3NFCA

Crystal structure of e.coli mazf toxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
94
Chain Sequence
b'YVPDMGDLIWVDFDHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PemK-like protein 1
molecule tags Toxin
source organism Escherichia coli
publication title Biochemical and Structural Analysis of E. coli MazF Toxin
rcsb
total genus 24
structure length 94
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nfcA00
5CO7A 3JRZA 4ELZC 5CKBA 2KMTA 1VUBA 3TCJA 5CCAA 5CKDA 3JSCA 4HKEA 2MF2A 5DLOA 3VUBA 4OF1A 5HK3A 5CKEA 1NE8A 5CKHA 5CR2A 3HPWA 4MZTA 5HKCA 5CQXA 4MZMA 1X75C 5CKFA 4MZPA 4VUBA 3G7ZA 5CK9A 2VUBA 4ME7A 5HK0A 4ELYC 4MDXA 1UB4A 2C06A 5CQYA 3NFCA 1M1FA
chains in the Genus database with same CATH superfamily
1VQPT 1ZUUA 4QW2A 3THKA 4C0DC 4ZGJB 3PGGA 4ZN1A 3JSCA 1YFNA 3RIRA 1YITT 4RTVA 1JJ2P 1SRLA 3E9FA 2EGCA 3RESA 4LDVA 2LZ6B 2K2VA 2LX7A 3GF5A 4BUGA 5GMKl 5LJ3f 9ATCB 2CDTA 4J9DA 2D6FA 4RTYA 2QI2A 2KVQG 4F17A 1OPLA 3X26B 4C8QB 1EX4A 2AZSA 2EJ9A 1TU0B 1UGSB 5IAYA 2ZGWA 3SWNB 3CCEQ 2V8IA 4J8OA 3REAB 1QCNA 3NTHA 2CT3A 5CK9A 3CPFA 2J05A 2DETA 1KIKA 2GF7A 4IUQA 1VIEA 3QKJA 4D8KA 1VQOA 3I56Q 2JM8A 1PKSA 3CCRT 1KQ1A 3S6WA 2VVKA 3L2UA 2LQWA 1WHKA 2DYBA 3TU4K 3CCLT 3JCMd 3CEYA 2YRCA 1ZBJA 1PKTA 2LCSA 2WSCE 1XQHA 2D1XA 1K1ZA 5GAOp 3GPLA 1NJIU 1FMWA 4GLKA 2YUQA 2MK5A 3LGLA 2EIFA 3PVLA 3HRUA 4OMFB 2E6NA 3A8OB 4OB2B 1WYXA 1KK7A 4NS5A 2XICA 5LJ3e 1WJSA 1FX7A 1WX6A 4XU2A 5A0DA 3C95A 2J6KA 3OYHA 4IIOA 3AT1B 2G3RA 2LJ0A 4M78E 3OYKA 4N4GA 2ESWA 1T0JA 4N0AA 3QPHA 5D7UA 1SKUB 2ENMA 3QZ9B 1LVKA 1VYTA 1I81A 3UWNA 2O31A 5LJ3h 2HKNA 2PVGB 2O4XA 2ZCFB 4C0FA 3L42A 1JXOA 1PHTA 2XDBA 1KQ2A 2RJFA 3EG0A 4PJLA 5GAN7 4IUTA 4ELZC 4M75B 4DEXA 1IGQA 3RUXA 2FO0A 3OYEA 4HT9A 4FU6A 1GRIA 4PLIA 4A4HA 1U06A 1XOVA 3OQ5A 2RNAA 4M7AD 4M75A 1I1JA 4O5VA 1TH7A 3KXTA 4GY5A 5D6XA 2ZPFB 1TTHB 1Y0MA 3UDCA 5LJ5f 4M77D 2K7AA 2EVRA 5A0LA 3OSSC 4JS5A 2KMTA 3Q1JA 4FIBA 2G6FX 1NZ9A 2DD5A 1RI9A 2F5TX 2KYMA 1VQ6A 2JS2A 4QVDA 3CCMA 2PQWA 1M2OA 1VYVA 1E6GA 4B9WA 1KD1R 3M0PA 3BDUA 2RHXA 3N5BB 2M16A 2FPDA 4JZ4A 1K0XA 1B7TA 1JBMA 4EMHA 1VQKA 3BFMA 3NTIA 1K0SA 4LDYA 4J6YA 4M77A 5I2MA 1TOVA 2K5FA 1W2BP 2FHDA 2E3HA 1QVGP 2RK2A 3CPWP 3OBYA 2KT8A 2QQBA 3KBGA 1PSEA 2V1RA 3RMQA 3FLGA 3QXEB 4BB7A 1VYUA 3AHUA 2XIDA 1ZA1B 4AFUC 2O9SA 3M55A 2YRDA 1KQSA 2EGAA 5DLOA 2GFAA 1ZA2B 1BI1A 3CC7Q 4PK4A 2O9VA 3QO3A 1M8VA 4ZTJA 3T9NA 5FU7B 1PNJA 4WTOB 1K8AC 2KEAA 2DYIA 3X24B 4M78A 2J06A 4FYXB 1NJIC 1UUEA 5FW9A 5KCOA 2GQVA 2JTMA 3H0IA 5GANe 5GAN6 4FT2A 2WSFE 2EYQA 2WACA 3FIFA 3QHSA 4J5YA 3JCMf 4OB3B 2QYZA 1N8RC 1MNEA 5GANg 1YIJT 1NM7A 3C12A 2CZ6B 4DBRA 4UC4A 2VASA 2SEMA 2K9GA 4E47A 2O88A 2BTTA 3CCUT 4HKEA 2COWA 3UF4A 1Q82U 1N8RR 1WXUA 4II1A 2JZ2A 5GANh 4Y92A 3VS5A 4PJNA 2FEIA 2JMAA 1WLPB 3OMGA 3CC2T 2GBQA 4KGXB 4C8QG 3MEAA 4J9HA 5LJ5d 2XU8A 3U23A 1T3LA 1KD1C 2JM9A 4JLIA 2AHJB 1M3AA 2MMPA 2VXFA 1R0BG 3NPFA 4GBQA 1ZQ1A 4C92F 4E6RA 2HBPA 1RLQC 1X6OA 1FWZA 4LNPA 3CMAQ 1CKAA 1KJWA 4PJJA 1YJ9Q 2IVWA 5LJ5g 4OMMA 3CC7T 4A4EA 1YJWQ 1DJ7B 2DVJA 2QDLA 1QVFA 4PJMA 5L8RE 1ZUYA 4EDUA 1VQ9A 2DIGA 1QP3A 4RMOA 1VQ5A 4E7JA 2CP2A 2E5QA 2BUDA 1GBRA 3V7RA 4M77G 5D6WA 1WPYA 1YI2Q 3PTAA 2YT6A 4E7LA 4XTUA 1JRIA 2QQ9A 1GXIE 4BY6B 2X4YA 2X51A 3A98A 4A4FA 3VS6A 1Q86R 4JRPA 4A54A 1BYMA 3META 5CCAA 3OYFA 1HSQA 3VS3A 2IIMA 2M1HA 4PFOA 4PFZA 1KQSP 3MEWA 3L2WA 1U3OA 2R5AA 1Y7XA 1U1SA 2DJZA 4RG8A 1LPLA 2V8JA 1NJIR 1S72A 5GAOr 2FPEA 4M75D 1VUBA 5KYUA 3CMAA 1MMGA 1S72Q 4N4IA 3QDRB 3QJ6A 5GAN4 2XD0A 3S3MA 2JXBA 4XTZA 2DFUA 3EG2A 2A08A 2DK3A 4PJOC 1M5Q1 3A8HB 1GL5A 4QVZA 5FLXE 4M7AA 1YJ9A 2VUBA 2SRCA 1KC8U 2DNUA 1WFWA 3V8LA 2VGMA 2DMOA 2LX9A 2P0KA 2VB6A 1PC0A 3E19A 3EGXB 2P0PA 1OEBA 2HQXA 3OMCA 1Y57A 4C92E 1KC8R 2PUOB 2KRSA 4FW1A 3QUIA 1ZUKA 3A8MB 2GFUA 3EFOA 3ZBDA 2O2OA 2Y90A 4RTUA 3JB9J 1ZHIA 3HP9A 4D8DA 1WHMA 1OPKA 3TQ7P 1R77A 2EQIA 4BY6C 3I5SA 1YWOA 4OF1A 4XQ3A 2OTLA 3DLLA 2O01E 1BIAA 3HFNA 2KROA 5CKFA 2FRYA 2LDMA 4HCBA 2OJ2A 4C8QC 4OMLA 1YI2T 1HK9A 1AHJB 2V8KA 1SEMA 4PJOE 3LLRA 3CCLA 4M7DG 1WHJA 2MF2A 7AT1B 1P92A 1TUDA 3REBB 5L23A 3MHXA 4C5HA 1A0NB 3QSUA 4IIMA 1VQ4Q 2JVVA 1D1CA 4J9GA 5GJVB 2QK0A 5AT1B 2YXYA 2DL3A 2F2VA 1I5LA 3JB9D 2IPOB 2DE0X 8AT1B 3L2VA 3IQLA 4M7DE 2CP0A 1YJ9T 1IREB 3TEEA 3G71T 1Q86C 1NBEB 5FRMA 3OA6A 3FDRA 4AFSC 1G3TA 3ASKA 3GNGA 2PUKB 1Q81R 3SFMA 3PMTA 2O4XB 4E2FB 1VQ7Q 5FRNA 3H9NA 2IG0A 3G4SQ 3CC2Q 1BBZA 3INZA 2PU9B 2VKNA 4C92D 4F7UA 2DF6A 4C5EA 4AT1B 3JCMb 4MMLA 2CYZB 3ME9A 1QWFA 2CREA 5GAMd 2EYZA 1TSFA 1MMAA 5GAOl 2XI9A 1NEGA 4J9CA 1D09B 2JN0A 2LTOA 4TVRA 1D0ZA 2LC4A 1Y96A 3GBQA 2HL5C 4YTLA 1OX8A 1G3YA 4JJDA 4XTVA 3CCSQ 1AZGB 1YJNT 3E2UA 2RB6A 3WXMB 4EMGA 2HKQB 2XKOC 2EKOA 2RD1A 1D3BB 3QZ5B 2ATCB 3CBMA 4PJOD 1UE9A 2YUOA 2MAMA 2KT1A 1OYXA 4X9CA 2RHIA 2E10A 1VQ8T 2KK4A 1YCSB 2RO0A 2D0QB 1JB0E 1KFZA 3CMEQ 4M7AF 4KRTA 5IH2A 1WIEA 2OTJQ 4M78B 3S3NA 1QQJA 4PJOG 2HSPA 1RABB 2F2XA 4M78F 2LP5A 3CCLQ 3OB9A 3LWIA 4M7DB 1WHGA 2JTEA 1ZSGA 2BKDN 2KI7A 1WA7A 6AT1B 3I55T 2LT1A 4M77C 4M75C 1K76A 1G3WA 4Z8AA 5IHIA 2QA4T 2CZ1B 3ER0A 3G6ET 1QKWA 3MEUA 2RI3A 1OULA 4A53A 3JCMc 2H3JA 2LJ3A 3OY9A 4PLLA 4FYWB 1QVGA 3EFRA 1X2KA 3TCJA 2HCKA 5C0MA 1XJWB 4BE0A 5LL6S 3FC3A 2I0NA 1D0XA 2VXEA 3CCJA 3BY7A 1KSWA 1AD5A 2RQUA 2K2MA 4BI8B 2OI3A 2A3LA 3CCJQ 1VQ6Q 3PNWC 2ABLA 4GLMA 4DQ2A 1X69A 1WJRA 1UEBA 4CC4B 2DERA 3CXCA 3QDFA 1WHHA 1UDLA 3UT1A 4M77E 1BKBA 3MP1A 3RKYA 2K3BA 4EMKC 1I07A 1WNLA 5FU7C 1VQOT 4J9IA 2JT4A 1J3TA 2COYA 1ZBXA 4BE1A 4Z02A 1GFDA 2GQIA 1CKBA 2K5IA 4OP0A 2D0NA 3PMIA 1TS9A 2X3WD 3BDLA 2DBMA 3A5ZB 2QQRA 5KYXB 3JB9G 3G4ST 2CT4A 4QQ6A 2D9TA 1VQ7T 3EG3A 3CCMQ 3JV3A 3QWXX 4JUVA 1YCYA 2DL7A 3ZL7C 3RBBB 1FYNA 3C0CA 3OYCA 2NUPB 1B07A 5D6YA 2L3QA 2QA4A 2X4XA 1PM3A 2DL5A 2QGGA 1AWOA 4NL2A 3VS2A 2PVDB 5EG2A 2X4WA 4F16A 5GAMj 3HHTB 2E65A 2E70A 5J39A 1R0CB 5KYWA 3JCMe 4C0ZA 3RDVA 1M2VA 4ANJA 3M0TA 1KQSS 1YIJA 2YRVA 4DOVA 1H92A 2GCXA 1M1KU 2L3PA 2VV5A 4LDUA 3X20B 2KYBA 3I56T 4RG2A 3GP8A 1BI0A 1VQMA 2BE9B 1QVFP 5GAN3 2DAQA 3EGXA 1FXXA 1RL2A 2XDDA 1WXBA 1AWWA 4VUBA 3GNFB 2CGHA 4OB0B 4LD9K 3QWYA 1CSKA 4CC2A 5CKDA 4ZNXA 3EAEA 1U1TA 2EPDA 4A4KA 1QVPA 1NPPA 2C0OA 2X35A 2ED1A 2KNBB 3HL8A 4M75G 5FU6C 3OYIA 3MP8A 2NUZA 1KG1A 4J83A 1K9AA 1RADB 1VQ9T 3G7ZA 3I5RA 1OV3A 3GOXA 2M0OA 3JCMJ 4O6JA 2ZAEA 3QG1A 4HVWA 2XHCA 4FYVB 2XMFA 3WVDB 3LWHA 5GANj 2XDPA 5FU6B 3RMSA 3CCQT 1M8MA 3EHQA 1MUZA 5KYXA 3MCAB 2HNIA 4B6MA 2HQHA 5LJ3d 3KFVA 5GAN2 5KE3A 1K9MR 2FRWA 4LD6A 4HT8A 4HCZA 3VS4A 1Z9ZA 1M9SA 1SF9A 3S3OA 2FL7A 3OW2P 1OQKA 1M90R 4F7UF 4WF2A 4EMKA 5LJ5j 3G6EQ 2B8AA 5CAIA 3G71Q 2ZPGB 4JS4A 1UGQB 1Q81C 5GMKm 3CXCP 1ZSZC 4XTWA 1I0CA 2RN8A 3D7SB 5HCKA 1X2QA 4DBFA 2LQKA 1ACMB 1UECA 4Y91A 1VQ4T 1RAGB 1HJDA 1ZX6A 4LE9A 4JDSA 2YSQA 5LJ3g 1YI2A 5HK0A 5GAMh 2P84A 2LNVA 2RM4A 3H6ZA 1UG1A 3CPWA 3JB9I 4EMKB 2DPPB 3HKSA 3G1JA 3ZFJA 5IXBA 1D1AA 4L5GA 2CZ7B 3JCMQ 3JCMW 3PFSA 4Y28E 2E6ZA 2CS7A 8ATCB 2DRMA 3NGPA 1NEBA 1WDXA 4F7UG 2F5KA 4PJOB 4R0KA 3NHNA 3CMAT 3VJPA 1SSHA 3VKIA 1W2BS 3EH1A 1JXMA 1IXDA 2E3IA 3CPWS 1I4K1 4C5IA 4Q5WA 2ZPBB 2HZYA 4FW2A 4PJOF 2EWNA 2W0ZA 1OOTA 2RJEA 1F1BB 3OS5A 2JTFA 2YWWA 5J3BA 1M27C 4MZPA 2FZCB 2P4RA 3I55Q 1RAAB 4MDXA 2YHTA 1C0MA 3EG9A 4C8QE 3NFCA 2A0FB 2HQEA 3FJ5A 4FL6A 1Z9QA 4M7DA 1M3CA 3M0QA 4C92A 2OTJT 2LT4A 1O75A 2DRKA 2RJDA 4XK8E 1VQNQ 1YHQT 1MHNA 4HCCA 3VS1A 4M78C 4X1VA 2B86A 5DY9A 1YHQA 1JU5C 2RMOA 1UGRB 5KYYB 3DB4A 3QYGB 2RK1A 2MWPA 1OZ3A 3CC7A 1LOJA 2L2PA 4M77F 4KBMB 2DL4A 2DLPA 2EFIA 3HRTA 3A8GB 4LUDA 1O9SA 3HPWA 4KH0B 1BI2A 2DTHA 2M02A 3MP6A 1VQ9Q 2F2WA 4DBQA 1SPKA 4M77B 1NLPC 3SB2A 2EYYA 5GANd 1BI3A 3LGFA 1AOJA 4E7KA 1M1FA 4E7HA 5C6SA 4XAXB 1EZZB 3EH2A 2XG8D 2GNCA 2HEQA 1AWJA 2QDYB 4M75E 3G4SA 1E7OA 4AFQC 4BI3A 4F04B 1BU1A 1K4US 3H0FA 3CQTA 1KC8C 4J6WA 1LNXA 2L0AA 2E64A 4M7AG 2BIVA 4LXCA 3JCMP 4LN2A 4FM4B 5CKBA 1BCOA 2RA2A 4R55A 2LCCA 3RERA 3E1SA 2EQJA 4BD3A 2HDAA 1M90C 3J80E 1G83A 2ZPHB 3RNJA 4IURA 4Z88A 5GAN8 1V76A 1H3HA 3CCQA 2X9HA 1NLOC 3JCMX 3ULRB 5GMKj 4FCYA 1VQMQ 2JMCA 1U8RA 2JNGA 2BZYA 2HSEB 2DO3A 2P0QA 3VU3C 2RI5A 4BE2A 2H3EB 4QQGA 1VQPA 1YJNA 2FZGB 2CUBA 2DXUA 4KGZB 2DTOA 3SD4A 1VQ5Q 2X3XD 4C5GA 4BDZA 2CP3A 2K79A 1Q82C 2F69A 2K6DA 2MYSA 4HVVA 2AKLA 4QT7A 4KUIA 1GCQC 4RCCA 1MGQA 1VQNA 4RTXA 3V7CA 2DXBA 4JJNK 1N8RU 5KYYA 3CD6Q 3CC4T 2L3RA 2JW4A 5GJWB 2DEUA 3WVEB 5KCHA 3CCVA 4QQDA 4AG2C 1IB8A 4MDWA 3VRZA 1VQ8Q 1QP2A 4HVUA 2AZVA 4CC7A 3UA7A 1W1FA 2MIOA 2GTJA 1K9MC 1YBYA 1WQ7A 4DBHA 2L3SA 2GTOA 3OW2A 4M7AC 1VQ6T 3H41A 1U5SA 3PE0A 2M51A 1R8OB 4JJCA 1RLPC 2K3YA 3EG9B 5CIUA 2A37A 4M7DF 1QVFS 1QLYA 4KUDK 1X27A 1TXQA 4RUGA 1C1AA 4Z89A 2XK0A 3SWNA 3OYNA 2RHYA 1G2BA 4M75F 1VQPQ 1FMKA 3VUZA 3URGA 4BACA 4DEYA 1M2VB 2PTKA 5CR2A 1TUGB 3A1PA 1AT1B 4XTXA 4M7AB 2W10A 4JZ3A 3R6OA 3G71A 1D0YA 4OVAA 1YJWT 3UA6A 4RTWA 2DXTA 1VIFA 2NWMA 4JPBW 1NYFA 2DIQA 2LRQA 4E7ZA 2ZZDA 1VQ7A 1UHFA 1AEYA 1SRMA 1YITA 3M0RA 2DD4A 1LCKA 3CCVQ 3C94A 1ABQA 1X75C 4NOYA 4XTYA 2QG9B 1M1KC 4ELYC 4FSXA 5I11A 1BCMA 3PIOA 1QKXA 3CC2A 5GAOn 3HFOA 1N27A 1T3SA 1OU9A 2RQRA 1WHLA 2NUTA 5LJ5e 2FPFA 1SG5A 2QGFB 4F7UB 2EAYA 4N0AC 2NUTB 2CH4W 3QBYA 2KBTA 1M1KR 2QXFA 3TREA 1Q7YR 4BDYA 3TVTA 3M54A 3M59A 1Q86U 1UB4A 2DL8A 1OX9A 5CO7A 2KXCA 2YDLA 1VQKQ 1WQWA 1VQ4A 4OMOA 2Z0WA 4J9EA 5HK3A 3E9GA 2KGTA 1WI7A 3O8VA 1IO6A 3CBOA 5DLQE 1W70A 1MV0B 4QVCA 2JUFA 3V8KA 2R5MA 3M57A 1VQ8A 3CXCS 2Y4YA 3UATA 1VOMA 1IHWA 5GAOq 1ZSZA 2C06A 4K11A 3I9QA 4ZGEB 2DILA 3CMEA 2LCLA 1NYGA 3M9QA 1BB9A 5A2QE 4IUVA 4RTTA 1MMNA 2COZA 2DA9A 2L5QA 3DB3A 1QCOA 2LMJA 1ZLMA 3JCMg 1YWPA 1K9MU 1K73R 3TSZA 5DM7R 2R58A 2DJQA 4AMCA 3SDZA 1PRMC 1VQLT 3EGUA 2LVMA 1UFFA 3FJPA 2QTXA 1IRXA 3O5ZA 1YIJQ 5KE2A 2CH4A 1TG0A 4XU3A 3RKWA 5CKEA 4AFZC 1M4ZA 1TUCA 3OYBA 3V8JA 2A36A 2C0IA 4NL3A 1GCQA 3LYIA 2K57A 4KH1B 1RAHB 2E4HA 5M9OA 3J81E 3CCRQ 1S72T 1UHCA 2E1HA 1YP5A 2NYSA 2GGRA 1OU8A 3FEOA 2KXDA 3M4YA 1B34A 3OYDA 4A63B 2DBKA 2ZPIB 2QTVA 2PVOB 2RHUA 3PVQA 4C0GA 3QYHB 2FG0A 1QWEA 1NG2A 2PNIA 3VV0A 4M4ZA 1X6BA 3P8HA 1UGPB 3OYMA 4OMPA 2DTIA 1N6AA 1OZ2A 1IGUA 2KDSA 1IHVA 4LUEA 2DZCA 2M9UA 1Q82R 3EG1A 1X01A 2HL3A 5GAMf 4J7IA 2ROLA 2KSSA 1VQOQ 1AWXA 1NE8A 1HD3A 2QQSA 3HTRA 3R6NA 4KT0E 1RAEB 1YITQ 2H8HA 1N9SA 2LQNA 1VQLA 2BE7D 3VYHB 3LH5A 3A8LB 1QMCA 2KQWA 3JCMV 2KE9A 2LQ8A 2A7YA 3M58A 2DKGA 3BW1A 3OSVA 3QIIA 4M78D 5CKHA 3L2RA 1VQ5T 1HYOA 1YN8A 3X25B 4D6WA 4ATOA 3BE3A 1RAIB 3PIPA 4FT4A 3ZEHA 3FRNA 3TSWA 4M7DD 1W6XA 3GIBA 2J7IA 3DKMA 2RH2A 2PZ1A 3P8BB 3CCUA 2QA4Q 2EYWA 2FB7A 2FYKA 5HKCA 3OYJA 1G3SA 5CQXA 2CSQA 3M53A 3CCVT 4P5NA 4ESRA 1JJ2S 4MMKA 5IHKA 3FB9A 2QEXT 1B3QA 3OYAA 1KD1U 1K8AR 2FZKB 1M3BA 4J6XA 3OS2A 4RKUE 2EW3A 3EFOB 3V7SA 1Q7YU 2VGNA 3M4GA 3SWNC 3CCRA 2LJ1A 3CMET 2HD0A 3VRYA 3SHWA 4MZMA 2KRMA 4ME7A 2Y4XA 2DXCA 3MPUB 4A4GA 1VQKT 5GAN5 5I22A 5IHNA 4L6V5 2OAUA 2HAXA 3EGDB 2JJ9A 2R57A 3NTKA 5GAMg 4X9DA 2CP7A 2RQTA 4BI4A 2K4YA 5CVIA 1SHGA 3J7AF 4JRIA 1IZ6A 1N9RA 5HY6A 2QAZA 2OX7A 3G6EA 1K8AU 1UTIA 3M56A 2OTLT 1UJ0A 4EIKA 1WXTA 1M1GA 1RUWA 4E7IA 4ZGDB 4WCIA 2DEQA 5LJ5h 2EKHA 1JEGA 2AK5A 2BZ8A 4HCKA 1GBQA 2ROTA 2EJFA 1MMDA 2E5KA 4OGCA 2ZPEB 4PKCC 3VYGA 1D3BA 2QEXQ 2X4JA 5KYWB 4AG1C 1MNDA 1PD0A 1H8KA 2EQMA 1JQQA 2D8JA 3JCMh 5KYUB 2EJGA 3CCEA 4HA8A 1YJWA 2MCNA 1Q95G 2AIRB 2JOYA 3L1AA 2KAFA 5AYFA 2EQKA 2CP5A 4C8QA 3VS0A 4OB1B 1RAFB 4N4HA 2OTJA 4KGVB 3CCUQ 2AKKA 2KRNA 2CSIA 2EYXA 3F70A 4JLGA 1K73U 1I5OB 1XNIA 4JRQA 3MO8A 5KYNA 1WJQA 3GLXA 1LJOA 3OYYA 2RPNA 4DOWA 1Y07A 2HMAA 1MV3A 4X34A 3RKXA 3CC4A 3OW2S 2CKKA 4PNOA 1C6VX 4C92C 4RCBA 4C8QD 1W4SA 1YJNQ 3CCST 3CC4Q 1D1BA 2RHZA 4IUPA 5J26A 1KHIA 1WZOA 2QASA 2NLUA 1RI0A 4PL6A 4R56A 2RQWA 4M78G 2CUDA 4EPCA 1GFCA 1M30A 5FROA 4IKFA 2YUNA 1YNZA 3I35A 1BIBA 1SSFA 2K5LA 3EFSA 3H8ZA 2ECZA 5IXFA 3I55A 3NMZC 4ORZA 2L89A 2VWFA 3LX7A 1GCPA 2RQVA 3LH0A 3M0UA 2J6FA 1H641 2ED0A 2QEXA 1QVGS 4LDXA 3OYLA 1PD1A 5I21A 3QJYA 5GMKh 4XU1A 4DA4A 4JRKA 4C0DB 1JO8A 5CQYA 4B9XA 2YLCA 1PG5B 4PFPA 2C0TA 5FWBA 4JJBA 4L59A 2MOXA 2DZ9A 2KY9A 3X28B 4V2SA 4FSSA 4J9BA 1PWTA 4CRIA 2E12A 3M5AA 2K3XA 2HBWA 2DM1A 4E7SA 2L8DA 3MKDA 1HXDA 3KUFA 1YHQQ 5ECAA 3CCQQ 2E41A 3OYGA 2EBPA 2MPXC 1SHFA 5FWCA 3M0SA 5GANf 4HXJA 3EHRA 2KR3A 3SEMA 2V26A 4LDWA 4OGEA 3DLMA 2RI2A 3PT9A 2CP6A 4IUUA 1FMVA 3VUBA 4ZN3A 1PCXA 3CCMT 1EFNA 1H3ZA 5LJ3j 2QQAA 1B34B 1X43A 2VYTA 1PSFA 5EC7A 1I8FA 2OTLQ 5GMKe 4C92B 1UJYA 1K73C 2EQUA 3RR6A 1E6HA 1ABOA 5IN1A 2BZXA 3LW5E 5KH6A 4M7DC 2DX1A 1OI1A 5I2SA 1QW1A 3CCJT 1Q81U 3JB9F 3HSBA 3CCSA 4RTZA 1V29B 3P8DA 3CBPA 2NUPA 1NPRA 1Y96B 3CD6T 2CZ0B 2AT1B 3VS7A 2OAWA 2JS0A 3OBWA 4XU0A 1X6GA 1VQNT 3C4SA 1KHCA 3JB9H 2P4TA 4MZTA 1UGVA 2D8HA 1Q7YC 4PJOA 1RACB 1PRLC 1T0HA 2F1LA 2MWOA 4KULA 4C8QF 3H0HA 1ZSZB 2VC8A 5GAMe 3L2QA 3CD6A 3MEVA 3OS1A 1M90U 1BK2A 1WGSA 2M0YA 3HRSA 2YUPA 3EGDA 4M7AE 4OMNA 1VQLQ 4F7UE 1VQMT 5A0GA 1S1NA 1G8XA 1N5ZA 2MI6A 4OMQA 2RJCA 2V1QA 1AZEA 4J7FA 3UPUA 3JAME 2WSEE 3OS0A 4CI0C 2A28A 5IT9E 1EIFA 4CC3A 3JRZA 1XTDA 2EGEA 4F14A 1ARKA 1QCFA 4ZTFA 1V1CA 2I2LA 4FYYB 5GMKi 3L2ZA 3I56A 3MJXA 1VA7A 5GAOm 4C92G 1Y71A 1JJ2A 4QKUA 2J6OA 2RF0A 2LNHB 1G5VA 1TWBA 1W2BA 4J9FA 2YLBA 3CCET 2FVUA 1AVZC 2DVEA
chains in the Genus database with same CATH topology
2DPPB 3HKSA 1VQPT 4QW2A 3ZFJA 4C0DC 4ZGJB 1X01A 3PGGA 4ZN1A 4L5GA 2CZ7B 3JCMQ 3JSCA 3JCMW 3PFSA 3RIRA 4Y28E 4BY6C 5GAMf 1YITT 2E6ZA 4J7IA 4OF1A 2CS7A 4XQ3A 2KSSA 2OTLA 1NE8A 3DLLA 3E9FA 2QQSA 2F5KA 3RESA 4F7UG 4PJOB 2O01E 1BIAA 3HFNA 3CMAT 4KT0E 3VJPA 4LDVA 2K2VA 3GF5A 5CKFA 3VKIA 4BUGA 2LDMA 1W2BS 4HCBA 4C8QC 1N9SA 5GMKl 5LJ3f 1YI2T 3CPWS 1HK9A 1I4K1 1AHJB 4C5IA 1VQLA 2D6FA 2QI2A 2V8KA 4Q5WA 2ZPBB 3VYHB 4PJOE 3A8LB 2KVQG 3LLRA 3CCLA 4M7DG 2KQWA 3JCMV 4C8QB 3X26B 2MF2A 2A7YA 2LQ8A 3M58A 1P92A 2DKGA 2EJ9A 1UGSB 3BW1A 5IAYA 2ZGWA 3MHXA 4C5HA 4PJOF 3OSVA 2EWNA 3QIIA 3SWNB 4M78D 2JVVA 2RJEA 5CKHA 3QSUA 3L2RA 2V8IA 1VQ5T 3X25B 4D6WA 4ATOA 4J8OA 3OS5A 2JTFA 1I5LA 3JB9D 3NTHA 5J3BA 4MZPA 5CK9A 3PIPA 4FT4A 3L2VA 3ZEHA 3CPFA 4M7DE 3FRNA 4MDXA 2YHTA 1YJ9T 2GF7A 3GIBA 1IREB 4IUQA 1VIEA 4C8QE 3NFCA 4M7DD 3QKJA 3TEEA 3G71T 2HQEA 1VQOA 3DKMA 1Q86C 2RH2A 5FRMA 4FL6A 3CCRT 3OA6A 1KQ1A 3FDRA 3S6WA 4M7DA 1G3TA 3ASKA 3GNGA 2PUKB 3SFMA 3P8BB 3L2UA 3PMTA 4C92A 3CCUA 3TU4K 2OTJT 2LT4A 2O4XB 3CCLT 1O75A 5FRNA 2FB7A 2RJDA 2FYKA 3JCMd 4XK8E 3CEYA 2IG0A 5HKCA 3OYJA 1G3SA 5CQXA 1YHQT 2WSCE 3INZA 3M53A 2PU9B 3CCVT 1MHNA 1XQHA 4HCCA 4P5NA 4M78C 4C92D 1JJ2S 4MMKA 4F7UA 5GAOp 3GPLA 1NJIU 4GLKA 3FB9A 5DY9A 4C5EA 2QEXT 3OYAA 1YHQA 3JCMb 1KD1U 4MMLA 2CYZB 1UGRB 3ME9A 3DB4A 3QYGB 4J6XA 2RK1A 3LGLA 2MWPA 3OS2A 1OZ3A 4RKUE 2EIFA 3CC7A 5GAMd 1LOJA 4M77F 3HRUA 4OMFB 2E6NA 4KBMB 3A8OB 4OB2B 2EFIA 4NS5A 2XICA 3HRTA 1FX7A 1WJSA 3A8GB 4XU2A 1O9SA 3V7SA 5LJ3e 5A0DA 3C95A 5GAOl 2XI9A 3OYHA 2VGNA 3HPWA 1Q7YU 3M4GA 3SWNC 3CCRA 2JN0A 1BI2A 2DTHA 3MP6A 3CMET 2HD0A 2LTOA 4TVRA 4MZMA 2G3RA 4M77B 2LC4A 4M78E 3SB2A 4ME7A 4N4GA 3OYKA 1Y96A 2Y4XA 2DXCA 4A4GA 1VQKT 5GANd 4YTLA 1BI3A 3LGFA 5GAN5 1G3YA 4E7KA 4XTVA 1M1FA 4L6V5 4E7HA 5C6SA 2OAUA 4XAXB 1YJNT 2HAXA 2XG8D 2RB6A 4N0AA 3QPHA 3WXMB 2QDYB 2R57A 3QZ9B 4M75E 4EMGA 2XKOC 3G4SA 2EKOA 3NTKA 1I81A 2RD1A 1D3BB 3QZ5B 3UWNA 4BI3A 4X9DA 5GAMg 5LJ3h 3CBMA 2PVGB 2O4XA 2ZCFB 4C0FA 1KC8C 4PJOD 3L42A 1LNXA 4J6WA 4BI4A 2XDBA 2K4YA 2E64A 5CVIA 4M7AG 2BIVA 2MAMA 3J7AF 1KQ2A 2RJFA 4JRIA 1OYXA 5GAN7 4X9CA 2RHIA 3JCMP 2E10A 4FM4B 4IUTA 4ELZC 5CKBA 4M75B 1VQ8T 1IZ6A 1N9RA 2RA2A 5HY6A 2KK4A 3RUXA 3OYEA 3G6EA 1K8AU 2RO0A 2LCCA 3M56A 2D0QB 4R55A 3RERA 3E1SA 4HT9A 2EQJA 4BD3A 2OTLT 4FU6A 1JB0E 4A4HA 4PLIA 1M90C 3J80E 1M1GA 4M7AF 4E7IA 1XOVA 3OQ5A 4ZGDB 4M78B 4M7AD 2ZPHB 3S3NA 4IURA 4M75A 2DEQA 4O5VA 5LJ5h 1TH7A 4PJOG 3KXTA 4GY5A 5D6XA 2ZPFB 5GAN8 4M78F 3UDCA 5LJ5f 4M77D 3OB9A 5A0LA 3LWIA 4M7DB 3OSSC 3CCQA 4JS5A 2KMTA 3Q1JA 4FIBA 2EJFA 3JCMX 5GMKj 2BKDN 1U8RA 4OGCA 1NZ9A 2JNGA 2DD5A 2ZPEB 4PKCC 3I55T 2F5TX 2LT1A 1VQ6A 4M77C 3CCMA 4QVDA 2DO3A 4M75C 2PQWA 1D3BA 3VYGA 2X4JA 2P0QA 1G3WA 3VU3C 4B9WA 2CZ1B 2EQMA 2QA4T 2RI5A 3BDUA 2RHXA 3N5BB 3ER0A 3G6ET 2M16A 4BE2A 4QQGA 3MEUA 1VQPA 2RI3A 3JCMh 1YJNA 2DXUA 2EJGA 4A53A 3CCEA 3JCMc 4HA8A 2DTOA 2H3JA 3SD4A 1JBMA 1YJWA 3OY9A 4EMHA 4C5GA 1VQKA 4PLLA 1QVGA 4BDZA 2JOYA 3BFMA 3L1AA 2KAFA 3NTIA 1Q82C 4LDYA 2F69A 3EFRA 4J6YA 2EQKA 4M77A 5AYFA 5I2MA 2K5FA 3TCJA 4C8QA 4OB1B 4N4HA 2FHDA 5C0MA 2OTJA 4BE0A 5LL6S 4KUIA 2RK2A 3OBYA 2QQBA 3KBGA 1PSEA 3FC3A 2VXEA 4RCCA 3RMQA 1MGQA 3BY7A 3F70A 3FLGA 3QXEB 3V7CA 4BB7A 3CCJA 2DXBA 4JJNK 1VQNA 1N8RU 4JLGA 1K73U 3CC4T 1XNIA 2L3RA 4BI8B 4JRQA 3MO8A 1WJQA 3AHUA 3GLXA 2A3LA 2XIDA 1LJOA 3OYYA 3WVEB 4DOWA 5KCHA 3CCVA 3PNWC 4QQDA 4MDWA 1Y07A 1QP2A 4X34A 3RKXA 1WJRA 1UEBA 4DQ2A 3CC4A 3M55A 3CXCA 3OW2S 2CKKA 1KQSA 4PNOA 4C92C 4RCBA 4C8QD 1W4SA 5DLOA 2GFAA 3UT1A 4M77E 1BKBA 3CCST 3MP1A 3RKYA 4EMKC 1YBYA 1WQ7A 3OW2A 1K9MC 4M7AC 2RHZA 1BI1A 1VQ6T 3QO3A 1R8OB 1WNLA 5FU7C 1VQOT 4IUPA 5J26A 1M8VA 1KHIA 3CPWA 2NLUA 1RI0A 2K3YA 4PL6A 4R56A 1ZBXA 4ZTJA 4BE1A 4Z02A 3T9NA 5FU7B 1K8AC 4M78G 4EPCA 2K5IA 5CIUA 5FROA 4OP0A 4IKFA 4M7DF 1QVFS 4KUDK 3PMIA 4M78A 3X24B 3BDLA 1NJIC 1BIBA 3A5ZB 1SSFA 2XK0A 2GQVA 2JTMA 2K5LA 3SWNA 3EFSA 5KCOA 2RHYA 3OYNA 3H8ZA 2QQRA 4M75F 3JB9G 3G4ST 5GANe 3VUZA 4QQ6A 3URGA 5GAN6 3I55A 4BACA 2D9TA 2WSFE 4FT2A 1VQ7T 2EYQA 2WACA 5CR2A 3FIFA 3QHSA 4J5YA 2L89A 3JCMf 4XTXA 4M7AB 3LX7A 3LH0A 2QEXA 4OB3B 1QVGS 1H641 4JUVA 1YCYA 3R6OA 1N8RC 4LDXA 3G71A 5GANg 4OVAA 3OYLA 1YIJT 3C12A 1YJWT 5I21A 3QJYA 2CZ6B 5GMKh 4XU1A 2DXTA 1VIFA 4UC4A 3OYCA 4JRKA 4DA4A 4C0DB 5CQYA 4B9XA 2YLCA 2DIQA 5D6YA 2LRQA 4E47A 2QA4A 2ZZDA 4L59A 3CCUT 2X4XA 1VQ7A 2DZ9A 4HKEA 2KY9A 1Q82U 3X28B 4V2SA 4II1A 4NL2A 4CRIA 2E12A 2JZ2A 1YITA 2PVDB 3M5AA 2K3XA 2DD4A 5EG2A 5GANh 2L8DA 2X4WA 1HXDA 5GAMj 3HHTB 2E65A 2E70A 3C94A 3KUFA 3OMGA 5J39A 3CC2T 1X75C 2E41A 3JCMe 4C0ZA 3OYGA 4NOYA 4XTYA 4C8QG 3MEAA 4ELYC 5LJ5d 2XU8A 1M1KC 1KQSS 5GANf 1KD1C 4FSXA 2AHJB 4JLIA 2MMPA 2VXFA 3PIOA 1YIJA 2YRVA 4DOVA 3CC2A 2GCXA 4LDWA 4OGEA 5GAOn 3HFOA 1M1KU 1N27A 3DLMA 1ZQ1A 2VV5A 2RI2A 4C92F 4LDUA 5LJ5e 3X20B 3PT9A 4IUUA 3I56T 4RG2A 2HBPA 3VUBA 1X6OA 4ZN3A 3GP8A 1FWZA 1BI0A 4F7UB 1VQMA 2EAYA 4N0AC 3CCMT 5GAN3 1H3ZA 5LJ3j 2DAQA 2IVWA 2QQAA 1B34B 3QBYA 4A4EA 5LJ5g 1FXXA 3CC7T 2VYTA 1RL2A 2XDDA 1DJ7B 1PSFA 2QXFA 3TREA 1I8FA 4VUBA 4BDYA 5GMKe 4C92B 3M54A 5L8RE 3M59A 1K73C 1QVFA 2EQUA 1Q86U 3GNFB 1UB4A 2CGHA 4OB0B 5IN1A 4EDUA 5CO7A 2DIGA 1VQ9A 3LW5E 4LD9K 5KH6A 4M7DC 1QP3A 4RMOA 1VQ5A 5CKDA 1OI1A 1WQWA 5I2SA 4E7JA 3EAEA 1U1TA 4A4KA 1QW1A 1QVPA 3CCJT 1NPPA 1VQ4A 2E5QA 2BUDA 2X35A 3HL8A 4M75G 1Q81U 3V7RA 5HK3A 3HSBA 3JB9F 3E9GA 3CCSA 5FU6C 3O8VA 3MP8A 3OYIA 4M77G 5D6WA 1WPYA 3CBOA 5DLQE 3PTAA 1KG1A 4E7LA 4QVCA 4J83A 2JUFA 3V8KA 4XTUA 1V29B 2R5MA 3M57A 1JRIA 2QQ9A 3P8DA 3CBPA 1VQ8A 3CXCS 1VQ9T 1GXIE 4BY6B 2X4YA 3G7ZA 2Y4YA 4A4FA 1NPRA 1Y96B 5GAOq 3GOXA 3CD6T 2M0OA 2CZ0B 2C06A 3JCMJ 4O6JA 4ZGEB 4JRPA 4A54A 3CMEA 1BYMA 3META 3QG1A 2LCLA 5CCAA 3OYFA 2XHCA 3M9QA 5A2QE 3OBWA 2M1HA 4XU0A 3WVDB 3MEWA 4IUVA 1VQNT 3C4SA 3L2WA 2L5QA 3DB3A 2R5AA 1Y7XA 3LWHA 1KHCA 3JB9H 5GANj 2XDPA 3JCMg 1K9MU 2P4TA 1U1SA 5FU6B 4MZTA 2DJZA 4RG8A 3RMSA 2R58A 5DM7R 3CCQT 1Q7YC 4PJOA 2V8JA 3SDZA 1VQLT 1S72A 5GAOr 3MCAB 2HNIA 2MWOA 4KULA 4C8QF 5GAMe 3L2QA 2LVMA 2VC8A 5LJ3d 3CD6A 2DVEA 5GAN2 5KE3A 4M75D 3MEVA 3OS1A 4LD6A 1VUBA 1M90U 3CMAA 4HT8A 1WGSA 3FJPA 3HP9A 2QTXA 3HRSA 4HCZA 3QDRB 3QJ6A 4N4IA 5GAN4 3S3MA 2XD0A 4M7AE 4F7UE 5KE2A 1M9SA 4XTZA 1VQMT 5A0GA 4XU3A 3S3OA 2FL7A 3RKWA 5CKEA 2DK3A 4PJOC 1M5Q1 1M4ZA 2MI6A 3A8HB 3OYBA 3V8JA 4QVZA 4NL3A 5FLXE 4F7UF 2RJCA 4WF2A 4EMKA 5LJ5j 4M7AA 4J7FA 3LYIA 1YJ9A 3UPUA 3JAME 2K57A 2WSEE 4CI0C 2B8AA 5M9OA 2VUBA 3OS0A 1KC8U 3J81E 5IT9E 1S72T 1EIFA 2E1HA 3V8LA 5CAIA 2VGMA 2ZPGB 3JRZA 1XTDA 4JS4A 1UGQB 2LX9A 2P0KA 3FEOA 5GMKm 3E19A 1B34A 3M4YA 1Q81C 4XTWA 2P0PA 3OYDA 4ZTFA 2HQXA 2ZPIB 3OMCA 2PVOB 2RHUA 2I2LA 5GMKi 4C92E 3L2ZA 3QYHB 4C0GA 2LQKA 3I56A 5GAOm 4C92G 1Y71A 4Y91A 1JJ2A 3VV0A 1VQ4T 2PUOB 3QUIA 3P8HA 1UGPB 3OYMA 1G5VA 2DTIA 4JDSA 1N6AA 3A8MB 1YI2A 2GFUA 1OZ2A 5LJ3g 2KDSA 3ZBDA 1W2BA 5HK0A 2Y90A 2YLBA 5GAMh 2LNVA 3JB9J 2RM4A 2DZCA 3H6ZA 3CCET 1ZHIA 2FVUA 3JB9I 2M9UA 4EMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO7 A;  3JRZ A;  4ELZ C;  5CKB A;  2KMT A;  1VUB A;  3TCJ A;  5CCA A;  5CKD A;  3JSC A;  4HKE A;  2MF2 A;  5DLO A;  3VUB A;  4OF1 A;  5HK3 A;  5CKE A;  1NE8 A;  5CKH A;  5CR2 A;  3HPW A;  4MZT A;  5HKC A;  5CQX A;  4MZM A;  1X75 C;  5CKF A;  4MZP A;  4VUB A;  3G7Z A;  5CK9 A;  2VUB A;  4ME7 A;  5HK0 A;  4ELY C;  4MDX A;  1UB4 A;  2C06 A;  5CQY A;  3NFC A;  1M1F A; 
#chains in the Genus database with same CATH topology
 1VQP T;  1ZUU A;  4QW2 A;  3THK A;  4C0D C;  4ZGJ B;  3PGG A;  4ZN1 A;  3JSC A;  1YFN A;  3RIR A;  1YIT T;  4RTV A;  1JJ2 P;  1SRL A;  3E9F A;  2EGC A;  3RES A;  4LDV A;  2LZ6 B;  2K2V A;  2LX7 A;  3GF5 A;  4BUG A;  5GMK l;  5LJ3 f;  9ATC B;  2CDT A;  4J9D A;  2D6F A;  4RTY A;  2QI2 A;  2KVQ G;  4F17 A;  1OPL A;  3X26 B;  4C8Q B;  1EX4 A;  2AZS A;  2EJ9 A;  1TU0 B;  1UGS B;  5IAY A;  2ZGW A;  3SWN B;  3CCE Q;  2V8I A;  4J8O A;  3REA B;  1QCN A;  3NTH A;  2CT3 A;  5CK9 A;  3CPF A;  2J05 A;  2DET A;  1KIK A;  2GF7 A;  4IUQ A;  1VIE A;  3QKJ A;  4D8K A;  1VQO A;  3I56 Q;  2JM8 A;  1PKS A;  3CCR T;  1KQ1 A;  3S6W A;  2VVK A;  3L2U A;  2LQW A;  1WHK A;  2DYB A;  3TU4 K;  3CCL T;  3JCM d;  3CEY A;  2YRC A;  1ZBJ A;  1PKT A;  2LCS A;  2WSC E;  1XQH A;  2D1X A;  1K1Z A;  5GAO p;  3GPL A;  1NJI U;  1FMW A;  4GLK A;  2YUQ A;  2MK5 A;  3LGL A;  2EIF A;  3PVL A;  3HRU A;  4OMF B;  2E6N A;  3A8O B;  4OB2 B;  1WYX A;  1KK7 A;  4NS5 A;  2XIC A;  5LJ3 e;  1WJS A;  1FX7 A;  1WX6 A;  4XU2 A;  5A0D A;  3C95 A;  2J6K A;  3OYH A;  4IIO A;  3AT1 B;  2G3R A;  2LJ0 A;  4M78 E;  3OYK A;  4N4G A;  2ESW A;  1T0J A;  4N0A A;  3QPH A;  5D7U A;  1SKU B;  2ENM A;  3QZ9 B;  1LVK A;  1VYT A;  1I81 A;  3UWN A;  2O31 A;  5LJ3 h;  2HKN A;  2PVG B;  2O4X A;  2ZCF B;  4C0F A;  3L42 A;  1JXO A;  1PHT A;  2XDB A;  1KQ2 A;  2RJF A;  3EG0 A;  4PJL A;  5GAN 7;  4IUT A;  4ELZ C;  4M75 B;  4DEX A;  1IGQ A;  3RUX A;  2FO0 A;  3OYE A;  4HT9 A;  4FU6 A;  1GRI A;  4PLI A;  4A4H A;  1U06 A;  1XOV A;  3OQ5 A;  2RNA A;  4M7A D;  4M75 A;  1I1J A;  4O5V A;  1TH7 A;  3KXT A;  4GY5 A;  5D6X A;  2ZPF B;  1TTH B;  1Y0M A;  3UDC A;  5LJ5 f;  4M77 D;  2K7A A;  2EVR A;  5A0L A;  3OSS C;  4JS5 A;  2KMT A;  3Q1J A;  4FIB A;  2G6F X;  1NZ9 A;  2DD5 A;  1RI9 A;  2F5T X;  2KYM A;  1VQ6 A;  2JS2 A;  4QVD A;  3CCM A;  2PQW A;  1M2O A;  1VYV A;  1E6G A;  4B9W A;  1KD1 R;  3M0P A;  3BDU A;  2RHX A;  3N5B B;  2M16 A;  2FPD A;  4JZ4 A;  1K0X A;  1B7T A;  1JBM A;  4EMH A;  1VQK A;  3BFM A;  3NTI A;  1K0S A;  4LDY A;  4J6Y A;  4M77 A;  5I2M A;  1TOV A;  2K5F A;  1W2B P;  2FHD A;  2E3H A;  1QVG P;  2RK2 A;  3CPW P;  3OBY A;  2KT8 A;  2QQB A;  3KBG A;  1PSE A;  2V1R A;  3RMQ A;  3FLG A;  3QXE B;  4BB7 A;  1VYU A;  3AHU A;  2XID A;  1ZA1 B;  4AFU C;  2O9S A;  3M55 A;  2YRD A;  1KQS A;  2EGA A;  5DLO A;  2GFA A;  1ZA2 B;  1BI1 A;  3CC7 Q;  4PK4 A;  2O9V A;  3QO3 A;  1M8V A;  4ZTJ A;  3T9N A;  5FU7 B;  1PNJ A;  4WTO B;  1K8A C;  2KEA A;  2DYI A;  3X24 B;  4M78 A;  2J06 A;  4FYX B;  1NJI C;  1UUE A;  5FW9 A;  5KCO A;  2GQV A;  2JTM A;  3H0I A;  5GAN e;  5GAN 6;  4FT2 A;  2WSF E;  2EYQ A;  2WAC A;  3FIF A;  3QHS A;  4J5Y A;  3JCM f;  4OB3 B;  2QYZ A;  1N8R C;  1MNE A;  5GAN g;  1YIJ T;  1NM7 A;  3C12 A;  2CZ6 B;  4DBR A;  4UC4 A;  2VAS A;  2SEM A;  2K9G A;  4E47 A;  2O88 A;  2BTT A;  3CCU T;  4HKE A;  2COW A;  3UF4 A;  1Q82 U;  1N8R R;  1WXU A;  4II1 A;  2JZ2 A;  5GAN h;  4Y92 A;  3VS5 A;  4PJN A;  2FEI A;  2JMA A;  1WLP B;  3OMG A;  3CC2 T;  2GBQ A;  4KGX B;  4C8Q G;  3MEA A;  4J9H A;  5LJ5 d;  2XU8 A;  3U23 A;  1T3L A;  1KD1 C;  2JM9 A;  4JLI A;  2AHJ B;  1M3A A;  2MMP A;  2VXF A;  1R0B G;  3NPF A;  4GBQ A;  1ZQ1 A;  4C92 F;  4E6R A;  2HBP A;  1RLQ C;  1X6O A;  1FWZ A;  4LNP A;  3CMA Q;  1CKA A;  1KJW A;  4PJJ A;  1YJ9 Q;  2IVW A;  5LJ5 g;  4OMM A;  3CC7 T;  4A4E A;  1YJW Q;  1DJ7 B;  2DVJ A;  2QDL A;  1QVF A;  4PJM A;  5L8R E;  1ZUY A;  4EDU A;  1VQ9 A;  2DIG A;  1QP3 A;  4RMO A;  1VQ5 A;  4E7J A;  2CP2 A;  2E5Q A;  2BUD A;  1GBR A;  3V7R A;  4M77 G;  5D6W A;  1WPY A;  1YI2 Q;  3PTA A;  2YT6 A;  4E7L A;  4XTU A;  1JRI A;  2QQ9 A;  1GXI E;  4BY6 B;  2X4Y A;  2X51 A;  3A98 A;  4A4F A;  3VS6 A;  1Q86 R;  4JRP A;  4A54 A;  1BYM A;  3MET A;  5CCA A;  3OYF A;  1HSQ A;  3VS3 A;  2IIM A;  2M1H A;  4PFO A;  4PFZ A;  1KQS P;  3MEW A;  3L2W A;  1U3O A;  2R5A A;  1Y7X A;  1U1S A;  2DJZ A;  4RG8 A;  1LPL A;  2V8J A;  1NJI R;  1S72 A;  5GAO r;  2FPE A;  4M75 D;  1VUB A;  5KYU A;  3CMA A;  1MMG A;  1S72 Q;  4N4I A;  3QDR B;  3QJ6 A;  5GAN 4;  2XD0 A;  3S3M A;  2JXB A;  4XTZ A;  2DFU A;  3EG2 A;  2A08 A;  2DK3 A;  4PJO C;  1M5Q 1;  3A8H B;  1GL5 A;  4QVZ A;  5FLX E;  4M7A A;  1YJ9 A;  2VUB A;  2SRC A;  1KC8 U;  2DNU A;  1WFW A;  3V8L A;  2VGM A;  2DMO A;  2LX9 A;  2P0K A;  2VB6 A;  1PC0 A;  3E19 A;  3EGX B;  2P0P A;  1OEB A;  2HQX A;  3OMC A;  1Y57 A;  4C92 E;  1KC8 R;  2PUO B;  2KRS A;  4FW1 A;  3QUI A;  1ZUK A;  3A8M B;  2GFU A;  3EFO A;  3ZBD A;  2O2O A;  2Y90 A;  4RTU A;  3JB9 J;  1ZHI A;  3HP9 A;  4D8D A;  1WHM A;  1OPK A;  3TQ7 P;  1R77 A;  2EQI A;  4BY6 C;  3I5S A;  1YWO A;  4OF1 A;  4XQ3 A;  2OTL A;  3DLL A;  2O01 E;  1BIA A;  3HFN A;  2KRO A;  5CKF A;  2FRY A;  2LDM A;  4HCB A;  2OJ2 A;  4C8Q C;  4OML A;  1YI2 T;  1HK9 A;  1AHJ B;  2V8K A;  1SEM A;  4PJO E;  3LLR A;  3CCL A;  4M7D G;  1WHJ A;  2MF2 A;  7AT1 B;  1P92 A;  1TUD A;  3REB B;  5L23 A;  3MHX A;  4C5H A;  1A0N B;  3QSU A;  4IIM A;  1VQ4 Q;  2JVV A;  1D1C A;  4J9G A;  5GJV B;  2QK0 A;  5AT1 B;  2YXY A;  2DL3 A;  2F2V A;  1I5L A;  3JB9 D;  2IPO B;  2DE0 X;  8AT1 B;  3L2V A;  3IQL A;  4M7D E;  2CP0 A;  1YJ9 T;  1IRE B;  3TEE A;  3G71 T;  1Q86 C;  1NBE B;  5FRM A;  3OA6 A;  3FDR A;  4AFS C;  1G3T A;  3ASK A;  3GNG A;  2PUK B;  1Q81 R;  3SFM A;  3PMT A;  2O4X B;  4E2F B;  1VQ7 Q;  5FRN A;  3H9N A;  2IG0 A;  3G4S Q;  3CC2 Q;  1BBZ A;  3INZ A;  2PU9 B;  2VKN A;  4C92 D;  4F7U A;  2DF6 A;  4C5E A;  4AT1 B;  3JCM b;  4MML A;  2CYZ B;  3ME9 A;  1QWF A;  2CRE A;  5GAM d;  2EYZ A;  1TSF A;  1MMA A;  5GAO l;  2XI9 A;  1NEG A;  4J9C A;  1D09 B;  2JN0 A;  2LTO A;  4TVR A;  1D0Z A;  2LC4 A;  1Y96 A;  3GBQ A;  2HL5 C;  4YTL A;  1OX8 A;  1G3Y A;  4JJD A;  4XTV A;  3CCS Q;  1AZG B;  1YJN T;  3E2U A;  2RB6 A;  3WXM B;  4EMG A;  2HKQ B;  2XKO C;  2EKO A;  2RD1 A;  1D3B B;  3QZ5 B;  2ATC B;  3CBM A;  4PJO D;  1UE9 A;  2YUO A;  2MAM A;  2KT1 A;  1OYX A;  4X9C A;  2RHI A;  2E10 A;  1VQ8 T;  2KK4 A;  1YCS B;  2RO0 A;  2D0Q B;  1JB0 E;  1KFZ A;  3CME Q;  4M7A F;  4KRT A;  5IH2 A;  1WIE A;  2OTJ Q;  4M78 B;  3S3N A;  1QQJ A;  4PJO G;  2HSP A;  1RAB B;  2F2X A;  4M78 F;  2LP5 A;  3CCL Q;  3OB9 A;  3LWI A;  4M7D B;  1WHG A;  2JTE A;  1ZSG A;  2BKD N;  2KI7 A;  1WA7 A;  6AT1 B;  3I55 T;  2LT1 A;  4M77 C;  4M75 C;  1K76 A;  1G3W A;  4Z8A A;  5IHI A;  2QA4 T;  2CZ1 B;  3ER0 A;  3G6E T;  1QKW A;  3MEU A;  2RI3 A;  1OUL A;  4A53 A;  3JCM c;  2H3J A;  2LJ3 A;  3OY9 A;  4PLL A;  4FYW B;  1QVG A;  3EFR A;  1X2K A;  3TCJ A;  2HCK A;  5C0M A;  1XJW B;  4BE0 A;  5LL6 S;  3FC3 A;  2I0N A;  1D0X A;  2VXE A;  3CCJ A;  3BY7 A;  1KSW A;  1AD5 A;  2RQU A;  2K2M A;  4BI8 B;  2OI3 A;  2A3L A;  3CCJ Q;  1VQ6 Q;  3PNW C;  2ABL A;  4GLM A;  4DQ2 A;  1X69 A;  1WJR A;  1UEB A;  4CC4 B;  2DER A;  3CXC A;  3QDF A;  1WHH A;  1UDL A;  3UT1 A;  4M77 E;  1BKB A;  3MP1 A;  3RKY A;  2K3B A;  4EMK C;  1I07 A;  1WNL A;  5FU7 C;  1VQO T;  4J9I A;  2JT4 A;  1J3T A;  2COY A;  1ZBX A;  4BE1 A;  4Z02 A;  1GFD A;  2GQI A;  1CKB A;  2K5I A;  4OP0 A;  2D0N A;  3PMI A;  1TS9 A;  2X3W D;  3BDL A;  2DBM A;  3A5Z B;  2QQR A;  5KYX B;  3JB9 G;  3G4S T;  2CT4 A;  4QQ6 A;  2D9T A;  1VQ7 T;  3EG3 A;  3CCM Q;  3JV3 A;  3QWX X;  4JUV A;  1YCY A;  2DL7 A;  3ZL7 C;  3RBB B;  1FYN A;  3C0C A;  3OYC A;  2NUP B;  1B07 A;  5D6Y A;  2L3Q A;  2QA4 A;  2X4X A;  1PM3 A;  2DL5 A;  2QGG A;  1AWO A;  4NL2 A;  3VS2 A;  2PVD B;  5EG2 A;  2X4W A;  4F16 A;  5GAM j;  3HHT B;  2E65 A;  2E70 A;  5J39 A;  1R0C B;  5KYW A;  3JCM e;  4C0Z A;  3RDV A;  1M2V A;  4ANJ A;  3M0T A;  1KQS S;  1YIJ A;  2YRV A;  4DOV A;  1H92 A;  2GCX A;  1M1K U;  2L3P A;  2VV5 A;  4LDU A;  3X20 B;  2KYB A;  3I56 T;  4RG2 A;  3GP8 A;  1BI0 A;  1VQM A;  2BE9 B;  1QVF P;  5GAN 3;  2DAQ A;  3EGX A;  1FXX A;  1RL2 A;  2XDD A;  1WXB A;  1AWW A;  4VUB A;  3GNF B;  2CGH A;  4OB0 B;  4LD9 K;  3QWY A;  1CSK A;  4CC2 A;  5CKD A;  4ZNX A;  3EAE A;  1U1T A;  2EPD A;  4A4K A;  1QVP A;  1NPP A;  2C0O A;  2X35 A;  2ED1 A;  2KNB B;  3HL8 A;  4M75 G;  5FU6 C;  3OYI A;  3MP8 A;  2NUZ A;  1KG1 A;  4J83 A;  1K9A A;  1RAD B;  1VQ9 T;  3G7Z A;  3I5R A;  1OV3 A;  3GOX A;  2M0O A;  3JCM J;  4O6J A;  2ZAE A;  3QG1 A;  4HVW A;  2XHC A;  4FYV B;  2XMF A;  3WVD B;  3LWH A;  5GAN j;  2XDP A;  5FU6 B;  3RMS A;  3CCQ T;  1M8M A;  3EHQ A;  1MUZ A;  5KYX A;  3MCA B;  2HNI A;  4B6M A;  2HQH A;  5LJ3 d;  3KFV A;  5GAN 2;  5KE3 A;  1K9M R;  2FRW A;  4LD6 A;  4HT8 A;  4HCZ A;  3VS4 A;  1Z9Z A;  1M9S A;  1SF9 A;  3S3O A;  2FL7 A;  3OW2 P;  1OQK A;  1M90 R;  4F7U F;  4WF2 A;  4EMK A;  5LJ5 j;  3G6E Q;  2B8A A;  5CAI A;  3G71 Q;  2ZPG B;  4JS4 A;  1UGQ B;  1Q81 C;  5GMK m;  3CXC P;  1ZSZ C;  4XTW A;  1I0C A;  2RN8 A;  3D7S B;  5HCK A;  1X2Q A;  4DBF A;  2LQK A;  1ACM B;  1UEC A;  4Y91 A;  1VQ4 T;  1RAG B;  1HJD A;  1ZX6 A;  4LE9 A;  4JDS A;  2YSQ A;  5LJ3 g;  1YI2 A;  5HK0 A;  5GAM h;  2P84 A;  2LNV A;  2RM4 A;  3H6Z A;  1UG1 A;  3CPW A;  3JB9 I;  4EMK B;  2DPP B;  3HKS A;  3G1J A;  3ZFJ A;  5IXB A;  1D1A A;  4L5G A;  2CZ7 B;  3JCM Q;  3JCM W;  3PFS A;  4Y28 E;  2E6Z A;  2CS7 A;  8ATC B;  2DRM A;  3NGP A;  1NEB A;  1WDX A;  4F7U G;  2F5K A;  4PJO B;  4R0K A;  3NHN A;  3CMA T;  3VJP A;  1SSH A;  3VKI A;  1W2B S;  3EH1 A;  1JXM A;  1IXD A;  2E3I A;  3CPW S;  1I4K 1;  4C5I A;  4Q5W A;  2ZPB B;  2HZY A;  4FW2 A;  4PJO F;  2EWN A;  2W0Z A;  1OOT A;  2RJE A;  1F1B B;  3OS5 A;  2JTF A;  2YWW A;  5J3B A;  1M27 C;  4MZP A;  2FZC B;  2P4R A;  3I55 Q;  1RAA B;  4MDX A;  2YHT A;  1C0M A;  3EG9 A;  4C8Q E;  3NFC A;  2A0F B;  2HQE A;  3FJ5 A;  4FL6 A;  1Z9Q A;  4M7D A;  1M3C A;  3M0Q A;  4C92 A;  2OTJ T;  2LT4 A;  1O75 A;  2DRK A;  2RJD A;  4XK8 E;  1VQN Q;  1YHQ T;  1MHN A;  4HCC A;  3VS1 A;  4M78 C;  4X1V A;  2B86 A;  5DY9 A;  1YHQ A;  1JU5 C;  2RMO A;  1UGR B;  5KYY B;  3DB4 A;  3QYG B;  2RK1 A;  2MWP A;  1OZ3 A;  3CC7 A;  1LOJ A;  2L2P A;  4M77 F;  4KBM B;  2DL4 A;  2DLP A;  2EFI A;  3HRT A;  3A8G B;  4LUD A;  1O9S A;  3HPW A;  4KH0 B;  1BI2 A;  2DTH A;  2M02 A;  3MP6 A;  1VQ9 Q;  2F2W A;  4DBQ A;  1SPK A;  4M77 B;  1NLP C;  3SB2 A;  2EYY A;  5GAN d;  1BI3 A;  3LGF A;  1AOJ A;  4E7K A;  1M1F A;  4E7H A;  5C6S A;  4XAX B;  1EZZ B;  3EH2 A;  2XG8 D;  2GNC A;  2HEQ A;  1AWJ A;  2QDY B;  4M75 E;  3G4S A;  1E7O A;  4AFQ C;  4BI3 A;  4F04 B;  1BU1 A;  1K4U S;  3H0F A;  3CQT A;  1KC8 C;  4J6W A;  1LNX A;  2L0A A;  2E64 A;  4M7A G;  2BIV A;  4LXC A;  3JCM P;  4LN2 A;  4FM4 B;  5CKB A;  1BCO A;  2RA2 A;  4R55 A;  2LCC A;  3RER A;  3E1S A;  2EQJ A;  4BD3 A;  2HDA A;  1M90 C;  3J80 E;  1G83 A;  2ZPH B;  3RNJ A;  4IUR A;  4Z88 A;  5GAN 8;  1V76 A;  1H3H A;  3CCQ A;  2X9H A;  1NLO C;  3JCM X;  3ULR B;  5GMK j;  4FCY A;  1VQM Q;  2JMC A;  1U8R A;  2JNG A;  2BZY A;  2HSE B;  2DO3 A;  2P0Q A;  3VU3 C;  2RI5 A;  4BE2 A;  2H3E B;  4QQG A;  1VQP A;  1YJN A;  2FZG B;  2CUB A;  2DXU A;  4KGZ B;  2DTO A;  3SD4 A;  1VQ5 Q;  2X3X D;  4C5G A;  4BDZ A;  2CP3 A;  2K79 A;  1Q82 C;  2F69 A;  2K6D A;  2MYS A;  4HVV A;  2AKL A;  4QT7 A;  4KUI A;  1GCQ C;  4RCC A;  1MGQ A;  1VQN A;  4RTX A;  3V7C A;  2DXB A;  4JJN K;  1N8R U;  5KYY A;  3CD6 Q;  3CC4 T;  2L3R A;  2JW4 A;  5GJW B;  2DEU A;  3WVE B;  5KCH A;  3CCV A;  4QQD A;  4AG2 C;  1IB8 A;  4MDW A;  3VRZ A;  1VQ8 Q;  1QP2 A;  4HVU A;  2AZV A;  4CC7 A;  3UA7 A;  1W1F A;  2MIO A;  2GTJ A;  1K9M C;  1YBY A;  1WQ7 A;  4DBH A;  2L3S A;  2GTO A;  3OW2 A;  4M7A C;  1VQ6 T;  3H41 A;  1U5S A;  3PE0 A;  2M51 A;  1R8O B;  4JJC A;  1RLP C;  2K3Y A;  3EG9 B;  5CIU A;  2A37 A;  4M7D F;  1QVF S;  1QLY A;  4KUD K;  1X27 A;  1TXQ A;  4RUG A;  1C1A A;  4Z89 A;  2XK0 A;  3SWN A;  3OYN A;  2RHY A;  1G2B A;  4M75 F;  1VQP Q;  1FMK A;  3VUZ A;  3URG A;  4BAC A;  4DEY A;  1M2V B;  2PTK A;  5CR2 A;  1TUG B;  3A1P A;  1AT1 B;  4XTX A;  4M7A B;  2W10 A;  4JZ3 A;  3R6O A;  3G71 A;  1D0Y A;  4OVA A;  1YJW T;  3UA6 A;  4RTW A;  2DXT A;  1VIF A;  2NWM A;  4JPB W;  1NYF A;  2DIQ A;  2LRQ A;  4E7Z A;  2ZZD A;  1VQ7 A;  1UHF A;  1AEY A;  1SRM A;  1YIT A;  3M0R A;  2DD4 A;  1LCK A;  3CCV Q;  3C94 A;  1ABQ A;  1X75 C;  4NOY A;  4XTY A;  2QG9 B;  1M1K C;  4ELY C;  4FSX A;  5I11 A;  1BCM A;  3PIO A;  1QKX A;  3CC2 A;  5GAO n;  3HFO A;  1N27 A;  1T3S A;  1OU9 A;  2RQR A;  1WHL A;  2NUT A;  5LJ5 e;  2FPF A;  1SG5 A;  2QGF B;  4F7U B;  2EAY A;  4N0A C;  2NUT B;  2CH4 W;  3QBY A;  2KBT A;  1M1K R;  2QXF A;  3TRE A;  1Q7Y R;  4BDY A;  3TVT A;  3M54 A;  3M59 A;  1Q86 U;  1UB4 A;  2DL8 A;  1OX9 A;  5CO7 A;  2KXC A;  2YDL A;  1VQK Q;  1WQW A;  1VQ4 A;  4OMO A;  2Z0W A;  4J9E A;  5HK3 A;  3E9G A;  2KGT A;  1WI7 A;  3O8V A;  1IO6 A;  3CBO A;  5DLQ E;  1W70 A;  1MV0 B;  4QVC A;  2JUF A;  3V8K A;  2R5M A;  3M57 A;  1VQ8 A;  3CXC S;  2Y4Y A;  3UAT A;  1VOM A;  1IHW A;  5GAO q;  1ZSZ A;  2C06 A;  4K11 A;  3I9Q A;  4ZGE B;  2DIL A;  3CME A;  2LCL A;  1NYG A;  3M9Q A;  1BB9 A;  5A2Q E;  4IUV A;  4RTT A;  1MMN A;  2COZ A;  2DA9 A;  2L5Q A;  3DB3 A;  1QCO A;  2LMJ A;  1ZLM A;  3JCM g;  1YWP A;  1K9M U;  1K73 R;  3TSZ A;  5DM7 R;  2R58 A;  2DJQ A;  4AMC A;  3SDZ A;  1PRM C;  1VQL T;  3EGU A;  2LVM A;  1UFF A;  3FJP A;  2QTX A;  1IRX A;  3O5Z A;  1YIJ Q;  5KE2 A;  2CH4 A;  1TG0 A;  4XU3 A;  3RKW A;  5CKE A;  4AFZ C;  1M4Z A;  1TUC A;  3OYB A;  3V8J A;  2A36 A;  2C0I A;  4NL3 A;  1GCQ A;  3LYI A;  2K57 A;  4KH1 B;  1RAH B;  2E4H A;  5M9O A;  3J81 E;  3CCR Q;  1S72 T;  1UHC A;  2E1H A;  1YP5 A;  2NYS A;  2GGR A;  1OU8 A;  3FEO A;  2KXD A;  3M4Y A;  1B34 A;  3OYD A;  4A63 B;  2DBK A;  2ZPI B;  2QTV A;  2PVO B;  2RHU A;  3PVQ A;  4C0G A;  3QYH B;  2FG0 A;  1QWE A;  1NG2 A;  2PNI A;  3VV0 A;  4M4Z A;  1X6B A;  3P8H A;  1UGP B;  3OYM A;  4OMP A;  2DTI A;  1N6A A;  1OZ2 A;  1IGU A;  2KDS A;  1IHV A;  4LUE A;  2DZC A;  2M9U A;  1Q82 R;  3EG1 A;  1X01 A;  2HL3 A;  5GAM f;  4J7I A;  2ROL A;  2KSS A;  1VQO Q;  1AWX A;  1NE8 A;  1HD3 A;  2QQS A;  3HTR A;  3R6N A;  4KT0 E;  1RAE B;  1YIT Q;  2H8H A;  1N9S A;  2LQN A;  1VQL A;  2BE7 D;  3VYH B;  3LH5 A;  3A8L B;  1QMC A;  2KQW A;  3JCM V;  2KE9 A;  2LQ8 A;  2A7Y A;  3M58 A;  2DKG A;  3BW1 A;  3OSV A;  3QII A;  4M78 D;  5CKH A;  3L2R A;  1VQ5 T;  1HYO A;  1YN8 A;  3X25 B;  4D6W A;  4ATO A;  3BE3 A;  1RAI B;  3PIP A;  4FT4 A;  3ZEH A;  3FRN A;  3TSW A;  4M7D D;  1W6X A;  3GIB A;  2J7I A;  3DKM A;  2RH2 A;  2PZ1 A;  3P8B B;  3CCU A;  2QA4 Q;  2EYW A;  2FB7 A;  2FYK A;  5HKC A;  3OYJ A;  1G3S A;  5CQX A;  2CSQ A;  3M53 A;  3CCV T;  4P5N A;  4ESR A;  1JJ2 S;  4MMK A;  5IHK A;  3FB9 A;  2QEX T;  1B3Q A;  3OYA A;  1KD1 U;  1K8A R;  2FZK B;  1M3B A;  4J6X A;  3OS2 A;  4RKU E;  2EW3 A;  3EFO B;  3V7S A;  1Q7Y U;  2VGN A;  3M4G A;  3SWN C;  3CCR A;  2LJ1 A;  3CME T;  2HD0 A;  3VRY A;  3SHW A;  4MZM A;  2KRM A;  4ME7 A;  2Y4X A;  2DXC A;  3MPU B;  4A4G A;  1VQK T;  5GAN 5;  5I22 A;  5IHN A;  4L6V 5;  2OAU A;  2HAX A;  3EGD B;  2JJ9 A;  2R57 A;  3NTK A;  5GAM g;  4X9D A;  2CP7 A;  2RQT A;  4BI4 A;  2K4Y A;  5CVI A;  1SHG A;  3J7A F;  4JRI A;  1IZ6 A;  1N9R A;  5HY6 A;  2QAZ A;  2OX7 A;  3G6E A;  1K8A U;  1UTI A;  3M56 A;  2OTL T;  1UJ0 A;  4EIK A;  1WXT A;  1M1G A;  1RUW A;  4E7I A;  4ZGD B;  4WCI A;  2DEQ A;  5LJ5 h;  2EKH A;  1JEG A;  2AK5 A;  2BZ8 A;  4HCK A;  1GBQ A;  2ROT A;  2EJF A;  1MMD A;  2E5K A;  4OGC A;  2ZPE B;  4PKC C;  3VYG A;  1D3B A;  2QEX Q;  2X4J A;  5KYW B;  4AG1 C;  1MND A;  1PD0 A;  1H8K A;  2EQM A;  1JQQ A;  2D8J A;  3JCM h;  5KYU B;  2EJG A;  3CCE A;  4HA8 A;  1YJW A;  2MCN A;  1Q95 G;  2AIR B;  2JOY A;  3L1A A;  2KAF A;  5AYF A;  2EQK A;  2CP5 A;  4C8Q A;  3VS0 A;  4OB1 B;  1RAF B;  4N4H A;  2OTJ A;  4KGV B;  3CCU Q;  2AKK A;  2KRN A;  2CSI A;  2EYX A;  3F70 A;  4JLG A;  1K73 U;  1I5O B;  1XNI A;  4JRQ A;  3MO8 A;  5KYN A;  1WJQ A;  3GLX A;  1LJO A;  3OYY A;  2RPN A;  4DOW A;  1Y07 A;  2HMA A;  1MV3 A;  4X34 A;  3RKX A;  3CC4 A;  3OW2 S;  2CKK A;  4PNO A;  1C6V X;  4C92 C;  4RCB A;  4C8Q D;  1W4S A;  1YJN Q;  3CCS T;  3CC4 Q;  1D1B A;  2RHZ A;  4IUP A;  5J26 A;  1KHI A;  1WZO A;  2QAS A;  2NLU A;  1RI0 A;  4PL6 A;  4R56 A;  2RQW A;  4M78 G;  2CUD A;  4EPC A;  1GFC A;  1M30 A;  5FRO A;  4IKF A;  2YUN A;  1YNZ A;  3I35 A;  1BIB A;  1SSF A;  2K5L A;  3EFS A;  3H8Z A;  2ECZ A;  5IXF A;  3I55 A;  3NMZ C;  4ORZ A;  2L89 A;  2VWF A;  3LX7 A;  1GCP A;  2RQV A;  3LH0 A;  3M0U A;  2J6F A;  1H64 1;  2ED0 A;  2QEX A;  1QVG S;  4LDX A;  3OYL A;  1PD1 A;  5I21 A;  3QJY A;  5GMK h;  4XU1 A;  4DA4 A;  4JRK A;  4C0D B;  1JO8 A;  5CQY A;  4B9X A;  2YLC A;  1PG5 B;  4PFP A;  2C0T A;  5FWB A;  4JJB A;  4L59 A;  2MOX A;  2DZ9 A;  2KY9 A;  3X28 B;  4V2S A;  4FSS A;  4J9B A;  1PWT A;  4CRI A;  2E12 A;  3M5A A;  2K3X A;  2HBW A;  2DM1 A;  4E7S A;  2L8D A;  3MKD A;  1HXD A;  3KUF A;  1YHQ Q;  5ECA A;  3CCQ Q;  2E41 A;  3OYG A;  2EBP A;  2MPX C;  1SHF A;  5FWC A;  3M0S A;  5GAN f;  4HXJ A;  3EHR A;  2KR3 A;  3SEM A;  2V26 A;  4LDW A;  4OGE A;  3DLM A;  2RI2 A;  3PT9 A;  2CP6 A;  4IUU A;  1FMV A;  3VUB A;  4ZN3 A;  1PCX A;  3CCM T;  1EFN A;  1H3Z A;  5LJ3 j;  2QQA A;  1B34 B;  1X43 A;  2VYT A;  1PSF A;  5EC7 A;  1I8F A;  2OTL Q;  5GMK e;  4C92 B;  1UJY A;  1K73 C;  2EQU A;  3RR6 A;  1E6H A;  1ABO A;  5IN1 A;  2BZX A;  3LW5 E;  5KH6 A;  4M7D C;  2DX1 A;  1OI1 A;  5I2S A;  1QW1 A;  3CCJ T;  1Q81 U;  3JB9 F;  3HSB A;  3CCS A;  4RTZ A;  1V29 B;  3P8D A;  3CBP A;  2NUP A;  1NPR A;  1Y96 B;  3CD6 T;  2CZ0 B;  2AT1 B;  3VS7 A;  2OAW A;  2JS0 A;  3OBW A;  4XU0 A;  1X6G A;  1VQN T;  3C4S A;  1KHC A;  3JB9 H;  2P4T A;  4MZT A;  1UGV A;  2D8H A;  1Q7Y C;  4PJO A;  1RAC B;  1PRL C;  1T0H A;  2F1L A;  2MWO A;  4KUL A;  4C8Q F;  3H0H A;  1ZSZ B;  2VC8 A;  5GAM e;  3L2Q A;  3CD6 A;  3MEV A;  3OS1 A;  1M90 U;  1BK2 A;  1WGS A;  2M0Y A;  3HRS A;  2YUP A;  3EGD A;  4M7A E;  4OMN A;  1VQL Q;  4F7U E;  1VQM T;  5A0G A;  1S1N A;  1G8X A;  1N5Z A;  2MI6 A;  4OMQ A;  2RJC A;  2V1Q A;  1AZE A;  4J7F A;  3UPU A;  3JAM E;  2WSE E;  3OS0 A;  4CI0 C;  2A28 A;  5IT9 E;  1EIF A;  4CC3 A;  3JRZ A;  1XTD A;  2EGE A;  4F14 A;  1ARK A;  1QCF A;  4ZTF A;  1V1C A;  2I2L A;  4FYY B;  5GMK i;  3L2Z A;  3I56 A;  3MJX A;  1VA7 A;  5GAO m;  4C92 G;  1Y71 A;  1JJ2 A;  4QKU A;  2J6O A;  2RF0 A;  2LNH B;  1G5V A;  1TWB A;  1W2B A;  4J9F A;  2YLB A;  3CCE T;  2FVU A;  1AVZ C;  2DVE A; 
#chains in the Genus database with same CATH homology
 2DPP B;  3HKS A;  1VQP T;  4QW2 A;  3ZFJ A;  4C0D C;  4ZGJ B;  1X01 A;  3PGG A;  4ZN1 A;  4L5G A;  2CZ7 B;  3JCM Q;  3JSC A;  3JCM W;  3PFS A;  3RIR A;  4Y28 E;  4BY6 C;  5GAM f;  1YIT T;  2E6Z A;  4J7I A;  4OF1 A;  2CS7 A;  4XQ3 A;  2KSS A;  2OTL A;  1NE8 A;  3DLL A;  3E9F A;  2QQS A;  2F5K A;  3RES A;  4F7U G;  4PJO B;  2O01 E;  1BIA A;  3HFN A;  3CMA T;  4KT0 E;  3VJP A;  4LDV A;  2K2V A;  3GF5 A;  5CKF A;  3VKI A;  4BUG A;  2LDM A;  1W2B S;  4HCB A;  4C8Q C;  1N9S A;  5GMK l;  5LJ3 f;  1YI2 T;  3CPW S;  1HK9 A;  1I4K 1;  1AHJ B;  4C5I A;  1VQL A;  2D6F A;  2QI2 A;  2V8K A;  4Q5W A;  2ZPB B;  3VYH B;  4PJO E;  3A8L B;  2KVQ G;  3LLR A;  3CCL A;  4M7D G;  2KQW A;  3JCM V;  4C8Q B;  3X26 B;  2MF2 A;  2A7Y A;  2LQ8 A;  3M58 A;  1P92 A;  2DKG A;  2EJ9 A;  1UGS B;  3BW1 A;  5IAY A;  2ZGW A;  3MHX A;  4C5H A;  4PJO F;  3OSV A;  2EWN A;  3QII A;  3SWN B;  4M78 D;  2JVV A;  2RJE A;  5CKH A;  3QSU A;  3L2R A;  2V8I A;  1VQ5 T;  3X25 B;  4D6W A;  4ATO A;  4J8O A;  3OS5 A;  2JTF A;  1I5L A;  3JB9 D;  3NTH A;  5J3B A;  4MZP A;  5CK9 A;  3PIP A;  4FT4 A;  3L2V A;  3ZEH A;  3CPF A;  4M7D E;  3FRN A;  4MDX A;  2YHT A;  1YJ9 T;  2GF7 A;  3GIB A;  1IRE B;  4IUQ A;  1VIE A;  4C8Q E;  3NFC A;  4M7D D;  3QKJ A;  3TEE A;  3G71 T;  2HQE A;  1VQO A;  3DKM A;  1Q86 C;  2RH2 A;  5FRM A;  4FL6 A;  3CCR T;  3OA6 A;  1KQ1 A;  3FDR A;  3S6W A;  4M7D A;  1G3T A;  3ASK A;  3GNG A;  2PUK B;  3SFM A;  3P8B B;  3L2U A;  3PMT A;  4C92 A;  3CCU A;  3TU4 K;  2OTJ T;  2LT4 A;  2O4X B;  3CCL T;  1O75 A;  5FRN A;  2FB7 A;  2RJD A;  2FYK A;  3JCM d;  4XK8 E;  3CEY A;  2IG0 A;  5HKC A;  3OYJ A;  1G3S A;  5CQX A;  1YHQ T;  2WSC E;  3INZ A;  3M53 A;  2PU9 B;  3CCV T;  1MHN A;  1XQH A;  4HCC A;  4P5N A;  4M78 C;  4C92 D;  1JJ2 S;  4MMK A;  4F7U A;  5GAO p;  3GPL A;  1NJI U;  4GLK A;  3FB9 A;  5DY9 A;  4C5E A;  2QEX T;  3OYA A;  1YHQ A;  3JCM b;  1KD1 U;  4MML A;  2CYZ B;  1UGR B;  3ME9 A;  3DB4 A;  3QYG B;  4J6X A;  2RK1 A;  3LGL A;  2MWP A;  3OS2 A;  1OZ3 A;  4RKU E;  2EIF A;  3CC7 A;  5GAM d;  1LOJ A;  4M77 F;  3HRU A;  4OMF B;  2E6N A;  4KBM B;  3A8O B;  4OB2 B;  2EFI A;  4NS5 A;  2XIC A;  3HRT A;  1FX7 A;  1WJS A;  3A8G B;  4XU2 A;  1O9S A;  3V7S A;  5LJ3 e;  5A0D A;  3C95 A;  5GAO l;  2XI9 A;  3OYH A;  2VGN A;  3HPW A;  1Q7Y U;  3M4G A;  3SWN C;  3CCR A;  2JN0 A;  1BI2 A;  2DTH A;  3MP6 A;  3CME T;  2HD0 A;  2LTO A;  4TVR A;  4MZM A;  2G3R A;  4M77 B;  2LC4 A;  4M78 E;  3SB2 A;  4ME7 A;  4N4G A;  3OYK A;  1Y96 A;  2Y4X A;  2DXC A;  4A4G A;  1VQK T;  5GAN d;  4YTL A;  1BI3 A;  3LGF A;  5GAN 5;  1G3Y A;  4E7K A;  4XTV A;  1M1F A;  4L6V 5;  4E7H A;  5C6S A;  2OAU A;  4XAX B;  1YJN T;  2HAX A;  2XG8 D;  2RB6 A;  4N0A A;  3QPH A;  3WXM B;  2QDY B;  2R57 A;  3QZ9 B;  4M75 E;  4EMG A;  2XKO C;  3G4S A;  2EKO A;  3NTK A;  1I81 A;  2RD1 A;  1D3B B;  3QZ5 B;  3UWN A;  4BI3 A;  4X9D A;  5GAM g;  5LJ3 h;  3CBM A;  2PVG B;  2O4X A;  2ZCF B;  4C0F A;  1KC8 C;  4PJO D;  3L42 A;  1LNX A;  4J6W A;  4BI4 A;  2XDB A;  2K4Y A;  2E64 A;  5CVI A;  4M7A G;  2BIV A;  2MAM A;  3J7A F;  1KQ2 A;  2RJF A;  4JRI A;  1OYX A;  5GAN 7;  4X9C A;  2RHI A;  3JCM P;  2E10 A;  4FM4 B;  4IUT A;  4ELZ C;  5CKB A;  4M75 B;  1VQ8 T;  1IZ6 A;  1N9R A;  2RA2 A;  5HY6 A;  2KK4 A;  3RUX A;  3OYE A;  3G6E A;  1K8A U;  2RO0 A;  2LCC A;  3M56 A;  2D0Q B;  4R55 A;  3RER A;  3E1S A;  4HT9 A;  2EQJ A;  4BD3 A;  2OTL T;  4FU6 A;  1JB0 E;  4A4H A;  4PLI A;  1M90 C;  3J80 E;  1M1G A;  4M7A F;  4E7I A;  1XOV A;  3OQ5 A;  4ZGD B;  4M78 B;  4M7A D;  2ZPH B;  3S3N A;  4IUR A;  4M75 A;  2DEQ A;  4O5V A;  5LJ5 h;  1TH7 A;  4PJO G;  3KXT A;  4GY5 A;  5D6X A;  2ZPF B;  5GAN 8;  4M78 F;  3UDC A;  5LJ5 f;  4M77 D;  3OB9 A;  5A0L A;  3LWI A;  4M7D B;  3OSS C;  3CCQ A;  4JS5 A;  2KMT A;  3Q1J A;  4FIB A;  2EJF A;  3JCM X;  5GMK j;  2BKD N;  1U8R A;  4OGC A;  1NZ9 A;  2JNG A;  2DD5 A;  2ZPE B;  4PKC C;  3I55 T;  2F5T X;  2LT1 A;  1VQ6 A;  4M77 C;  3CCM A;  4QVD A;  2DO3 A;  4M75 C;  2PQW A;  1D3B A;  3VYG A;  2X4J A;  2P0Q A;  1G3W A;  3VU3 C;  4B9W A;  2CZ1 B;  2EQM A;  2QA4 T;  2RI5 A;  3BDU A;  2RHX A;  3N5B B;  3ER0 A;  3G6E T;  2M16 A;  4BE2 A;  4QQG A;  3MEU A;  1VQP A;  2RI3 A;  3JCM h;  1YJN A;  2DXU A;  2EJG A;  4A53 A;  3CCE A;  3JCM c;  4HA8 A;  2DTO A;  2H3J A;  3SD4 A;  1JBM A;  1YJW A;  3OY9 A;  4EMH A;  4C5G A;  1VQK A;  4PLL A;  1QVG A;  4BDZ A;  2JOY A;  3BFM A;  3L1A A;  2KAF A;  3NTI A;  1Q82 C;  4LDY A;  2F69 A;  3EFR A;  4J6Y A;  2EQK A;  4M77 A;  5AYF A;  5I2M A;  2K5F A;  3TCJ A;  4C8Q A;  4OB1 B;  4N4H A;  2FHD A;  5C0M A;  2OTJ A;  4BE0 A;  5LL6 S;  4KUI A;  2RK2 A;  3OBY A;  2QQB A;  3KBG A;  1PSE A;  3FC3 A;  2VXE A;  4RCC A;  3RMQ A;  1MGQ A;  3BY7 A;  3F70 A;  3FLG A;  3QXE B;  3V7C A;  4BB7 A;  3CCJ A;  2DXB A;  4JJN K;  1VQN A;  1N8R U;  4JLG A;  1K73 U;  3CC4 T;  1XNI A;  2L3R A;  4BI8 B;  4JRQ A;  3MO8 A;  1WJQ A;  3AHU A;  3GLX A;  2A3L A;  2XID A;  1LJO A;  3OYY A;  3WVE B;  4DOW A;  5KCH A;  3CCV A;  3PNW C;  4QQD A;  4MDW A;  1Y07 A;  1QP2 A;  4X34 A;  3RKX A;  1WJR A;  1UEB A;  4DQ2 A;  3CC4 A;  3M55 A;  3CXC A;  3OW2 S;  2CKK A;  1KQS A;  4PNO A;  4C92 C;  4RCB A;  4C8Q D;  1W4S A;  5DLO A;  2GFA A;  3UT1 A;  4M77 E;  1BKB A;  3CCS T;  3MP1 A;  3RKY A;  4EMK C;  1YBY A;  1WQ7 A;  3OW2 A;  1K9M C;  4M7A C;  2RHZ A;  1BI1 A;  1VQ6 T;  3QO3 A;  1R8O B;  1WNL A;  5FU7 C;  1VQO T;  4IUP A;  5J26 A;  1M8V A;  1KHI A;  3CPW A;  2NLU A;  1RI0 A;  2K3Y A;  4PL6 A;  4R56 A;  1ZBX A;  4ZTJ A;  4BE1 A;  4Z02 A;  3T9N A;  5FU7 B;  1K8A C;  4M78 G;  4EPC A;  2K5I A;  5CIU A;  5FRO A;  4OP0 A;  4IKF A;  4M7D F;  1QVF S;  4KUD K;  3PMI A;  4M78 A;  3X24 B;  3BDL A;  1NJI C;  1BIB A;  3A5Z B;  1SSF A;  2XK0 A;  2GQV A;  2JTM A;  2K5L A;  3SWN A;  3EFS A;  5KCO A;  2RHY A;  3OYN A;  3H8Z A;  2QQR A;  4M75 F;  3JB9 G;  3G4S T;  5GAN e;  3VUZ A;  4QQ6 A;  3URG A;  5GAN 6;  3I55 A;  4BAC A;  2D9T A;  2WSF E;  4FT2 A;  1VQ7 T;  2EYQ A;  2WAC A;  5CR2 A;  3FIF A;  3QHS A;  4J5Y A;  2L89 A;  3JCM f;  4XTX A;  4M7A B;  3LX7 A;  3LH0 A;  2QEX A;  4OB3 B;  1QVG S;  1H64 1;  4JUV A;  1YCY A;  3R6O A;  1N8R C;  4LDX A;  3G71 A;  5GAN g;  4OVA A;  3OYL A;  1YIJ T;  3C12 A;  1YJW T;  5I21 A;  3QJY A;  2CZ6 B;  5GMK h;  4XU1 A;  2DXT A;  1VIF A;  4UC4 A;  3OYC A;  4JRK A;  4DA4 A;  4C0D B;  5CQY A;  4B9X A;  2YLC A;  2DIQ A;  5D6Y A;  2LRQ A;  4E47 A;  2QA4 A;  2ZZD A;  4L59 A;  3CCU T;  2X4X A;  1VQ7 A;  2DZ9 A;  4HKE A;  2KY9 A;  1Q82 U;  3X28 B;  4V2S A;  4II1 A;  4NL2 A;  4CRI A;  2E12 A;  2JZ2 A;  1YIT A;  2PVD B;  3M5A A;  2K3X A;  2DD4 A;  5EG2 A;  5GAN h;  2L8D A;  2X4W A;  1HXD A;  5GAM j;  3HHT B;  2E65 A;  2E70 A;  3C94 A;  3KUF A;  3OMG A;  5J39 A;  3CC2 T;  1X75 C;  2E41 A;  3JCM e;  4C0Z A;  3OYG A;  4NOY A;  4XTY A;  4C8Q G;  3MEA A;  4ELY C;  5LJ5 d;  2XU8 A;  1M1K C;  1KQS S;  5GAN f;  1KD1 C;  4FSX A;  2AHJ B;  4JLI A;  2MMP A;  2VXF A;  3PIO A;  1YIJ A;  2YRV A;  4DOV A;  3CC2 A;  2GCX A;  4LDW A;  4OGE A;  5GAO n;  3HFO A;  1M1K U;  1N27 A;  3DLM A;  1ZQ1 A;  2VV5 A;  2RI2 A;  4C92 F;  4LDU A;  5LJ5 e;  3X20 B;  3PT9 A;  4IUU A;  3I56 T;  4RG2 A;  2HBP A;  3VUB A;  1X6O A;  4ZN3 A;  3GP8 A;  1FWZ A;  1BI0 A;  4F7U B;  1VQM A;  2EAY A;  4N0A C;  3CCM T;  5GAN 3;  1H3Z A;  5LJ3 j;  2DAQ A;  2IVW A;  2QQA A;  1B34 B;  3QBY A;  4A4E A;  5LJ5 g;  1FXX A;  3CC7 T;  2VYT A;  1RL2 A;  2XDD A;  1DJ7 B;  1PSF A;  2QXF A;  3TRE A;  1I8F A;  4VUB A;  4BDY A;  5GMK e;  4C92 B;  3M54 A;  5L8R E;  3M59 A;  1K73 C;  1QVF A;  2EQU A;  1Q86 U;  3GNF B;  1UB4 A;  2CGH A;  4OB0 B;  5IN1 A;  4EDU A;  5CO7 A;  2DIG A;  1VQ9 A;  3LW5 E;  4LD9 K;  5KH6 A;  4M7D C;  1QP3 A;  4RMO A;  1VQ5 A;  5CKD A;  1OI1 A;  1WQW A;  5I2S A;  4E7J A;  3EAE A;  1U1T A;  4A4K A;  1QW1 A;  1QVP A;  3CCJ T;  1NPP A;  1VQ4 A;  2E5Q A;  2BUD A;  2X35 A;  3HL8 A;  4M75 G;  1Q81 U;  3V7R A;  5HK3 A;  3HSB A;  3JB9 F;  3E9G A;  3CCS A;  5FU6 C;  3O8V A;  3MP8 A;  3OYI A;  4M77 G;  5D6W A;  1WPY A;  3CBO A;  5DLQ E;  3PTA A;  1KG1 A;  4E7L A;  4QVC A;  4J83 A;  2JUF A;  3V8K A;  4XTU A;  1V29 B;  2R5M A;  3M57 A;  1JRI A;  2QQ9 A;  3P8D A;  3CBP A;  1VQ8 A;  3CXC S;  1VQ9 T;  1GXI E;  4BY6 B;  2X4Y A;  3G7Z A;  2Y4Y A;  4A4F A;  1NPR A;  1Y96 B;  5GAO q;  3GOX A;  3CD6 T;  2M0O A;  2CZ0 B;  2C06 A;  3JCM J;  4O6J A;  4ZGE B;  4JRP A;  4A54 A;  3CME A;  1BYM A;  3MET A;  3QG1 A;  2LCL A;  5CCA A;  3OYF A;  2XHC A;  3M9Q A;  5A2Q E;  3OBW A;  2M1H A;  4XU0 A;  3WVD B;  3MEW A;  4IUV A;  1VQN T;  3C4S A;  3L2W A;  2L5Q A;  3DB3 A;  2R5A A;  1Y7X A;  3LWH A;  1KHC A;  3JB9 H;  5GAN j;  2XDP A;  3JCM g;  1K9M U;  2P4T A;  1U1S A;  5FU6 B;  4MZT A;  2DJZ A;  4RG8 A;  3RMS A;  2R58 A;  5DM7 R;  3CCQ T;  1Q7Y C;  4PJO A;  2V8J A;  3SDZ A;  1VQL T;  1S72 A;  5GAO r;  3MCA B;  2HNI A;  2MWO A;  4KUL A;  4C8Q F;  5GAM e;  3L2Q A;  2LVM A;  2VC8 A;  5LJ3 d;  3CD6 A;  2DVE A;  5GAN 2;  5KE3 A;  4M75 D;  3MEV A;  3OS1 A;  4LD6 A;  1VUB A;  1M90 U;  3CMA A;  4HT8 A;  1WGS A;  3FJP A;  3HP9 A;  2QTX A;  3HRS A;  4HCZ A;  3QDR B;  3QJ6 A;  4N4I A;  5GAN 4;  3S3M A;  2XD0 A;  4M7A E;  4F7U E;  5KE2 A;  1M9S A;  4XTZ A;  1VQM T;  5A0G A;  4XU3 A;  3S3O A;  2FL7 A;  3RKW A;  5CKE A;  2DK3 A;  4PJO C;  1M5Q 1;  1M4Z A;  2MI6 A;  3A8H B;  3OYB A;  3V8J A;  4QVZ A;  4NL3 A;  5FLX E;  4F7U F;  2RJC A;  4WF2 A;  4EMK A;  5LJ5 j;  4M7A A;  4J7F A;  3LYI A;  1YJ9 A;  3UPU A;  3JAM E;  2K57 A;  2WSE E;  4CI0 C;  2B8A A;  5M9O A;  2VUB A;  3OS0 A;  1KC8 U;  3J81 E;  5IT9 E;  1S72 T;  1EIF A;  2E1H A;  3V8L A;  5CAI A;  2VGM A;  2ZPG B;  3JRZ A;  1XTD A;  4JS4 A;  1UGQ B;  2LX9 A;  2P0K A;  3FEO A;  5GMK m;  3E19 A;  1B34 A;  3M4Y A;  1Q81 C;  4XTW A;  2P0P A;  3OYD A;  4ZTF A;  2HQX A;  2ZPI B;  3OMC A;  2PVO B;  2RHU A;  2I2L A;  5GMK i;  4C92 E;  3L2Z A;  3QYH B;  4C0G A;  2LQK A;  3I56 A;  5GAO m;  4C92 G;  1Y71 A;  4Y91 A;  1JJ2 A;  3VV0 A;  1VQ4 T;  2PUO B;  3QUI A;  3P8H A;  1UGP B;  3OYM A;  1G5V A;  2DTI A;  4JDS A;  1N6A A;  3A8M B;  1YI2 A;  2GFU A;  1OZ2 A;  5LJ3 g;  2KDS A;  3ZBD A;  1W2B A;  5HK0 A;  2Y90 A;  2YLB A;  5GAM h;  2LNV A;  3JB9 J;  2RM4 A;  2DZC A;  3H6Z A;  3CCE T;  1ZHI A;  2FVU A;  3JB9 I;  2M9U A;  4EMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...