A;  1M1K U;  5GAM f;  3URG A;  2QEX T;  3X24 B;  3CCM Q;  1VOM A;  2W0Z A;  2O88 A;  1NJI C;  2VGM A;  1SSF A;  1ZBJ A;  5CKE A;  2CRE A;  3MP1 A;  1DJ7 B;  4FSS A;  4E2F B;  4M7D D;  4JLI A;  4LD9 K;  2ENM A;  2RNA A;  2O01 E;  3CCS Q;  2DJZ A;  1N9S A;  1J3T A;  3VS3 A;  2DA9 A;  3ZFJ A;  1X6G A;  3VS6 A;  1N8R C;  3QPH A;  2F69 A;  1X27 A;  3M58 A;  1YWP A;  4D8D A;  1B3Q A;  4FYW B;  2DVE A;  4RCB A;  5GAO m;  2VC8 A;  1LVK A;  3G71 Q;  3C0C A;  1AOJ A;  4HVV A;  4KT0 E;  3M0R A;  1RI9 A;  2KXD A;  4FL6 A;  3OYF A;  3PMT A;  3E19 A;  1G3W A;  3H8Z A;  1YJN T;  4BB7 A;  5A0G A;  2V8K A;  2XHC A;  2X51 A;  1WFW A;  3CC2 Q;  5GAO n;  2JTF A;  1U1S A;  2QK0 A;  3RMS A;  3S3M A;  1G3T A;  5LJ3 f;  2C0I A;  1AVZ C;  5DY9 A;  2F2V A;  1XJW B;  2QA4 A;  2IPO B;  3KUF A;  2E10 A;  1VQP Q;  2RF0 A;  4VUB A;  2X4J A;  4FCY A;  4N4I A;  2OAU A;  4CC3 A;  3LGF A;  5LJ5 e;  2KVQ G;  4DBQ A;  1W6X A;  5I22 A;  4E7I A;  4XTV A;  2ZPE B;  4PLI A;  2LCC A;  2OAW A;  2PU9 B;  2DPP B;  4C8Q D;  1AWO A;  2DE0 X;  1GBR A;  3ZEH A;  1KQ1 A;  1HYO A;  1BI3 A;  3BFM A;  4OP0 A;  4XTX A;  1BKB A;  1SRL A;  1MMD A;  4EMG A;  4IUU A;  1PSE A;  1P92 A;  1QVP A;  3GNG A;  4BE2 A;  2F5T X;  3CC4 T;  2WSE E;  2E4H A;  2EQK A;  2P4T A;  3PVL A;  4KUI A;  1YJ9 A;  2RQU A;  3VV0 A;  1K9M U;  4C8Q C;  4C92 C;  1SF9 A;  3PE0 A;  5IAY A;  1OX9 A;  2NYS A;  4NL3 A;  1TWB A;  4LDW A;  4GLM A;  4O6J A;  2XG8 D;  3I9Q A;  4A53 A;  2CT4 A;  3OYA A;  2CUB A;  3CPW P;  2EW3 A;  2CZ1 B;  2DYI A;  3I5R A;  1OU9 A;  5GAO r;  2KYM A;  2L89 A;  4PJM A;  4R0K A;  5GAM h;  1NPP A;  2ESW A;  2HQX A;  2BE9 B;  3H41 A;  2OTJ T;  3CCE Q;  2C0T A;  4C92 A;  3CD6 T;  1MMG A;  2JW4 A;  4Y92 A;  2K5F A;  1WPY A;  3REB B;  5KCH A;  3QYH B;  2DM1 A;  5GAN d;  3TSW A;  1OI1 A;  1M9S A;  1B7T A;  2QTX A;  2HBP A;  5GAN 6;  2O2O A;  1X6O A;  1VYT A;  2OI3 A;  4QVZ A;  4F7U E;  3CC2 A;  5FWB A;  2WSF E;  4F7U F;  3JAM E;  2KY9 A;  3OMG A;  4PJL A;  3SHW A;  1RAG B;  2GTO A;  4R56 A;  4X34 A;  9ATC B;  4MZM A;  2BE7 D;  2EYW A;  2JZ2 A;  2QGG A;  3EGD B;  2E65 A;  1OEB A;  2K3X A;  3FIF A;  1K0X A;  1VYU A;  4RTU A;  2R5M A;  4E7H A;  2BUD A;  2K6D A;  1VQP A;  5FRN A;  1XNI A;  3H0F A;  5CAI A;  2HSP A;  3LLR A;  3RNJ A;  3EFR A;  3A8O B;  2RO0 A;  2RM4 A;  4Z02 A;  1O9S A;  1U1T A;  2GFA A;  1N6A A;  1UGS B;  2DBK A;  2YSQ A;  2L3P A;  3H0H A;  3MEV A;  3IQL A;  3CBO A;  2ROL A;  4DQ2 A;  1LCK A;  4ZNX A;  1KHC A;  3NPF A;  4OB0 B;  1BK2 A;  2CDT A;  4BI3 A;  2LMJ A;  1VQ8 Q;  1AWJ A;  5ECA A;  4FYX B;  3JB9 D;  4M77 A;  4HCB A;  5HY6 A;  1ABQ A;  2E5K A;  2EGC A;  2RQR A;  2M02 A;  2IVW A;  3CC7 A;  1S72 T;  1YCY A;  1NE8 A;  1OV3 A;  1KC8 R;  1VQM Q;  2VWF A;  2DL7 A;  1SSH A;  2L3S A;  4WF2 A;  2LJ3 A;  2QXF A;  1HJD A;  1I07 A;  1H64 1;  2ZPH B;  3PTA A;  5CKF A;  1WXU A;  1VQ7 T;  2GFU A;  3UF4 A;  3A8M B;  5GAM g;  5IXF A;  1M90 U;  3ZBD A;  4PJJ A;  2R58 A;  4OMF B;  5FLX E;  3ASK A;  2AT1 B;  5CKB A;  1LJO A;  3JCM e;  4M77 C;  3EG2 A;  2EYZ A;  1MHN A;  3M4Y A;  3CCV A;  4MDW A;  2IIM A;  1WHJ A;  3PGG A;  4X1V A;  4ZTJ A;  1X6B A;  4LDY A;  1OYX A;  3VUB A;  3QUI A;  2DIG A;  3QZ5 B;  5LJ5 d;  1KC8 C;  3SD4 A;  2K2M A;  4OGC A;  3BW1 A;  2OTJ Q;  5DM7 R;  2ZPF B;  1NM7 A;  1WIE A;  2PUK B;  5HCK A;  1RAA B;  1YJ9 Q;  3KFV A;  1EFN A;  2KAF A;  1ZSG A;  2NUP A;  2PTK A;  2LVM A;  3TQ7 P;  4OB2 B;  4M78 F;  1YIT Q;  1H3Z A;  4K11 A;  2BZY A;  2K3B A;  1PCX A;  3CME A;  2V8I A;  3HRT A;  3L2Q A;  4QQD A;  1VQK T;  2KGT A;  1MND A;  1YP5 A;  1ZA1 B;  4LE9 A;  1R77 A;  1RAC B;  4XU3 A;  1YJW Q;  1GFD A;  1VQ4 Q;  2YT6 A;  2DEQ A;  5HK3 A;  1KC8 U;  1IZ6 A;  2DTO A;  1HXD A;  2EYX A;  4IUR A;  1JU5 C;  2NUT A;  8ATC B;  2MYS A;  3G4S A;  3I56 A;  2A7Y A;  4B6M A;  1YIJ A;  2D8H A;  2K5L A;  3H6Z A;  4JJD A;  1D0X A;  1T0H A;  3BDL A;  2ZGW A;  1M1F A;  2Y4Y A;  2F2W A;  1MV3 A; 
#chains in the Genus database with same CATH homology
 1M5Q 1;  1FWZ A;  4PNO A;  5M9O A;  4R55 A;  1B34 A;  3CCE A;  1VQK A;  2FYK A;  2E70 A;  4IUV A;  2DD5 A;  1LOJ A;  2QQB A;  4PL6 A;  4LDX A;  4TVR A;  2E1H A;  5GMK i;  5LJ3 h;  3DLM A;  5DLQ E;  1Y71 A;  2DZC A;  2MMP A;  2EJ9 A;  4CI0 C;  4MZP A;  2DXT A;  3J81 E;  3GOX A;  2LT4 A;  3JB9 J;  4ZGD B;  1BIA A;  2L8D A;  1Y96 A;  5A0D A;  3OBY A;  3PNW C;  3HFN A;  2OTL T;  2Y4X A;  3JCM f;  3L2W A;  2EYQ A;  2XDP A;  3OYN A;  2RH2 A;  3C95 A;  3PT9 A;  4L59 A;  4C0D C;  3OYH A;  1YHQ T;  3HP9 A;  5LJ3 e;  3L2U A;  3BDU A;  5GAO l;  1KG1 A;  3LWH A;  1WJQ A;  3V7S A;  3CCU T;  3LGL A;  5CQY A;  4E47 A;  3CXC A;  4KUD K;  1XQH A;  5J39 A;  3RKX A;  3HKS A;  3JRZ A;  3MCA B;  4O5V A;  4KUL A;  4M75 G;  2XD0 A;  2RK1 A;  5GAN g;  1BI0 A;  2EIF A;  3M55 A;  4QW2 A;  4XTY A;  4C0D B;  1KQ2 A;  2OTJ A;  3EAE A;  3VYH B;  2GCX A;  2XKO C;  3CBP A;  5EG2 A;  1Q86 U;  2PVD B;  3CCJ A;  3G6E A;  4FIB A;  5CQX A;  1VQ5 T;  3P8B B;  4ZN3 A;  2LC4 A;  4JLG A;  2M0O A;  3HRS A;  5CVI A;  2R57 A;  5CKD A;  5LJ5 f;  4GLK A;  3CCM T;  3MP8 A;  3G71 A;  4JUV A;  4M77 G;  3V8J A;  5C0M A;  3CC2 T;  1YBY A;  1M1K U;  3MEU A;  5GAM f;  2YLC A;  4GY5 A;  4BAC A;  2WSC E;  2EFI A;  5I2M A;  1NJI U;  3URG A;  5KH6 A;  2QEX T;  4HT8 A;  4XTU A;  3X24 B;  2FVU A;  3CME T;  4JRQ A;  1VIF A;  2DTI A;  2RI2 A;  4IUT A;  4A4H A;  5CR2 A;  1NJI C;  2VGM A;  1VQ8 T;  5GAN e;  3VU3 C;  1SSF A;  4PJO A;  1I4K 1;  2QQ9 A;  5CKE A;  3MP1 A;  2XIC A;  4DOW A;  3OYM A;  1W2B S;  1DJ7 B;  3QG1 A;  4M7D D;  4N4G A;  4C92 B;  4JLI A;  2QA4 T;  4HCC A;  4LD9 K;  1X01 A;  2O01 E;  5A0L A;  3QJY A;  3VJP A;  5LJ3 d;  3HSB A;  1VQO T;  2A3L A;  2DJZ A;  4BUG A;  1N9S A;  1UEB A;  4M7D B;  2LDM A;  2DIQ A;  4DA4 A;  3QBY A;  3L2R A;  3JCM J;  2C06 A;  4M7A G;  3ZFJ A;  1VQN A;  3QSU A;  3S6W A;  4BD3 A;  1N8R C;  3QPH A;  3CPW S;  2F69 A;  3M58 A;  4F7U A;  2LRQ A;  3VYG A;  2DVE A;  4QQG A;  3X26 B;  4C0G A;  4XK8 E;  4RCB A;  5GAO m;  2QQR A;  2VC8 A;  4JJN K;  1XOV A;  3N5B B;  3E9F A;  2FL7 A;  3DLL A;  3P8D A;  4KT0 E;  3JCM P;  5AYF A;  2D0Q B;  3MET A;  4M78 D;  1D3B A;  1BIB A;  5I2S A;  1QP3 A;  5LJ3 g;  1ZBX A;  4RMO A;  1VQ9 A;  4FL6 A;  4CRI A;  1YIT T;  3OYF A;  4HKE A;  2CS7 A;  3PMT A;  3E19 A;  1G3W A;  1I8F A;  1WJS A;  3JCM g;  1VUB A;  5GMK h;  3H8Z A;  5GMK j;  3G6E T;  4BB7 A;  2QQS A;  5A0G A;  3OYJ A;  5HKC A;  1YJN T;  3TU4 K;  2V8K A;  2XHC A;  4JRK A;  4C8Q G;  2V8J A;  1VQL A;  5GMK l;  3HPW A;  3HHT B;  2LQ8 A;  4LDU A;  3T9N A;  3CCL A;  2CGH A;  4FT4 A;  4J7I A;  5GAO n;  2VV5 A;  4BDY A;  1VQ6 T;  2JTF A;  4M75 E;  3CCQ T;  1U1S A;  4ZTF A;  2XID A;  3RMS A;  3I55 A;  2JTM A;  1G3T A;  2LQK A;  3L42 A;  4HA8 A;  4EMK B;  4XQ3 A;  5LJ3 f;  2GF7 A;  5DY9 A;  2EJF A;  2L3R A;  2QA4 A;  3CMA T;  3KUF A;  3L2V A;  1VQ7 A;  1BI1 A;  4JRP A;  2E10 A;  1NZ9 A;  2PVG B;  3V8L A;  5GMK e;  3GPL A;  4VUB A;  2RD1 A;  5LL6 S;  4C5E A;  4EMK C;  4M7D F;  2GQV A;  1YI2 T;  2LNV A;  2X4J A;  2HQE A;  3SWN B;  4MML A;  4N4I A;  3TRE A;  2OAU A;  1M1G A;  2QEX A;  3BY7 A;  2L5Q A;  3LGF A;  4ELZ C;  5LJ5 e;  3LH0 A;  1Q81 U;  2K5I A;  2KVQ G;  2RB6 A;  3NFC A;  5GAM d;  1VQ6 A;  3L1A A;  2MWP A;  4Q5W A;  3FC3 A;  1VQ4 T;  4E7I A;  4IUQ A;  4XTV A;  3OQ5 A;  2EWN A;  4B9X A;  1VQL T;  2YHT A;  2ZPE B;  3GLX A;  1UB4 A;  1WQW A;  4PLI A;  4M7A C;  4M7D A;  2HAX A;  2LCC A;  1BYM A;  2PU9 B;  2DPP B;  4C8Q D;  3WXM B;  2ZZD A;  4PLL A;  1VQP T;  3OYK A;  3SWN A;  2KK4 A;  3ZEH A;  1KQ1 A;  4V2S A;  5CK9 A;  2DD4 A;  5FRM A;  4J6Y A;  4UC4 A;  1BI3 A;  3TEE A;  3RIR A;  3BFM A;  4OP0 A;  1Y07 A;  1BKB A;  4XTX A;  3VUZ A;  3NTH A;  4M77 E;  4EMG A;  2DAQ A;  3QDR B;  3I56 T;  4IUU A;  2DO3 A;  4E7K A;  2LCL A;  4DOV A;  1PSE A;  1PSF A;  4II1 A;  3PIP A;  1P92 A;  1K8A U;  1QVP A;  2P0P A;  3GNG A;  4C5G A;  4EMK A;  2F5T X;  3JCM d;  2PQW A;  4BE2 A;  3S3M A;  2E5Q A;  3CC4 T;  2WSE E;  2EQK A;  2P4T A;  3FLG A;  1MGQ A;  4KUI A;  1YJ9 A;  3VV0 A;  1K9M U;  2RJD A;  4X9D A;  1JJ2 A;  1QW1 A;  2E64 A;  2HNI A;  3CBM A;  4C8Q C;  5IT9 E;  4C8Q E;  3FJP A;  2FHD A;  4C92 C;  2LT1 A;  3SDZ A;  3OB9 A;  1Q7Y C;  1HK9 A;  5IAY A;  2CZ6 B;  2VYT A;  2QQA A;  3HRU A;  4J5Y A;  5GAM e;  4NS5 A;  3KXT A;  4OF1 A;  4NL3 A;  3PIO A;  3CCL T;  4XTW A;  4LDW A;  3P8H A;  4PJO F;  4YTL A;  3RES A;  1Q81 C;  2K2V A;  4O6J A;  2XG8 D;  3SB2 A;  1YI2 A;  3CPF A;  3RKW A;  3C4S A;  4A53 A;  2E12 A;  4XU1 A;  3UWN A;  2RA2 A;  3OA6 A;  3OYA A;  1Y7X A;  2X4W A;  5L8R E;  3JCM h;  3JCM X;  5GAN f;  3X28 B;  5LJ3 j;  2EAY A;  3UT1 A;  3M4G A;  3CEY A;  2CZ1 B;  1BI2 A;  4F7U B;  1I5L A;  5GAO r;  4IKF A;  3OW2 S;  4M7A E;  2KQW A;  3CXC S;  1R8O B;  2L89 A;  2VGN A;  3OYG A;  3OYC A;  3JCM Q;  5GAM h;  4MMK A;  5J3B A;  1AHJ B;  2I2L A;  1QP2 A;  3SFM A;  4EDU A;  5GAM j;  1NPP A;  1ZHI A;  2DXC A;  2HQX A;  2XK0 A;  4L6V 5;  3OYD A;  2EQJ A;  2OTJ T;  1GXI E;  4C92 G;  4A54 A;  4E7L A;  4M78 E;  4C92 A;  3CD6 T;  5KCO A;  4C0F A;  4Y28 E;  3GIB A;  5FU7 B;  3UDC A;  1G3Y A;  2RJE A;  2R5A A;  3Q1J A;  4ME7 A;  4RKU E;  1VQO A;  3OS5 A;  4C5I A;  4QQ6 A;  3CPW A;  2FB7 A;  4FM4 B;  1Q82 U;  3M53 A;  4PJO B;  1VQ4 A;  2VXF A;  3OS0 A;  3LYI A;  2EKO A;  2F5K A;  2K5F A;  2AHJ B;  1WPY A;  4QVC A;  2MWO A;  1M90 C;  4M78 B;  3QYH B;  3MEA A;  3INZ A;  5KCH A;  5GAN d;  3CCS A;  3RER A;  1N9R A;  4J7F A;  3JB9 H;  1OI1 A;  2M1H A;  1M9S A;  4HT9 A;  3GF5 A;  2CYZ B;  2QTX A;  3M9Q A;  1KQS S;  5KE3 A;  2HBP A;  3M56 A;  3QHS A;  1WQ7 A;  5GAN 6;  2M9U A;  5CKH A;  3C12 A;  3CCR T;  1X6O A;  2EQU A;  4LDV A;  2YRV A;  3JCM V;  1N8R U;  2KMT A;  3CMA A;  1OZ2 A;  2VXE A;  4N0A C;  4QVZ A;  4F7U E;  1WGS A;  3FB9 A;  2JN0 A;  1FX7 A;  3OYL A;  3CC2 A;  3CCM A;  4ZGJ B;  5LJ5 g;  2ZPI B;  4PJO D;  2YLB A;  4LD6 A;  4E7J A;  2MI6 A;  3DB4 A;  2RJC A;  3DKM A;  2O4X B;  3OBW A;  2WSF E;  4F7U F;  3JAM E;  2KY9 A;  1I81 A;  3CD6 A;  3OMG A;  1QVF A;  3PMI A;  4R56 A;  4X9C A;  4X34 A;  4A4F A;  4C92 D;  1JB0 E;  4D6W A;  5GAN h;  3FEO A;  4MZM A;  3X20 B;  1KD1 U;  2RK2 A;  5LJ5 h;  2WAC A;  1XTD A;  4EMH A;  2K57 A;  2JZ2 A;  3GNF B;  1X75 C;  2K3Y A;  3JB9 F;  2XDB A;  2E65 A;  2K3X A;  1UGP B;  4C92 F;  3FIF A;  3OSV A;  4M75 F;  4JS5 A;  4C8Q F;  4B9W A;  2OTL A;  3G71 T;  2DKG A;  2R5M A;  1IRE B;  4E7H A;  3C94 A;  2BUD A;  3HFO A;  3JCM W;  1G3S A;  3L2Z A;  2ZPG B;  2H3J A;  4MZT A;  1VQP A;  5FRN A;  3KBG A;  1S72 A;  1XNI A;  5C6S A;  3MO8 A;  5CAI A;  3LLR A;  4M7D C;  2BIV A;  3EFR A;  3A8O B;  1Q82 C;  4OB1 B;  2RO0 A;  2RM4 A;  2E41 A;  4Z02 A;  4QVD A;  1O9S A;  3RMQ A;  1U1T A;  3S3N A;  2GFA A;  3S3O A;  1N6A A;  4ZGE B;  1UGS B;  2XI9 A;  3OS1 A;  3RKY A;  3E1S A;  1ZQ1 A;  1EIF A;  3MP6 A;  4BI4 A;  3MEV A;  5I21 A;  4ATO A;  3M54 A;  3CBO A;  2EQM A;  3LWI A;  4M7A F;  3OYE A;  5GAN 5;  4N4H A;  1YJW A;  5D6W A;  4P5N A;  2RHI A;  4DQ2 A;  1YJ9 T;  3CC4 A;  2XU8 A;  2RHY A;  1D3B B;  1JRI A;  4FT2 A;  2DXU A;  4JDS A;  4M78 C;  1QVG A;  1QVG S;  2Y90 A;  2CZ0 B;  2G3R A;  3SWN C;  1KHC A;  4OB0 B;  1JJ2 S;  4PJO E;  2ZCF B;  1WNL A;  4BI3 A;  1Y96 B;  4C5H A;  3CCQ A;  1YJW T;  3G4S T;  3JB9 D;  1KD1 C;  2JUF A;  4M77 A;  2JNG A;  3HL8 A;  1VQ8 A;  4HCB A;  3A8L B;  5HY6 A;  3QZ9 B;  1LNX A;  3GP8 A;  2XDD A;  4ELY C;  4BE0 A;  4XU0 A;  1RL2 A;  1B34 B;  4HCZ A;  5CCA A;  1K9M C;  5DLO A;  4RG2 A;  4M75 B;  5J26 A;  2IVW A;  3CC7 A;  3JB9 G;  1S72 T;  1YCY A;  1NE8 A;  1M8V A;  1JBM A;  3J80 E;  3WVD B;  2DZ9 A;  3OW2 A;  3A8H B;  2JOY A;  4WF2 A;  2QXF A;  5D6X A;  2DTH A;  2VUB A;  3V8K A;  1G5V A;  2RHX A;  4JRI A;  3M5A A;  2MF2 A;  3V7R A;  4FU6 A;  3QO3 A;  2RHU A;  1H64 1;  2ZPH B;  3PTA A;  5CKF A;  3QII A;  1Q7Y U;  1VQ7 T;  2GFU A;  3LW5 E;  3O8V A;  4PKC C;  1TH7 A;  3A8M B;  5GAM g;  1M90 U;  3ZBD A;  4IUP A;  4A4E A;  2R58 A;  3I55 T;  4OMF B;  5FLX E;  2RHZ A;  3NTK A;  3ASK A;  4RCC A;  4M7A D;  3OMC A;  5CKB A;  1K73 U;  1LJO A;  1N27 A;  3JCM e;  3LX7 A;  5GAN 3;  4M75 A;  3CCE T;  5GAN 2;  4M77 C;  2M16 A;  2BKD N;  3JCM c;  1MHN A;  5GAN 7;  3M4Y A;  5GAN j;  3CCV A;  3X25 B;  4MDW A;  3JSC A;  2LTO A;  1YJN A;  1KHI A;  1NPR A;  3PGG A;  5FU6 C;  4BY6 B;  4ZTJ A;  1YIT A;  3CCR A;  4M77 B;  1VQ9 T;  4LDY A;  5GMK m;  4F7U G;  1OYX A;  1QVF S;  3M59 A;  3VUB A;  4A4G A;  4M78 G;  3QUI A;  2DIG A;  3QZ5 B;  1M4Z A;  2KDS A;  3ME9 A;  5LJ5 d;  5KE2 A;  4NL2 A;  3AHU A;  1KC8 C;  3SD4 A;  4OGC A;  2RJF A;  3JCM b;  3CCJ T;  3BW1 A;  4KBM B;  4M77 D;  2RI5 A;  3QYG B;  4BDZ A;  3F70 A;  2QI2 A;  2DK3 A;  5DM7 R;  1VQN T;  4J8O A;  2DXB A;  2ZPF B;  3MEW A;  1K8A C;  3NTI A;  3OYY A;  3CCU A;  2PUK B;  4C8Q A;  3QJ6 A;  4XAX B;  1VQM T;  2X35 A;  2P0Q A;  2KAF A;  2LVM A;  4OB2 B;  4PJO C;  4OGE A;  4M78 F;  2B8A A;  4M77 F;  4JS4 A;  4OB3 B;  1H3Z A;  4Y91 A;  3G7Z A;  1KQS A;  3M57 A;  1VIE A;  2K4Y A;  4J83 A;  5CIU A;  4J6X A;  3R6O A;  5HK0 A;  3CME A;  2HD0 A;  2RI3 A;  2P0K A;  5D6Y A;  2V8I A;  3FRN A;  3HRT A;  5A2Q E;  2PVO B;  5FU7 C;  5GAN 4;  3L2Q A;  2X4X A;  4OVA A;  4M7A A;  4QQD A;  1VQK T;  1WJR A;  3WVE B;  3CCV T;  3UPU A;  3TCJ A;  2KSS A;  5IN1 A;  3CCS T;  1U8R A;  3EFS A;  4XU3 A;  4EPC A;  3OY9 A;  1VQ5 A;  4L5G A;  5GAN 8;  3CC7 T;  3VKI A;  3J7A F;  4A4K A;  2PUO B;  2D6F A;  3QXE B;  2NLU A;  2DEQ A;  1FXX A;  5HK3 A;  4M7D G;  1VQM A;  2E6Z A;  1KC8 U;  4BI8 B;  4ZN1 A;  5LJ5 j;  4M7A B;  1O75 A;  1IZ6 A;  3OSS C;  4M75 C;  2MAM A;  4PJO G;  1V29 B;  2DTO A;  4J6W A;  3V7C A;  2O4X A;  1W4S A;  3JB9 I;  1YIJ T;  2ZPB B;  1YHQ A;  3PFS A;  4C92 E;  4FSX A;  4C0Z A;  2D9T A;  3FDR A;  1RI0 A;  1HXD A;  2QDY B;  4BE1 A;  4IUR A;  3E9G A;  3A8G B;  5FU6 B;  1UGR B;  2IG0 A;  2JVV A;  4BY6 C;  3RUX A;  3G4S A;  5CO7 A;  3I56 A;  2A7Y A;  2CKK A;  1K73 C;  2E6N A;  1M1K C;  1YIJ A;  3A5Z B;  4MDX A;  1OZ3 A;  4M7D E;  2K5L A;  4XTZ A;  2X4Y A;  3H6Z A;  3OS2 A;  3QKJ A;  2LX9 A;  5FRO A;  5GAO p;  3BDL A;  2ZGW A;  4RG8 A;  5GAO q;  1W2B A;  1M1F A;  2Y4Y A;  2EJG A;  1UGQ B;  3MHX A;  3OYI A;  4M75 D;  1Q86 C;  3DB3 A;  4NOY A;  4XU2 A;  3OYB A;  4C8Q B;  4M78 A;  2CZ7 B;  4N0A A;  3ER0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...