3NFCA

Crystal structure of e.coli mazf toxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
94
Chain Sequence
YVPDMGDLIWVDFDHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of E. coli MazF Toxin
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords PemK-like protein 1
total genus 24
structure length 94
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nfcA00
5CKDA 2VUBA 3JSCA 5CQYA 5CQXA 5CO7A 5CCAA 4MZMA 5CKFA 5CKEA 5HKCA 5HK0A 4VUBA 2KMTA 2C06A 5CKHA 3TCJA 5HK3A 4ELYC 3HPWA 1M1FA 3G7ZA 4ME7A 5DLOA 3NFCA 3JRZA 4HKEA 2MF2A 4ELZC 4MZPA 1VUBA 4OF1A 5CK9A 4MZTA 5CR2A 1UB4A 1X75C 1NE8A 4MDXA 5CKBA 3VUBA
chains in the Genus database with same CATH superfamily
5GMKl 1YJNA 3BW1A 3HFNA 4C92D 1NEGA 3MP1A 5CCAA 1ZUKA 2RJCA 4M78G 4XU3A 4BY6C 1M27C 3GP8A 3CCJQ 1KQSP 5CKHA 4PKCC 2MIOA 2FB7A 4BE1A 4FYVB 4E47A 2X9HA 3VKIA 2RI5A 1K8AC 4F7UA 5I11A 1AZGB 3DB4A 4OMMA 5IH2A 2LZ6B 2XHCA 3MO8A 1QVGA 3CMAT 1ZX6A 2CP0A 3L42A 3L2QA 1Q7YU 2DRMA 3OA6A 2EJFA 1UHFA 4ZGJB 1PHTA 3PFSA 1ZLMA 3ZEHA 4BB7A 2H8HA 4LD6A 3KUFA 4MZPA 4EMHA 2PU9B 4XQ3A 4M75C 1Q95G 4PJNA 4PJOA 3VS2A 3M4GA 5CKFA 5GAN3 3CCUQ 3A8OB 2E41A 3HRTA 1C0MA 4C0GA 2RJFA 2DM1A 2K3BA 3JAME 1JJ2P 2RHUA 3QIIA 1OEBA 4C92B 3CCEA 2DTIA 3SWNB 4JRQA 5FROA 5LJ3j 4RTUA 4Y92A 5GAMg 4KUDK 3QUIA 4RTYA 3EFSA 3RNJA 3VRYA 2F5TX 2LJ0A 1D0XA 5KYYB 2RPNA 2AZSA 1HYOA 4FSXA 1NM7A 1HXDA 3EG0A 2V8JA 2DETA 1HD3A 1W70A 3X24B 2FPDA 3EGXB 2VASA 3I9QA 3JV3A 4ZN1A 4KRTA 2DL5A 5DY9A 2KBTA 3CMEQ 2NLUA 2QG9B 3PIPA 2V1RA 4OMOA 2JN0A 1PCXA 1WJRA 3CC4Q 2NUPA 3PMTA 4DOVA 2QQSA 3CD6A 4PJOE 1WZOA 2FL7A 1YJ9T 2QEXA 1VQ7T 2M02A 2HZYA 3OYDA 5GJWB 2LCCA 3CCJA 5GANd 2KNBB 3CC7Q 1PD1A 1OX8A 2F2XA 1GCQC 2KE9A 1YN8A 2GNCA 1YJNQ 4JJDA 1GCQA 3BY7A 1MMGA 1V1CA 4FL6A 1UFFA 2NYSA 1X2KA 4RTZA 4LNPA 2CZ0B 4JRIA 3C94A 4M77E 2CP2A 3JB9J 1NJIU 3MEUA 5IXFA 4M75B 2XDPA 1WJSA 1QVPA 2ZPGB 4F17A 2YUPA 1VQ4A 2E70A 3H0FA 4R55A 4OMLA 4C8QA 2EQIA 3IQLA 4C5IA 2ECZA 3CC2A 4QVDA 4F16A 3I5RA 4LUEA 4ELYC 2R57A 1Q82R 1V29B 2OI3A 1RAAB 1PG5B 3NFCA 5GANe 2RQVA 3UATA 1K9MU 1AVZC 4KT0E 3G6EQ 2KXCA 1I81A 2M1HA 1G8XA 3OMGA 1UB4A 1OZ3A 2PTKA 2ESWA 3CEYA 1UGPB 2DTHA 3ZFJA 4BDYA 2RQUA 5GMKi 1M2VB 1YCSB 1X6OA 1T3LA 3LGLA 2SRCA 2PUOB 3RESA 1BB9A 3OW2S 3CCUT 3VS7A 1MMDA 2FYKA 4E7ZA 2F69A 3O5ZA 2SEMA 5GAN2 3EGDA 1YHQQ 3QHSA 3P8BB 4C5EA 2Y4YA 2ABLA 3A8MB 1FX7A 1PM3A 5I21A 4LDYA 4HT8A 2NUTB 2OTLA 4NL3A 2D0NA 4MZMA 5D6WA 2DILA 2PVGB 2O9VA 1YI2Q 1TS9A 1Y0MA 3E2UA 4M7DG 2ZPFB 1YHQA 2C0IA 2O88A 4C92C 3QDRB 4J6WA 5GAMh 1MMNA 4C5HA 1FMKA 1JJ2A 2RHXA 2RQWA 1QKWA 5GANh 3JCMd 1X2QA 2DTOA 1I1JA 3H8ZA 3EG9A 1M3BA 1M8VA 3M57A 3L2ZA 4AFUC 3G4SA 2JTFA 1WIEA 3QKJA 5GMKm 3HSBA 3TREA 4J9EA 3CC2Q 1F1BB 1JEGA 3OYBA 3UA7A 4MDXA 3ME9A 5FU6C 1VQ8A 1VQNT 3OS0A 1VQKQ 2DLPA 2HKQB 1BIAA 4WTOB 3JB9F 1X01A 3FDRA 2FPFA 4DOWA 4N4HA 2A36A 1M3CA 2NUTA 3NHNA 1G3WA 4DBRA 2CSIA 1QP2A 2GBQA 1EX4A 1C1AA 3JCMg 1WXTA 3A8GB 1VQKA 4JS5A 3BDLA 4LUDA 1EFNA 2PUKB 2CT4A 5HK0A 4X1VA 5KE2A 3CPWP 4JJNK 3M4YA 2MWPA 3CD6T 3CCLT 3C4SA 4EIKA 1M90R 2YRVA 3MEVA 2EYYA 4C8QD 2CH4A 3OSSC 3OYJA 1VYUA 4C92E 1WQ7A 1YP5A 4IUPA 4C5GA 4VUBA 1KIKA 2ENMA 3VV0A 4QQ6A 4M75F 3WVEB 1BI2A 2KRMA 4NOYA 1S72Q 4M7AB 3QG1A 1P92A 3CCVA 2DF6A 4KBMB 5GAOl 5GANf 4IUVA 3OB9A 1KJWA 1BI3A 3CCVT 2E5KA 3CBPA 4LDVA 5LL6S 3JCMQ 1AZEA 4A53A 2HEQA 3VUZA 5FLXE 2VWFA 1IO6A 5J39A 4X34A 1WHHA 3H0IA 3I55A 1BCMA 3O8VA 2HAXA 1X27A 1WHLA 3DKMA 1SRLA 5GAOr 1TUDA 3VS3A 3E9FA 2LCSA 2VGNA 3M59A 4ANJA 4QQDA 4J7FA 2DD5A 3OYCA 3TVTA 3C12A 5KCOA 2WSCE 1RAGB 4J9CA 4JPBW 2LT4A 1YFNA 4P5NA 1KQ2A 1OQKA 5CKBA 1E6HA 4JLGA 4D8DA 1M5Q1 2VUBA 3I56Q 2V8KA 1N8RC 3OS2A 4C0FA 1UECA 5IHNA 1XQHA 4LE9A 2PZ1A 3JRZA 3EGUA 4AFQC 1B3QA 4FT2A 4IUQA 2IIMA 1OPKA 5IHKA 4M7DA 1ABQA 3TQ7P 4M7AG 3FC3A 2GTJA 2ZGWA 1VQNA 1RI9A 2JJ9A 2MI6A 3QJYA 1RAIB 3TCJA 3SD4A 2QQRA 1PRMC 3GLXA 1U06A 5IXBA 2QTVA 4HVWA 2AK5A 2DAQA 1A0NB 1M1KU 3LW5E 4NS5A 4EMKB 4BY6B 2JS0A 3EG9B 4M78C 1OOTA 2KYMA 3EG2A 2XK0A 1ZHIA 4EMKA 3GF5A 1TUCA 2J06A 2EAYA 2X35A 4F7UB 2KDSA 3RERA 3V7SA 1KQSS 2CP6A 1X6BA 1H641 1NPPA 1B07A 1VQ8T 4LN2A 1VQ7Q 4QVCA 4B9WA 3V7CA 3JCMJ 3I5SA 5LJ5f 3CXCS 5GMKe 4B6MA 3CCUA 1VQMA 3MP6A 4EMGA 1D3BB 1B34B 4LD9K 2PNIA 2DYIA 2KGTA 4IUTA 4M75G 1W4SA 1VIEA 2OJ2A 1RI0A 2CP3A 1K8AR 1U1SA 3X28B 1EIFA 2MWOA 5J3BA 1W2BP 2I0NA 2EKHA 4BE0A 4Q5WA 3ZBDA 2YXYA 5CK9A 1Z9ZA 1QQJA 1KD1R 2E1HA 3THKA 1Q81C 1G5VA 1N9RA 2HQHA 2JT4A 3CBOA 5A0LA 3M9QA 2E10A 4FSSA 1VQ4T 1IHVA 2EFIA 2RI2A 2QI2A 3M5AA 1UGSB 1RL2A 1D09B 2X3XD 2XG8D 3PMIA 1VQOT 1VQ9T 1KC8U 1KD1C 3CCRA 1J3TA 1LCKA 3VRZA 5I22A 4JRPA 1TSFA 2XIDA 1YJWT 3FB9A 4HXJA 1N6AA 5FU6B 4M77D 2JTMA 4M7AE 1Z9QA 3A1PA 2V1QA 1N9SA 1WYXA 3OS5A 4KH1B 3NTKA 2DBKA 1H92A 4KH0B 1WDXA 1VQ9Q 3QZ9B 1MNDA 2LQ8A 4ME7A 4OB2B 1M1GA 1MUZA 2JMCA 1AHJB 2DL7A 5GMKj 2HQXA 2DXBA 3CMET 2ZPHB 1K0SA 5FRMA 1ZUUA 2L2PA 4OVAA 3RMSA 2EBPA 2DA9A 4LDXA 2GTOA 1QLYA 1K1ZA 2BKDN 2DMOA 1VQOA 2RQTA 4L6V5 2HQEA 1RUWA 1BIBA 3GBQA 2JXBA 1ZBJA 4HCKA 4R56A 5GAMd 1PKTA 5CQXA 4PJJA 2X4XA 2DO3A 2AKKA 2DJZA 4PJOC 2DIGA 2E64A 4C0DB 1SKUB 1WQWA 3LGFA 3CCSA 4A4KA 4M7AA 3QYGB 1QWFA 3N5BB 2HCKA 4E7LA 4JDSA 3E9GA 2OTLT 1M1KC 2C0OA 1WGSA 1TWBA 1GFDA 1R0CB 3HL8A 1NLOC 3CXCP 2LNHB 4OMNA 4M78E 1FMWA 1VQ6T 4X9CA 1S72A 4M7AC 1K8AU 2FRYA 1ZSGA 2NWMA 4F7UF 2JMAA 1VQKT 4KUIA 1GL5A 1KQSA 1NG2A 5A2QE 2P0KA 3M55A 1OI1A 1K9MR 4RUGA 5LJ3f 3MP8A 2X51A 1I4K1 1YIJT 5IAYA 1BKBA 3DB3A 1YJ9Q 2G6FX 1VQPA 1D1CA 6AT1B 1M8MA 1TG0A 1YWPA 3OYFA 4F04B 2HNIA 2EVRA 1TUGB 2YT6A 2L3RA 2AIRB 2WSFE 4IKFA 2B86A 3TSZA 2O9SA 2L3QA 2RH2A 5AYFA 1YJNT 2GFAA 4RTXA 1BCOA 2K2MA 4GLMA 4EPCA 4IURA 3AHUA 1ZA2B 2K4YA 4FYXB 5CAIA 2YUOA 3M0UA 1R77A 1UDLA 2QYZA 1KC8R 3F70A 3EH2A 1WHGA 1Q7YR 3MEWA 2LCLA 3L1AA 3OSVA 3BDUA 3CMAA 1BYMA 3CCET 5GMKh 5GAMe 3L2VA 3OBYA 5L8RE 4F7UE 2BZXA 2VXEA 3JCMb 3G7ZA 1UE9A 5D6YA 2RK2A 4AT1B 1XNIA 4RG2A 2J6KA 3OYLA 1VUBA 4FYYB 4N4IA 1G3YA 5GANg 2JTEA 4FU6A 3EG3A 3M0QA 4FW2A 2YHTA 5HCKA 2JM8A 5FU7B 1ZA1B 3WXMB 1Q86R 1BI0A 5KYXB 2JUFA 3BFMA 1JXMA 3HHTB 5GAN7 4FT4A 2CZ7B 4M78B 1AD5A 5KH6A 3EGDB 4M7DE 3CCQT 3GNGA 5GAN4 1JBMA 1YJWQ 4BUGA 2OTLQ 1FMVA 2HBPA 4GBQA 2JOYA 1RABB 4OMQA 4GY5A 2CUBA 1E7OA 1KHCA 1CKAA 2K5FA 1NEBA 3CCSQ 1E6GA 3A98A 3JCMh 1IZ6A 3CCQQ 1VQLQ 2CP5A 1B34A 1UGQB 4J9FA 1RLPC 2DE0X 4PFOA 2F5KA 1U5SA 5D6XA 5CKEA 4Z89A 3G6EA 3OW2P 2XD0A 4J9IA 4C8QC 2L0AA 1QVGS 4PLIA 1GRIA 4XU2A 2HSEB 4BI8B 3S3OA 2NUPB 1I5OB 2LX9A 4JJBA 2GCXA 2RNAA 3H41A 1S72T 2VB6A 4J9DA 3QYHB 1OX9A 3E1SA 2IG0A 1AWXA 2K3XA 4M7DF 4M77A 2DEUA 1K73R 3JCMV 1JXOA 1Q82U 2R58A 4M7AD 5FW9A 1YCYA 2BUDA 2DX1A 3UWNA 4J5YA 3CBMA 1K4US 2XI9A 4A4GA 4O5VA 4R0KA 2MAMA 1N27A 1Y96A 4CC2A 1UUEA 1R0BG 3OYMA 1IREB 4BE2A 2O2OA 3JCMe 2ED1A 4HCCA 1CKBA 4M7DC 4OB3B 3HRSA 1G3SA 1G3TA 2P84A 4LXCA 2DERA 1SRMA 2P4TA 3M0SA 1IGQA 2QXFA 3ULRB 1ARKA 1X69A 5DLOA 2EPDA 2E5QA 4Z02A 2EYQA 4DA4A 2C0TA 4QVZA 1PNJA 3CPFA 2XKOC 3VS6A 4WCIA 2D0QB 1U1TA 1PD0A 5M9OA 3OY9A 3VS1A 4XTXA 2ZCFB 1MV3A 4PJLA 2EQJA 3RIRA 4RMOA 4E7KA 3QBYA 4JLIA 4N0AC 2EJ9A 3QO3A 3SB2A 4M75E 4HVVA 2OX7A 1D1AA 2KK4A 1D0YA 2M9UA 4JUVA 2COYA 1NPRA 4OGCA 3QZ5B 1YNZA 2KMTA 4RTTA 2D9TA 4C0DC 2VVKA 5I2SA 3JCMc 3CCQA 1VQMT 1K73U 4OMPA 3NTHA 1K9AA 1D1BA 4OB1B 3CCMA 2R5MA 4ZN3A 2K5LA 2DJQA 3H9NA 2K2VA 2IVWA 5FRNA 2QAZA 1HK9A 2QA4A 1CSKA 4KULA 2LDMA 2BE9B 2O31A 2EGAA 3PVLA 1RAEB 1SG5A 4MDWA 2HL3A 1VA7A 3M53A 4EDUA 4WF2A 1VQPT 2VXFA 1WNLA 5CR2A 2MK5A 4Y28E 3RDVA 4FCYA 2YLBA 4AG2C 2ZPEB 2JVVA 2P0QA 1EZZB 4PJMA 3MPUB 1QWEA 1M4ZA 5DLQE 1RAFB 4TVRA 1KG1A 4C8QB 1YITT 3VU3C 4FW1A 2O01E 1WFWA 3G6ET 4M75A 3KXTA 2CSQA 2DNUA 2MYSA 2ZZDA 4M77F 1X75C 2M0YA 3J7AF 3CMAQ 4II1A 4Z88A 4ZTJA 1UG1A 3MJXA 3PIOA 1ABOA 2K79A 3CCST 1BU1A 2B8AA 1Q7YC 1PRLC 1W2BS 1IGUA 3QJ6A 2J6FA 3META 1XTDA 2E12A 2EYZA 2BZ8A 4HVUA 5LJ3h 4A4FA 2KROA 2DYBA 4ATOA 1I5LA 4PFPA 3VUBA 1G83A 3MCAB 2XU8A 4M75D 5CO7A 4AG1C 4JJCA 1JU5C 1VQ8Q 5LJ5j 3CCRT 3S3MA 1VQ6Q 2YRDA 4V2SA 1Q81R 4ZGEB 5C0MA 2EWNA 2BE7D 1YJ9A 1BI1A 4PJOD 2LC4A 4PJOG 3R6NA 1TXQA 3SDZA 2W0ZA 8ATCB 2YLCA 3FJ5A 2QK0A 2DL4A 1UGVA 3PNWC 2LQNA 2HMAA 3ZL7C 2DXTA 1QMCA 2CP7A 1JO8A 1VQLA 2FEIA 2COZA 2F2VA 3PT9A 3MEAA 2FZCB 4L5GA 1UTIA 4A4EA 2L3SA 2KYBA 1YIJA 4A54A 5KE3A 3A8LB 2DXUA 3M0TA 1YI2A 3EAEA 1TOVA 2X4WA 2RB6A 2WSEE 1AWOA 5KYUA 4IIOA 1YJWA 5GAMj 2K7AA 3GIBA 1UEBA 2DBMA 3GOXA 1T3SA 4PL6A 3INZA 2RM4A 3UT1A 2KT8A 3NGPA 3OS1A 3G71A 1QCNA 2F1LA 5LJ5h 4J6YA 5IT9E 2QDYB 3EGXA 2QQAA 5CVIA 2ZPIB 2PVDB 2DVJA 4DBFA 2JZ2A 5GAOp 4BACA 1LNXA 4OGEA 2KI7A 1NJIC 1T0JA 2CUDA 4E7JA 3H0HA 4BD3A 5FWCA 1H3HA 3OYGA 3M56A 3RR6A 1IXDA 2PVOB 2A0FB 4M77B 2E65A 3HFOA 3RKYA 4PJOF 3M54A 4X9DA 1VQ5T 4J9BA 2YRCA 3OMCA 3TSWA 2AHJB 3S6WA 4E2FB 1GCPA 2GQVA 4CRIA 3JCMP 1QKXA 1WHMA 5GAN6 2QGGA 3RKWA 1Y96B 2AT1B 3RMQA 2EGEA 4JRKA 3AT1B 1TTHB 2XDBA 3X26B 1VQ9A 4FYWB 4C0ZA 3RKXA 2RQRA 4A63B 4ORZA 3CQTA 1NBEB 2D8JA 1IB8A 3QPHA 2RN8A 3RUXA 2D8HA 3JB9G 2RK1A 1RAHB 5KYNA 3MKDA 3M0RA 2DZCA 3NMZC 3CCRQ 4ZTFA 3M58A 4J9HA 3VYHB 2LVMA 3G71T 5L23A 1KHIA 2WACA 3OYHA 4XAXB 3LLRA 2CGHA 1QCOA 1WI7A 1K73C 1Q86U 2QASA 3R6OA 3JB9D 4E7HA 3CC4A 2AKLA 4DQ2A 1SEMA 3X20B 1WHKA 4DBQA 3DLMA 1S1NA 1VQ5Q 4M7DB 4ZGDB 2VGMA 5A0GA 2R5AA 1BK2A 1N8RU 3UF4A 2H3EB 3QXEB 4IIMA 5GAOm 1W1FA 4C8QE 2Z0WA 2G3RA 1Q81U 2L89A 1JJ2S 2OTJQ 2DK3A 4RCBA 4HCBA 4KGZB 3M0PA 3CCMQ 2CH4W 1MNEA 2JS2A 2A3LA 2E3HA 4C8QG 1VQMQ 1YWOA 1WJQA 3JCMf 1AOJA 2L3PA 2EYWA 4KGVB 4XTWA 3ER0A 1I8FA 5AT1B 3OQ5A 3LWHA 3QSUA 2W10A 3L2WA 3VS4A 2KRSA 3L2UA 4D6WA 3C95A 1QP3A 1M2OA 1M3AA 2A28A 2P0PA 5LJ3e 2J6OA 3EFOA 4QW2A 2FRWA 1XJWB 2DXCA 1VQ6A 2AZVA 1FYNA 2H3JA 2L8DA 2O4XB 1D0ZA 3UDCA 4F14A 3PTAA 4BI3A 3URGA 2NUZA 5EG2A 7AT1B 1VQ4Q 1K0XA 1ZSZC 4CC3A 2HSPA 2JM9A 2LJ1A 4XTZA 1OPLA 2OAWA 2V26A 3VS5A 3JCMW 4C92G 2RHYA 3J80E 3EG1A 2EYXA 2CKKA 2QTXA 1SSHA 2FHDA 3REBB 2IPOB 1PSEA 1FWZA 4IUUA 4QT7A 4OB0B 1MMAA 2K9GA 5CKDA 1Y07A 2RA2A 5LJ3d 1YI2T 4J9GA 1HJDA 1U3OA 1Q82C 3OYYA 1LPLA 2RI3A 2HD0A 3VS0A 5IN1A 2QEXQ 4XTUA 3ASKA 5GJVB 1ZUYA 2DVEA 3CD6Q 4LDUA 2OAUA 2VC8A 2FZGB 2DPPB 1OU8A 3OYNA 2KXDA 4M4ZA 2HKNA 4RKUE 2I2LA 2DZ9A 4AFZC 3CCMT 2YUNA 2VYTA 1SPKA 1W6XA 4KGXB 2JW4A 4UC4A 3KFVA 2M16A 2D6FA 2BIVA 3OYEA 4C92A 2QA4Q 1M2VA 2CDTA 3SEMA 5GAOq 5D7UA 5GANj 1JB0E 1Y7XA 1WA7A 3OYAA 4XU1A 3T9NA 2YSQA 1WXUA 3I55Q 2DIQA 3CPWA 4LDWA 3CCJT 1WX6A 1Q86C 5I2MA 5KYWB 1VQ7A 2Y4XA 3EFOB 2LX7A 4M77G 2DD4A 1N8RR 2LQKA 4QKUA 1VQLT 4J83A 2HL5C 3LX7A 2K57A 2A7YA 5EC7A 2QGFB 1WXBA 1M9SA 2OTJA 1ZBXA 1MGQA 4FM4B 4XTVA 1AT1B 3LWIA 1KK7A 2KT1A 2K3YA 5A0DA 1BBZA 1UHCA 3J81E 2EGCA 3G4ST 3JB9H 4HT9A 3TEEA 1LJOA 4M77C 2RO0A 1JRIA 4MZTA 1VQ5A 1MHNA 2KVQG 1YITA 2K5IA 3E19A 3HRUA 3A8HB 3I56T 1T0HA 1M1KR 2PQWA 2FPEA 3QWXX 2RD1A 2ZAEA 5GAOn 4N0AA 3CC2T 1RLQC 3QWYA 1FXXA 2KY9A 2LT1A 1GBQA 1UJYA 1VQNQ 3SWNC 1SF9A 4Z8AA 1ZSZB 4E6RA 2BTTA 4CC7A 1VYTA 2DKGA 5LJ5g 1AWJA 2DRKA 4JZ4A 3NTIA 4QQGA 2C06A 3EHQA 4J8OA 1G2BA 2O4XA 1NJIR 3GNFB 1C6VX 1V76A 3KBGA 3EHRA 3CXCA 1VIFA 2EW3A 1K9MC 2KQWA 1H3ZA 3P8HA 3UPUA 3I56A 5C6SA 1D3BA 4XTYA 2EIFA 1ACMB 1U8RA 1R8OB 5FWBA 2MCNA 5KYXA 3CC4T 1O9SA 3V7RA 2GGRA 5HY6A 3OYKA 3G1JA 4NL2A 1YHQT 2ZPBB 3QDFA 3C0CA 4BI4A 4ELZC 1GBRA 5LJ5d 2X4JA 1JQQA 2GF7A 3VYGA 2MMPA 2K6DA 2QA4T 4J6XA 2M51A 3HP9A 1KC8C 1RACB 1X43A 2EKOA 4XK8E 3CPWS 3EH1A 3I55T 1H8KA 1PKSA 3LYIA 4RTWA 3X25B 2RF0A 3WVDB 2P4RA 2RHZA 2LJ3A 5KCHA 2ED0A 3G71Q 2OTJT 1OU9A 1OV3A 3JSCA 2LQWA 3MHXA 4OMFB 5J26A 1PC0A 1RADB 4C92F 1M90U 4RG8A 1QW1A 3CCVQ 2DFUA 2EQUA 1IRXA 4M78F 3JB9I 3V8LA 3OBWA 4HKEA 1UGRB 3V8KA 1TU0B 5ECAA 2QEXT 2L5QA 1WPYA 4E7SA 4YTLA 3PVQA 1PWTA 2M0OA 4D8KA 5KYUB 1I0CA 5KYYA 4DEYA 3LH5A 1Y71A 1KFZA 1NZ9A 1SSFA 2HBWA 2KSSA 3FLGA 4N4GA 1QCFA 1M30A 2EQKA 4ZNXA 3HPWA 4O6JA 3SWNA 2XMFA 1MV0B 1VQOQ 3CC7T 8AT1B 2LNVA 3CCLQ 2QQ9A 1WLPB 3PGGA 5CIUA 2QDLA 2RJDA 1KD1U 2YUQA 4Y91A 4PLLA 3BE3A 2BZYA 4C8QF 1SHFA 4PJOB 2CZ1B 5GAN5 1QVFS 2YDLA 3SHWA 1AWWA 4J7IA 1TH7A 1OULA 4OP0A 2E4HA 2FVUA 2CZ6B 2EQMA 2EJGA 2A37A 5LJ5e 2LRQA 5DM7R 5CQYA 2YWWA 3FJPA 2DL3A 1AEYA 3S3NA 4BDZA 2KRNA 3OYIA 3H6ZA 2X4YA 3CC7A 3CCLA 1QVFA 3G4SQ 2E6NA 2RJEA 1VQPQ 1OZ2A 1PSFA 4HCZA 1X6GA 2JNGA 4K11A 2E6ZA 2KR3A 3A5ZB 3TU4K 2FG0A 5LJ3g 1VYVA 1LVKA 2J05A 1YITQ 9ATCB 4JZ3A 2GQIA 4EMKC 3FIFA 3SFMA 3CMEA 3DLLA 1IHWA 3EFRA 2KEAA 3NPFA 3LH0A 2RHIA 2RMOA 2COWA 4MMKA 4RCCA 1HSQA 1VOMA 2FO0A 4PNOA 2X3WD 2MOXA 4CC4B 2ROLA 2F2WA 2Y90A 3FRNA 1NYGA 4HA8A 2QQBA 3D7SB 3HTRA 4A4HA 4ESRA 3REAB 1YIJQ 1M1FA 5GAN8 3CCEQ 1QVGP 3U23A 1OYXA 2CT3A 2CYZB 4PK4A 2LTOA 2DL8A 4OF1A 2CREA 4RTVA 1LOJA 1NE8A 1KSWA 4E7IA 4M78A 1W2BA 4AFSC 3Q1JA 5FU7C 3P8DA 2VV5A 1N5ZA 5GAMf 4AMCA 5KYWA 2VKNA 5HK3A 3VJPA 5IHIA 1WHJA 1SHGA 3GPLA 1DJ7B 2KAFA 3V8JA 4F7UG 1NYFA 2MF2A 2LMJA 1UJ0A 1KQ1A 1QVFP 2FZKB 2E3IA 3FEOA 1YBYA 4JS4A 3JCMX 3OW2A 4M7DD 4M78D 4FIBA 1K76A 1GFCA 2CS7A 2MPXC 2ROTA 3RBBB 2ATCB 3HKSA 4L59A 4GLKA 4PFZA 1GXIE 1I07A 2V8IA 1Y57A 1O75A 2DEQA 1ZSZA 2LP5A 4MMLA 5HKCA 1M90C 2HDAA 4B9XA 4DBHA 2XDDA 1ZQ1A 2J7IA 2XICA 2GFUA 4CI0C 3UA6A 4M7AF 1B7TA 2A08A 3PE0A 4XU0A 3L2RA 1NLPC 3I35A 4DEXA 1XOVA 2D1XA
chains in the Genus database with same CATH topology
1Y96A 5GMKl 3OYMA 4M7DA 1IREB 5CKDA 4BE2A 1YJNA 3BW1A 1Y07A 3HFNA 4C92D 4M7AG 2RA2A 5LJ3d 3JCMe 1YI2T 4HCCA 3MP1A 3FC3A 5CCAA 1Q82C 2ZGWA 4M7DC 1VQNA 4OB3B 2RJCA 3OYYA 4M78G 3HRSA 4XU3A 1G3SA 4BY6C 3GP8A 1G3TA 2MI6A 3QJYA 2RI3A 2P4TA 5CKHA 2HD0A 2QXFA 3TCJA 3SD4A 4PKCC 5IN1A 2QQRA 3GLXA 4XTUA 3ASKA 2FB7A 5DLOA 2E5QA 4Z02A 2DVEA 4BE1A 4LDUA 4E47A 2EYQA 2OAUA 2VC8A 4DA4A 4QVZA 3VKIA 2RI5A 1K8AC 2DPPB 3OYNA 4F7UA 2DAQA 3CPFA 2XKOC 3DB4A 1M1KU 1QVGA 2XHCA 3MO8A 3LW5E 3CMAT 4NS5A 4RKUE 2I2LA 2DZ9A 3L42A 3L2QA 1Q7YU 2D0QB 1U1TA 3CCMT 5M9OA 2VYTA 3OA6A 4EMKB 2EJFA 4ZGJB 3OY9A 4UC4A 4BY6B 2M16A 4XTXA 4M78C 2D6FA 2ZCFB 2BIVA 2XK0A 3PFSA 1ZHIA 2EQJA 3RIRA 3ZEHA 4EMKA 4RMOA 3OYEA 4BB7A 4E7KA 4C92A 3QBYA 3KUFA 3GF5A 4LD6A 4MZPA 4JLIA 4N0AC 2PU9B 2EJ9A 2EAYA 4EMHA 2X35A 4XQ3A 5GAOq 4M75C 4F7UB 3QO3A 5GANj 3SB2A 4PJOA 4M75E 2KDSA 3RERA 3V7SA 2KK4A 1JB0E 1KQSS 2M9UA 4JUVA 1Y7XA 3M4GA 1H641 1NPPA 3OYAA 4XU1A 5CKFA 3T9NA 1NPRA 5GAN3 1VQ8T 4OGCA 3A8OB 2E41A 3QZ5B 3HRTA 2KMTA 4QVCA 2D9TA 4C0GA 2RJFA 4C0DC 4B9WA 5I2SA 3JCMc 3CCQA 2DIQA 3CPWA 3V7CA 4LDWA 3JAME 3CCJT 5LJ5f 3JCMJ 2RHUA 3QIIA 5I2MA 3CXCS 1VQMT 1Q86C 4C92B 3CCEA 1K73U 2DTIA 1VQ7A 2Y4XA 4M77G 5GMKe 2DD4A 3CCUA 3SWNB 1VQMA 3NTHA 4JRQA 2LQKA 3MP6A 5FROA 4OB1B 4EMGA 5LJ3j 5GAMg 1D3BB 2R5MA 3CCMA 1VQLT 4KUDK 3QUIA 4J83A 4ZN3A 3EFSA 2K5LA 1B34B 4LD9K 3LX7A 2K57A 2A7YA 2K2VA 2IVWA 4IUTA 4M75G 2F5TX 1M9SA 5FRNA 1W4SA 2OTJA 1ZBXA 1HK9A 1MGQA 1VIEA 2QA4A 4FM4B 4KULA 2LDMA 4XTVA 1RI0A 3LWIA 4FSXA 1U1SA 3X28B 1EIFA 1HXDA 2V8JA 2K3YA 2MWOA 5J3BA 5A0DA 3X24B 4MDWA 4BE0A 3J81E 4Q5WA 3M53A 4EDUA 4WF2A 3G4ST 3ZBDA 1VQPT 3JB9H 2VXFA 1LJOA 1WNLA 3TEEA 4M77C 4ZN1A 5CK9A 4HT9A 2RO0A 1JRIA 4MZTA 4Y28E 5CR2A 5DY9A 1VQ5A 2NLUA 2E1HA 1MHNA 1Q81C 1G5VA 1N9RA 2KVQG 3PIPA 2YLBA 2ZPEB 2JVVA 1YITA 2P0QA 2JN0A 2K5IA 3E19A 3HRUA 1WJRA 1M4ZA 3A8HB 3CBOA 5DLQE 5A0LA 3I56T 3PMTA 4TVRA 1KG1A 3M9QA 2E10A 2PQWA 4DOVA 1VQ4T 4C8QB 2EFIA 2QQSA 2RI2A 1YITT 3CD6A 2QI2A 2RD1A 3VU3C 5GAOn 3M5AA 4PJOE 1UGSB 1RL2A 2O01E 4N0AA 2FL7A 1YJ9T 2XG8D 3PMIA 2QEXA 1VQOT 1VQ9T 1KC8U 3G6ET 4M75A 1KD1C 3CC2T 1VQ7T 3CCRA 3KXTA 4JRPA 1FXXA 2XIDA 3OYDA 2KY9A 2LCCA 2LT1A 3CCJA 1YJWT 5GANd 2ZZDA 3FB9A 4M77F 3SWNC 1X75C 3J7AF 1N6AA 5FU6B 4M77D 2JTMA 4II1A 4ZTJA 4M7AE 2DKGA 3BY7A 5LJ5g 1N9SA 3PIOA 3OS5A 4FL6A 3NTKA 3CCST 2B8AA 3NTIA 4QQGA 2C06A 1Q7YC 4J8OA 1W2BS 3QJ6A 3QZ9B 2LQ8A 2O4XA 1XTDA 3META 2E12A 3GNFB 4ME7A 4OB2B 2CZ0B 5LJ3h 4A4FA 4JRIA 1M1GA 3KBGA 3C94A 3CXCA 1VIFA 1AHJB 4M77E 3JB9J 1NJIU 1K9MC 2KQWA 3MEUA 1H3ZA 4ATOA 3P8HA 1I5LA 4M75B 3UPUA 3VUBA 2XDPA 3MCAB 5C6SA 3I56A 1D3BA 4XTYA 1WJSA 1QVPA 2EIFA 2HQXA 2ZPGB 2DXBA 2E70A 5GMKj 1VQ4A 2XU8A 1U8RA 4M75D 5CO7A 3CMET 4R55A 1R8OB 4C8QA 2ZPHB 3CC4T 5FRMA 1O9SA 3V7RA 5LJ5j 1YIJT 5HY6A 4C5IA 3CCRT 3CC2A 4QVDA 4OVAA 3RMSA 4ELYC 3OYKA 3S3MA 2R57A 4V2SA 4ZGEB 5C0MA 4LDXA 2EWNA 1V29B 4NL2A 2BKDN 1VQOA 3NFCA 1YJ9A 1BI1A 2ZPBB 4L6V5 2LC4A 5GANe 1YHQT 4BI4A 4ELZC 1K9MU 4KT0E 4PJOD 2HQEA 4PJOG 1BIBA 2X4JA 5LJ5d 1I81A 2M1HA 3SDZA 2GF7A 3OMGA 1UB4A 3VYGA 2MMPA 1OZ3A 3CEYA 1UGPB 2YLCA 4J6XA 2QA4T 2DTHA 3PNWC 3ZFJA 4R56A 5GAMd 4BDYA 5CQXA 5GMKi 3HP9A 2DXTA 2X4XA 2DO3A 1KC8C 2DJZA 1X6OA 1VQLA 4PJOC 3LGLA 2DIGA 2E64A 2EKOA 4XK8E 2PUOB 3PT9A 3MEAA 3RESA 4C0DB 3CPWS 4L5GA 3OW2S 3CCUT 3I55T 1WQWA 2FYKA 3LGFA 2F69A 4A4EA 3CCSA 3LYIA 5GAN2 3X25B 4A4KA 1YIJA 4M7AA 3QYGB 3WVDB 3N5BB 3QHSA 4A54A 5KE3A 3P8BB 4E7LA 3A8LB 4JDSA 3E9GA 2RHZA 2DXUA 5KCHA 4C5EA 2OTLT 2Y4YA 1M1KC 3A8MB 1YI2A 1FX7A 3EAEA 2OTJT 2X4WA 5I21A 4LDYA 2RB6A 2WSEE 1WGSA 4HT8A 3JSCA 2OTLA 3MHXA 4NL3A 4OMFB 5J26A 5GAMj 3HL8A 1YJWA 3GIBA 1UEBA 3GOXA 4MZMA 4PL6A 5D6WA 2PVGB 4C92F 1M90U 3INZA 4RG8A 1QW1A 2RM4A 3UT1A 3OS1A 2EQUA 4M78F 3JB9I 3G71A 4M78E 4M7DG 1VQ6T 2ZPFB 5LJ5h 4X9CA 1YHQA 4J6YA 5IT9E 1S72A 2QDYB 3V8LA 3OBWA 4M7AC 1K8AU 2QQAA 4O5VA 5CVIA 4HKEA 3QDRB 1UGRB 4C92C 3V8KA 4J6WA 2ZPIB 2PVDB 5GAMh 2QEXT 2JZ2A 2L5QA 1WPYA 5GAOp 4BACA 1LNXA 4OGEA 4YTLA 4C5HA 1NJIC 2M0OA 4F7UF 1JJ2A 2RHXA 1VQKT 1Y71A 4E7JA 4KUIA 5GANh 1NZ9A 1SSFA 2KSSA 3FLGA 4N4GA 1KQSA 3JCMd 5A2QE 2P0KA 2DTOA 3M55A 1OI1A 2EQKA 4BD3A 3H8ZA 3MP8A 5LJ3f 3HPWA 4O6JA 1I4K1 3SWNA 5IAYA 1BKBA 3DB3A 3M57A 3M56A 3L2ZA 3OYGA 1VQPA 1M8VA 3CC7T 3G4SA 2JTFA 3QKJA 5GMKm 3HSBA 2LNVA 3OYFA 3TREA 2PVOB 2HNIA 4M77B 2E65A 2QQ9A 3HFOA 2L3RA 2WSFE 3RKYA 4PJOF 3OYBA 4MDXA 3ME9A 4IKFA 3PGGA 5FU6C 1VQ8A 5CIUA 2RJDA 3M54A 1KD1U 4X9DA 4Y91A 1VQ5T 1VQNT 4PLLA 3OS0A 3OMCA 1BIAA 2AHJB 2RH2A 5AYFA 3S6WA 4C8QF 1YJNT 3JB9F 1X01A 4PJOB 2GFAA 2GQVA 4CRIA 2CZ1B 5GAN5 3JCMP 3FDRA 4EPCA 1QVFS 4IURA 5GAN6 3RKWA 4DOWA 1Y96B 3AHUA 4J7IA 2K4YA 4N4HA 1TH7A 3RMQA 4JRKA 2XDBA 3X26B 5CAIA 1VQ9A 4OP0A 1G3WA 3F70A 2FVUA 2CZ6B 4C0ZA 1QP2A 3RKXA 3JCMg 2EQMA 3A8GB 1VQKA 2EJGA 3MEWA 4JS5A 5LJ5e 2LRQA 2LCLA 3L1AA 3BDLA 3FJPA 3OSVA 5CQYA 5DM7R 3BDUA 3CMAA 3S3NA 3QPHA 4BDZA 3RUXA 1BYMA 2PUKB 3OYIA 5HK0A 3H6ZA 2RK1A 5KE2A 3JB9G 3CCET 5GMKh 5GAMe 3L2VA 3OBYA 2X4YA 3CC7A 3CCLA 4JJNK 5L8RE 4F7UE 1QVFA 3JCMb 2VXEA 3G7ZA 2E6NA 2DZCA 2RJEA 3M4YA 5D6YA 2RK2A 1OZ2A 1PSFA 1XNIA 4HCZA 2MWPA 4RG2A 4ZTFA 3M58A 3VYHB 3CD6T 3CCLT 2LVMA 3OYLA 3G71T 1VUBA 2WACA 1KHIA 2JNGA 3C4SA 4XAXB 3LLRA 4N4IA 2CGHA 1G3YA 3OYHA 5GANg 1K73C 1Q86U 2YRVA 3MEVA 2E6ZA 4FU6A 3A5ZB 3R6OA 4C8QD 3TU4K 3JB9D 5LJ3g 4E7HA 3CC4A 4DQ2A 2YHTA 5FU7B 3OSSC 3X20B 3OYJA 3WXMB 4EMKC 3FIFA 3DLMA 4C92E 1BI0A 3SFMA 4M7DB 1WQ7A 4IUPA 3CMEA 4C5GA 2JUFA 2VGMA 3BFMA 3HHTB 4VUBA 4ZGDB 5GAN7 5A0GA 3DLLA 2R5AA 3EFRA 4FT4A 2CZ7B 4M78B 3VV0A 4QQ6A 4M75F 3WVEB 1N8RU 3LH0A 1BI2A 4NOYA 3QXEB 5KH6A 2RHIA 4M7AB 5GAOm 3QG1A 4MMKA 4M7DE 3CCQT 4RCCA 4C8QE 1P92A 3GNGA 3CCVA 2G3RA 5GAN4 1Q81U 2L89A 4KBMB 5GAOl 4PNOA 1JJ2S 5GANf 1JBMA 4IUVA 3OB9A 4BUGA 1BI3A 2DK3A 3CCVT 4RCBA 2HBPA 4HCBA 3CBPA 2Y90A 3FRNA 2JOYA 4LDVA 5LL6S 3JCMQ 4GY5A 4OB0B 4A53A 1KHCA 2A3LA 4HA8A 3VUZA 5FLXE 4C8QG 2QQBA 2K5FA 4A4HA 1WJQA 1M1FA 5J39A 3JCMf 4X34A 5GAN8 3JCMh 4XTWA 1OYXA 2CYZB 1IZ6A 3ER0A 3I55A 2LTOA 3O8VA 2HAXA 4OF1A 1I8FA 3DKMA 3OQ5A 1LOJA 5GAOr 1UGQB 1NE8A 1B34A 3LWHA 3QSUA 3E9FA 4E7IA 3L2WA 4M78A 1W2BA 3L2UA 2F5KA 4D6WA 3C95A 2VGNA 1QP3A 3Q1JA 2P0PA 5FU7C 3M59A 5D6XA 5LJ3e 3P8DA 5CKEA 2VV5A 4QQDA 5GAMf 4J7FA 2DD5A 4QW2A 3OYCA 3G6EA 2XD0A 4C8QC 1QVGS 4PLIA 5HK3A 3C12A 4XU2A 3VJPA 5KCOA 4BI8B 2WSCE 3GPLA 3S3OA 1DJ7B 2KAFA 2LX9A 3V8JA 2DXCA 4F7UG 1VQ6A 2GCXA 2H3JA 2L8DA 2MF2A 1S72T 2O4XB 2LT4A 1KQ1A 3UDCA 3FEOA 4P5NA 3PTAA 1KQ2A 3QYHB 1YBYA 5CKBA 3URGA 4BI3A 3JCMX 3E1SA 2IG0A 4JS4A 3OW2A 4M7DD 4M78D 4FIBA 4JLGA 1M5Q1 2K3XA 2CS7A 2VUBA 5EG2A 3HKSA 4L59A 2V8KA 4GLKA 1GXIE 4M7DF 2V8IA 4M77A 2DEQA 1O75A 4MMLA 5HKCA 3OS2A 1N8RC 3JCMV 1M90C 4XTZA 4B9XA 2R58A 1Q82U 4C0FA 2XDDA 3JCMW 4C92G 1ZQ1A 2RHYA 3J80E 2XICA 1XQHA 2GFUA 4M7AD 4CI0C 1YCYA 2CKKA 2QTXA 2BUDA 4M7AF 3UWNA 4J5YA 3CBMA 2FHDA 3JRZA 1PSEA 4XU0A 3L2RA 1FWZA 1XOVA 2XI9A 4IUUA 4A4GA 4FT2A 4IUQA 2MAMA 1N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKD A;  2VUB A;  3JSC A;  5CQY A;  5CQX A;  5CO7 A;  5CCA A;  4MZM A;  5CKF A;  5CKE A;  5HKC A;  5HK0 A;  4VUB A;  2KMT A;  2C06 A;  5CKH A;  3TCJ A;  5HK3 A;  4ELY C;  3HPW A;  1M1F A;  3G7Z A;  4ME7 A;  5DLO A;  3NFC A;  3JRZ A;  4HKE A;  2MF2 A;  4ELZ C;  4MZP A;  1VUB A;  4OF1 A;  5CK9 A;  4MZT A;  5CR2 A;  1UB4 A;  1X75 C;  1NE8 A;  4MDX A;  5CKB A;  3VUB A; 
#chains in the Genus database with same CATH topology
 5GMK l;  1YJN A;  3BW1 A;  3HFN A;  4C92 D;  1NEG A;  3MP1 A;  5CCA A;  1ZUK A;  2RJC A;  4M78 G;  4XU3 A;  4BY6 C;  1M27 C;  3GP8 A;  3CCJ Q;  1KQS P;  5CKH A;  4PKC C;  2MIO A;  2FB7 A;  4BE1 A;  4FYV B;  4E47 A;  2X9H A;  3VKI A;  2RI5 A;  1K8A C;  4F7U A;  5I11 A;  1AZG B;  3DB4 A;  4OMM A;  5IH2 A;  2LZ6 B;  2XHC A;  3MO8 A;  1QVG A;  3CMA T;  1ZX6 A;  2CP0 A;  3L42 A;  3L2Q A;  1Q7Y U;  2DRM A;  3OA6 A;  2EJF A;  1UHF A;  4ZGJ B;  1PHT A;  3PFS A;  1ZLM A;  3ZEH A;  4BB7 A;  2H8H A;  4LD6 A;  3KUF A;  4MZP A;  4EMH A;  2PU9 B;  4XQ3 A;  4M75 C;  1Q95 G;  4PJN A;  4PJO A;  3VS2 A;  3M4G A;  5CKF A;  5GAN 3;  3CCU Q;  3A8O B;  2E41 A;  3HRT A;  1C0M A;  4C0G A;  2RJF A;  2DM1 A;  2K3B A;  3JAM E;  1JJ2 P;  2RHU A;  3QII A;  1OEB A;  4C92 B;  3CCE A;  2DTI A;  3SWN B;  4JRQ A;  5FRO A;  5LJ3 j;  4RTU A;  4Y92 A;  5GAM g;  4KUD K;  3QUI A;  4RTY A;  3EFS A;  3RNJ A;  3VRY A;  2F5T X;  2LJ0 A;  1D0X A;  5KYY B;  2RPN A;  2AZS A;  1HYO A;  4FSX A;  1NM7 A;  1HXD A;  3EG0 A;  2V8J A;  2DET A;  1HD3 A;  1W70 A;  3X24 B;  2FPD A;  3EGX B;  2VAS A;  3I9Q A;  3JV3 A;  4ZN1 A;  4KRT A;  2DL5 A;  5DY9 A;  2KBT A;  3CME Q;  2NLU A;  2QG9 B;  3PIP A;  2V1R A;  4OMO A;  2JN0 A;  1PCX A;  1WJR A;  3CC4 Q;  2NUP A;  3PMT A;  4DOV A;  2QQS A;  3CD6 A;  4PJO E;  1WZO A;  2FL7 A;  1YJ9 T;  2QEX A;  1VQ7 T;  2M02 A;  2HZY A;  3OYD A;  5GJW B;  2LCC A;  3CCJ A;  5GAN d;  2KNB B;  3CC7 Q;  1PD1 A;  1OX8 A;  2F2X A;  1GCQ C;  2KE9 A;  1YN8 A;  2GNC A;  1YJN Q;  4JJD A;  1GCQ A;  3BY7 A;  1MMG A;  1V1C A;  4FL6 A;  1UFF A;  2NYS A;  1X2K A;  4RTZ A;  4LNP A;  2CZ0 B;  4JRI A;  3C94 A;  4M77 E;  2CP2 A;  3JB9 J;  1NJI U;  3MEU A;  5IXF A;  4M75 B;  2XDP A;  1WJS A;  1QVP A;  2ZPG B;  4F17 A;  2YUP A;  1VQ4 A;  2E70 A;  3H0F A;  4R55 A;  4OML A;  4C8Q A;  2EQI A;  3IQL A;  4C5I A;  2ECZ A;  3CC2 A;  4QVD A;  4F16 A;  3I5R A;  4LUE A;  4ELY C;  2R57 A;  1Q82 R;  1V29 B;  2OI3 A;  1RAA B;  1PG5 B;  3NFC A;  5GAN e;  2RQV A;  3UAT A;  1K9M U;  1AVZ C;  4KT0 E;  3G6E Q;  2KXC A;  1I81 A;  2M1H A;  1G8X A;  3OMG A;  1UB4 A;  1OZ3 A;  2PTK A;  2ESW A;  3CEY A;  1UGP B;  2DTH A;  3ZFJ A;  4BDY A;  2RQU A;  5GMK i;  1M2V B;  1YCS B;  1X6O A;  1T3L A;  3LGL A;  2SRC A;  2PUO B;  3RES A;  1BB9 A;  3OW2 S;  3CCU T;  3VS7 A;  1MMD A;  2FYK A;  4E7Z A;  2F69 A;  3O5Z A;  2SEM A;  5GAN 2;  3EGD A;  1YHQ Q;  3QHS A;  3P8B B;  4C5E A;  2Y4Y A;  2ABL A;  3A8M B;  1FX7 A;  1PM3 A;  5I21 A;  4LDY A;  4HT8 A;  2NUT B;  2OTL A;  4NL3 A;  2D0N A;  4MZM A;  5D6W A;  2DIL A;  2PVG B;  2O9V A;  1YI2 Q;  1TS9 A;  1Y0M A;  3E2U A;  4M7D G;  2ZPF B;  1YHQ A;  2C0I A;  2O88 A;  4C92 C;  3QDR B;  4J6W A;  5GAM h;  1MMN A;  4C5H A;  1FMK A;  1JJ2 A;  2RHX A;  2RQW A;  1QKW A;  5GAN h;  3JCM d;  1X2Q A;  2DTO A;  1I1J A;  3H8Z A;  3EG9 A;  1M3B A;  1M8V A;  3M57 A;  3L2Z A;  4AFU C;  3G4S A;  2JTF A;  1WIE A;  3QKJ A;  5GMK m;  3HSB A;  3TRE A;  4J9E A;  3CC2 Q;  1F1B B;  1JEG A;  3OYB A;  3UA7 A;  4MDX A;  3ME9 A;  5FU6 C;  1VQ8 A;  1VQN T;  3OS0 A;  1VQK Q;  2DLP A;  2HKQ B;  1BIA A;  4WTO B;  3JB9 F;  1X01 A;  3FDR A;  2FPF A;  4DOW A;  4N4H A;  2A36 A;  1M3C A;  2NUT A;  3NHN A;  1G3W A;  4DBR A;  2CSI A;  1QP2 A;  2GBQ A;  1EX4 A;  1C1A A;  3JCM g;  1WXT A;  3A8G B;  1VQK A;  4JS5 A;  3BDL A;  4LUD A;  1EFN A;  2PUK B;  2CT4 A;  5HK0 A;  4X1V A;  5KE2 A;  3CPW P;  4JJN K;  3M4Y A;  2MWP A;  3CD6 T;  3CCL T;  3C4S A;  4EIK A;  1M90 R;  2YRV A;  3MEV A;  2EYY A;  4C8Q D;  2CH4 A;  3OSS C;  3OYJ A;  1VYU A;  4C92 E;  1WQ7 A;  1YP5 A;  4IUP A;  4C5G A;  4VUB A;  1KIK A;  2ENM A;  3VV0 A;  4QQ6 A;  4M75 F;  3WVE B;  1BI2 A;  2KRM A;  4NOY A;  1S72 Q;  4M7A B;  3QG1 A;  1P92 A;  3CCV A;  2DF6 A;  4KBM B;  5GAO l;  5GAN f;  4IUV A;  3OB9 A;  1KJW A;  1BI3 A;  3CCV T;  2E5K A;  3CBP A;  4LDV A;  5LL6 S;  3JCM Q;  1AZE A;  4A53 A;  2HEQ A;  3VUZ A;  5FLX E;  2VWF A;  1IO6 A;  5J39 A;  4X34 A;  1WHH A;  3H0I A;  3I55 A;  1BCM A;  3O8V A;  2HAX A;  1X27 A;  1WHL A;  3DKM A;  1SRL A;  5GAO r;  1TUD A;  3VS3 A;  3E9F A;  2LCS A;  2VGN A;  3M59 A;  4ANJ A;  4QQD A;  4J7F A;  2DD5 A;  3OYC A;  3TVT A;  3C12 A;  5KCO A;  2WSC E;  1RAG B;  4J9C A;  4JPB W;  2LT4 A;  1YFN A;  4P5N A;  1KQ2 A;  1OQK A;  5CKB A;  1E6H A;  4JLG A;  4D8D A;  1M5Q 1;  2VUB A;  3I56 Q;  2V8K A;  1N8R C;  3OS2 A;  4C0F A;  1UEC A;  5IHN A;  1XQH A;  4LE9 A;  2PZ1 A;  3JRZ A;  3EGU A;  4AFQ C;  1B3Q A;  4FT2 A;  4IUQ A;  2IIM A;  1OPK A;  5IHK A;  4M7D A;  1ABQ A;  3TQ7 P;  4M7A G;  3FC3 A;  2GTJ A;  2ZGW A;  1VQN A;  1RI9 A;  2JJ9 A;  2MI6 A;  3QJY A;  1RAI B;  3TCJ A;  3SD4 A;  2QQR A;  1PRM C;  3GLX A;  1U06 A;  5IXB A;  2QTV A;  4HVW A;  2AK5 A;  2DAQ A;  1A0N B;  1M1K U;  3LW5 E;  4NS5 A;  4EMK B;  4BY6 B;  2JS0 A;  3EG9 B;  4M78 C;  1OOT A;  2KYM A;  3EG2 A;  2XK0 A;  1ZHI A;  4EMK A;  3GF5 A;  1TUC A;  2J06 A;  2EAY A;  2X35 A;  4F7U B;  2KDS A;  3RER A;  3V7S A;  1KQS S;  2CP6 A;  1X6B A;  1H64 1;  1NPP A;  1B07 A;  1VQ8 T;  4LN2 A;  1VQ7 Q;  4QVC A;  4B9W A;  3V7C A;  3JCM J;  3I5S A;  5LJ5 f;  3CXC S;  5GMK e;  4B6M A;  3CCU A;  1VQM A;  3MP6 A;  4EMG A;  1D3B B;  1B34 B;  4LD9 K;  2PNI A;  2DYI A;  2KGT A;  4IUT A;  4M75 G;  1W4S A;  1VIE A;  2OJ2 A;  1RI0 A;  2CP3 A;  1K8A R;  1U1S A;  3X28 B;  1EIF A;  2MWO A;  5J3B A;  1W2B P;  2I0N A;  2EKH A;  4BE0 A;  4Q5W A;  3ZBD A;  2YXY A;  5CK9 A;  1Z9Z A;  1QQJ A;  1KD1 R;  2E1H A;  3THK A;  1Q81 C;  1G5V A;  1N9R A;  2HQH A;  2JT4 A;  3CBO A;  5A0L A;  3M9Q A;  2E10 A;  4FSS A;  1VQ4 T;  1IHV A;  2EFI A;  2RI2 A;  2QI2 A;  3M5A A;  1UGS B;  1RL2 A;  1D09 B;  2X3X D;  2XG8 D;  3PMI A;  1VQO T;  1VQ9 T;  1KC8 U;  1KD1 C;  3CCR A;  1J3T A;  1LCK A;  3VRZ A;  5I22 A;  4JRP A;  1TSF A;  2XID A;  1YJW T;  3FB9 A;  4HXJ A;  1N6A A;  5FU6 B;  4M77 D;  2JTM A;  4M7A E;  1Z9Q A;  3A1P A;  2V1Q A;  1N9S A;  1WYX A;  3OS5 A;  4KH1 B;  3NTK A;  2DBK A;  1H92 A;  4KH0 B;  1WDX A;  1VQ9 Q;  3QZ9 B;  1MND A;  2LQ8 A;  4ME7 A;  4OB2 B;  1M1G A;  1MUZ A;  2JMC A;  1AHJ B;  2DL7 A;  5GMK j;  2HQX A;  2DXB A;  3CME T;  2ZPH B;  1K0S A;  5FRM A;  1ZUU A;  2L2P A;  4OVA A;  3RMS A;  2EBP A;  2DA9 A;  4LDX A;  2GTO A;  1QLY A;  1K1Z A;  2BKD N;  2DMO A;  1VQO A;  2RQT A;  4L6V 5;  2HQE A;  1RUW A;  1BIB A;  3GBQ A;  2JXB A;  1ZBJ A;  4HCK A;  4R56 A;  5GAM d;  1PKT A;  5CQX A;  4PJJ A;  2X4X A;  2DO3 A;  2AKK A;  2DJZ A;  4PJO C;  2DIG A;  2E64 A;  4C0D B;  1SKU B;  1WQW A;  3LGF A;  3CCS A;  4A4K A;  4M7A A;  3QYG B;  1QWF A;  3N5B B;  2HCK A;  4E7L A;  4JDS A;  3E9G A;  2OTL T;  1M1K C;  2C0O A;  1WGS A;  1TWB A;  1GFD A;  1R0C B;  3HL8 A;  1NLO C;  3CXC P;  2LNH B;  4OMN A;  4M78 E;  1FMW A;  1VQ6 T;  4X9C A;  1S72 A;  4M7A C;  1K8A U;  2FRY A;  1ZSG A;  2NWM A;  4F7U F;  2JMA A;  1VQK T;  4KUI A;  1GL5 A;  1KQS A;  1NG2 A;  5A2Q E;  2P0K A;  3M55 A;  1OI1 A;  1K9M R;  4RUG A;  5LJ3 f;  3MP8 A;  2X51 A;  1I4K 1;  1YIJ T;  5IAY A;  1BKB A;  3DB3 A;  1YJ9 Q;  2G6F X;  1VQP A;  1D1C A;  6AT1 B;  1M8M A;  1TG0 A;  1YWP A;  3OYF A;  4F04 B;  2HNI A;  2EVR A;  1TUG B;  2YT6 A;  2L3R A;  2AIR B;  2WSF E;  4IKF A;  2B86 A;  3TSZ A;  2O9S A;  2L3Q A;  2RH2 A;  5AYF A;  1YJN T;  2GFA A;  4RTX A;  1BCO A;  2K2M A;  4GLM A;  4EPC A;  4IUR A;  3AHU A;  1ZA2 B;  2K4Y A;  4FYX B;  5CAI A;  2YUO A;  3M0U A;  1R77 A;  1UDL A;  2QYZ A;  1KC8 R;  3F70 A;  3EH2 A;  1WHG A;  1Q7Y R;  3MEW A;  2LCL A;  3L1A A;  3OSV A;  3BDU A;  3CMA A;  1BYM A;  3CCE T;  5GMK h;  5GAM e;  3L2V A;  3OBY A;  5L8R E;  4F7U E;  2BZX A;  2VXE A;  3JCM b;  3G7Z A;  1UE9 A;  5D6Y A;  2RK2 A;  4AT1 B;  1XNI A;  4RG2 A;  2J6K A;  3OYL A;  1VUB A;  4FYY B;  4N4I A;  1G3Y A;  5GAN g;  2JTE A;  4FU6 A;  3EG3 A;  3M0Q A;  4FW2 A;  2YHT A;  5HCK A;  2JM8 A;  5FU7 B;  1ZA1 B;  3WXM B;  1Q86 R;  1BI0 A;  5KYX B;  2JUF A;  3BFM A;  1JXM A;  3HHT B;  5GAN 7;  4FT4 A;  2CZ7 B;  4M78 B;  1AD5 A;  5KH6 A;  3EGD B;  4M7D E;  3CCQ T;  3GNG A;  5GAN 4;  1JBM A;  1YJW Q;  4BUG A;  2OTL Q;  1FMV A;  2HBP A;  4GBQ A;  2JOY A;  1RAB B;  4OMQ A;  4GY5 A;  2CUB A;  1E7O A;  1KHC A;  1CKA A;  2K5F A;  1NEB A;  3CCS Q;  1E6G A;  3A98 A;  3JCM h;  1IZ6 A;  3CCQ Q;  1VQL Q;  2CP5 A;  1B34 A;  1UGQ B;  4J9F A;  1RLP C;  2DE0 X;  4PFO A;  2F5K A;  1U5S A;  5D6X A;  5CKE A;  4Z89 A;  3G6E A;  3OW2 P;  2XD0 A;  4J9I A;  4C8Q C;  2L0A A;  1QVG S;  4PLI A;  1GRI A;  4XU2 A;  2HSE B;  4BI8 B;  3S3O A;  2NUP B;  1I5O B;  2LX9 A;  4JJB A;  2GCX A;  2RNA A;  3H41 A;  1S72 T;  2VB6 A;  4J9D A;  3QYH B;  1OX9 A;  3E1S A;  2IG0 A;  1AWX A;  2K3X A;  4M7D F;  4M77 A;  2DEU A;  1K73 R;  3JCM V;  1JXO A;  1Q82 U;  2R58 A;  4M7A D;  5FW9 A;  1YCY A;  2BUD A;  2DX1 A;  3UWN A;  4J5Y A;  3CBM A;  1K4U S;  2XI9 A;  4A4G A;  4O5V A;  4R0K A;  2MAM A;  1N27 A;  1Y96 A;  4CC2 A;  1UUE A;  1R0B G;  3OYM A;  1IRE B;  4BE2 A;  2O2O A;  3JCM e;  2ED1 A;  4HCC A;  1CKB A;  4M7D C;  4OB3 B;  3HRS A;  1G3S A;  1G3T A;  2P84 A;  4LXC A;  2DER A;  1SRM A;  2P4T A;  3M0S A;  1IGQ A;  2QXF A;  3ULR B;  1ARK A;  1X69 A;  5DLO A;  2EPD A;  2E5Q A;  4Z02 A;  2EYQ A;  4DA4 A;  2C0T A;  4QVZ A;  1PNJ A;  3CPF A;  2XKO C;  3VS6 A;  4WCI A;  2D0Q B;  1U1T A;  1PD0 A;  5M9O A;  3OY9 A;  3VS1 A;  4XTX A;  2ZCF B;  1MV3 A;  4PJL A;  2EQJ A;  3RIR A;  4RMO A;  4E7K A;  3QBY A;  4JLI A;  4N0A C;  2EJ9 A;  3QO3 A;  3SB2 A;  4M75 E;  4HVV A;  2OX7 A;  1D1A A;  2KK4 A;  1D0Y A;  2M9U A;  4JUV A;  2COY A;  1NPR A;  4OGC A;  3QZ5 B;  1YNZ A;  2KMT A;  4RTT A;  2D9T A;  4C0D C;  2VVK A;  5I2S A;  3JCM c;  3CCQ A;  1VQM T;  1K73 U;  4OMP A;  3NTH A;  1K9A A;  1D1B A;  4OB1 B;  3CCM A;  2R5M A;  4ZN3 A;  2K5L A;  2DJQ A;  3H9N A;  2K2V A;  2IVW A;  5FRN A;  2QAZ A;  1HK9 A;  2QA4 A;  1CSK A;  4KUL A;  2LDM A;  2BE9 B;  2O31 A;  2EGA A;  3PVL A;  1RAE B;  1SG5 A;  4MDW A;  2HL3 A;  1VA7 A;  3M53 A;  4EDU A;  4WF2 A;  1VQP T;  2VXF A;  1WNL A;  5CR2 A;  2MK5 A;  4Y28 E;  3RDV A;  4FCY A;  2YLB A;  4AG2 C;  2ZPE B;  2JVV A;  2P0Q A;  1EZZ B;  4PJM A;  3MPU B;  1QWE A;  1M4Z A;  5DLQ E;  1RAF B;  4TVR A;  1KG1 A;  4C8Q B;  1YIT T;  3VU3 C;  4FW1 A;  2O01 E;  1WFW A;  3G6E T;  4M75 A;  3KXT A;  2CSQ A;  2DNU A;  2MYS A;  2ZZD A;  4M77 F;  1X75 C;  2M0Y A;  3J7A F;  3CMA Q;  4II1 A;  4Z88 A;  4ZTJ A;  1UG1 A;  3MJX A;  3PIO A;  1ABO A;  2K79 A;  3CCS T;  1BU1 A;  2B8A A;  1Q7Y C;  1PRL C;  1W2B S;  1IGU A;  3QJ6 A;  2J6F A;  3MET A;  1XTD A;  2E12 A;  2EYZ A;  2BZ8 A;  4HVU A;  5LJ3 h;  4A4F A;  2KRO A;  2DYB A;  4ATO A;  1I5L A;  4PFP A;  3VUB A;  1G83 A;  3MCA B;  2XU8 A;  4M75 D;  5CO7 A;  4AG1 C;  4JJC A;  1JU5 C;  1VQ8 Q;  5LJ5 j;  3CCR T;  3S3M A;  1VQ6 Q;  2YRD A;  4V2S A;  1Q81 R;  4ZGE B;  5C0M A;  2EWN A;  2BE7 D;  1YJ9 A;  1BI1 A;  4PJO D;  2LC4 A;  4PJO G;  3R6N A;  1TXQ A;  3SDZ A;  2W0Z A;  8ATC B;  2YLC A;  3FJ5 A;  2QK0 A;  2DL4 A;  1UGV A;  3PNW C;  2LQN A;  2HMA A;  3ZL7 C;  2DXT A;  1QMC A;  2CP7 A;  1JO8 A;  1VQL A;  2FEI A;  2COZ A;  2F2V A;  3PT9 A;  3MEA A;  2FZC B;  4L5G A;  1UTI A;  4A4E A;  2L3S A;  2KYB A;  1YIJ A;  4A54 A;  5KE3 A;  3A8L B;  2DXU A;  3M0T A;  1YI2 A;  3EAE A;  1TOV A;  2X4W A;  2RB6 A;  2WSE E;  1AWO A;  5KYU A;  4IIO A;  1YJW A;  5GAM j;  2K7A A;  3GIB A;  1UEB A;  2DBM A;  3GOX A;  1T3S A;  4PL6 A;  3INZ A;  2RM4 A;  3UT1 A;  2KT8 A;  3NGP A;  3OS1 A;  3G71 A;  1QCN A;  2F1L A;  5LJ5 h;  4J6Y A;  5IT9 E;  2QDY B;  3EGX A;  2QQA A;  5CVI A;  2ZPI B;  2PVD B;  2DVJ A;  4DBF A;  2JZ2 A;  5GAO p;  4BAC A;  1LNX A;  4OGE A;  2KI7 A;  1NJI C;  1T0J A;  2CUD A;  4E7J A;  3H0H A;  4BD3 A;  5FWC A;  1H3H A;  3OYG A;  3M56 A;  3RR6 A;  1IXD A;  2PVO B;  2A0F B;  4M77 B;  2E65 A;  3HFO A;  3RKY A;  4PJO F;  3M54 A;  4X9D A;  1VQ5 T;  4J9B A;  2YRC A;  3OMC A;  3TSW A;  2AHJ B;  3S6W A;  4E2F B;  1GCP A;  2GQV A;  4CRI A;  3JCM P;  1QKX A;  1WHM A;  5GAN 6;  2QGG A;  3RKW A;  1Y96 B;  2AT1 B;  3RMQ A;  2EGE A;  4JRK A;  3AT1 B;  1TTH B;  2XDB A;  3X26 B;  1VQ9 A;  4FYW B;  4C0Z A;  3RKX A;  2RQR A;  4A63 B;  4ORZ A;  3CQT A;  1NBE B;  2D8J A;  1IB8 A;  3QPH A;  2RN8 A;  3RUX A;  2D8H A;  3JB9 G;  2RK1 A;  1RAH B;  5KYN A;  3MKD A;  3M0R A;  2DZC A;  3NMZ C;  3CCR Q;  4ZTF A;  3M58 A;  4J9H A;  3VYH B;  2LVM A;  3G71 T;  5L23 A;  1KHI A;  2WAC A;  3OYH A;  4XAX B;  3LLR A;  2CGH A;  1QCO A;  1WI7 A;  1K73 C;  1Q86 U;  2QAS A;  3R6O A;  3JB9 D;  4E7H A;  3CC4 A;  2AKL A;  4DQ2 A;  1SEM A;  3X20 B;  1WHK A;  4DBQ A;  3DLM A;  1S1N A;  1VQ5 Q;  4M7D B;  4ZGD B;  2VGM A;  5A0G A;  2R5A A;  1BK2 A;  1N8R U;  3UF4 A;  2H3E B;  3QXE B;  4IIM A;  5GAO m;  1W1F A;  4C8Q E;  2Z0W A;  2G3R A;  1Q81 U;  2L89 A;  1JJ2 S;  2OTJ Q;  2DK3 A;  4RCB A;  4HCB A;  4KGZ B;  3M0P A;  3CCM Q;  2CH4 W;  1MNE A;  2JS2 A;  2A3L A;  2E3H A;  4C8Q G;  1VQM Q;  1YWO A;  1WJQ A;  3JCM f;  1AOJ A;  2L3P A;  2EYW A;  4KGV B;  4XTW A;  3ER0 A;  1I8F A;  5AT1 B;  3OQ5 A;  3LWH A;  3QSU A;  2W10 A;  3L2W A;  3VS4 A;  2KRS A;  3L2U A;  4D6W A;  3C95 A;  1QP3 A;  1M2O A;  1M3A A;  2A28 A;  2P0P A;  5LJ3 e;  2J6O A;  3EFO A;  4QW2 A;  2FRW A;  1XJW B;  2DXC A;  1VQ6 A;  2AZV A;  1FYN A;  2H3J A;  2L8D A;  2O4X B;  1D0Z A;  3UDC A;  4F14 A;  3PTA A;  4BI3 A;  3URG A;  2NUZ A;  5EG2 A;  7AT1 B;  1VQ4 Q;  1K0X A;  1ZSZ C;  4CC3 A;  2HSP A;  2JM9 A;  2LJ1 A;  4XTZ A;  1OPL A;  2OAW A;  2V26 A;  3VS5 A;  3JCM W;  4C92 G;  2RHY A;  3J80 E;  3EG1 A;  2EYX A;  2CKK A;  2QTX A;  1SSH A;  2FHD A;  3REB B;  2IPO B;  1PSE A;  1FWZ A;  4IUU A;  4QT7 A;  4OB0 B;  1MMA A;  2K9G A;  5CKD A;  1Y07 A;  2RA2 A;  5LJ3 d;  1YI2 T;  4J9G A;  1HJD A;  1U3O A;  1Q82 C;  3OYY A;  1LPL A;  2RI3 A;  2HD0 A;  3VS0 A;  5IN1 A;  2QEX Q;  4XTU A;  3ASK A;  5GJV B;  1ZUY A;  2DVE A;  3CD6 Q;  4LDU A;  2OAU A;  2VC8 A;  2FZG B;  2DPP B;  1OU8 A;  3OYN A;  2KXD A;  4M4Z A;  2HKN A;  4RKU E;  2I2L A;  2DZ9 A;  4AFZ C;  3CCM T;  2YUN A;  2VYT A;  1SPK A;  1W6X A;  4KGX B;  2JW4 A;  4UC4 A;  3KFV A;  2M16 A;  2D6F A;  2BIV A;  3OYE A;  4C92 A;  2QA4 Q;  1M2V A;  2CDT A;  3SEM A;  5GAO q;  5D7U A;  5GAN j;  1JB0 E;  1Y7X A;  1WA7 A;  3OYA A;  4XU1 A;  3T9N A;  2YSQ A;  1WXU A;  3I55 Q;  2DIQ A;  3CPW A;  4LDW A;  3CCJ T;  1WX6 A;  1Q86 C;  5I2M A;  5KYW B;  1VQ7 A;  2Y4X A;  3EFO B;  2LX7 A;  4M77 G;  2DD4 A;  1N8R R;  2LQK A;  4QKU A;  1VQL T;  4J83 A;  2HL5 C;  3LX7 A;  2K57 A;  2A7Y A;  5EC7 A;  2QGF B;  1WXB A;  1M9S A;  2OTJ A;  1ZBX A;  1MGQ A;  4FM4 B;  4XTV A;  1AT1 B;  3LWI A;  1KK7 A;  2KT1 A;  2K3Y A;  5A0D A;  1BBZ A;  1UHC A;  3J81 E;  2EGC A;  3G4S T;  3JB9 H;  4HT9 A;  3TEE A;  1LJO A;  4M77 C;  2RO0 A;  1JRI A;  4MZT A;  1VQ5 A;  1MHN A;  2KVQ G;  1YIT A;  2K5I A;  3E19 A;  3HRU A;  3A8H B;  3I56 T;  1T0H A;  1M1K R;  2PQW A;  2FPE A;  3QWX X;  2RD1 A;  2ZAE A;  5GAO n;  4N0A A;  3CC2 T;  1RLQ C;  3QWY A;  1FXX A;  2KY9 A;  2LT1 A;  1GBQ A;  1UJY A;  1VQN Q;  3SWN C;  1SF9 A;  4Z8A A;  1ZSZ B;  4E6R A;  2BTT A;  4CC7 A;  1VYT A;  2DKG A;  5LJ5 g;  1AWJ A;  2DRK A;  4JZ4 A;  3NTI A;  4QQG A;  2C06 A;  3EHQ A;  4J8O A;  1G2B A;  2O4X A;  1NJI R;  3GNF B;  1C6V X;  1V76 A;  3KBG A;  3EHR A;  3CXC A;  1VIF A;  2EW3 A;  1K9M C;  2KQW A;  1H3Z A;  3P8H A;  3UPU A;  3I56 A;  5C6S A;  1D3B A;  4XTY A;  2EIF A;  1ACM B;  1U8R A;  1R8O B;  5FWB A;  2MCN A;  5KYX A;  3CC4 T;  1O9S A;  3V7R A;  2GGR A;  5HY6 A;  3OYK A;  3G1J A;  4NL2 A;  1YHQ T;  2ZPB B;  3QDF A;  3C0C A;  4BI4 A;  4ELZ C;  1GBR A;  5LJ5 d;  2X4J A;  1JQQ A;  2GF7 A;  3VYG A;  2MMP A;  2K6D A;  2QA4 T;  4J6X A;  2M51 A;  3HP9 A;  1KC8 C;  1RAC B;  1X43 A;  2EKO A;  4XK8 E;  3CPW S;  3EH1 A;  3I55 T;  1H8K A;  1PKS A;  3LYI A;  4RTW A;  3X25 B;  2RF0 A;  3WVD B;  2P4R A;  2RHZ A;  2LJ3 A;  5KCH A;  2ED0 A;  3G71 Q;  2OTJ T;  1OU9 A;  1OV3 A;  3JSC A;  2LQW A;  3MHX A;  4OMF B;  5J26 A;  1PC0 A;  1RAD B;  4C92 F;  1M90 U;  4RG8 A;  1QW1 A;  3CCV Q;  2DFU A;  2EQU A;  1IRX A;  4M78 F;  3JB9 I;  3V8L A;  3OBW A;  4HKE A;  1UGR B;  3V8K A;  1TU0 B;  5ECA A;  2QEX T;  2L5Q A;  1WPY A;  4E7S A;  4YTL A;  3PVQ A;  1PWT A;  2M0O A;  4D8K A;  5KYU B;  1I0C A;  5KYY A;  4DEY A;  3LH5 A;  1Y71 A;  1KFZ A;  1NZ9 A;  1SSF A;  2HBW A;  2KSS A;  3FLG A;  4N4G A;  1QCF A;  1M30 A;  2EQK A;  4ZNX A;  3HPW A;  4O6J A;  3SWN A;  2XMF A;  1MV0 B;  1VQO Q;  3CC7 T;  8AT1 B;  2LNV A;  3CCL Q;  2QQ9 A;  1WLP B;  3PGG A;  5CIU A;  2QDL A;  2RJD A;  1KD1 U;  2YUQ A;  4Y91 A;  4PLL A;  3BE3 A;  2BZY A;  4C8Q F;  1SHF A;  4PJO B;  2CZ1 B;  5GAN 5;  1QVF S;  2YDL A;  3SHW A;  1AWW A;  4J7I A;  1TH7 A;  1OUL A;  4OP0 A;  2E4H A;  2FVU A;  2CZ6 B;  2EQM A;  2EJG A;  2A37 A;  5LJ5 e;  2LRQ A;  5DM7 R;  5CQY A;  2YWW A;  3FJP A;  2DL3 A;  1AEY A;  3S3N A;  4BDZ A;  2KRN A;  3OYI A;  3H6Z A;  2X4Y A;  3CC7 A;  3CCL A;  1QVF A;  3G4S Q;  2E6N A;  2RJE A;  1VQP Q;  1OZ2 A;  1PSF A;  4HCZ A;  1X6G A;  2JNG A;  4K11 A;  2E6Z A;  2KR3 A;  3A5Z B;  3TU4 K;  2FG0 A;  5LJ3 g;  1VYV A;  1LVK A;  2J05 A;  1YIT Q;  9ATC B;  4JZ3 A;  2GQI A;  4EMK C;  3FIF A;  3SFM A;  3CME A;  3DLL A;  1IHW A;  3EFR A;  2KEA A;  3NPF A;  3LH0 A;  2RHI A;  2RMO A;  2COW A;  4MMK A;  4RCC A;  1HSQ A;  1VOM A;  2FO0 A;  4PNO A;  2X3W D;  2MOX A;  4CC4 B;  2ROL A;  2F2W A;  2Y90 A;  3FRN A;  1NYG A;  4HA8 A;  2QQB A;  3D7S B;  3HTR A;  4A4H A;  4ESR A;  3REA B;  1YIJ Q;  1M1F A;  5GAN 8;  3CCE Q;  1QVG P;  3U23 A;  1OYX A;  2CT3 A;  2CYZ B;  4PK4 A;  2LTO A;  2DL8 A;  4OF1 A;  2CRE A;  4RTV A;  1LOJ A;  1NE8 A;  1KSW A;  4E7I A;  4M78 A;  1W2B A;  4AFS C;  3Q1J A;  5FU7 C;  3P8D A;  2VV5 A;  1N5Z A;  5GAM f;  4AMC A;  5KYW A;  2VKN A;  5HK3 A;  3VJP A;  5IHI A;  1WHJ A;  1SHG A;  3GPL A;  1DJ7 B;  2KAF A;  3V8J A;  4F7U G;  1NYF A;  2MF2 A;  2LMJ A;  1UJ0 A;  1KQ1 A;  1QVF P;  2FZK B;  2E3I A;  3FEO A;  1YBY A;  4JS4 A;  3JCM X;  3OW2 A;  4M7D D;  4M78 D;  4FIB A;  1K76 A;  1GFC A;  2CS7 A;  2MPX C;  2ROT A;  3RBB B;  2ATC B;  3HKS A;  4L59 A;  4GLK A;  4PFZ A;  1GXI E;  1I07 A;  2V8I A;  1Y57 A;  1O75 A;  2DEQ A;  1ZSZ A;  2LP5 A;  4MML A;  5HKC A;  1M90 C;  2HDA A;  4B9X A;  4DBH A;  2XDD A;  1ZQ1 A;  2J7I A;  2XIC A;  2GFU A;  4CI0 C;  3UA6 A;  4M7A F;  1B7T A;  2A08 A;  3PE0 A;  4XU0 A;  3L2R A;  1NLP C;  3I35 A;  4DEX A;  1XOV A;  2D1X A; 
#chains in the Genus database with same CATH homology
 1Y96 A;  5GMK l;  3OYM A;  4M7D A;  1IRE B;  5CKD A;  4BE2 A;  1YJN A;  3BW1 A;  1Y07 A;  3HFN A;  4C92 D;  4M7A G;  2RA2 A;  5LJ3 d;  3JCM e;  1YI2 T;  4HCC A;  3MP1 A;  3FC3 A;  5CCA A;  1Q82 C;  2ZGW A;  4M7D C;  1VQN A;  4OB3 B;  2RJC A;  3OYY A;  4M78 G;  3HRS A;  4XU3 A;  1G3S A;  4BY6 C;  3GP8 A;  1G3T A;  2MI6 A;  3QJY A;  2RI3 A;  2P4T A;  5CKH A;  2HD0 A;  2QXF A;  3TCJ A;  3SD4 A;  4PKC C;  5IN1 A;  2QQR A;  3GLX A;  4XTU A;  3ASK A;  2FB7 A;  5DLO A;  2E5Q A;  4Z02 A;  2DVE A;  4BE1 A;  4LDU A;  4E47 A;  2EYQ A;  2OAU A;  2VC8 A;  4DA4 A;  4QVZ A;  3VKI A;  2RI5 A;  1K8A C;  2DPP B;  3OYN A;  4F7U A;  2DAQ A;  3CPF A;  2XKO C;  3DB4 A;  1M1K U;  1QVG A;  2XHC A;  3MO8 A;  3LW5 E;  3CMA T;  4NS5 A;  4RKU E;  2I2L A;  2DZ9 A;  3L42 A;  3L2Q A;  1Q7Y U;  2D0Q B;  1U1T A;  3CCM T;  5M9O A;  2VYT A;  3OA6 A;  4EMK B;  2EJF A;  4ZGJ B;  3OY9 A;  4UC4 A;  4BY6 B;  2M16 A;  4XTX A;  4M78 C;  2D6F A;  2ZCF B;  2BIV A;  2XK0 A;  3PFS A;  1ZHI A;  2EQJ A;  3RIR A;  3ZEH A;  4EMK A;  4RMO A;  3OYE A;  4BB7 A;  4E7K A;  4C92 A;  3QBY A;  3KUF A;  3GF5 A;  4LD6 A;  4MZP A;  4JLI A;  4N0A C;  2PU9 B;  2EJ9 A;  2EAY A;  4EMH A;  2X35 A;  4XQ3 A;  5GAO q;  4M75 C;  4F7U B;  3QO3 A;  5GAN j;  3SB2 A;  4PJO A;  4M75 E;  2KDS A;  3RER A;  3V7S A;  2KK4 A;  1JB0 E;  1KQS S;  2M9U A;  4JUV A;  1Y7X A;  3M4G A;  1H64 1;  1NPP A;  3OYA A;  4XU1 A;  5CKF A;  3T9N A;  1NPR A;  5GAN 3;  1VQ8 T;  4OGC A;  3A8O B;  2E41 A;  3QZ5 B;  3HRT A;  2KMT A;  4QVC A;  2D9T A;  4C0G A;  2RJF A;  4C0D C;  4B9W A;  5I2S A;  3JCM c;  3CCQ A;  2DIQ A;  3CPW A;  3V7C A;  4LDW A;  3JAM E;  3CCJ T;  5LJ5 f;  3JCM J;  2RHU A;  3QII A;  5I2M A;  3CXC S;  1VQM T;  1Q86 C;  4C92 B;  3CCE A;  1K73 U;  2DTI A;  1VQ7 A;  2Y4X A;  4M77 G;  5GMK e;  2DD4 A;  3CCU A;  3SWN B;  1VQM A;  3NTH A;  4JRQ A;  2LQK A;  3MP6 A;  5FRO A;  4OB1 B;  4EMG A;  5LJ3 j;  5GAM g;  1D3B B;  2R5M A;  3CCM A;  1VQL T;  4KUD K;  3QUI A;  4J83 A;  4ZN3 A;  3EFS A;  2K5L A;  1B34 B;  4LD9 K;  3LX7 A;  2K57 A;  2A7Y A;  2K2V A;  2IVW A;  4IUT A;  4M75 G;  2F5T X;  1M9S A;  5FRN A;  1W4S A;  2OTJ A;  1ZBX A;  1HK9 A;  1MGQ A;  1VIE A;  2QA4 A;  4FM4 B;  4KUL A;  2LDM A;  4XTV A;  1RI0 A;  3LWI A;  4FSX A;  1U1S A;  3X28 B;  1EIF A;  1HXD A;  2V8J A;  2K3Y A;  2MWO A;  5J3B A;  5A0D A;  3X24 B;  4MDW A;  4BE0 A;  3J81 E;  4Q5W A;  3M53 A;  4EDU A;  4WF2 A;  3G4S T;  3ZBD A;  1VQP T;  3JB9 H;  2VXF A;  1LJO A;  1WNL A;  3TEE A;  4M77 C;  4ZN1 A;  5CK9 A;  4HT9 A;  2RO0 A;  1JRI A;  4MZT A;  4Y28 E;  5CR2 A;  5DY9 A;  1VQ5 A;  2NLU A;  2E1H A;  1MHN A;  1Q81 C;  1G5V A;  1N9R A;  2KVQ G;  3PIP A;  2YLB A;  2ZPE B;  2JVV A;  1YIT A;  2P0Q A;  2JN0 A;  2K5I A;  3E19 A;  3HRU A;  1WJR A;  1M4Z A;  3A8H B;  3CBO A;  5DLQ E;  5A0L A;  3I56 T;  3PMT A;  4TVR A;  1KG1 A;  3M9Q A;  2E10 A;  2PQW A;  4DOV A;  1VQ4 T;  4C8Q B;  2EFI A;  2QQS A;  2RI2 A;  1YIT T;  3CD6 A;  2QI2 A;  2RD1 A;  3VU3 C;  5GAO n;  3M5A A;  4PJO E;  1UGS B;  1RL2 A;  2O01 E;  4N0A A;  2FL7 A;  1YJ9 T;  2XG8 D;  3PMI A;  2QEX A;  1VQO T;  1VQ9 T;  1KC8 U;  3G6E T;  4M75 A;  1KD1 C;  3CC2 T;  1VQ7 T;  3CCR A;  3KXT A;  4JRP A;  1FXX A;  2XID A;  3OYD A;  2KY9 A;  2LCC A;  2LT1 A;  3CCJ A;  1YJW T;  5GAN d;  2ZZD A;  3FB9 A;  4M77 F;  3SWN C;  1X75 C;  3J7A F;  1N6A A;  5FU6 B;  4M77 D;  2JTM A;  4II1 A;  4ZTJ A;  4M7A E;  2DKG A;  3BY7 A;  5LJ5 g;  1N9S A;  3PIO A;  3OS5 A;  4FL6 A;  3NTK A;  3CCS T;  2B8A A;  3NTI A;  4QQG A;  2C06 A;  1Q7Y C;  4J8O A;  1W2B S;  3QJ6 A;  3QZ9 B;  2LQ8 A;  2O4X A;  1XTD A;  3MET A;  2E12 A;  3GNF B;  4ME7 A;  4OB2 B;  2CZ0 B;  5LJ3 h;  4A4F A;  4JRI A;  1M1G A;  3KBG A;  3C94 A;  3CXC A;  1VIF A;  1AHJ B;  4M77 E;  3JB9 J;  1NJI U;  1K9M C;  2KQW A;  3MEU A;  1H3Z A;  4ATO A;  3P8H A;  1I5L A;  4M75 B;  3UPU A;  3VUB A;  2XDP A;  3MCA B;  5C6S A;  3I56 A;  1D3B A;  4XTY A;  1WJS A;  1QVP A;  2EIF A;  2HQX A;  2ZPG B;  2DXB A;  2E70 A;  5GMK j;  1VQ4 A;  2XU8 A;  1U8R A;  4M75 D;  5CO7 A;  3CME T;  4R55 A;  1R8O B;  4C8Q A;  2ZPH B;  3CC4 T;  5FRM A;  1O9S A;  3V7R A;  5LJ5 j;  1YIJ T;  5HY6 A;  4C5I A;  3CCR T;  3CC2 A;  4QVD A;  4OVA A;  3RMS A;  4ELY C;  3OYK A;  3S3M A;  2R57 A;  4V2S A;  4ZGE B;  5C0M A;  4LDX A;  2EWN A;  1V29 B;  4NL2 A;  2BKD N;  1VQO A;  3NFC A;  1YJ9 A;  1BI1 A;  2ZPB B;  4L6V 5;  2LC4 A;  5GAN e;  1YHQ T;  4BI4 A;  4ELZ C;  1K9M U;  4KT0 E;  4PJO D;  2HQE A;  4PJO G;  1BIB A;  2X4J A;  5LJ5 d;  1I81 A;  2M1H A;  3SDZ A;  2GF7 A;  3OMG A;  1UB4 A;  3VYG A;  2MMP A;  1OZ3 A;  3CEY A;  1UGP B;  2YLC A;  4J6X A;  2QA4 T;  2DTH A;  3PNW C;  3ZFJ A;  4R56 A;  5GAM d;  4BDY A;  5CQX A;  5GMK i;  3HP9 A;  2DXT A;  2X4X A;  2DO3 A;  1KC8 C;  2DJZ A;  1X6O A;  1VQL A;  4PJO C;  3LGL A;  2DIG A;  2E64 A;  2EKO A;  4XK8 E;  2PUO B;  3PT9 A;  3MEA A;  3RES A;  4C0D B;  3CPW S;  4L5G A;  3OW2 S;  3CCU T;  3I55 T;  1WQW A;  2FYK A;  3LGF A;  2F69 A;  4A4E A;  3CCS A;  3LYI A;  5GAN 2;  3X25 B;  4A4K A;  1YIJ A;  4M7A A;  3QYG B;  3WVD B;  3N5B B;  3QHS A;  4A54 A;  5KE3 A;  3P8B B;  4E7L A;  3A8L B;  4JDS A;  3E9G A;  2RHZ A;  2DXU A;  5KCH A;  4C5E A;  2OTL T;  2Y4Y A;  1M1K C;  3A8M B;  1YI2 A;  1FX7 A;  3EAE A;  2OTJ T;  2X4W A;  5I21 A;  4LDY A;  2RB6 A;  2WSE E;  1WGS A;  4HT8 A;  3JSC A;  2OTL A;  3MHX A;  4NL3 A;  4OMF B;  5J26 A;  5GAM j;  3HL8 A;  1YJW A;  3GIB A;  1UEB A;  3GOX A;  4MZM A;  4PL6 A;  5D6W A;  2PVG B;  4C92 F;  1M90 U;  3INZ A;  4RG8 A;  1QW1 A;  2RM4 A;  3UT1 A;  3OS1 A;  2EQU A;  4M78 F;  3JB9 I;  3G71 A;  4M78 E;  4M7D G;  1VQ6 T;  2ZPF B;  5LJ5 h;  4X9C A;  1YHQ A;  4J6Y A;  5IT9 E;  1S72 A;  2QDY B;  3V8L A;  3OBW A;  4M7A C;  1K8A U;  2QQA A;  4O5V A;  5CVI A;  4HKE A;  3QDR B;  1UGR B;  4C92 C;  3V8K A;  4J6W A;  2ZPI B;  2PVD B;  5GAM h;  2QEX T;  2JZ2 A;  2L5Q A;  1WPY A;  5GAO p;  4BAC A;  1LNX A;  4OGE A;  4YTL A;  4C5H A;  1NJI C;  2M0O A;  4F7U F;  1JJ2 A;  2RHX A;  1VQK T;  1Y71 A;  4E7J A;  4KUI A;  5GAN h;  1NZ9 A;  1SSF A;  2KSS A;  3FLG A;  4N4G A;  1KQS A;  3JCM d;  5A2Q E;  2P0K A;  2DTO A;  3M55 A;  1OI1 A;  2EQK A;  4BD3 A;  3H8Z A;  3MP8 A;  5LJ3 f;  3HPW A;  4O6J A;  1I4K 1;  3SWN A;  5IAY A;  1BKB A;  3DB3 A;  3M57 A;  3M56 A;  3L2Z A;  3OYG A;  1VQP A;  1M8V A;  3CC7 T;  3G4S A;  2JTF A;  3QKJ A;  5GMK m;  3HSB A;  2LNV A;  3OYF A;  3TRE A;  2PVO B;  2HNI A;  4M77 B;  2E65 A;  2QQ9 A;  3HFO A;  2L3R A;  2WSF E;  3RKY A;  4PJO F;  3OYB A;  4MDX A;  3ME9 A;  4IKF A;  3PGG A;  5FU6 C;  1VQ8 A;  5CIU A;  2RJD A;  3M54 A;  1KD1 U;  4X9D A;  4Y91 A;  1VQ5 T;  1VQN T;  4PLL A;  3OS0 A;  3OMC A;  1BIA A;  2AHJ B;  2RH2 A;  5AYF A;  3S6W A;  4C8Q F;  1YJN T;  3JB9 F;  1X01 A;  4PJO B;  2GFA A;  2GQV A;  4CRI A;  2CZ1 B;  5GAN 5;  3JCM P;  3FDR A;  4EPC A;  1QVF S;  4IUR A;  5GAN 6;  3RKW A;  4DOW A;  1Y96 B;  3AHU A;  4J7I A;  2K4Y A;  4N4H A;  1TH7 A;  3RMQ A;  4JRK A;  2XDB A;  3X26 B;  5CAI A;  1VQ9 A;  4OP0 A;  1G3W A;  3F70 A;  2FVU A;  2CZ6 B;  4C0Z A;  1QP2 A;  3RKX A;  3JCM g;  2EQM A;  3A8G B;  1VQK A;  2EJG A;  3MEW A;  4JS5 A;  5LJ5 e;  2LRQ A;  2LCL A;  3L1A A;  3BDL A;  3FJP A;  3OSV A;  5CQY A;  5DM7 R;  3BDU A;  3CMA A;  3S3N A;  3QPH A;  4BDZ A;  3RUX A;  1BYM A;  2PUK B;  3OYI A;  5HK0 A;  3H6Z A;  2RK1 A;  5KE2 A;  3JB9 G;  3CCE T;  5GMK h;  5GAM e;  3L2V A;  3OBY A;  2X4Y A;  3CC7 A;  3CCL A;  4JJN K;  5L8R E;  4F7U E;  1QVF A;  3JCM b;  2VXE A;  3G7Z A;  2E6N A;  2DZC A;  2RJE A;  3M4Y A;  5D6Y A;  2RK2 A;  1OZ2 A;  1PSF A;  1XNI A;  4HCZ A;  2MWP A;  4RG2 A;  4ZTF A;  3M58 A;  3VYH B;  3CD6 T;  3CCL T;  2LVM A;  3OYL A;  3G71 T;  1VUB A;  2WAC A;  1KHI A;  2JNG A;  3C4S A;  4XAX B;  3LLR A;  4N4I A;  2CGH A;  1G3Y A;  3OYH A;  5GAN g;  1K73 C;  1Q86 U;  2YRV A;  3MEV A;  2E6Z A;  4FU6 A;  3A5Z B;  3R6O A;  4C8Q D;  3TU4 K;  3JB9 D;  5LJ3 g;  4E7H A;  3CC4 A;  4DQ2 A;  2YHT A;  5FU7 B;  3OSS C;  3X20 B;  3OYJ A;  3WXM B;  4EMK C;  3FIF A;  3DLM A;  4C92 E;  1BI0 A;  3SFM A;  4M7D B;  1WQ7 A;  4IUP A;  3CME A;  4C5G A;  2JUF A;  2VGM A;  3BFM A;  3HHT B;  4VUB A;  4ZGD B;  5GAN 7;  5A0G A;  3DLL A;  2R5A A;  3EFR A;  4FT4 A;  2CZ7 B;  4M78 B;  3VV0 A;  4QQ6 A;  4M75 F;  3WVE B;  1N8R U;  3LH0 A;  1BI2 A;  4NOY A;  3QXE B;  5KH6 A;  2RHI A;  4M7A B;  5GAO m;  3QG1 A;  4MMK A;  4M7D E;  3CCQ T;  4RCC A;  4C8Q E;  1P92 A;  3GNG A;  3CCV A;  2G3R A;  5GAN 4;  1Q81 U;  2L89 A;  4KBM B;  5GAO l;  4PNO A;  1JJ2 S;  5GAN f;  1JBM A;  4IUV A;  3OB9 A;  4BUG A;  1BI3 A;  2DK3 A;  3CCV T;  4RCB A;  2HBP A;  4HCB A;  3CBP A;  2Y90 A;  3FRN A;  2JOY A;  4LDV A;  5LL6 S;  3JCM Q;  4GY5 A;  4OB0 B;  4A53 A;  1KHC A;  2A3L A;  4HA8 A;  3VUZ A;  5FLX E;  4C8Q G;  2QQB A;  2K5F A;  4A4H A;  1WJQ A;  1M1F A;  5J39 A;  3JCM f;  4X34 A;  5GAN 8;  3JCM h;  4XTW A;  1OYX A;  2CYZ B;  1IZ6 A;  3ER0 A;  3I55 A;  2LTO A;  3O8V A;  2HAX A;  4OF1 A;  1I8F A;  3DKM A;  3OQ5 A;  1LOJ A;  5GAO r;  1UGQ B;  1NE8 A;  1B34 A;  3LWH A;  3QSU A;  3E9F A;  4E7I A;  3L2W A;  4M78 A;  1W2B A;  3L2U A;  2F5K A;  4D6W A;  3C95 A;  2VGN A;  1QP3 A;  3Q1J A;  2P0P A;  5FU7 C;  3M59 A;  5D6X A;  5LJ3 e;  3P8D A;  5CKE A;  2VV5 A;  4QQD A;  5GAM f;  4J7F A;  2DD5 A;  4QW2 A;  3OYC A;  3G6E A;  2XD0 A;  4C8Q C;  1QVG S;  4PLI A;  5HK3 A;  3C12 A;  4XU2 A;  3VJP A;  5KCO A;  4BI8 B;  2WSC E;  3GPL A;  3S3O A;  1DJ7 B;  2KAF A;  2LX9 A;  3V8J A;  2DXC A;  4F7U G;  1VQ6 A;  2GCX A;  2H3J A;  2L8D A;  2MF2 A;  1S72 T;  2O4X B;  2LT4 A;  1KQ1 A;  3UDC A;  3FEO A;  4P5N A;  3PTA A;  1KQ2 A;  3QYH B;  1YBY A;  5CKB A;  3URG A;  4BI3 A;  3JCM X;  3E1S A;  2IG0 A;  4JS4 A;  3OW2 A;  4M7D D;  4M78 D;  4FIB A;  4JLG A;  1M5Q 1;  2K3X A;  2CS7 A;  2VUB A;  5EG2 A;  3HKS A;  4L59 A;  2V8K A;  4GLK A;  1GXI E;  4M7D F;  2V8I A;  4M77 A;  2DEQ A;  1O75 A;  4MML A;  5HKC A;  3OS2 A;  1N8R C;  3JCM V;  1M90 C;  4XTZ A;  4B9X A;  2R58 A;  1Q82 U;  4C0F A;  2XDD A;  3JCM W;  4C92 G;  1ZQ1 A;  2RHY A;  3J80 E;  2XIC A;  1XQH A;  2GFU A;  4M7A D;  4CI0 C;  1YCY A;  2CKK A;  2QTX A;  2BUD A;  4M7A F;  3UWN A;  4J5Y A;  3CBM A;  2FHD A;  3JRZ A;  1PSE A;  4XU0 A;  3L2R A;  1FWZ A;  1XOV A;  2XI9 A;  4IUU A;  4A4G A;  4FT2 A;  4IUQ A;  2MAM A;  1N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...