3NFCA

Crystal structure of e.coli mazf toxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
94
Chain Sequence
YVPDMGDLIWVDFDHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PemK-like protein 1
publication title Biochemical and Structural Analysis of E. coli MazF Toxin
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 94
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nfcA00
5CKDA 4OF1A 5CKFA 3VUBA 5HK3A 4MZPA 5CK9A 5HK0A 3TCJA 1X75C 5CQYA 4VUBA 5CCAA 4MDXA 3NFCA 4MZMA 5HKCA 1M1FA 4ME7A 3G7ZA 2KMTA 5CO7A 2VUBA 1NE8A 5CKBA 5CKEA 4ELYC 2C06A 4MZTA 4HKEA 3JSCA 1VUBA 5CQXA 4ELZC 5CR2A 1UB4A 5DLOA 3JRZA 3HPWA 5CKHA 2MF2A
chains in the Genus database with same CATH superfamily
4EMHA 2PVGB 4PJOB 3OS0A 1OV3A 4PJOF 5GANj 1VQOQ 2VXEA 4HA8A 1WHHA 5KYXB 2GTOA 2YWWA 2ZPBB 1CSKA 2E10A 1QMCA 3OYJA 3VKIA 2QGFB 1M1KR 4BDZA 1TXQA 2L89A 4M78C 2HQEA 3I5SA 2WSFE 2OTJT 1V29B 3RDVA 1MHNA 3KXTA 1ZSGA 2D9TA 2QEXT 2QI2A 2ATCB 2KI7A 3M0PA 4EDUA 4FSXA 2HDAA 2JW4A 1SHFA 4Y28E 4EMGA 2X9HA 3JV3A 3BE3A 1K9AA 2QQSA 5HK3A 1H8KA 2HCKA 3CPFA 1VQ8T 2DL5A 2MK5A 2CZ0B 4KT0E 1YHQT 3EG1A 4R55A 2E3HA 2HSPA 3G7ZA 4FIBA 1JXMA 2DZCA 4M75B 2M1HA 2R5MA 2VASA 3CBOA 4PJMA 5EC7A 2C06A 3DLLA 1G3WA 4QQGA 1MGQA 5KYUA 3CC7T 3GP8A 1WA7A 3UDCA 2QDYB 2YUOA 4M75F 1WIEA 3QWYA 3PMTA 2E4HA 3EGXA 2A3LA 1M4ZA 2NUPB 4MZPA 4XTZA 1WFWA 4M7DD 1RAAB 5HY6A 1B07A 2RB6A 4KRTA 2XICA 4C8QB 2D6FA 1MUZA 4M7DG 1XOVA 1X43A 2EYWA 3JCMb 2DYIA 5IAYA 1YITQ 2LX7A 5GAN5 2FRYA 4JLIA 5LJ5f 1E7OA 1Y0MA 2JT4A 3JCMf 4E7SA 2XK0A 3MJXA 3FJ5A 4J7FA 4QVZA 1RACB 1SRMA 4OB0B 3VUZA 3JB9H 3A8LB 2V8KA 4BE1A 3KFVA 4CI0C 5CKHA 1TOVA 4RMOA 1O9SA 3JB9G 1K9MU 4RKUE 2QA4T 1G8XA 1LPLA 3G4SQ 2D8JA 5GAN8 3MPUB 1U8RA 1B3QA 2E3IA 3QJ6A 3SFMA 3OMGA 1PKTA 2O9SA 2LVMA 2VGMA 1BCMA 2K4YA 2ZPFB 1KSWA 2ECZA 1OX8A 1ARKA 1PG5B 1NM7A 1YCSB 1Y7XA 4ZN1A 1YI2T 4LUDA 2ROTA 3G6EQ 4FT4A 2YRVA 2E65A 1E6GA 5LJ3d 2RH2A 1N8RR 3G71T 1N9SA 3INZA 4HXJA 1VQNA 5KYXA 1PSEA 3D7SB 1UJ0A 2VB6A 1Q86R 1PHTA 2NUTB 3SHWA 3I56A 3CMAT 1KG1A 2SRCA 2DETA 1PD0A 4X9CA 3M57A 2KE9A 2M0OA 4QQDA 2X4YA 4RCCA 3Q1JA 2P4TA 3M0UA 1UGRB 1NBEB 1R8OB 1UGQB 4OMOA 4M7AG 4RCBA 4J9IA 1VQ6A 4IUQA 2CDTA 1QLYA 3AHUA 4RTUA 3RR6A 3H41A 3OS1A 2K3BA 5CQXA 1Y71A 2O2OA 2V1RA 5GMKj 2RNAA 2P0PA 3CCLQ 1VQ4Q 2DVEA 2COYA 2OTLT 3CC4A 4OF1A 2L5QA 2PQWA 5HK0A 4OB1B 3A8GB 2JVVA 2P84A 1G83A 5GMKm 4AFQC 1I5LA 3L2RA 1UGSB 3OYLA 5AYFA 2KSSA 2VC8A 5GAMf 1W70A 2FZGB 2KRMA 4A54A 2HKNA 1MNEA 4CC3A 2AK5A 3DB3A 4BDYA 5CKFA 4C8QA 5I21A 5KYNA 4ZNXA 4F16A 3CPWP 4MDXA 1LNXA 2QTXA 1LOJA 1VQKQ 4BE2A 2VGNA 3PNWC 1GFDA 2RJEA 3JCMW 3M9QA 3HRSA 3L2QA 1DJ7B 3WVEB 4M7DE 1RUWA 2DAQA 4M78B 3LX7A 2RK2A 4X34A 1PD1A 1OZ2A 3CCSQ 3CCVA 2EJGA 1ZA1B 4BE0A 3E1SA 2QDLA 1BCOA 1ZBJA 2ZPIB 5GAOp 2F5KA 2YSQA 3A98A 2PZ1A 5IXFA 4XTVA 1UEBA 2K3XA 3OW2A 1RAHB 1M30A 1FMVA 4ZGDB 6AT1B 1M1KC 1QKWA 3CCET 1KQSA 1Q7YU 2F2XA 1WHLA 4MZTA 2HL3A 4N4GA 3CCJA 3GIBA 3OSSC 3QHSA 2DL3A 3HTRA 4C5EA 4BY6C 2FPEA 4M4ZA 4Y92A 1RLPC 2H3JA 2NUTA 1YBYA 2RJCA 1QVFS 2LDMA 2J7IA 2PVDB 1LJOA 1HXDA 1H3ZA 5LL6S 1VUBA 4EMKC 3G1JA 2RHIA 5CKDA 1T0HA 4JLGA 3QKJA 2CH4W 1SG5A 2YUQA 4HVVA 3X20B 3CCMQ 2A37A 2E6ZA 4M7DC 5I2MA 1GCPA 2RI5A 1GRIA 3CXCS 3R6NA 5CKEA 4F7UA 4KGZB 3OY9A 1OZ3A 5LJ5d 2F1LA 3EGUA 3DB4A 3JCMd 2DXTA 4DOVA 2E12A 2GFUA 5AT1B 2A0FB 3EH2A 3UWNA 2B86A 3V8KA 1AD5A 4ANJA 4CRIA 5LJ3e 3CCRQ 2IIMA 5DLQE 3LGFA 3RESA 3HRTA 2DTOA 2ZCFB 1YITA 1MV0B 4J8OA 3VUBA 2CGHA 5A0LA 4HCBA 3C95A 3I5RA 2BE9B 3TCJA 2CT3A 1YIJT 1WJRA 2HAXA 1PRLC 2QEXA 4A63B 2EJFA 4JS4A 4J6YA 1U1TA 2CP5A 4GY5A 4M78A 2LQNA 5GAN3 4O6JA 2CSIA 5IHNA 2EFIA 1OYXA 4OMNA 1AWJA 4X1VA 2L8DA 3C94A 1UECA 2QASA 2XU8A 1VQ8A 1VQNQ 2FZCB 3S3OA 3I56Q 1QQJA 3L1AA 3V7SA 4BUGA 4J9FA 2DTHA 3EHQA 3G4SA 1YJWA 2CP0A 2RQUA 1IHWA 2GQVA 1TUGB 4HKEA 1OX9A 1Q86C 4XAXB 1NLOC 3OYHA 1VQ9T 2EQMA 2OJ2A 4PJNA 2D0NA 2K5FA 2CP2A 1K1ZA 2VKNA 2QQRA 3MP6A 4OB2B 5LJ3h 2DIQA 1FYNA 2J6FA 1MMGA 4DBQA 3V7RA 4F14A 1H641 2Y90A 1KIKA 4M77G 2EYZA 1WDXA 4NL3A 3NPFA 2JTEA 2K79A 1SPKA 1Z9QA 5KYWB 3FB9A 3CC4Q 3CCQA 3VYGA 3CCUQ 2HSEB 3RKWA 1BI1A 2QTVA 5GJWB 1LVKA 2DVJA 3P8DA 4C92F 2KT1A 2XHCA 3NTKA 5A0GA 3I55T 1YJ9T 2QYZA 4Z8AA 1NYFA 5D6WA 2KGTA 1FWZA 3E2UA 2LP5A 2L2PA 3TQ7P 5GAMd 2V1QA 3QSUA 1BIBA 1UGPB 3CCLA 3CBMA 3CD6Q 1HJDA 2A08A 1D1BA 3M0SA 2CKKA 4E7KA 3H0HA 3PFSA 5A2QE 1VQ7T 1PRMC 4PJJA 2C0OA 1YI2A 1XNIA 4ZTFA 5CR2A 4XTXA 3FC3A 4BACA 2RQRA 3VS1A 1IZ6A 1OEBA 1VIEA 4C92D 1VQOT 1KD1R 4E7LA 2JM8A 1VQMQ 3CCVQ 1MNDA 1KK7A 2O88A 5EG2A 3RMSA 1U5SA 2HEQA 3SEMA 4BY6B 2HL5C 1VQKA 4EIKA 2R57A 4J6XA 4ORZA 4ZTJA 1B7TA 1NEBA 3BDLA 1R0BG 1TS9A 2DEUA 4JRPA 4DEXA 1AZEA 1D09B 3QUIA 3L2ZA 4JJNK 5FU7B 1M8MA 2JMAA 4LDUA 4OP0A 4EMKB 1Z9ZA 2DZ9A 5HCKA 1NE8A 1MV3A 4E7ZA 3CCJQ 2FZKB 2O4XA 3CCSA 3EG3A 2W0ZA 2WSCE 3JAME 2MF2A 3TSWA 1I8FA 1Q82U 5I2SA 4M7DB 2YLCA 3GOXA 2QGGA 3E19A 4LXCA 5CCAA 4V2SA 2K57A 2BUDA 4FW1A 2DRKA 5HKCA 5LJ5e 4JRIA 4M7DF 1PC0A 3I9QA 2LMJA 1MMAA 3OW2P 1T3SA 1IO6A 1X2KA 1RAGB 3SD4A 2EJ9A 2X3XD 3GF5A 4KH0B 4AFZC 1KQSP 3H0IA 3VRYA 1VQPT 1AWXA 2KXDA 4LE9A 1S72Q 1YJNA 2ABLA 4IURA 3F70A 4QW2A 2ROLA 2DE0X 1M8VA 4J9BA 1RADB 4E6RA 2B8AA 3GPLA 2WSEE 1G5VA 4KUDK 4M77E 2I0NA 2COWA 1O75A 3MP1A 3JB9F 5LJ3g 3RMQA 3OS5A 3OSVA 2RQVA 1BK2A 1M1GA 1X27A 3OYIA 2DILA 2O31A 3CCMA 3ER0A 5GAOm 5LJ5h 2EYQA 3RUXA 1B34A 1WQ7A 3LYIA 1CKAA 2GQIA 5KCOA 3C12A 3JCMh 2HNIA 2AZSA 2FG0A 3ZFJA 2LZ6B 1KC8C 1JJ2A 1VQLT 3PVLA 2QEXQ 5KYYB 1CKBA 3G6ET 4N0AC 1OU9A 2K9GA 2DMOA 2LRQA 1TUDA 2JOYA 2EVRA 3M59A 2PVOB 4ELYC 3JCMV 3HL8A 3JB9D 5D6YA 1VQ8Q 4AG2C 1KJWA 3UA7A 2KT8A 1ZQ1A 1WGSA 2RM4A 3EGDB 2FPFA 1GBQA 3CCRA 3NTIA 5GAN6 4M7AF 2J6KA 1YJWQ 3CC7Q 3J80E 2FRWA 1VYTA 1PSFA 2M02A 2MIOA 2VWFA 1AEYA 3RBBB 4PL6A 2F2VA 1D3BB 5GMKl 1QCNA 4C92E 2JXBA 3DLMA 2FB7A 4KBMB 4PJOA 4J9GA 2PUOB 3OYMA 2DJZA 1R0CB 2V26A 3L2VA 4C0GA 1S1NA 1VQ4T 4EMKA 3MHXA 4B6MA 1ZSZC 3EAEA 3UF4A 5IN1A 1NLPC 2EQJA 4M77C 2E1HA 3H0FA 3H9NA 3HP9A 1VOMA 2VUBA 1QVGA 3QJYA 5GANf 3JSCA 1AZGB 4LDYA 3CCQQ 3CMEA 4C8QG 2RMOA 2L3SA 2JS0A 1WXUA 4JS5A 4M7AD 1K9MR 1HYOA 3QYHB 2E5KA 3LW5E 2RI2A 4J7IA 4PKCC 1I0CA 1YFNA 2GGRA 2J6OA 2FHDA 1N5ZA 3ZBDA 3QXEB 1OU8A 3QYGB 2CUDA 2QA4Q 5CIUA 2L3PA 1KHCA 1ZUUA 3MEVA 2HMAA 1BIAA 2KAFA 2X4JA 2LTOA 1VQ5A 1JRIA 1QWFA 3M0TA 1AT1B 4GBQA 3MP8A 3OS2A 3EFOB 3EFRA 3CCUA 4M75A 1YI2Q 3CPWS 4A53A 1WZOA 2LJ1A 5GAMh 1IXDA 1WLPB 2PTKA 1WPYA 5GAN4 4IKFA 2M51A 2NUPA 4JRQA 5FRNA 1VYUA 3M53A 5FWBA 1Q95G 3VS4A 4C92C 4KUIA 3J81E 1KD1C 2DD5A 1AHJB 1QCOA 3CD6A 3VS0A 2KY9A 3V8LA 3R6OA 4MMKA 1HK9A 3LH5A 2CP3A 2JM9A 2BE7D 1PM3A 2CP7A 4BB7A 1K8AR 1NJIU 5KE3A 2F2WA 2MAMA 1R77A 2KR3A 5KYYA 2XI9A 3BFMA 1ABOA 1ZBXA 3META 1KQ2A 3NTHA 2XD0A 2DNUA 4KGXB 4J9CA 1Q81R 1EIFA 1XTDA 3OYYA 3RKXA 3VRZA 3EG9B 5FWCA 1W2BS 1K4US 4VUBA 2X35A 1VQMA 2OI3A 4RTVA 4FYVB 5D6XA 1A0NB 2JN0A 2ED1A 2XIDA 1I5OB 3EGDA 5LJ5g 1D0ZA 1OPKA 4Z88A 3JCMg 1TSFA 4D8DA 1QP3A 2NLUA 4OMMA 4PNOA 4RTZA 1QW1A 3V7CA 1YJ9A 1W6XA 3M0RA 4F7UG 4YTLA 2H8HA 2ZGWA 5A0DA 3SWNC 4NL2A 2XMFA 3TU4K 4C0DC 4ZGEB 2E6NA 4XU1A 4ATOA 4OMLA 3RKYA 3VS5A 4LNPA 1IRXA 1KFZA 1YJNQ 1ZLMA 1UJYA 2DYBA 2KYMA 4A4GA 1X6BA 5LJ3j 2AZVA 5C0MA 1UUEA 1VQ7A 5FW9A 3PE0A 3EG2A 3FLGA 4MZMA 4PK4A 1OI1A 2EW3A 4JUVA 2FL7A 1X69A 1NZ9A 2IVWA 3FRNA 4FW2A 5FU7C 4L5GA 3OQ5A 1YP5A 1D1AA 4DBRA 4BD3A 2EGEA 5GAOr 4ZN3A 3SDZA 3VV0A 2PNIA 4M78G 4OMFB 3CC2T 3M4YA 1M1FA 3OYCA 1Q7YR 1S72A 4M7AE 4DA4A 1C1AA 2YLBA 5FU6C 4HVWA 2CT4A 3HPWA 3BY7A 3X24B 1KC8U 1UG1A 4A4FA 2RF0A 3EFOA 3H8ZA 1E6HA 1ZA2B 2DBMA 2COZA 4LD6A 2HBPA 4KGVB 4LD9K 2P0KA 5CK9A 2FYKA 2XDPA 1VQNT 1JU5C 2L3QA 2Y4XA 1WNLA 3UATA 2P0QA 3I56T 5C6SA 5IXBA 1WXBA 3A8OB 4XQ3A 2LCSA 1ZSZB 2HD0A 1JB0E 4XTYA 3L2WA 2LCLA 4M77B 3ZEHA 1JQQA 2RJFA 4BI4A 4LDVA 2OTJA 4X9DA 2BKDN 1RL2A 2H3EB 5M9OA 4M77F 1VQ6T 5GAMg 2BZ8A 4FYWB 1JJ2P 4QVDA 1QP2A 5KCHA 1NPPA 4HCZA 4OGCA 4OMPA 2QQ9A 1IHVA 2GF7A 2OX7A 3OYAA 2BZYA 1GFCA 5J26A 1YHQA 4HCKA 1SHGA 4F17A 3CC4T 3MEAA 3A1PA 3X26B 1X75C 1WX6A 4FYYB 3OBWA 5GMKi 3URGA 4OVAA 1N8RC 3O8VA 4FSSA 2AT1B 3CMEQ 4XTWA 5CKBA 5GANd 3CC7A 2EGAA 5DY9A 3FEOA 1BB9A 1ABQA 5GAN7 1SEMA 1RABB 2BZXA 2DERA 4FYXB 1WXTA 4FM4B 1AOJA 2EAYA 2RO0A 1UDLA 3QO3A 4HT9A 4M7AC 1AVZC 1K9MC 3MEWA 3NMZC 4GLMA 4M77D 2MI6A 5CVIA 3LWIA 1WHJA 4F7UE 1ZUKA 2VYTA 4P5NA 3CQTA 1VQ5Q 3BDUA 2KYBA 1FX7A 4PJLA 3HFNA 1YIJQ 3EFSA 4C92B 2K7AA 4IUVA 2J06A 3WVDB 1I07A 2KDSA 2RA2A 4E47A 1QVGP 2DTIA 1PCXA 2RJDA 4CC7A 2LCCA 2EQUA 3CCVT 2GBQA 2RHZA 2ESWA 2LNHB 4ELZC 4R56A 1ACMB 1M2OA 2QA4A 1QVPA 2EYXA 1KD1U 5KYUB 3BW1A 1X2QA 3ZL7C 2GTJA 1QWEA 1G3TA 2CS7A 4Q5WA 1VQ9Q 4XU2A 1TG0A 5J3BA 3EGXB 1JO8A 4RTTA 5FRMA 2K2VA 3V8JA 2MMPA 3L42A 1M27C 3TVTA 5LJ5j 2E41A 1BU1A 4FU6A 3T9NA 1K8AC 2P4RA 2MPXC 3KBGA 4WF2A 1D1CA 3G71A 3CCJT 3FIFA 1D0XA 1M3BA 3SWNB 4J9EA 4NS5A 1OOTA 4C0DB 4II1A 1TTHB 3CMAA 2VVKA 2D8HA 2KMTA 1Q81C 2YRDA 2RD1A 2DK3A 4RTXA 3M54A 3QZ5B 4QQ6A 4ZGJB 4Z89A 3M56A 3I55Q 1YJ9Q 2ED0A 3HFOA 1BI3A 2CZ7B 3S6WA 2DF6A 3H6ZA 1OPLA 1M1KU 3I35A 4CC4B 3A8HB 2JTMA 2CH4A 2CREA 5GAOq 2VXFA 1J3TA 2C0IA 1W2BA 4J9HA 4O5VA 2CSQA 1XQHA 3MCAB 2VV5A 1U3OA 3OW2S 5I22A 2E5QA 2OTLA 4JJDA 2KXCA 3E9FA 1VQ7Q 2DA9A 2LNVA 5IHIA 1KQSS 1YN8A 4HVUA 2DFUA 1Y57A 2C0TA 4A4HA 4IUUA 2LT4A 1FMWA 2SEMA 5FU6B 3SB2A 4RG8A 1FMKA 3JCMJ 1WQWA 1M90R 1UFFA 1ZHIA 2JJ9A 3JCMe 2DM1A 1PKSA 1K73R 2JUFA 5IH2A 2RQWA 3OYNA 3HRUA 4JDSA 1BI2A 1BI0A 2DX1A 2EKOA 3TSZA 1YITT 2J05A 2KVQG 3M0QA 2GFAA 3OBYA 2D1XA 1M2VB 5CO7A 3GLXA 1G3SA 5KYWA 4C92A 4E2FB 3OYDA 4PLLA 4J9DA 1Q7YC 4WTOB 1AWOA 1QVFA 1GXIE 2K5LA 1WHGA 2KRSA 1Q82R 3JCMX 2DPPB 4PJOD 1I1JA 2DJQA 8ATCB 2ZPHB 1GCQC 1V1CA 5J39A 2HZYA 2YDLA 4PJOG 3GNFB 3LWHA 2JS2A 4N4HA 1YJWT 1TU0B 2KNBB 3G4ST 5GAMj 3VS2A 2Y4YA 3CXCA 2BTTA 4E7HA 4NOYA 4RTWA 2OTJQ 3C4SA 2LT1A 1WHKA 1M3CA 2YUPA 5GANe 3IQLA 4RTYA 5KE2A 3CCEA 1IGUA 2EQIA 2LC4A 2RPNA 2KROA 1GBRA 1U06A 1X6GA 1WHMA 4QT7A 1VQPQ 3M55A 4OMQA 5L8RE 4AMCA 3J7AF 4FCYA 1X01A 4LDWA 2I2LA 4C8QF 2MCNA 1SSHA 4M7AB 1SSFA 1P92A 1SKUB 3SWNA 2L0AA 3EG0A 1YHQQ 1LCKA 1KQ1A 1YWPA 1TUCA 3CCQT 1N8RU 2MYSA 3LGLA 1JEGA 1Q86U 4OGEA 2NWMA 2O9VA 2EWNA 2D0QB 4M75D 2FO0A 4WCIA 5GAN2 2V8JA 2ZZDA 1I4K1 1YNZA 2CZ6B 3X25B 1IGQA 1YWOA 4M75G 5KH6A 3CC2A 3CCLT 3GNGA 4J83A 2DL8A 2GNCA 2MOXA 3NFCA 5GAMe 3JCMQ 3QDFA 3ASKA 4AG1C 4C8QD 5GANh 1K0XA 5D7UA 4ESRA 4QVCA 2FVUA 2XG8D 3REBB 1VQLQ 2MWPA 1RI0A 4PFPA 4M7DA 2JNGA 1WJSA 3M5AA 1EFNA 2G6FX 1V76A 2X51A 2YXYA 5CQYA 4B9WA 4CC2A 2EIFA 5FROA 5GAOn 3LLRA 2AKLA 3A5ZB 2KBTA 1W4SA 1FXXA 2YHTA 1KHIA 3C0CA 2M0YA 5FLXE 1VQKT 3VJPA 2A28A 2IPOB 1K76A 1M2VA 1YIJA 1D0YA 3JCMP 4K11A 3QBYA 2HQXA 2RHYA 1OQKA 4GLKA 3P8HA 1K8AU 4R0KA 1OULA 2DEQA 1UB4A 2O01E 3G71Q 2QQAA 3CCST 4DEYA 4F7UB 2KRNA 3MKDA 3VS7A 4J5YA 4PLIA 2DRMA 3P8BB 4L59A 1Q81U 3CMAQ 1T3LA 3VU3C 4IUPA 4F7UF 3PT9A 5IHKA 2QG9B 4XU3A 3VS3A 2YT6A 1SF9A 3QWXX 1WYXA 4IIOA 3RNJA 4A4EA 2Z0WA 1VQ9A 1UHFA 2QAZA 2DXUA 4FL6A 4LUEA 2DO3A 4TVRA 4PJOE 3GBQA 4LDXA 1XJWB 2F5TX 4HCCA 4C0FA 3L2UA 2CP6A 2A7YA 2L3RA 1YJNT 3OYGA 4AT1B 4M7AA 2EBPA 2LQKA 2CUBA 4AFSC 2QXFA 2OTLQ 1HSQA 2YUNA 2GCXA 4BI8B 1C0MA 3QIIA 1C6VX 2V8IA 2M16A 3RERA 1W1FA 2AIRB 1EX4A 1VIFA 3I55A 3PIPA 1D3BA 4M78F 4HT8A 9ATCB 1JBMA 2M9UA 5GMKe 4PFOA 1UE9A 2QQBA 4FT2A 4JZ3A 1NJIR 3CCMT 1M90C 3QDRB 3OYFA 3MEUA 1HD3A 3KUFA 1K73C 1BKBA 1W2BP 2CYZB 3REAB 3PGGA 2OAWA 2DLPA 2EQKA 4M75E 4QKUA 2CZ1B 4ME7A 3WXMB 2EPDA 1N6AA 2ENMA 3S3MA 1N27A 2NYSA 1TWBA 4E7IA 4JZ4A 1VQOA 3OA6A 2DXBA 4M78D 1WI7A 4C8QE 2AHJB 3CCRT 3JB9J 1Q82C 1PWTA 1RLQC 4J6WA 3UT1A 2ZAEA 4PJOC 2LX9A 5I11A 2K6DA 5GANg 4AFUC 5GJVB 1VA7A 3NHNA 1BYMA 4C0ZA 5GMKh 3MO8A 1NYGA 4C5IA 1UGVA 3U23A 4C5HA 3OYKA 3HHTB 3RIRA 3CCEQ 2X4WA 2LQ8A 4XK8E 1M3AA 2JZ2A 2HKQB 3PMIA 2K3YA 1QVFP 2K2MA 4E7JA 1I81A 4UC4A 1VYVA 3VYHB 4Z02A 3PVQA 3PTAA 4JJBA 1JJ2S 3QG1A 2AKKA 3CMET 2KK4A 5IT9E 4A4KA 2EKHA 2JTFA 2W10A 1Y96B 3N5BB 1NPRA 1QKXA 2RK1A 4RUGA 3CXCP 2KQWA 1AWWA 2FEIA 1EZZB 3A8MB 2EGCA 3UA6A 2YRCA 1M5Q1 4DOWA 1NG2A 2LJ3A 2RI3A 4KH1B 1KC8R 1TH7A 3FDRA 4M75C 1VQPA 4EPCA 3CC2Q 1ZUYA 3EG9A 3JB9I 2E64A 1VQ5T 2NUZA 3M4GA 1PNJA 2XDBA 1N9RA 3OYEA 3CCUT 3VS6A 4C8QC 2ZPGB 2KEAA 1RAFB 2XDDA 2PU9B 4F04B 1JXOA 2O4XB 4MDWA 1YCYA 3E9GA 1IREB 2ZPEB 1QVGS 4DQ2A 1BBZA 2JMCA 3X28B 2DIGA 4MMLA 4Y91A 2HQHA 3UPUA 2FPDA 1K0SA 3CD6T 3CEYA 2E70A 4DBHA 8AT1B 3S3NA 1GL5A 3JRZA 4L6V5 1UTIA 1GCQA 2LQWA 1VQLA 4BI3A 3PIOA 1ZX6A 1VQ6Q 2X4XA 3G6EA 5LJ3f 2DD4A 1RI9A 3OMCA 2F69A 2RQTA 3TEEA 2QK0A 2DL7A 3OB9A 1T0JA 1VQMT 4N4IA 2RHUA 2R58A 4N0AA 4XU0A 3JCMc 4IIMA 1SRLA 3O5ZA 4JRKA 2LJ0A 3EHRA 5CAIA 2G3RA 1U1SA 3ME9A 4DBFA 2DKGA 3TREA 1MMDA 2IG0A 1X6OA 4M78E 2MWOA 4LN2A 3THKA 7AT1B 5DLOA 1NEGA 3CPWA 2PUKB 2RHXA 1UHCA 3QZ9B 2RN8A 4XTUA 1H92A 1MMNA 1IB8A 4KULA 1VQ4A 2XKOC 1B34B 4D8KA 2DBKA 1G3YA 3HSBA 3AT1B 5ECAA 2DXCA 2OAUA 4OB3B 1RAIB 4PFZA 3OYBA 2EYYA 2X3WD 4JPBW 1H3HA 3ULRB 2A36A 1ZSZA 3DKMA 1Y07A 2R5AA 2HBWA 4M77A 4JJCA 4IUTA 3HKSA 1RAEB 5DM7R 1WJQA 4RG2A 1QCFA 3NGPA 1Y96A 2WACA 2K5IA 3QPHA 4C92G 3FJPA 3LH0A 1G2BA 4B9XA 4D6WA 2BIVA 5L23A 2DL4A 1M90U 1M9SA 1S72T 1F1BB 3M58A 1K73U 4C5GA 3EH1A 3CBPA 1NJIC 5GAOl
chains in the Genus database with same CATH topology
2L8DA 4EMHA 4M75G 3C94A 2XU8A 1QP3A 1VQ8A 5KH6A 2NLUA 2PVGB 4PNOA 4PJOB 1QW1A 3V7CA 1YJ9A 3CC2A 3S3OA 3OS0A 3GNGA 3CCLT 4J83A 4F7UG 4YTLA 3NFCA 5GAMe 3L1AA 2ZGWA 3JCMQ 3V7SA 4BUGA 5A0DA 2DTHA 3ASKA 3G4SA 1YJWA 3SWNC 4PJOF 4C8QD 2GQVA 4NL2A 5GANh 4QVCA 5GANj 2FVUA 2XG8D 3TU4K 2VXEA 4HA8A 4C0DC 4HKEA 2E6NA 4XU1A 4ZGEB 1Q86C 4ATOA 4XAXB 3RKYA 2ZPBB 2E10A 2MWPA 1RI0A 3OYHA 1VQ9T 2EQMA 4M7DA 2JNGA 2K5FA 3OYJA 3VKIA 1WJSA 2QQRA 3M5AA 3MP6A 4OB2B 5LJ3h 4A4GA 5LJ3j 2DIQA 4BDZA 5C0MA 3V7RA 1VQ7A 2L89A 4M78C 5CQYA 1H641 2HQEA 4B9WA 2WSFE 2EIFA 3FLGA 4MZMA 2OTJT 2Y90A 1OI1A 1V29B 5FROA 4JUVA 4M77G 2FL7A 5GAOn 1NZ9A 1MHNA 2IVWA 3LLRA 3FRNA 3KXTA 2D9TA 2QEXT 2QI2A 4NL3A 3A5ZB 5FU7C 4L5GA 3OQ5A 1W4SA 1FXXA 2YHTA 3FB9A 1KHIA 5FLXE 4EDUA 1VQKT 4FSXA 3VJPA 4BD3A 3VYGA 3CCQA 4Y28E 4EMGA 5GAOr 3RKWA 4ZN3A 3SDZA 3VV0A 1BI1A 1YIJA 2QQSA 5HK3A 3JCMP 3CPFA 3P8DA 4C92F 1VQ8T 2XHCA 2CZ0B 3NTKA 5A0GA 4KT0E 3I55T 4M78G 1YJ9T 4OMFB 1YHQT 3CC2T 3M4YA 1M1FA 4R55A 4FIBA 3OYCA 3G7ZA 1S72A 3QBYA 2DZCA 5D6WA 4M7AE 4DA4A 1FWZA 4M75B 2HQXA 2M1HA 2R5MA 2RHYA 2YLBA 3CBOA 3P8HA 4GLKA 5FU6C 3DLLA 1K8AU 1G3WA 2C06A 2DEQA 5GAMd 4QQGA 1UB4A 2O01E 1MGQA 3CC7T 3HPWA 3BY7A 3GP8A 3X24B 1KC8U 3UDCA 2QQAA 3CCST 3QSUA 4F7UB 2QDYB 4A4FA 4M75F 3H8ZA 1BIBA 4J5YA 3P8BB 1UGPB 4PLIA 4LD6A 2HBPA 3CCLA 3PMTA 4L59A 3CBMA 1Q81U 2A3LA 1M4ZA 4XTZA 4MZPA 2P0KA 5CK9A 4LD9K 2CKKA 3VU3C 4IUPA 4F7UF 4E7KA 4M7DD 5HY6A 2RB6A 2FYKA 2XDPA 3PT9A 2XICA 3PFSA 4C8QB 5A2QE 1VQ7T 4XU3A 2D6FA 1VQNT 4M7DG 1XOVA 2Y4XA 1XNIA 1YI2A 4ZTFA 1WNLA 4A4EA 3JCMb 5IAYA 2P0QA 1VQ9A 5CR2A 2DXUA 4FL6A 5C6SA 3I56T 5GAN5 4XTXA 3FC3A 4BACA 2DO3A 4TVRA 4PJOE 3A8OB 4JLIA 1IZ6A 4XQ3A 5LJ5f 4LDXA 1VIEA 4C92D 1VQOT 2HD0A 2F5TX 1JB0E 4XTYA 3JCMf 3L2WA 2LCLA 4E7LA 4M77B 3ZEHA 4HCCA 2RJFA 4C0FA 4BI4A 3L2UA 4LDVA 2XK0A 2OTJA 2A7YA 4X9DA 2L3RA 4J7FA 2BKDN 1YJNT 4QVZA 3OYGA 1RL2A 4OB0B 5EG2A 3RMSA 4M77F 2LQKA 3VUZA 5M9OA 1VQ6T 4M7AA 5GAMg 3JB9H 3A8LB 2QXFA 2GCXA 4QVDA 2V8KA 4BE1A 4BY6B 1QP2A 4BI8B 5KCHA 1VQKA 1NPPA 2R57A 4HCZA 4J6XA 4OGCA 5CKHA 3QIIA 4CI0C 4ZTJA 2V8IA 2M16A 3BDLA 4RMOA 3RERA 2QQ9A 1O9SA 2GF7A 3JB9G 1K9MU 4RKUE 2QA4T 3OYAA 4JRPA 1VIFA 5J26A 3QUIA 3I55A 3PIPA 1YHQA 3CC4T 3MEAA 5GAN8 1U8RA 3X26B 1D3BA 1X75C 3L2ZA 4M78F 3QJ6A 4JJNK 4HT8A 5FU7B 3SFMA 1JBMA 2M9UA 3OBWA 3OMGA 3URGA 5GMKi 5GMKe 4OVAA 4LDUA 4OP0A 2LVMA 2VGMA 2QQBA 3O8VA 4FT2A 4EMKB 1N8RC 2DZ9A 4XTWA 2K4YA 1NE8A 2ZPFB 5CKBA 5GANd 3CC7A 5DY9A 3FEOA 2O4XA 3CCSA 1Y7XA 4ZN1A 5GAN7 1YI2T 3CCMT 1M90C 3QDRB 3JAME 2WSCE 3OYFA 3MEUA 4FM4B 2MF2A 4FT4A 2EAYA 2RO0A 1I8FA 3KUFA 2YRVA 3QO3A 1Q82U 1K73C 4HT9A 4M7AC 1BKBA 2E65A 5I2SA 4M7DB 2CYZB 2RH2A 2YLCA 3PGGA 5LJ3d 3G71T 3GOXA 1N9SA 3E19A 1K9MC 3MEWA 2EQKA 4M77D 4M75E 3INZA 5CCAA 4V2SA 2K57A 2BUDA 1VQNA 2CZ1B 2MI6A 1PSEA 5CVIA 5HKCA 3LWIA 4ME7A 5LJ5e 4JRIA 3WXMB 4M7DF 1N6AA 4F7UE 3I56A 3CMAT 1KG1A 2VYTA 4P5NA 3S3MA 4X9CA 1N27A 3M57A 3BDUA 2M0OA 2EJ9A 3SD4A 1FX7A 4QQDA 4E7IA 2X4YA 3HFNA 1VQOA 3EFSA 3GF5A 4RCCA 3Q1JA 2P4TA 4C92B 4IUVA 3WVDB 3OA6A 2DXBA 1UGRB 1VQPT 2KDSA 2RA2A 4E47A 1R8OB 4M78D 1UGQB 4C8QE 4M7AG 2AHJB 1YJNA 3CCRT 3JB9J 2DTIA 4RCBA 1Q82C 4IURA 1VQ6A 2RJDA 3F70A 4J6WA 4IUQA 4QW2A 3UT1A 2LX9A 4PJOC 2LCCA 2EQUA 5GANg 3AHUA 1M8VA 3CCVT 2RHZA 3OS1A 1BYMA 4C0ZA 5CQXA 1Y71A 2B8AA 4ELZC 4R56A 5GMKh 3GPLA 2WSEE 1G5VA 5GMKj 2P0PA 3MO8A 4M77E 4C5IA 4KUDK 2DVEA 2QA4A 1QVPA 4C5HA 3MP1A 1O75A 3OYKA 3JB9F 5LJ3g 2OTLT 3HHTB 1KD1U 3RIRA 3BW1A 3CC4A 2X4WA 2LQ8A 4OF1A 4XK8E 3RMQA 3OS5A 2JZ2A 3OSVA 2L5QA 2PQWA 3PMIA 5HK0A 4OB1B 2K3YA 3A8GB 2JVVA 1M1GA 1G3TA 2CS7A 4Q5WA 3OYIA 5GMKm 4XU2A 1I5LA 5J3BA 4E7JA 1I81A 5FRMA 2K2VA 4UC4A 3V8JA 3L2RA 1UGSB 2MMPA 3L42A 5AYFA 3OYLA 2KSSA 3VYHB 2VC8A 3CCMA 3ER0A 4Z02A 5GAMf 5GAOm 5LJ5h 3PTAA 2EYQA 1JJ2S 3QG1A 3RUXA 5LJ5j 1B34A 1WQ7A 2E41A 4A54A 3LYIA 4FU6A 3T9NA 3CMET 2KK4A 3C12A 3JCMh 5KCOA 1K8AC 4WF2A 3KBGA 2HNIA 5IT9E 3G71A 3DB3A 4A4KA 3CCJT 3FIFA 3ZFJA 4BDYA 5CKFA 4C8QA 2JTFA 5I21A 1KC8C 1JJ2A 1VQLT 3SWNB 4NS5A 3G6ET 4N0AC 1Y96B 4C0DB 4MDXA 3N5BB 1LNXA 1NPRA 4II1A 2RK1A 3CMAA 2QTXA 1Q81C 1LOJA 2KMTA 2KQWA 2LRQA 2VGNA 3PNWC 4BE2A 2RD1A 2DK3A 2RJEA 3A8MB 3M54A 3JCMW 3QZ5B 2JOYA 3M9QA 3M59A 4ELYC 2PVOB 3HRSA 1M5Q1 3HL8A 4QQ6A 3JCMV 4DOWA 4ZGJB 2RI3A 3L2QA 3JB9D 5D6YA 1DJ7B 3WVEB 3M56A 4M7DE 1TH7A 3FDRA 4M75C 1VQPA 4EPCA 1ZQ1A 2DAQA 3HFOA 1WGSA 1BI3A 2CZ7B 4M78B 3S6WA 2RM4A 3H6ZA 3CCRA 3LX7A 2RK2A 3NTIA 3JB9I 2E64A 5GAN6 1M1KU 1VQ5T 4M7AF 4X34A 3A8HB 3M4GA 2JTMA 2XDBA 1OZ2A 5GAOq 3J80E 2VXFA 1N9RA 3OYEA 1PSFA 3CCVA 3CCUT 2EJGA 4PL6A 1D3BB 5GMKl 1W2BA 4C92E 4O5VA 4BE0A 3E1SA 3DLMA 1XQHA 2FB7A 3MCAB 2VV5A 4C8QC 2ZPGB 3OW2S 2ZPIB 5GAOp 2E5QA 4KBMB 2OTLA 2F5KA 2XDDA 2PU9B 4PJOA 2PUOB 3OYMA 2O4XB 2DJZA 3E9FA 4MDWA 4XTVA 1UEBA 1YCYA 2LNVA 2K3XA 3OW2A 3E9GA 3L2VA 1KQSS 4C0GA 1VQ4T 4EMKA 1IREB 3MHXA 2ZPEB 4ZGDB 1QVGS 3EAEA 4DQ2A 5IN1A 4A4HA 4IUUA 2LT4A 2EQJA 5FU6B 3SB2A 1M1KC 3X28B 4M77C 2DIGA 2E1HA 4MMLA 4Y91A 1KQSA 4RG8A 1Q7YU 3CCET 3HP9A 3UPUA 2VUBA 3JCMJ 1WQWA 3CD6T 3CEYA 1QVGA 3QJYA 2E70A 4MZTA 1ZHIA 3JCMe 3JSCA 5GANf 3S3NA 4LDYA 3CMEA 3JRZA 2JUFA 4L6V5 4C8QG 4N4GA 3CCJA 3GIBA 4JS5A 3OSSC 4M7AD 3QHSA 3OYNA 3HRUA 4JDSA 1VQLA 4BI3A 4BY6C 4C5EA 3PIOA 1BI2A 3QYHB 1BI0A 2EKOA 2H3JA 1YITT 2X4XA 3G6EA 3LW5E 2KVQG 2RI2A 4J7IA 5LJ3f 4PKCC 2DD4A 2GFAA 1YBYA 2FHDA 2RJCA 3OBYA 3OMCA 3ZBDA 2F69A 3TEEA 3QXEB 2LDMA 2PVDB 3OB9A 5CO7A 1QVFS 3GLXA 3QYGB 1G3SA 1LJOA 1HXDA 4C92A 1VQMT 3OYDA 1H3ZA 4PLLA 4N4IA 5LL6S 5CIUA 1VUBA 2RHUA 1Q7YC 2R58A 1KHCA 3MEVA 4N0AA 4EMKC 1QVFA 1GXIE 2K5LA 4XU0A 1BIAA 2KAFA 2X4JA 3JCMc 2RHIA 2LTOA 1VQ5A 5CKDA 1JRIA 4JLGA 3JCMX 3QKJA 2DPPB 3MP8A 3OS2A 4PJOD 4JRKA 3CCUA 3EFRA 3X20B 4M75A 2ZPHB 2E6ZA 4M7DC 3CPWS 5I2MA 2G3RA 4A53A 5CAIA 1U1SA 3ME9A 2RI5A 5J39A 2DKGA 4PJOG 3TREA 3GNFB 3LWHA 3CXCS 5CKEA 4N4HA 1YJWT 2IG0A 4F7UA 5GAMh 3G4ST 1X6OA 5GAMj 4M78E 2MWOA 1WPYA 5GAN4 5DLOA 4IKFA 3OY9A 2PUKB 3CPWA 2RHXA 1OZ3A 5LJ5d 3QZ9B 4XTUA 2Y4YA 3CXCA 3DB4A 4E7HA 4NOYA 4KULA 4JRQA 1VQ4A 5FRNA 3JCMd 2DXTA 2LT1A 2XKOC 3C4SA 2E12A 2GFUA 3M53A 1B34B 4DOVA 1G3YA 4C92C 3HSBA 3UWNA 5GANe 3V8KA 5KE2A 3CCEA 4KUIA 2DXCA 3J81E 1KD1C 2DD5A 1AHJB 2LC4A 2OAUA 4OB3B 3CD6A 2KY9A 3V8LA 3R6OA 4MMKA 1HK9A 3OYBA 3M55A 5L8RE 4CRIA 3J7AF 4BB7A 1X01A 3DKMA 1NJIU 5KE3A 5LJ3e 1Y07A 2I2LA 2R5AA 4LDWA 2MAMA 4C8QF 4M7AB 4M77A 1SSFA 1P92A 4IUTA 5DLQE 3HKSA 3LGFA 2XI9A 3RESA 3SWNA 1WJQA 3HRTA 5DM7R 4RG2A 2DTOA 2ZCFB 3BFMA 1KQ1A 1YITA 1Y96A 1ZBXA 3META 1KQ2A 3NTHA 2XD0A 4J8OA 3VUBA 3CCQT 2CGHA 5A0LA 1N8RU 2WACA 3C95A 4HCBA 1EIFA 2K5IA 1XTDA 3OYYA 3RKXA 3QPHA 4C92G 3TCJA 1W2BS 3FJPA 1YIJT 4VUBA 2X35A 3LGLA 3LH0A 1WJRA 4B9XA 2HAXA 2QEXA 4D6WA 1VQMA 1Q86U 4OGEA 2BIVA 5D6XA 1M90U 2EJFA 2JN0A 4JS4A 1M9SA 2XIDA 4J6YA 2EWNA 1U1TA 4GY5A 1S72T 4M78A 2D0QB 3M58A 4M75D 5LJ5g 5GAN3 1K73U 4O6JA 4C5GA 2V8JA 5GAN2 2ZZDA 2EFIA 1OYXA 3CBPA 1I4K1 3JCMg 2CZ6B 3X25B 1NJIC 5GAOl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKD A;  4OF1 A;  5CKF A;  3VUB A;  5HK3 A;  4MZP A;  5CK9 A;  5HK0 A;  3TCJ A;  1X75 C;  5CQY A;  4VUB A;  5CCA A;  4MDX A;  3NFC A;  4MZM A;  5HKC A;  1M1F A;  4ME7 A;  3G7Z A;  2KMT A;  5CO7 A;  2VUB A;  1NE8 A;  5CKB A;  5CKE A;  4ELY C;  2C06 A;  4MZT A;  4HKE A;  3JSC A;  1VUB A;  5CQX A;  4ELZ C;  5CR2 A;  1UB4 A;  5DLO A;  3JRZ A;  3HPW A;  5CKH A;  2MF2 A; 
#chains in the Genus database with same CATH topology
 4EMH A;  2PVG B;  4PJO B;  3OS0 A;  1OV3 A;  4PJO F;  5GAN j;  1VQO Q;  2VXE A;  4HA8 A;  1WHH A;  5KYX B;  2GTO A;  2YWW A;  2ZPB B;  1CSK A;  2E10 A;  1QMC A;  3OYJ A;  3VKI A;  2QGF B;  1M1K R;  4BDZ A;  1TXQ A;  2L89 A;  4M78 C;  2HQE A;  3I5S A;  2WSF E;  2OTJ T;  1V29 B;  3RDV A;  1MHN A;  3KXT A;  1ZSG A;  2D9T A;  2QEX T;  2QI2 A;  2ATC B;  2KI7 A;  3M0P A;  4EDU A;  4FSX A;  2HDA A;  2JW4 A;  1SHF A;  4Y28 E;  4EMG A;  2X9H A;  3JV3 A;  3BE3 A;  1K9A A;  2QQS A;  5HK3 A;  1H8K A;  2HCK A;  3CPF A;  1VQ8 T;  2DL5 A;  2MK5 A;  2CZ0 B;  4KT0 E;  1YHQ T;  3EG1 A;  4R55 A;  2E3H A;  2HSP A;  3G7Z A;  4FIB A;  1JXM A;  2DZC A;  4M75 B;  2M1H A;  2R5M A;  2VAS A;  3CBO A;  4PJM A;  5EC7 A;  2C06 A;  3DLL A;  1G3W A;  4QQG A;  1MGQ A;  5KYU A;  3CC7 T;  3GP8 A;  1WA7 A;  3UDC A;  2QDY B;  2YUO A;  4M75 F;  1WIE A;  3QWY A;  3PMT A;  2E4H A;  3EGX A;  2A3L A;  1M4Z A;  2NUP B;  4MZP A;  4XTZ A;  1WFW A;  4M7D D;  1RAA B;  5HY6 A;  1B07 A;  2RB6 A;  4KRT A;  2XIC A;  4C8Q B;  2D6F A;  1MUZ A;  4M7D G;  1XOV A;  1X43 A;  2EYW A;  3JCM b;  2DYI A;  5IAY A;  1YIT Q;  2LX7 A;  5GAN 5;  2FRY A;  4JLI A;  5LJ5 f;  1E7O A;  1Y0M A;  2JT4 A;  3JCM f;  4E7S A;  2XK0 A;  3MJX A;  3FJ5 A;  4J7F A;  4QVZ A;  1RAC B;  1SRM A;  4OB0 B;  3VUZ A;  3JB9 H;  3A8L B;  2V8K A;  4BE1 A;  3KFV A;  4CI0 C;  5CKH A;  1TOV A;  4RMO A;  1O9S A;  3JB9 G;  1K9M U;  4RKU E;  2QA4 T;  1G8X A;  1LPL A;  3G4S Q;  2D8J A;  5GAN 8;  3MPU B;  1U8R A;  1B3Q A;  2E3I A;  3QJ6 A;  3SFM A;  3OMG A;  1PKT A;  2O9S A;  2LVM A;  2VGM A;  1BCM A;  2K4Y A;  2ZPF B;  1KSW A;  2ECZ A;  1OX8 A;  1ARK A;  1PG5 B;  1NM7 A;  1YCS B;  1Y7X A;  4ZN1 A;  1YI2 T;  4LUD A;  2ROT A;  3G6E Q;  4FT4 A;  2YRV A;  2E65 A;  1E6G A;  5LJ3 d;  2RH2 A;  1N8R R;  3G71 T;  1N9S A;  3INZ A;  4HXJ A;  1VQN A;  5KYX A;  1PSE A;  3D7S B;  1UJ0 A;  2VB6 A;  1Q86 R;  1PHT A;  2NUT B;  3SHW A;  3I56 A;  3CMA T;  1KG1 A;  2SRC A;  2DET A;  1PD0 A;  4X9C A;  3M57 A;  2KE9 A;  2M0O A;  4QQD A;  2X4Y A;  4RCC A;  3Q1J A;  2P4T A;  3M0U A;  1UGR B;  1NBE B;  1R8O B;  1UGQ B;  4OMO A;  4M7A G;  4RCB A;  4J9I A;  1VQ6 A;  4IUQ A;  2CDT A;  1QLY A;  3AHU A;  4RTU A;  3RR6 A;  3H41 A;  3OS1 A;  2K3B A;  5CQX A;  1Y71 A;  2O2O A;  2V1R A;  5GMK j;  2RNA A;  2P0P A;  3CCL Q;  1VQ4 Q;  2DVE A;  2COY A;  2OTL T;  3CC4 A;  4OF1 A;  2L5Q A;  2PQW A;  5HK0 A;  4OB1 B;  3A8G B;  2JVV A;  2P84 A;  1G83 A;  5GMK m;  4AFQ C;  1I5L A;  3L2R A;  1UGS B;  3OYL A;  5AYF A;  2KSS A;  2VC8 A;  5GAM f;  1W70 A;  2FZG B;  2KRM A;  4A54 A;  2HKN A;  1MNE A;  4CC3 A;  2AK5 A;  3DB3 A;  4BDY A;  5CKF A;  4C8Q A;  5I21 A;  5KYN A;  4ZNX A;  4F16 A;  3CPW P;  4MDX A;  1LNX A;  2QTX A;  1LOJ A;  1VQK Q;  4BE2 A;  2VGN A;  3PNW C;  1GFD A;  2RJE A;  3JCM W;  3M9Q A;  3HRS A;  3L2Q A;  1DJ7 B;  3WVE B;  4M7D E;  1RUW A;  2DAQ A;  4M78 B;  3LX7 A;  2RK2 A;  4X34 A;  1PD1 A;  1OZ2 A;  3CCS Q;  3CCV A;  2EJG A;  1ZA1 B;  4BE0 A;  3E1S A;  2QDL A;  1BCO A;  1ZBJ A;  2ZPI B;  5GAO p;  2F5K A;  2YSQ A;  3A98 A;  2PZ1 A;  5IXF A;  4XTV A;  1UEB A;  2K3X A;  3OW2 A;  1RAH B;  1M30 A;  1FMV A;  4ZGD B;  6AT1 B;  1M1K C;  1QKW A;  3CCE T;  1KQS A;  1Q7Y U;  2F2X A;  1WHL A;  4MZT A;  2HL3 A;  4N4G A;  3CCJ A;  3GIB A;  3OSS C;  3QHS A;  2DL3 A;  3HTR A;  4C5E A;  4BY6 C;  2FPE A;  4M4Z A;  4Y92 A;  1RLP C;  2H3J A;  2NUT A;  1YBY A;  2RJC A;  1QVF S;  2LDM A;  2J7I A;  2PVD B;  1LJO A;  1HXD A;  1H3Z A;  5LL6 S;  1VUB A;  4EMK C;  3G1J A;  2RHI A;  5CKD A;  1T0H A;  4JLG A;  3QKJ A;  2CH4 W;  1SG5 A;  2YUQ A;  4HVV A;  3X20 B;  3CCM Q;  2A37 A;  2E6Z A;  4M7D C;  5I2M A;  1GCP A;  2RI5 A;  1GRI A;  3CXC S;  3R6N A;  5CKE A;  4F7U A;  4KGZ B;  3OY9 A;  1OZ3 A;  5LJ5 d;  2F1L A;  3EGU A;  3DB4 A;  3JCM d;  2DXT A;  4DOV A;  2E12 A;  2GFU A;  5AT1 B;  2A0F B;  3EH2 A;  3UWN A;  2B86 A;  3V8K A;  1AD5 A;  4ANJ A;  4CRI A;  5LJ3 e;  3CCR Q;  2IIM A;  5DLQ E;  3LGF A;  3RES A;  3HRT A;  2DTO A;  2ZCF B;  1YIT A;  1MV0 B;  4J8O A;  3VUB A;  2CGH A;  5A0L A;  4HCB A;  3C95 A;  3I5R A;  2BE9 B;  3TCJ A;  2CT3 A;  1YIJ T;  1WJR A;  2HAX A;  1PRL C;  2QEX A;  4A63 B;  2EJF A;  4JS4 A;  4J6Y A;  1U1T A;  2CP5 A;  4GY5 A;  4M78 A;  2LQN A;  5GAN 3;  4O6J A;  2CSI A;  5IHN A;  2EFI A;  1OYX A;  4OMN A;  1AWJ A;  4X1V A;  2L8D A;  3C94 A;  1UEC A;  2QAS A;  2XU8 A;  1VQ8 A;  1VQN Q;  2FZC B;  3S3O A;  3I56 Q;  1QQJ A;  3L1A A;  3V7S A;  4BUG A;  4J9F A;  2DTH A;  3EHQ A;  3G4S A;  1YJW A;  2CP0 A;  2RQU A;  1IHW A;  2GQV A;  1TUG B;  4HKE A;  1OX9 A;  1Q86 C;  4XAX B;  1NLO C;  3OYH A;  1VQ9 T;  2EQM A;  2OJ2 A;  4PJN A;  2D0N A;  2K5F A;  2CP2 A;  1K1Z A;  2VKN A;  2QQR A;  3MP6 A;  4OB2 B;  5LJ3 h;  2DIQ A;  1FYN A;  2J6F A;  1MMG A;  4DBQ A;  3V7R A;  4F14 A;  1H64 1;  2Y90 A;  1KIK A;  4M77 G;  2EYZ A;  1WDX A;  4NL3 A;  3NPF A;  2JTE A;  2K79 A;  1SPK A;  1Z9Q A;  5KYW B;  3FB9 A;  3CC4 Q;  3CCQ A;  3VYG A;  3CCU Q;  2HSE B;  3RKW A;  1BI1 A;  2QTV A;  5GJW B;  1LVK A;  2DVJ A;  3P8D A;  4C92 F;  2KT1 A;  2XHC A;  3NTK A;  5A0G A;  3I55 T;  1YJ9 T;  2QYZ A;  4Z8A A;  1NYF A;  5D6W A;  2KGT A;  1FWZ A;  3E2U A;  2LP5 A;  2L2P A;  3TQ7 P;  5GAM d;  2V1Q A;  3QSU A;  1BIB A;  1UGP B;  3CCL A;  3CBM A;  3CD6 Q;  1HJD A;  2A08 A;  1D1B A;  3M0S A;  2CKK A;  4E7K A;  3H0H A;  3PFS A;  5A2Q E;  1VQ7 T;  1PRM C;  4PJJ A;  2C0O A;  1YI2 A;  1XNI A;  4ZTF A;  5CR2 A;  4XTX A;  3FC3 A;  4BAC A;  2RQR A;  3VS1 A;  1IZ6 A;  1OEB A;  1VIE A;  4C92 D;  1VQO T;  1KD1 R;  4E7L A;  2JM8 A;  1VQM Q;  3CCV Q;  1MND A;  1KK7 A;  2O88 A;  5EG2 A;  3RMS A;  1U5S A;  2HEQ A;  3SEM A;  4BY6 B;  2HL5 C;  1VQK A;  4EIK A;  2R57 A;  4J6X A;  4ORZ A;  4ZTJ A;  1B7T A;  1NEB A;  3BDL A;  1R0B G;  1TS9 A;  2DEU A;  4JRP A;  4DEX A;  1AZE A;  1D09 B;  3QUI A;  3L2Z A;  4JJN K;  5FU7 B;  1M8M A;  2JMA A;  4LDU A;  4OP0 A;  4EMK B;  1Z9Z A;  2DZ9 A;  5HCK A;  1NE8 A;  1MV3 A;  4E7Z A;  3CCJ Q;  2FZK B;  2O4X A;  3CCS A;  3EG3 A;  2W0Z A;  2WSC E;  3JAM E;  2MF2 A;  3TSW A;  1I8F A;  1Q82 U;  5I2S A;  4M7D B;  2YLC A;  3GOX A;  2QGG A;  3E19 A;  4LXC A;  5CCA A;  4V2S A;  2K57 A;  2BUD A;  4FW1 A;  2DRK A;  5HKC A;  5LJ5 e;  4JRI A;  4M7D F;  1PC0 A;  3I9Q A;  2LMJ A;  1MMA A;  3OW2 P;  1T3S A;  1IO6 A;  1X2K A;  1RAG B;  3SD4 A;  2EJ9 A;  2X3X D;  3GF5 A;  4KH0 B;  4AFZ C;  1KQS P;  3H0I A;  3VRY A;  1VQP T;  1AWX A;  2KXD A;  4LE9 A;  1S72 Q;  1YJN A;  2ABL A;  4IUR A;  3F70 A;  4QW2 A;  2ROL A;  2DE0 X;  1M8V A;  4J9B A;  1RAD B;  4E6R A;  2B8A A;  3GPL A;  2WSE E;  1G5V A;  4KUD K;  4M77 E;  2I0N A;  2COW A;  1O75 A;  3MP1 A;  3JB9 F;  5LJ3 g;  3RMQ A;  3OS5 A;  3OSV A;  2RQV A;  1BK2 A;  1M1G A;  1X27 A;  3OYI A;  2DIL A;  2O31 A;  3CCM A;  3ER0 A;  5GAO m;  5LJ5 h;  2EYQ A;  3RUX A;  1B34 A;  1WQ7 A;  3LYI A;  1CKA A;  2GQI A;  5KCO A;  3C12 A;  3JCM h;  2HNI A;  2AZS A;  2FG0 A;  3ZFJ A;  2LZ6 B;  1KC8 C;  1JJ2 A;  1VQL T;  3PVL A;  2QEX Q;  5KYY B;  1CKB A;  3G6E T;  4N0A C;  1OU9 A;  2K9G A;  2DMO A;  2LRQ A;  1TUD A;  2JOY A;  2EVR A;  3M59 A;  2PVO B;  4ELY C;  3JCM V;  3HL8 A;  3JB9 D;  5D6Y A;  1VQ8 Q;  4AG2 C;  1KJW A;  3UA7 A;  2KT8 A;  1ZQ1 A;  1WGS A;  2RM4 A;  3EGD B;  2FPF A;  1GBQ A;  3CCR A;  3NTI A;  5GAN 6;  4M7A F;  2J6K A;  1YJW Q;  3CC7 Q;  3J80 E;  2FRW A;  1VYT A;  1PSF A;  2M02 A;  2MIO A;  2VWF A;  1AEY A;  3RBB B;  4PL6 A;  2F2V A;  1D3B B;  5GMK l;  1QCN A;  4C92 E;  2JXB A;  3DLM A;  2FB7 A;  4KBM B;  4PJO A;  4J9G A;  2PUO B;  3OYM A;  2DJZ A;  1R0C B;  2V26 A;  3L2V A;  4C0G A;  1S1N A;  1VQ4 T;  4EMK A;  3MHX A;  4B6M A;  1ZSZ C;  3EAE A;  3UF4 A;  5IN1 A;  1NLP C;  2EQJ A;  4M77 C;  2E1H A;  3H0F A;  3H9N A;  3HP9 A;  1VOM A;  2VUB A;  1QVG A;  3QJY A;  5GAN f;  3JSC A;  1AZG B;  4LDY A;  3CCQ Q;  3CME A;  4C8Q G;  2RMO A;  2L3S A;  2JS0 A;  1WXU A;  4JS5 A;  4M7A D;  1K9M R;  1HYO A;  3QYH B;  2E5K A;  3LW5 E;  2RI2 A;  4J7I A;  4PKC C;  1I0C A;  1YFN A;  2GGR A;  2J6O A;  2FHD A;  1N5Z A;  3ZBD A;  3QXE B;  1OU8 A;  3QYG B;  2CUD A;  2QA4 Q;  5CIU A;  2L3P A;  1KHC A;  1ZUU A;  3MEV A;  2HMA A;  1BIA A;  2KAF A;  2X4J A;  2LTO A;  1VQ5 A;  1JRI A;  1QWF A;  3M0T A;  1AT1 B;  4GBQ A;  3MP8 A;  3OS2 A;  3EFO B;  3EFR A;  3CCU A;  4M75 A;  1YI2 Q;  3CPW S;  4A53 A;  1WZO A;  2LJ1 A;  5GAM h;  1IXD A;  1WLP B;  2PTK A;  1WPY A;  5GAN 4;  4IKF A;  2M51 A;  2NUP A;  4JRQ A;  5FRN A;  1VYU A;  3M53 A;  5FWB A;  1Q95 G;  3VS4 A;  4C92 C;  4KUI A;  3J81 E;  1KD1 C;  2DD5 A;  1AHJ B;  1QCO A;  3CD6 A;  3VS0 A;  2KY9 A;  3V8L A;  3R6O A;  4MMK A;  1HK9 A;  3LH5 A;  2CP3 A;  2JM9 A;  2BE7 D;  1PM3 A;  2CP7 A;  4BB7 A;  1K8A R;  1NJI U;  5KE3 A;  2F2W A;  2MAM A;  1R77 A;  2KR3 A;  5KYY A;  2XI9 A;  3BFM A;  1ABO A;  1ZBX A;  3MET A;  1KQ2 A;  3NTH A;  2XD0 A;  2DNU A;  4KGX B;  4J9C A;  1Q81 R;  1EIF A;  1XTD A;  3OYY A;  3RKX A;  3VRZ A;  3EG9 B;  5FWC A;  1W2B S;  1K4U S;  4VUB A;  2X35 A;  1VQM A;  2OI3 A;  4RTV A;  4FYV B;  5D6X A;  1A0N B;  2JN0 A;  2ED1 A;  2XID A;  1I5O B;  3EGD A;  5LJ5 g;  1D0Z A;  1OPK A;  4Z88 A;  3JCM g;  1TSF A;  4D8D A;  1QP3 A;  2NLU A;  4OMM A;  4PNO A;  4RTZ A;  1QW1 A;  3V7C A;  1YJ9 A;  1W6X A;  3M0R A;  4F7U G;  4YTL A;  2H8H A;  2ZGW A;  5A0D A;  3SWN C;  4NL2 A;  2XMF A;  3TU4 K;  4C0D C;  4ZGE B;  2E6N A;  4XU1 A;  4ATO A;  4OML A;  3RKY A;  3VS5 A;  4LNP A;  1IRX A;  1KFZ A;  1YJN Q;  1ZLM A;  1UJY A;  2DYB A;  2KYM A;  4A4G A;  1X6B A;  5LJ3 j;  2AZV A;  5C0M A;  1UUE A;  1VQ7 A;  5FW9 A;  3PE0 A;  3EG2 A;  3FLG A;  4MZM A;  4PK4 A;  1OI1 A;  2EW3 A;  4JUV A;  2FL7 A;  1X69 A;  1NZ9 A;  2IVW A;  3FRN A;  4FW2 A;  5FU7 C;  4L5G A;  3OQ5 A;  1YP5 A;  1D1A A;  4DBR A;  4BD3 A;  2EGE A;  5GAO r;  4ZN3 A;  3SDZ A;  3VV0 A;  2PNI A;  4M78 G;  4OMF B;  3CC2 T;  3M4Y A;  1M1F A;  3OYC A;  1Q7Y R;  1S72 A;  4M7A E;  4DA4 A;  1C1A A;  2YLB A;  5FU6 C;  4HVW A;  2CT4 A;  3HPW A;  3BY7 A;  3X24 B;  1KC8 U;  1UG1 A;  4A4F A;  2RF0 A;  3EFO A;  3H8Z A;  1E6H A;  1ZA2 B;  2DBM A;  2COZ A;  4LD6 A;  2HBP A;  4KGV B;  4LD9 K;  2P0K A;  5CK9 A;  2FYK A;  2XDP A;  1VQN T;  1JU5 C;  2L3Q A;  2Y4X A;  1WNL A;  3UAT A;  2P0Q A;  3I56 T;  5C6S A;  5IXB A;  1WXB A;  3A8O B;  4XQ3 A;  2LCS A;  1ZSZ B;  2HD0 A;  1JB0 E;  4XTY A;  3L2W A;  2LCL A;  4M77 B;  3ZEH A;  1JQQ A;  2RJF A;  4BI4 A;  4LDV A;  2OTJ A;  4X9D A;  2BKD N;  1RL2 A;  2H3E B;  5M9O A;  4M77 F;  1VQ6 T;  5GAM g;  2BZ8 A;  4FYW B;  1JJ2 P;  4QVD A;  1QP2 A;  5KCH A;  1NPP A;  4HCZ A;  4OGC A;  4OMP A;  2QQ9 A;  1IHV A;  2GF7 A;  2OX7 A;  3OYA A;  2BZY A;  1GFC A;  5J26 A;  1YHQ A;  4HCK A;  1SHG A;  4F17 A;  3CC4 T;  3MEA A;  3A1P A;  3X26 B;  1X75 C;  1WX6 A;  4FYY B;  3OBW A;  5GMK i;  3URG A;  4OVA A;  1N8R C;  3O8V A;  4FSS A;  2AT1 B;  3CME Q;  4XTW A;  5CKB A;  5GAN d;  3CC7 A;  2EGA A;  5DY9 A;  3FEO A;  1BB9 A;  1ABQ A;  5GAN 7;  1SEM A;  1RAB B;  2BZX A;  2DER A;  4FYX B;  1WXT A;  4FM4 B;  1AOJ A;  2EAY A;  2RO0 A;  1UDL A;  3QO3 A;  4HT9 A;  4M7A C;  1AVZ C;  1K9M C;  3MEW A;  3NMZ C;  4GLM A;  4M77 D;  2MI6 A;  5CVI A;  3LWI A;  1WHJ A;  4F7U E;  1ZUK A;  2VYT A;  4P5N A;  3CQT A;  1VQ5 Q;  3BDU A;  2KYB A;  1FX7 A;  4PJL A;  3HFN A;  1YIJ Q;  3EFS A;  4C92 B;  2K7A A;  4IUV A;  2J06 A;  3WVD B;  1I07 A;  2KDS A;  2RA2 A;  4E47 A;  1QVG P;  2DTI A;  1PCX A;  2RJD A;  4CC7 A;  2LCC A;  2EQU A;  3CCV T;  2GBQ A;  2RHZ A;  2ESW A;  2LNH B;  4ELZ C;  4R56 A;  1ACM B;  1M2O A;  2QA4 A;  1QVP A;  2EYX A;  1KD1 U;  5KYU B;  3BW1 A;  1X2Q A;  3ZL7 C;  2GTJ A;  1QWE A;  1G3T A;  2CS7 A;  4Q5W A;  1VQ9 Q;  4XU2 A;  1TG0 A;  5J3B A;  3EGX B;  1JO8 A;  4RTT A;  5FRM A;  2K2V A;  3V8J A;  2MMP A;  3L42 A;  1M27 C;  3TVT A;  5LJ5 j;  2E41 A;  1BU1 A;  4FU6 A;  3T9N A;  1K8A C;  2P4R A;  2MPX C;  3KBG A;  4WF2 A;  1D1C A;  3G71 A;  3CCJ T;  3FIF A;  1D0X A;  1M3B A;  3SWN B;  4J9E A;  4NS5 A;  1OOT A;  4C0D B;  4II1 A;  1TTH B;  3CMA A;  2VVK A;  2D8H A;  2KMT A;  1Q81 C;  2YRD A;  2RD1 A;  2DK3 A;  4RTX A;  3M54 A;  3QZ5 B;  4QQ6 A;  4ZGJ B;  4Z89 A;  3M56 A;  3I55 Q;  1YJ9 Q;  2ED0 A;  3HFO A;  1BI3 A;  2CZ7 B;  3S6W A;  2DF6 A;  3H6Z A;  1OPL A;  1M1K U;  3I35 A;  4CC4 B;  3A8H B;  2JTM A;  2CH4 A;  2CRE A;  5GAO q;  2VXF A;  1J3T A;  2C0I A;  1W2B A;  4J9H A;  4O5V A;  2CSQ A;  1XQH A;  3MCA B;  2VV5 A;  1U3O A;  3OW2 S;  5I22 A;  2E5Q A;  2OTL A;  4JJD A;  2KXC A;  3E9F A;  1VQ7 Q;  2DA9 A;  2LNV A;  5IHI A;  1KQS S;  1YN8 A;  4HVU A;  2DFU A;  1Y57 A;  2C0T A;  4A4H A;  4IUU A;  2LT4 A;  1FMW A;  2SEM A;  5FU6 B;  3SB2 A;  4RG8 A;  1FMK A;  3JCM J;  1WQW A;  1M90 R;  1UFF A;  1ZHI A;  2JJ9 A;  3JCM e;  2DM1 A;  1PKS A;  1K73 R;  2JUF A;  5IH2 A;  2RQW A;  3OYN A;  3HRU A;  4JDS A;  1BI2 A;  1BI0 A;  2DX1 A;  2EKO A;  3TSZ A;  1YIT T;  2J05 A;  2KVQ G;  3M0Q A;  2GFA A;  3OBY A;  2D1X A;  1M2V B;  5CO7 A;  3GLX A;  1G3S A;  5KYW A;  4C92 A;  4E2F B;  3OYD A;  4PLL A;  4J9D A;  1Q7Y C;  4WTO B;  1AWO A;  1QVF A;  1GXI E;  2K5L A;  1WHG A;  2KRS A;  1Q82 R;  3JCM X;  2DPP B;  4PJO D;  1I1J A;  2DJQ A;  8ATC B;  2ZPH B;  1GCQ C;  1V1C A;  5J39 A;  2HZY A;  2YDL A;  4PJO G;  3GNF B;  3LWH A;  2JS2 A;  4N4H A;  1YJW T;  1TU0 B;  2KNB B;  3G4S T;  5GAM j;  3VS2 A;  2Y4Y A;  3CXC A;  2BTT A;  4E7H A;  4NOY A;  4RTW A;  2OTJ Q;  3C4S A;  2LT1 A;  1WHK A;  1M3C A;  2YUP A;  5GAN e;  3IQL A;  4RTY A;  5KE2 A;  3CCE A;  1IGU A;  2EQI A;  2LC4 A;  2RPN A;  2KRO A;  1GBR A;  1U06 A;  1X6G A;  1WHM A;  4QT7 A;  1VQP Q;  3M55 A;  4OMQ A;  5L8R E;  4AMC A;  3J7A F;  4FCY A;  1X01 A;  4LDW A;  2I2L A;  4C8Q F;  2MCN A;  1SSH A;  4M7A B;  1SSF A;  1P92 A;  1SKU B;  3SWN A;  2L0A A;  3EG0 A;  1YHQ Q;  1LCK A;  1KQ1 A;  1YWP A;  1TUC A;  3CCQ T;  1N8R U;  2MYS A;  3LGL A;  1JEG A;  1Q86 U;  4OGE A;  2NWM A;  2O9V A;  2EWN A;  2D0Q B;  4M75 D;  2FO0 A;  4WCI A;  5GAN 2;  2V8J A;  2ZZD A;  1I4K 1;  1YNZ A;  2CZ6 B;  3X25 B;  1IGQ A;  1YWO A;  4M75 G;  5KH6 A;  3CC2 A;  3CCL T;  3GNG A;  4J83 A;  2DL8 A;  2GNC A;  2MOX A;  3NFC A;  5GAM e;  3JCM Q;  3QDF A;  3ASK A;  4AG1 C;  4C8Q D;  5GAN h;  1K0X A;  5D7U A;  4ESR A;  4QVC A;  2FVU A;  2XG8 D;  3REB B;  1VQL Q;  2MWP A;  1RI0 A;  4PFP A;  4M7D A;  2JNG A;  1WJS A;  3M5A A;  1EFN A;  2G6F X;  1V76 A;  2X51 A;  2YXY A;  5CQY A;  4B9W A;  4CC2 A;  2EIF A;  5FRO A;  5GAO n;  3LLR A;  2AKL A;  3A5Z B;  2KBT A;  1W4S A;  1FXX A;  2YHT A;  1KHI A;  3C0C A;  2M0Y A;  5FLX E;  1VQK T;  3VJP A;  2A28 A;  2IPO B;  1K76 A;  1M2V A;  1YIJ A;  1D0Y A;  3JCM P;  4K11 A;  3QBY A;  2HQX A;  2RHY A;  1OQK A;  4GLK A;  3P8H A;  1K8A U;  4R0K A;  1OUL A;  2DEQ A;  1UB4 A;  2O01 E;  3G71 Q;  2QQA A;  3CCS T;  4DEY A;  4F7U B;  2KRN A;  3MKD A;  3VS7 A;  4J5Y A;  4PLI A;  2DRM A;  3P8B B;  4L59 A;  1Q81 U;  3CMA Q;  1T3L A;  3VU3 C;  4IUP A;  4F7U F;  3PT9 A;  5IHK A;  2QG9 B;  4XU3 A;  3VS3 A;  2YT6 A;  1SF9 A;  3QWX X;  1WYX A;  4IIO A;  3RNJ A;  4A4E A;  2Z0W A;  1VQ9 A;  1UHF A;  2QAZ A;  2DXU A;  4FL6 A;  4LUE A;  2DO3 A;  4TVR A;  4PJO E;  3GBQ A;  4LDX A;  1XJW B;  2F5T X;  4HCC A;  4C0F A;  3L2U A;  2CP6 A;  2A7Y A;  2L3R A;  1YJN T;  3OYG A;  4AT1 B;  4M7A A;  2EBP A;  2LQK A;  2CUB A;  4AFS C;  2QXF A;  2OTL Q;  1HSQ A;  2YUN A;  2GCX A;  4BI8 B;  1C0M A;  3QII A;  1C6V X;  2V8I A;  2M16 A;  3RER A;  1W1F A;  2AIR B;  1EX4 A;  1VIF A;  3I55 A;  3PIP A;  1D3B A;  4M78 F;  4HT8 A;  9ATC B;  1JBM A;  2M9U A;  5GMK e;  4PFO A;  1UE9 A;  2QQB A;  4FT2 A;  4JZ3 A;  1NJI R;  3CCM T;  1M90 C;  3QDR B;  3OYF A;  3MEU A;  1HD3 A;  3KUF A;  1K73 C;  1BKB A;  1W2B P;  2CYZ B;  3REA B;  3PGG A;  2OAW A;  2DLP A;  2EQK A;  4M75 E;  4QKU A;  2CZ1 B;  4ME7 A;  3WXM B;  2EPD A;  1N6A A;  2ENM A;  3S3M A;  1N27 A;  2NYS A;  1TWB A;  4E7I A;  4JZ4 A;  1VQO A;  3OA6 A;  2DXB A;  4M78 D;  1WI7 A;  4C8Q E;  2AHJ B;  3CCR T;  3JB9 J;  1Q82 C;  1PWT A;  1RLQ C;  4J6W A;  3UT1 A;  2ZAE A;  4PJO C;  2LX9 A;  5I11 A;  2K6D A;  5GAN g;  4AFU C;  5GJV B;  1VA7 A;  3NHN A;  1BYM A;  4C0Z A;  5GMK h;  3MO8 A;  1NYG A;  4C5I A;  1UGV A;  3U23 A;  4C5H A;  3OYK A;  3HHT B;  3RIR A;  3CCE Q;  2X4W A;  2LQ8 A;  4XK8 E;  1M3A A;  2JZ2 A;  2HKQ B;  3PMI A;  2K3Y A;  1QVF P;  2K2M A;  4E7J A;  1I81 A;  4UC4 A;  1VYV A;  3VYH B;  4Z02 A;  3PVQ A;  3PTA A;  4JJB A;  1JJ2 S;  3QG1 A;  2AKK A;  3CME T;  2KK4 A;  5IT9 E;  4A4K A;  2EKH A;  2JTF A;  2W10 A;  1Y96 B;  3N5B B;  1NPR A;  1QKX A;  2RK1 A;  4RUG A;  3CXC P;  2KQW A;  1AWW A;  2FEI A;  1EZZ B;  3A8M B;  2EGC A;  3UA6 A;  2YRC A;  1M5Q 1;  4DOW A;  1NG2 A;  2LJ3 A;  2RI3 A;  4KH1 B;  1KC8 R;  1TH7 A;  3FDR A;  4M75 C;  1VQP A;  4EPC A;  3CC2 Q;  1ZUY A;  3EG9 A;  3JB9 I;  2E64 A;  1VQ5 T;  2NUZ A;  3M4G A;  1PNJ A;  2XDB A;  1N9R A;  3OYE A;  3CCU T;  3VS6 A;  4C8Q C;  2ZPG B;  2KEA A;  1RAF B;  2XDD A;  2PU9 B;  4F04 B;  1JXO A;  2O4X B;  4MDW A;  1YCY A;  3E9G A;  1IRE B;  2ZPE B;  1QVG S;  4DQ2 A;  1BBZ A;  2JMC A;  3X28 B;  2DIG A;  4MML A;  4Y91 A;  2HQH A;  3UPU A;  2FPD A;  1K0S A;  3CD6 T;  3CEY A;  2E70 A;  4DBH A;  8AT1 B;  3S3N A;  1GL5 A;  3JRZ A;  4L6V 5;  1UTI A;  1GCQ A;  2LQW A;  1VQL A;  4BI3 A;  3PIO A;  1ZX6 A;  1VQ6 Q;  2X4X A;  3G6E A;  5LJ3 f;  2DD4 A;  1RI9 A;  3OMC A;  2F69 A;  2RQT A;  3TEE A;  2QK0 A;  2DL7 A;  3OB9 A;  1T0J A;  1VQM T;  4N4I A;  2RHU A;  2R58 A;  4N0A A;  4XU0 A;  3JCM c;  4IIM A;  1SRL A;  3O5Z A;  4JRK A;  2LJ0 A;  3EHR A;  5CAI A;  2G3R A;  1U1S A;  3ME9 A;  4DBF A;  2DKG A;  3TRE A;  1MMD A;  2IG0 A;  1X6O A;  4M78 E;  2MWO A;  4LN2 A;  3THK A;  7AT1 B;  5DLO A;  1NEG A;  3CPW A;  2PUK B;  2RHX A;  1UHC A;  3QZ9 B;  2RN8 A;  4XTU A;  1H92 A;  1MMN A;  1IB8 A;  4KUL A;  1VQ4 A;  2XKO C;  1B34 B;  4D8K A;  2DBK A;  1G3Y A;  3HSB A;  3AT1 B;  5ECA A;  2DXC A;  2OAU A;  4OB3 B;  1RAI B;  4PFZ A;  3OYB A;  2EYY A;  2X3W D;  4JPB W;  1H3H A;  3ULR B;  2A36 A;  1ZSZ A;  3DKM A;  1Y07 A;  2R5A A;  2HBW A;  4M77 A;  4JJC A;  4IUT A;  3HKS A;  1RAE B;  5DM7 R;  1WJQ A;  4RG2 A;  1QCF A;  3NGP A;  1Y96 A;  2WAC A;  2K5I A;  3QPH A;  4C92 G;  3FJP A;  3LH0 A;  1G2B A;  4B9X A;  4D6W A;  2BIV A;  5L23 A;  2DL4 A;  1M90 U;  1M9S A;  1S72 T;  1F1B B;  3M58 A;  1K73 U;  4C5G A;  3EH1 A;  3CBP A;  1NJI C;  5GAO l; 
#chains in the Genus database with same CATH homology
 2L8D A;  4EMH A;  4M75 G;  3C94 A;  2XU8 A;  1QP3 A;  1VQ8 A;  5KH6 A;  2NLU A;  2PVG B;  4PNO A;  4PJO B;  1QW1 A;  3V7C A;  1YJ9 A;  3CC2 A;  3S3O A;  3OS0 A;  3GNG A;  3CCL T;  4J83 A;  4F7U G;  4YTL A;  3NFC A;  5GAM e;  3L1A A;  2ZGW A;  3JCM Q;  3V7S A;  4BUG A;  5A0D A;  2DTH A;  3ASK A;  3G4S A;  1YJW A;  3SWN C;  4PJO F;  4C8Q D;  2GQV A;  4NL2 A;  5GAN h;  4QVC A;  5GAN j;  2FVU A;  2XG8 D;  3TU4 K;  2VXE A;  4HA8 A;  4C0D C;  4HKE A;  2E6N A;  4XU1 A;  4ZGE B;  1Q86 C;  4ATO A;  4XAX B;  3RKY A;  2ZPB B;  2E10 A;  2MWP A;  1RI0 A;  3OYH A;  1VQ9 T;  2EQM A;  4M7D A;  2JNG A;  2K5F A;  3OYJ A;  3VKI A;  1WJS A;  2QQR A;  3M5A A;  3MP6 A;  4OB2 B;  5LJ3 h;  4A4G A;  5LJ3 j;  2DIQ A;  4BDZ A;  5C0M A;  3V7R A;  1VQ7 A;  2L89 A;  4M78 C;  5CQY A;  1H64 1;  2HQE A;  4B9W A;  2WSF E;  2EIF A;  3FLG A;  4MZM A;  2OTJ T;  2Y90 A;  1OI1 A;  1V29 B;  5FRO A;  4JUV A;  4M77 G;  2FL7 A;  5GAO n;  1NZ9 A;  1MHN A;  2IVW A;  3LLR A;  3FRN A;  3KXT A;  2D9T A;  2QEX T;  2QI2 A;  4NL3 A;  3A5Z B;  5FU7 C;  4L5G A;  3OQ5 A;  1W4S A;  1FXX A;  2YHT A;  3FB9 A;  1KHI A;  5FLX E;  4EDU A;  1VQK T;  4FSX A;  3VJP A;  4BD3 A;  3VYG A;  3CCQ A;  4Y28 E;  4EMG A;  5GAO r;  3RKW A;  4ZN3 A;  3SDZ A;  3VV0 A;  1BI1 A;  1YIJ A;  2QQS A;  5HK3 A;  3JCM P;  3CPF A;  3P8D A;  4C92 F;  1VQ8 T;  2XHC A;  2CZ0 B;  3NTK A;  5A0G A;  4KT0 E;  3I55 T;  4M78 G;  1YJ9 T;  4OMF B;  1YHQ T;  3CC2 T;  3M4Y A;  1M1F A;  4R55 A;  4FIB A;  3OYC A;  3G7Z A;  1S72 A;  3QBY A;  2DZC A;  5D6W A;  4M7A E;  4DA4 A;  1FWZ A;  4M75 B;  2HQX A;  2M1H A;  2R5M A;  2RHY A;  2YLB A;  3CBO A;  3P8H A;  4GLK A;  5FU6 C;  3DLL A;  1K8A U;  1G3W A;  2C06 A;  2DEQ A;  5GAM d;  4QQG A;  1UB4 A;  2O01 E;  1MGQ A;  3CC7 T;  3HPW A;  3BY7 A;  3GP8 A;  3X24 B;  1KC8 U;  3UDC A;  2QQA A;  3CCS T;  3QSU A;  4F7U B;  2QDY B;  4A4F A;  4M75 F;  3H8Z A;  1BIB A;  4J5Y A;  3P8B B;  1UGP B;  4PLI A;  4LD6 A;  2HBP A;  3CCL A;  3PMT A;  4L59 A;  3CBM A;  1Q81 U;  2A3L A;  1M4Z A;  4XTZ A;  4MZP A;  2P0K A;  5CK9 A;  4LD9 K;  2CKK A;  3VU3 C;  4IUP A;  4F7U F;  4E7K A;  4M7D D;  5HY6 A;  2RB6 A;  2FYK A;  2XDP A;  3PT9 A;  2XIC A;  3PFS A;  4C8Q B;  5A2Q E;  1VQ7 T;  4XU3 A;  2D6F A;  1VQN T;  4M7D G;  1XOV A;  2Y4X A;  1XNI A;  1YI2 A;  4ZTF A;  1WNL A;  4A4E A;  3JCM b;  5IAY A;  2P0Q A;  1VQ9 A;  5CR2 A;  2DXU A;  4FL6 A;  5C6S A;  3I56 T;  5GAN 5;  4XTX A;  3FC3 A;  4BAC A;  2DO3 A;  4TVR A;  4PJO E;  3A8O B;  4JLI A;  1IZ6 A;  4XQ3 A;  5LJ5 f;  4LDX A;  1VIE A;  4C92 D;  1VQO T;  2HD0 A;  2F5T X;  1JB0 E;  4XTY A;  3JCM f;  3L2W A;  2LCL A;  4E7L A;  4M77 B;  3ZEH A;  4HCC A;  2RJF A;  4C0F A;  4BI4 A;  3L2U A;  4LDV A;  2XK0 A;  2OTJ A;  2A7Y A;  4X9D A;  2L3R A;  4J7F A;  2BKD N;  1YJN T;  4QVZ A;  3OYG A;  1RL2 A;  4OB0 B;  5EG2 A;  3RMS A;  4M77 F;  2LQK A;  3VUZ A;  5M9O A;  1VQ6 T;  4M7A A;  5GAM g;  3JB9 H;  3A8L B;  2QXF A;  2GCX A;  4QVD A;  2V8K A;  4BE1 A;  4BY6 B;  1QP2 A;  4BI8 B;  5KCH A;  1VQK A;  1NPP A;  2R57 A;  4HCZ A;  4J6X A;  4OGC A;  5CKH A;  3QII A;  4CI0 C;  4ZTJ A;  2V8I A;  2M16 A;  3BDL A;  4RMO A;  3RER A;  2QQ9 A;  1O9S A;  2GF7 A;  3JB9 G;  1K9M U;  4RKU E;  2QA4 T;  3OYA A;  4JRP A;  1VIF A;  5J26 A;  3QUI A;  3I55 A;  3PIP A;  1YHQ A;  3CC4 T;  3MEA A;  5GAN 8;  1U8R A;  3X26 B;  1D3B A;  1X75 C;  3L2Z A;  4M78 F;  3QJ6 A;  4JJN K;  4HT8 A;  5FU7 B;  3SFM A;  1JBM A;  2M9U A;  3OBW A;  3OMG A;  3URG A;  5GMK i;  5GMK e;  4OVA A;  4LDU A;  4OP0 A;  2LVM A;  2VGM A;  2QQB A;  3O8V A;  4FT2 A;  4EMK B;  1N8R C;  2DZ9 A;  4XTW A;  2K4Y A;  1NE8 A;  2ZPF B;  5CKB A;  5GAN d;  3CC7 A;  5DY9 A;  3FEO A;  2O4X A;  3CCS A;  1Y7X A;  4ZN1 A;  5GAN 7;  1YI2 T;  3CCM T;  1M90 C;  3QDR B;  3JAM E;  2WSC E;  3OYF A;  3MEU A;  4FM4 B;  2MF2 A;  4FT4 A;  2EAY A;  2RO0 A;  1I8F A;  3KUF A;  2YRV A;  3QO3 A;  1Q82 U;  1K73 C;  4HT9 A;  4M7A C;  1BKB A;  2E65 A;  5I2S A;  4M7D B;  2CYZ B;  2RH2 A;  2YLC A;  3PGG A;  5LJ3 d;  3G71 T;  3GOX A;  1N9S A;  3E19 A;  1K9M C;  3MEW A;  2EQK A;  4M77 D;  4M75 E;  3INZ A;  5CCA A;  4V2S A;  2K57 A;  2BUD A;  1VQN A;  2CZ1 B;  2MI6 A;  1PSE A;  5CVI A;  5HKC A;  3LWI A;  4ME7 A;  5LJ5 e;  4JRI A;  3WXM B;  4M7D F;  1N6A A;  4F7U E;  3I56 A;  3CMA T;  1KG1 A;  2VYT A;  4P5N A;  3S3M A;  4X9C A;  1N27 A;  3M57 A;  3BDU A;  2M0O A;  2EJ9 A;  3SD4 A;  1FX7 A;  4QQD A;  4E7I A;  2X4Y A;  3HFN A;  1VQO A;  3EFS A;  3GF5 A;  4RCC A;  3Q1J A;  2P4T A;  4C92 B;  4IUV A;  3WVD B;  3OA6 A;  2DXB A;  1UGR B;  1VQP T;  2KDS A;  2RA2 A;  4E47 A;  1R8O B;  4M78 D;  1UGQ B;  4C8Q E;  4M7A G;  2AHJ B;  1YJN A;  3CCR T;  3JB9 J;  2DTI A;  4RCB A;  1Q82 C;  4IUR A;  1VQ6 A;  2RJD A;  3F70 A;  4J6W A;  4IUQ A;  4QW2 A;  3UT1 A;  2LX9 A;  4PJO C;  2LCC A;  2EQU A;  5GAN g;  3AHU A;  1M8V A;  3CCV T;  2RHZ A;  3OS1 A;  1BYM A;  4C0Z A;  5CQX A;  1Y71 A;  2B8A A;  4ELZ C;  4R56 A;  5GMK h;  3GPL A;  2WSE E;  1G5V A;  5GMK j;  2P0P A;  3MO8 A;  4M77 E;  4C5I A;  4KUD K;  2DVE A;  2QA4 A;  1QVP A;  4C5H A;  3MP1 A;  1O75 A;  3OYK A;  3JB9 F;  5LJ3 g;  2OTL T;  3HHT B;  1KD1 U;  3RIR A;  3BW1 A;  3CC4 A;  2X4W A;  2LQ8 A;  4OF1 A;  4XK8 E;  3RMQ A;  3OS5 A;  2JZ2 A;  3OSV A;  2L5Q A;  2PQW A;  3PMI A;  5HK0 A;  4OB1 B;  2K3Y A;  3A8G B;  2JVV A;  1M1G A;  1G3T A;  2CS7 A;  4Q5W A;  3OYI A;  5GMK m;  4XU2 A;  1I5L A;  5J3B A;  4E7J A;  1I81 A;  5FRM A;  2K2V A;  4UC4 A;  3V8J A;  3L2R A;  1UGS B;  2MMP A;  3L42 A;  5AYF A;  3OYL A;  2KSS A;  3VYH B;  2VC8 A;  3CCM A;  3ER0 A;  4Z02 A;  5GAM f;  5GAO m;  5LJ5 h;  3PTA A;  2EYQ A;  1JJ2 S;  3QG1 A;  3RUX A;  5LJ5 j;  1B34 A;  1WQ7 A;  2E41 A;  4A54 A;  3LYI A;  4FU6 A;  3T9N A;  3CME T;  2KK4 A;  3C12 A;  3JCM h;  5KCO A;  1K8A C;  4WF2 A;  3KBG A;  2HNI A;  5IT9 E;  3G71 A;  3DB3 A;  4A4K A;  3CCJ T;  3FIF A;  3ZFJ A;  4BDY A;  5CKF A;  4C8Q A;  2JTF A;  5I21 A;  1KC8 C;  1JJ2 A;  1VQL T;  3SWN B;  4NS5 A;  3G6E T;  4N0A C;  1Y96 B;  4C0D B;  4MDX A;  3N5B B;  1LNX A;  1NPR A;  4II1 A;  2RK1 A;  3CMA A;  2QTX A;  1Q81 C;  1LOJ A;  2KMT A;  2KQW A;  2LRQ A;  2VGN A;  3PNW C;  4BE2 A;  2RD1 A;  2DK3 A;  2RJE A;  3A8M B;  3M54 A;  3JCM W;  3QZ5 B;  2JOY A;  3M9Q A;  3M59 A;  4ELY C;  2PVO B;  3HRS A;  1M5Q 1;  3HL8 A;  4QQ6 A;  3JCM V;  4DOW A;  4ZGJ B;  2RI3 A;  3L2Q A;  3JB9 D;  5D6Y A;  1DJ7 B;  3WVE B;  3M56 A;  4M7D E;  1TH7 A;  3FDR A;  4M75 C;  1VQP A;  4EPC A;  1ZQ1 A;  2DAQ A;  3HFO A;  1WGS A;  1BI3 A;  2CZ7 B;  4M78 B;  3S6W A;  2RM4 A;  3H6Z A;  3CCR A;  3LX7 A;  2RK2 A;  3NTI A;  3JB9 I;  2E64 A;  5GAN 6;  1M1K U;  1VQ5 T;  4M7A F;  4X34 A;  3A8H B;  3M4G A;  2JTM A;  2XDB A;  1OZ2 A;  5GAO q;  3J80 E;  2VXF A;  1N9R A;  3OYE A;  1PSF A;  3CCV A;  3CCU T;  2EJG A;  4PL6 A;  1D3B B;  5GMK l;  1W2B A;  4C92 E;  4O5V A;  4BE0 A;  3E1S A;  3DLM A;  1XQH A;  2FB7 A;  3MCA B;  2VV5 A;  4C8Q C;  2ZPG B;  3OW2 S;  2ZPI B;  5GAO p;  2E5Q A;  4KBM B;  2OTL A;  2F5K A;  2XDD A;  2PU9 B;  4PJO A;  2PUO B;  3OYM A;  2O4X B;  2DJZ A;  3E9F A;  4MDW A;  4XTV A;  1UEB A;  1YCY A;  2LNV A;  2K3X A;  3OW2 A;  3E9G A;  3L2V A;  1KQS S;  4C0G A;  1VQ4 T;  4EMK A;  1IRE B;  3MHX A;  2ZPE B;  4ZGD B;  1QVG S;  3EAE A;  4DQ2 A;  5IN1 A;  4A4H A;  4IUU A;  2LT4 A;  2EQJ A;  5FU6 B;  3SB2 A;  1M1K C;  3X28 B;  4M77 C;  2DIG A;  2E1H A;  4MML A;  4Y91 A;  1KQS A;  4RG8 A;  1Q7Y U;  3CCE T;  3HP9 A;  3UPU A;  2VUB A;  3JCM J;  1WQW A;  3CD6 T;  3CEY A;  1QVG A;  3QJY A;  2E70 A;  4MZT A;  1ZHI A;  3JCM e;  3JSC A;  5GAN f;  3S3N A;  4LDY A;  3CME A;  3JRZ A;  2JUF A;  4L6V 5;  4C8Q G;  4N4G A;  3CCJ A;  3GIB A;  4JS5 A;  3OSS C;  4M7A D;  3QHS A;  3OYN A;  3HRU A;  4JDS A;  1VQL A;  4BI3 A;  4BY6 C;  4C5E A;  3PIO A;  1BI2 A;  3QYH B;  1BI0 A;  2EKO A;  2H3J A;  1YIT T;  2X4X A;  3G6E A;  3LW5 E;  2KVQ G;  2RI2 A;  4J7I A;  5LJ3 f;  4PKC C;  2DD4 A;  2GFA A;  1YBY A;  2FHD A;  2RJC A;  3OBY A;  3OMC A;  3ZBD A;  2F69 A;  3TEE A;  3QXE B;  2LDM A;  2PVD B;  3OB9 A;  5CO7 A;  1QVF S;  3GLX A;  3QYG B;  1G3S A;  1LJO A;  1HXD A;  4C92 A;  1VQM T;  3OYD A;  1H3Z A;  4PLL A;  4N4I A;  5LL6 S;  5CIU A;  1VUB A;  2RHU A;  1Q7Y C;  2R58 A;  1KHC A;  3MEV A;  4N0A A;  4EMK C;  1QVF A;  1GXI E;  2K5L A;  4XU0 A;  1BIA A;  2KAF A;  2X4J A;  3JCM c;  2RHI A;  2LTO A;  1VQ5 A;  5CKD A;  1JRI A;  4JLG A;  3JCM X;  3QKJ A;  2DPP B;  3MP8 A;  3OS2 A;  4PJO D;  4JRK A;  3CCU A;  3EFR A;  3X20 B;  4M75 A;  2ZPH B;  2E6Z A;  4M7D C;  3CPW S;  5I2M A;  2G3R A;  4A53 A;  5CAI A;  1U1S A;  3ME9 A;  2RI5 A;  5J39 A;  2DKG A;  4PJO G;  3TRE A;  3GNF B;  3LWH A;  3CXC S;  5CKE A;  4N4H A;  1YJW T;  2IG0 A;  4F7U A;  5GAM h;  3G4S T;  1X6O A;  5GAM j;  4M78 E;  2MWO A;  1WPY A;  5GAN 4;  5DLO A;  4IKF A;  3OY9 A;  2PUK B;  3CPW A;  2RHX A;  1OZ3 A;  5LJ5 d;  3QZ9 B;  4XTU A;  2Y4Y A;  3CXC A;  3DB4 A;  4E7H A;  4NOY A;  4KUL A;  4JRQ A;  1VQ4 A;  5FRN A;  3JCM d;  2DXT A;  2LT1 A;  2XKO C;  3C4S A;  2E12 A;  2GFU A;  3M53 A;  1B34 B;  4DOV A;  1G3Y A;  4C92 C;  3HSB A;  3UWN A;  5GAN e;  3V8K A;  5KE2 A;  3CCE A;  4KUI A;  2DXC A;  3J81 E;  1KD1 C;  2DD5 A;  1AHJ B;  2LC4 A;  2OAU A;  4OB3 B;  3CD6 A;  2KY9 A;  3V8L A;  3R6O A;  4MMK A;  1HK9 A;  3OYB A;  3M55 A;  5L8R E;  4CRI A;  3J7A F;  4BB7 A;  1X01 A;  3DKM A;  1NJI U;  5KE3 A;  5LJ3 e;  1Y07 A;  2I2L A;  2R5A A;  4LDW A;  2MAM A;  4C8Q F;  4M7A B;  4M77 A;  1SSF A;  1P92 A;  4IUT A;  5DLQ E;  3HKS A;  3LGF A;  2XI9 A;  3RES A;  3SWN A;  1WJQ A;  3HRT A;  5DM7 R;  4RG2 A;  2DTO A;  2ZCF B;  3BFM A;  1KQ1 A;  1YIT A;  1Y96 A;  1ZBX A;  3MET A;  1KQ2 A;  3NTH A;  2XD0 A;  4J8O A;  3VUB A;  3CCQ T;  2CGH A;  5A0L A;  1N8R U;  2WAC A;  3C95 A;  4HCB A;  1EIF A;  2K5I A;  1XTD A;  3OYY A;  3RKX A;  3QPH A;  4C92 G;  3TCJ A;  1W2B S;  3FJP A;  1YIJ T;  4VUB A;  2X35 A;  3LGL A;  3LH0 A;  1WJR A;  4B9X A;  2HAX A;  2QEX A;  4D6W A;  1VQM A;  1Q86 U;  4OGE A;  2BIV A;  5D6X A;  1M90 U;  2EJF A;  2JN0 A;  4JS4 A;  1M9S A;  2XID A;  4J6Y A;  2EWN A;  1U1T A;  4GY5 A;  1S72 T;  4M78 A;  2D0Q B;  3M58 A;  4M75 D;  5LJ5 g;  5GAN 3;  1K73 U;  4O6J A;  4C5G A;  2V8J A;  5GAN 2;  2ZZD A;  2EFI A;  1OYX A;  3CBP A;  1I4K 1;  3JCM g;  2CZ6 B;  3X25 B;  1NJI C;  5GAO l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...