3NFCA

Crystal structure of e.coli mazf toxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
94
Chain Sequence
b'YVPDMGDLIWVDFDHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PemK-like protein 1
publication title Biochemical and Structural Analysis of E. coli MazF Toxin
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 94
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nfcA00
4MZMA 1VUBA 4HKEA 5HK0A 4MDXA 2KMTA 5DLOA 3TCJA 5CR2A 5CO7A 4ELZC 5HK3A 5CKEA 5CKFA 4VUBA 5CKHA 2C06A 2MF2A 5CKBA 4OF1A 3HPWA 1M1FA 4MZPA 4MZTA 3G7ZA 5CQXA 3NFCA 3VUBA 5CK9A 3JSCA 4ELYC 3JRZA 5CKDA 1NE8A 5CCAA 5CQYA 5HKCA 2VUBA 4ME7A 1UB4A 1X75C
chains in the Genus database with same CATH superfamily
4C8QD 1TSFA 4LDVA 4LUEA 1BI0A 2X3XD 2E3HA 4LDUA 4PFPA 4EIKA 4PJOF 3G6EA 2VXEA 4O6JA 2EJFA 1TH7A 4M7AF 4E7ZA 3BDUA 2EGAA 4RKUE 1VIEA 1PD1A 3JB9J 2LT4A 1BB9A 3UT1A 1OV3A 5KYYB 3MEWA 2RH2A 2GFAA 5FRNA 3O8VA 2P4TA 4PK4A 4JZ4A 1RLPC 4J9FA 4C8QA 4F16A 1FMVA 1NJIC 1P92A 2JTMA 1R0CB 3DLMA 3LGFA 1WHGA 2DFUA 3VS4A 1CSKA 2QYZA 2L2PA 5D6WA 3GOXA 3CCSA 1MMGA 1PWTA 3THKA 1B3QA 3PIPA 1PKSA 2EKHA 2CP6A 2HBWA 2VB6A 5HK3A 4OMNA 2DETA 2HDAA 3CXCA 1GXIE 3MP8A 2E10A 2K4YA 2JTEA 2HEQA 1QWEA 1AHJB 4DEXA 4PJOB 5GMKl 2O4XB 1KQSS 1VQNQ 1NYGA 1AEYA 3EG2A 1T3LA 3N5BB 3J81E 1WYXA 1NLOC 4DBQA 1Q86U 4M7AB 4KGVB 4ZGEB 2X3WD 5IHKA 1MNDA 4PJNA 3CD6Q 2YUNA 4XAXB 4J6YA 5CKHA 2M16A 3GNGA 8AT1B 4KH0B 5LJ3e 1WX6A 2YUQA 2ZPEB 3C94A 1RUWA 3ULRB 1M1GA 1VQ9A 2RK1A 2JTFA 3QO3A 2A37A 5GJWB 3H0FA 1BIAA 3I55T 1YJWA 1KFZA 5AT1B 2LQWA 1ZX6A 2V26A 3G71Q 1VQ5T 1WHLA 2X9HA 3MEUA 3VV0A 2DL8A 3CCET 1VQ8T 1B34B 2RQTA 1GBRA 2JS0A 2DM1A 2CP7A 4EMKA 4XTVA 1AVZC 1VQPQ 1J3TA 2RHYA 1VQLA 3A1PA 4BE1A 4RTVA 1Q86C 3V7RA 1PSFA 4J9CA 1YI2Q 2GNCA 3SHWA 3ZFJA 1WIEA 4OMPA 3VS2A 5J3BA 1I1JA 3R6NA 3LYIA 4R56A 1YIJT 3CCRQ 3SB2A 2Y4XA 1YITT 3CC7Q 3HRSA 4HCCA 3MHXA 1QP3A 3PTAA 1QCNA 4DQ2A 2R5MA 3UWNA 4KH1B 1AWXA 1K0SA 1QMCA 5I21A 4OF1A 5GMKm 2A0FB 1N6AA 2DF6A 2DERA 4XU2A 4J9BA 1D0YA 3RMSA 3RUXA 1RLQC 2O88A 1VA7A 1K9MC 2AZVA 2YDLA 5LJ5e 2NUPA 1IREB 2K57A 4LDYA 1HD3A 3MJXA 3CPWP 2WACA 1VQMA 2JOYA 5CKFA 3LH0A 3S6WA 5GMKj 4JJNK 1GRIA 2YXYA 2DTIA 1TS9A 2YHTA 5FLXE 3M58A 5C0MA 1Y0MA 1U5SA 4XTUA 4K11A 3I5RA 4C5IA 4CC3A 2PTKA 2D8JA 2H3EB 1WHMA 2MOXA 1C6VX 2HCKA 1X27A 3SFMA 3CC4T 3RIRA 3RKXA 4M75D 1I0CA 4M7DF 1WXBA 1JXMA 1W70A 2FPFA 2KEAA 1BK2A 5L23A 3LWHA 3CCMA 1W2BS 1BCMA 3D7SB 3M0UA 3VUBA 2FZCB 4HT8A 5FW9A 2PQWA 4M78G 3G1JA 4J9IA 1HYOA 2DVJA 4JRKA 3MPUB 2CZ0B 2L3QA 5A0DA 2V1QA 1KD1C 1G5VA 2EQUA 1X75C 3EG9A 1N8RR 4ANJA 4M75A 4M78B 1MUZA 3OYKA 3I56A 4BY6C 4D8DA 2XIDA 2LX9A 3M5AA 4CC2A 4KGXB 5GAOn 3MCAB 3OMGA 1ZA2B 3QBYA 3JCMg 2MWPA 3G6ET 1WQ7A 2RQVA 1KIKA 5CCAA 1RAEB 4RMOA 4E7JA 2LCSA 2VUBA 3URGA 1SPKA 1Z9QA 4QVCA 1Q81R 2COWA 3TREA 5IAYA 1VQ7A 4X9CA 2CUDA 2WSEE 2FPEA 2RJFA 1QP2A 2DBKA 2QTXA 4FM4B 1WDXA 1H92A 4OMOA 4HT9A 1NEBA 1D1AA 2NWMA 5GAN5 2Z0WA 3CCST 1FMKA 2P84A 4PJMA 2M0OA 5GAN3 4F7UB 1ZSZB 3OBYA 1OOTA 4M75F 4QVZA 4YTLA 4DOWA 3I35A 1M2VB 4HCKA 4JRPA 2RK2A 3EGUA 2HQHA 1YP5A 1LCKA 2BE9B 1Q7YU 1I5OB 3CC2A 2RJEA 4NL3A 1M8VA 1M2OA 1QCFA 4DBRA 2RPNA 1JQQA 1X2KA 2DEUA 2HQEA 4RUGA 1UTIA 2AKKA 2WSFE 4A4HA 1M1KR 2FZGB 2BIVA 3OW2S 1QKWA 3CXCP 2EPDA 2AIRB 1VQKA 1D0XA 4AFUC 3M56A 1H3ZA 2XD0A 2VGNA 1VQ9T 3LLRA 1AZGB 3AHUA 3EFOA 3V7SA 1PKTA 4FL6A 4JUVA 5CR2A 2A08A 1YJWT 3EHRA 1VIFA 3JCMQ 3VKIA 1K4US 4MZTA 2DXTA 4OVAA 3ZL7C 2B86A 1UHFA 3I55Q 1G2BA 4IUPA 1H3HA 5LJ3g 1M30A 1HXDA 2K3XA 2HSPA 1KHCA 2ENMA 3JCMd 1S72A 1VQ5Q 1VQLT 2RI2A 4FYXB 1YJNA 1VQ8Q 1BBZA 1T3SA 4OGEA 3GPLA 1UEBA 1BI3A 3EFSA 4E6RA 3VRYA 2GQIA 3QWYA 4C92D 2MWOA 5GAN8 1YIJQ 5DY9A 2KRMA 1BYMA 1YITQ 3VU3C 1QQJA 3CCJA 2ZAEA 2KRSA 2COYA 4EMGA 2KT1A 4RG2A 1UDLA 4KUIA 3VYHB 3JB9F 5GANe 4C0DC 1LOJA 4NL2A 4J7FA 3OS0A 2NUTB 1HK9A 1W2BA 3RNJA 1TG0A 1PHTA 3LX7A 2M9UA 3CMEA 4C92A 2L3SA 3L2ZA 2I2LA 4M77A 4L59A 3CCEA 1VQOA 1VQMT 2LCLA 2JMAA 4XTZA 2LRQA 2L5QA 3OA6A 4R55A 3I5SA 1FX7A 2HKQB 2KGTA 2KQWA 1X69A 1RAAB 3T9NA 2A7YA 5LJ5g 1VYVA 1R0BG 1VOMA 2K79A 2BZYA 4AFSC 3OYMA 2P0KA 4E7IA 2K7AA 3INZA 2BUDA 2M51A 5GJVB 3HRUA 3CC4Q 1M5Q1 2RJDA 2DIGA 3CCMT 4IIOA 4JDSA 5CQYA 1W6XA 3M54A 2GBQA 4JJCA 2F2WA 2DO3A 2PNIA 5LJ3d 2XI9A 2DE0X 4PJOD 3CBMA 1Y57A 1UGRB 1X01A 1ZA1B 4F14A 3OS2A 4FYVB 4M7AD 1SEMA 3I56T 4X1VA 4DOVA 3ZBDA 2KAFA 4M77F 4FYWB 1VQ6A 5GAMe 2QK0A 1OQKA 3PE0A 5KYNA 2DEQA 2LNVA 5HCKA 3WVEB 1JO8A 1RAGB 3X26B 4JLIA 1K9AA 2XG8D 4BI8B 2DTHA 1TUDA 2JS2A 2QTVA 3G6EQ 4PJOA 3RMQA 2O4XA 3A8GB 4C92C 3MP1A 1VQ7T 2GGRA 3A5ZB 4QQ6A 4M7AA 2JT4A 2MI6A 4BE0A 2J6FA 4ZGDB 1VQ4A 2RI3A 5I2MA 3H41A 1PG5B 4OMFB 3MEAA 2D6FA 1SG5A 1WFWA 5CO7A 4VUBA 1UGVA 2E70A 2FO0A 5CQXA 4IUQA 3VS3A 4NS5A 1K8AR 2KR3A 1JJ2S 5D6YA 3SEMA 3CCSQ 2KNBB 2RNAA 1ABQA 2F5KA 3CC2T 3OYAA 2DL3A 4J9HA 2ROTA 1OPLA 1G83A 2E64A 5FWCA 3SWNB 2QGGA 3PT9A 1ZQ1A 1K73R 2BTTA 5AYFA 1BI1A 3WXMB 5LJ5d 3KXTA 1T0HA 3JCMh 2FVUA 1R8OB 4PFZA 1PC0A 2E12A 2VXFA 2K9GA 2J05A 3QJ6A 3CEYA 1VQKT 2GFUA 2FZKB 1D3BB 1AOJA 1XNIA 5I22A 1QVGP 3V8KA 2CSQA 2KYBA 4CRIA 3EGDB 1VQ9Q 3ER0A 1N5ZA 3PNWC 2MYSA 4BDZA 2RQWA 3R6OA 1M3BA 3OYCA 2DILA 1YJWQ 3CCVA 1ZUUA 2LX7A 2LJ3A 5ECAA 1M3AA 1S72T 1VUBA 2YWWA 2BKDN 1YJNT 4AG1C 1UUEA 4FSXA 2ZZDA 3RERA 3UDCA 2K5FA 1VQLQ 5D6XA 2DL7A 1FWZA 3OS5A 1N8RU 3QHSA 4AG2C 5CIUA 1UE9A 1AWWA 2G6FX 1AWOA 5J26A 3EFRA 3QZ9B 5CAIA 1OU9A 3JCMf 2FRWA 1RABB 1YWOA 3CCJT 1B07A 3M9QA 2PVDB 1OZ2A 3OYFA 4HVVA 3JV3A 2D8HA 1NLPC 1JU5C 2ED1A 2QQRA 4X34A 1Q81U 4EPCA 3VJPA 1M90U 3L2WA 4RTTA 4N4HA 1N9SA 1KG1A 2EKOA 1BU1A 1TWBA 5KYWB 3CMET 3MEVA 3HRTA 3X24B 3KFVA 3FJ5A 2YUOA 3BW1A 4P5NA 1VQOT 2RJCA 1NBEB 3JSCA 5LJ3h 4M7DD 2KI7A 3BDLA 4QQGA 5GANg 2RQUA 2V8IA 3JCMP 1K9MU 4ORZA 1GCQA 4C8QC 4M78A 1N8RC 3CCLA 1YWPA 2XDPA 1LNXA 1EZZB 1VQMQ 1KC8U 1G3TA 2LTOA 1FYNA 4B9XA 1GCPA 2X35A 3HPWA 2CP0A 2E41A 2AZSA 1XQHA 3OYNA 2FYKA 2ESWA 2KBTA 4IUUA 3PMTA 2EFIA 4M7DA 5IHNA 1Q81C 1M90C 1RADB 4C8QG 4BDYA 2Y4YA 2F69A 2QQBA 2EGEA 2O31A 3CCMQ 4PLLA 3S3OA 2O01E 3FC3A 3EGXB 2J6OA 2F2VA 1WXUA 2IG0A 3FRNA 1NYFA 1WGSA 1VQ6T 1WZOA 1JJ2A 1G3YA 2LJ1A 2QEXA 2ZGWA 1UB4A 4JJBA 4F7UA 1KD1U 3I56Q 1KC8C 4M78F 1QCOA 1SHGA 2YLCA 2M0YA 1M2VA 2FRYA 1JRIA 2MF2A 5LJ3f 1QVFP 2DTOA 4AMCA 4LDWA 5CVIA 4RTZA 3KBGA 5GAOq 1C1AA 1IXDA 1KK7A 5GAMg 2J06A 1VQ4T 1UG1A 2DIQA 4FT2A 1IHVA 4A4KA 5LJ5h 3TEEA 1LPLA 1FXXA 4EMKC 2QG9B 1M1KC 1VQ7Q 4N0AA 2MAMA 4DBHA 1GCQC 1KHIA 4PJJA 4QKUA 4Y92A 3BFMA 2CGHA 1X2QA 3JCMb 1I4K1 3ZEHA 2K3YA 2JM8A 3DB3A 3C0CA 3FJPA 5DM7R 3L2RA 4C92E 3M0PA 5GANd 1UHCA 4F7UF 5C6SA 4C5GA 5I11A 1ACMB 4QW2A 4A4EA 1TU0B 3CC2Q 1X6OA 3EG0A 3NFCA 2JN0A 2QA4A 2CP2A 1WJSA 3H0HA 2LVMA 3OY9A 2QGFB 4ZGJB 3OBWA 1Q86R 1KQSA 2ZPBB 1ZHIA 3GLXA 2D0NA 1SRMA 5KYUA 2O9SA 1NPRA 2W10A 2EW3A 3A8OB 2KXDA 1VQKQ 2YLBA 2H3JA 4E7SA 4J9GA 2I0NA 2RHUA 3V8JA 2LZ6B 3C95A 4J7IA 1RI0A 2EJ9A 5LJ5f 1UGSB 2J6KA 2NLUA 1OEBA 2P4RA 4BY6B 2SRCA 3CCVT 2KROA 2NYSA 3M53A 4JRIA 2EYYA 2JJ9A 4BB7A 3JAME 1B7TA 2DD5A 3FEOA 3G4SA 3M4GA 2NUTA 4PKCC 3CBPA 1S72Q 2X4JA 2G3RA 1WLPB 4RTUA 3CPWS 1YJNQ 2OAWA 3M0QA 4J6XA 3EHQA 4KULA 2EQKA 3JB9D 3VS7A 4MDXA 5GAMd 2DJZA 1I8FA 1OPKA 2OTJA 2LQ8A 3QYGB 5LJ3j 3OSVA 1RL2A 1ZUYA 2JXBA 5GAN7 4JZ3A 2AKLA 4LXCA 4M75C 1JBMA 1Y96B 2D1XA 6AT1B 2E65A 2QQSA 1IB8A 5L8RE 1I81A 3PFSA 2HQXA 3CCJQ 5EC7A 2L3RA 3X25B 4LE9A 1X43A 2JVVA 2O9VA 2KDSA 4C0ZA 3OYJA 4BI4A 4PNOA 4Z89A 4C0GA 2VKNA 4LUDA 2YRVA 4A4FA 5J39A 2CS7A 1CKAA 1Y71A 3CMEQ 4M75G 1F1BB 3M4YA 3HFOA 4RTXA 3DLLA 4HXJA 3CCLT 3CCEQ 3OQ5A 1VQOQ 3M57A 2YRCA 2A36A 2P0QA 5GAOp 2LQKA 3L2QA 2CKKA 3VRZA 3CCQA 4IKFA 5HKCA 3LWIA 4A63B 4D8KA 4DBFA 4N4GA 4M77D 4ZN3A 4IURA 1X6GA 3VS5A 1JXOA 1K73U 3U23A 2KYMA 4FYYB 5FU6C 4C8QE 2ZPHB 3E9FA 3OB9A 4OB2B 2NUZA 2CT4A 5KYXB 1K0XA 1YN8A 1V1CA 5GAN4 5FU7C 4DA4A 3H6ZA 5LJ5j 2PVOB 1KQ2A 2RI5A 1WJQA 1IGQA 2AT1B 1PD0A 2EQMA 3J7AF 4J83A 3SD4A 2QEXT 2X4WA 2EGCA 3H0IA 2CZ7B 3KUFA 4IIMA 4WTOB 2V8KA 3VYGA 5GANh 1U8RA 4C5HA 2OTLA 4E7LA 1YNZA 4LNPA 2HMAA 1JEGA 2FHDA 4MMLA 2XHCA 1RAIB 3CXCS 1SSFA 1K73C 4C0DB 1QW1A 3CPFA 1JB0E 3J80E 1IHWA 4A54A 2VV5A 1VQ4Q 3H8ZA 3BY7A 1SSHA 3OYBA 2KRNA 5DLQE 3X20B 5CKDA 1D3BA 5KYYA 1UGQB 3UF4A 4Z02A 5A2QE 2XICA 2YT6A 1K1ZA 3EGDA 4J5YA 3EFOB 4OP0A 4JS4A 4XTWA 2K5IA 4AFQC 1Q7YR 2XK0A 2XDDA 1N9RA 2EVRA 2QA4T 4Y28E 2RB6A 3RDVA 1SHFA 3CPWA 5FWBA 3JCMV 3VUZA 3ASKA 4J6WA 2FG0A 3NPFA 1YJ9A 4OGCA 1GFCA 4EMHA 5GANf 4E2FB 7AT1B 1UGPB 2MK5A 3HHTB 3L42A 4ELYC 3DKMA 3RR6A 1UECA 3OW2A 5GAMh 1Y07A 3CCUA 2VYTA 4M77C 4JS5A 1SKUB 1AZEA 2DK3A 4Q5WA 4RTWA 4FIBA 5KCOA 2MPXC 4ELZC 1KSWA 2CH4W 4GLKA 2ZPGB 5GMKe 3JB9I 4XQ3A 1PRMC 5HY6A 1NEGA 2DRMA 5A0GA 2MMPA 2DXBA 3WVDB 3G4ST 3JCMW 3MKDA 2HBPA 2FL7A 3CCVQ 2F1LA 4C92G 2K5LA 4M4ZA 3GNFB 5KYWA 3RESA 1A0NB 2RA2A 4LD6A 3NTIA 4B6MA 2FB7A 4C92B 4LD9K 1D1BA 2EAYA 1B34A 2GCXA 4RCCA 2OTJT 2OX7A 4Z8AA 1YHQA 2L0AA 5A0LA 1H641 2ECZA 4ESRA 3EH2A 2DNUA 2FPDA 1MMDA 5GAN6 8ATCB 4BE2A 3L2VA 2M1HA 4NOYA 4J8OA 1D0ZA 2EYWA 2AHJB 1DJ7B 2FEIA 4UC4A 2PUOB 2LP5A 1KJWA 3VS0A 3QDFA 3LH5A 1Z9ZA 5GAMf 1U3OA 2X4XA 3QXEB 1WHHA 1ARKA 4PJOC 3EG3A 1E6GA 2ZPIB 4XTYA 4N4IA 4HA8A 1X6BA 2MCNA 1GL5A 4M75E 4M7AC 2RHXA 3NGPA 2GQVA 4HCZA 1LJOA 4GY5A 3CMAA 2CT3A 4TVRA 2OI3A 3EGXA 1RAFB 3M0RA 1BCOA 1Q82R 4CC7A 1D09B 3QG1A 4KGZB 2JW4A 3CCLQ 4QQDA 2GTJA 2E4HA 1W1FA 1W4SA 3CCQT 1WHKA 4PJOG 2D9TA 5IH2A 2DYBA 1BIBA 1YCSB 4F04B 4M7AG 3REAB 3OYIA 1ABOA 1WI7A 3PVLA 1AWJA 1OU8A 4FW1A 5GANj 2XU8A 1SF9A 2L3PA 4M78D 3L2UA 2F2XA 2DKGA 1PCXA 2YUPA 2VC8A 1LVKA 3E2UA 1IZ6A 2COZA 3JCMJ 1MMNA 4FW2A 5IT9E 2PZ1A 2JM9A 2QXFA 3A8MB 1OYXA 2LC4A 3M0SA 4C8QF 5CK9A 2KXCA 2RN8A 2P0PA 1RI9A 5IN1A 2CYZB 2V1RA 4KT0E 2QEXQ 2RHZA 3P8DA 1QLYA 4Z88A 2XKOC 2VWFA 3S3MA 1HSQA 2OTLT 1W2BP 5GMKi 4RG8A 1XJWB 1U1TA 5HK0A 2DX1A 2KE9A 4R0KA 5I2SA 1YFNA 4BUGA 3C12A 2QDLA 2QASA 3EG1A 3M0TA 1VYTA 3JRZA 3QPHA 1WNLA 1O75A 2BZ8A 2M02A 1QVGS 1KQ1A 1QWFA 2A3LA 1VQNA 2XMFA 4MMKA 4A53A 1EFNA 3OS1A 3TSWA 2RMOA 1M1KU 3QDRB 3A98A 3P8BB 3CD6A 2JMCA 4CC4B 4KRTA 2DJQA 2LMJA 4PLIA 3OYHA 4ZN1A 5GAMj 4J9EA 1M8MA 1NJIR 4C8QB 4RCBA 4E47A 3GP8A 1GBQA 3GF5A 2CUBA 4JPBW 1MMAA 1RACB 3M59A 1ZSZA 4MZMA 4HKEA 2K2VA 4BD3A 2JUFA 3TU4K 2CDTA 2CZ1B 2QA4Q 4XU0A 4XU1A 3G71A 1YJ9T 2SEMA 2DXUA 2QQAA 4L5GA 3HL8A 4PJLA 3RBBB 2DLPA 2D0QB 4ATOA 1NM7A 1VQPA 1MHNA 1UFFA 4OB1B 3CCUT 4XK8E 4QVDA 2IVWA 4LN2A 5FROA 4L6V5 2HZYA 1YCYA 1M3CA 1YI2A 2KMTA 4WCIA 3JB9H 2LQNA 3GBQA 2RD1A 1IRXA 2KVQG 4FSSA 1Y96A 2V8JA 2JNGA 4M78C 3CCRA 1IGUA 3CC7A 3GIBA 3QYHB 2DVEA 2DXCA 4B9WA 3OW2P 3RKWA 4LDXA 2A28A 2CREA 2DZCA 2LNHB 1U06A 3G4SQ 2ATCB 4M77E 2K2MA 2OAUA 1M9SA 4WF2A 1OI1A 4M7DC 3UA6A 4XU3A 3QSUA 1BI2A 2DMOA 1YHQT 3A8HB 5FRMA 4ZTJA 4OMMA 3AT1B 4AFZC 2DAQA 4EMKB 5GAN2 2OTJQ 2KY9A 3TCJA 1QVPA 3HFNA 2DL4A 4C5EA 3CBOA 1ZBJA 2DRKA 2DZ9A 2C0TA 2EYXA 3FIFA 1WPYA 4O5VA 1ZSZC 1XTDA 4M7DG 2QQ9A 2KK4A 3NTKA 1ZLMA 1MV0B 3E9GA 2X4YA 3NTHA 1ZSGA 3X28B 1M90R 4M7DB 2YRDA 2ABLA 3PGGA 5KYXA 2HD0A 4E7KA 2CP3A 4FU6A 3OYEA 1NPPA 2GTOA 3E19A 3CMAT 2LJ0A 3ME9A 4ZNXA 3V7CA 1G3WA 1N27A 5GAOl 2O2OA 3TQ7P 4F7UG 4N0AC 1WA7A 2DPPB 4OMQA 3UA7A 1K9MR 1GFDA 1E7OA 1TXQA 4IUTA 1WJRA 1QVFS 2E5QA 2ED0A 1KC8R 1WXTA 5D7UA 2NUPB 1MV3A 4RTYA 4PJOE 4GBQA 5IXFA 2RHIA 1ZUKA 1PNJA 1H8KA 4M7AE 2R5AA 2QDYB 3CCQQ 4DEYA 1PM3A 4JLGA 2K6DA 4JRQA 4PFOA 2HAXA 2Y90A 2PU9B 4BI3A 3L1AA 1QVGA 2EYZA 5DLOA 1CKBA 1Y7XA 4KBMB 2B8AA 3O5ZA 2VASA 1V29B 3FDRA 4D6WA 3JCMc 3UPUA 3OYDA 1TOVA 2ZPFB 1O9SA 3M55A 5LL6S 3UATA 2KT8A 1I07A 3LGLA 3EAEA 1S1NA 2LT1A 3FLGA 3QKJA 2IPOB 4J9DA 2MIOA 1KD1R 3HSBA 3A8LB 3OMCA 2WSCE 3EG9B 3QZ5B 4M75B 1K8AU 1OZ3A 2E1HA 2VVKA 2RO0A 1Q7YC 2OTLQ 1C0MA 2QAZA 2C0IA 2L89A 5IXBA 1SRLA 1U1SA 2R57A 3META 1XOVA 2YSQA 1VQNT 3P8HA 3V8LA 4JJDA 3I9QA 1OULA 4FT4A 3SDZA 5KYUB 1Q95G 5GAOm 2HL3A 2DL5A 3FB9A 3MO8A 4GLMA 3CD6T 1PRLC 2AK5A 2E6ZA 1T0JA 3NMZC 2JZ2A 4II1A 4CI0C 3Q1JA 3LW5E 4ME7A 3HTRA 2HL5C 5KE3A 2LDMA 1NZ9A 2X51A 2H8HA 2DA9A 3MP6A 4A4GA 3EH1A 2BE7D 2CH4A 5M9OA 5KCHA 2VGMA 1RAHB 1VQ6Q 1MGQA 2K3BA 3G7ZA 2HKNA 1K8AC 2DD4A 2RM4A 2CP5A 1WQWA 4OMLA 5KH6A 3G71T 3QWXX 2OJ2A 4OB0B 3DB4A 1ZBXA 1UJYA 3I55A 3F70A 3HKSA 2EBPA 1JJ2P 5FU6B 1VQPT 3SWNA 1VQ5A 3PVQA 1YJ9Q 2BZXA 2E5KA 2IIMA 3OYLA 3C4SA 1Q82U 1YI2T 1VQ8A 2C0OA 1AD5A 1D1CA 2RQRA 2EQJA 5FU7B 4C0FA 3CCUQ 3CCRT 4QT7A 4Y91A 3CC7T 1OX8A 1FMWA 3TVTA 2R58A 3PIOA 3JB9G 4X9DA 1YIJA 4ZTFA 2W0ZA 1YITA 1G8XA 2EQIA 3QUIA 9ATCB 5CKBA 4HCBA 1M4ZA 2EJGA 2DYIA 2KSSA 1TTHB 4MDWA 4E7HA 2HNIA 4M78E 2PUKB 3OYGA 1NG2A 1EX4A 1I5LA 2CZ6B 5GAOr 5EG2A 1PSEA 4HVWA 4C92F 2EIFA 1OX9A 3QIIA 5CKEA 1BKBA 1HJDA 3HP9A 1Q82C 4EDUA 1V76A 2QI2A 1YHQQ 2C06A 1QVFA 4F17A 2EWNA 2L8DA 4IUVA 3VS6A 4FCYA 3BE3A 1MNEA 1NE8A 1TUGB 4M7DE 4KUDK 2CSIA 2ZCFB 4OB3B 4V2SA 2DBMA 3IQLA 1KQSP 3OSSC 3S3NA 1QKXA 3OYYA 2PVGB 2GF7A 1VYUA 1IO6A 2RF0A 2E6NA 4BACA 1M1FA 3JCMX 4MZPA 1EIFA 1M27C 3SWNC 1TUCA 2XDBA 1G3SA 3PMIA 3QJYA 2HSEB 3CC4A 3VS1A 2LCCA 3CQTA 5IHIA 4F7UE 2J7IA 1WHJA 3CMAQ 3H9NA 4M77G 3JCMe 1UJ0A 4AT1B 1YBYA 2EYQA 1NJIU 4PL6A 5GMKh 3NHNA 4M77B 2F5TX 4XTXA 2E3IA 3REBB 4HVUA 3TSZA 2ROLA 3RKYA 1E6HA 1AT1B 3E1SA 1R77A 5KE2A 1K76A
chains in the Genus database with same CATH topology
3CCVT 3OS1A 3M53A 4C8QD 4LDVA 4JRIA 1BI0A 1M1KU 4BB7A 3QDRB 3JAME 3L2ZA 2I2LA 2DD5A 3P8BB 4M77A 3FEOA 4L59A 3CCEA 3CD6A 3G4SA 3M4GA 4LDUA 1VQMT 1VQOA 2LCLA 4PKCC 4PJOF 4PLIA 3G6EA 2VXEA 4ZN1A 4O6JA 5GAMj 4XTZA 2LRQA 3OYHA 3CBPA 2L5QA 2EJFA 4C8QB 3OA6A 4R55A 1FX7A 1TH7A 2X4JA 4RCBA 4M7AF 2G3RA 4E47A 3GP8A 3BDUA 3CPWS 3GF5A 4RKUE 1VIEA 3JB9J 2LT4A 3UT1A 4J6XA 4KULA 2KQWA 3M59A 3T9NA 3MEWA 4MZMA 2RH2A 2EQKA 2GFAA 4HKEA 3JB9D 3O8VA 5FRNA 2A7YA 5LJ5g 2K2VA 2P4TA 5GAMd 2DJZA 1I8FA 4MDXA 2OTJA 4BD3A 3OYMA 2P0KA 4E7IA 3INZA 2JUFA 2LQ8A 3QYGB 4C8QA 3TU4K 2CZ1B 2BUDA 4XU0A 5LJ3j 4XU1A 3G71A 3OSVA 1P92A 1YJ9T 1NJIC 3HRUA 1RL2A 2DXUA 2QQAA 4L5GA 1M5Q1 3HL8A 5GAN7 2JTMA 2RJDA 4M75C 3DLMA 1JBMA 1Y96B 2DIGA 3LGFA 3CCMT 2D0QB 2E65A 2QQSA 4JDSA 4ATOA 5L8RE 5CQYA 1VQPA 1MHNA 3M54A 5D6WA 3GOXA 1I81A 4OB1B 3CCSA 3CCUT 4XK8E 2DO3A 4QVDA 3PFSA 2HQXA 2IVWA 5FROA 2L3RA 4L6V5 5LJ3d 1YCYA 2XI9A 3X25B 3PIPA 4PJOD 1YI2A 3CBMA 1UGRB 1X01A 2KMTA 5HK3A 2JVVA 3JB9H 2KDSA 2RD1A 3OS2A 2KVQG 4C0ZA 3OYJA 4M7AD 3I56T 3CXCA 1GXIE 4DOVA 1Y96A 2V8JA 2JNGA 2KAFA 3MP8A 4M78C 4PNOA 2E10A 2K4YA 4M77F 4BI4A 3CCRA 1AHJB 4PJOB 1VQ6A 4C0GA 5GAMe 5GMKl 3CC7A 2O4XB 2YRVA 1KQSS 4A4FA 3GIBA 5J39A 2CS7A 3QYHB 2DVEA 1Y71A 2DXCA 3N5BB 4B9WA 2DEQA 3J81E 1Q86U 4M75G 4M7AB 3RKWA 2LNVA 3WVEB 4ZGEB 4LDXA 3M4YA 3X26B 3HFOA 4JLIA 3DLLA 1KQ2A 2DZCA 2XG8D 4BI8B 3CCLT 2DTHA 3OQ5A 3M57A 4XAXB 4J6YA 4M77E 5CKHA 2OAUA 2M16A 3GNGA 3RMQA 1M9SA 4WF2A 4PJOA 1OI1A 4M7DC 2O4XA 3A8GB 2P0QA 5LJ3e 5GAOp 4C92C 2LQKA 2ZPEB 3MP1A 1VQ7T 3A5ZB 3C94A 4XU3A 4QQ6A 4M7AA 2MI6A 3QSUA 1BI2A 3L2QA 4BE0A 1M1GA 2CKKA 1YHQT 3A8HB 4ZGDB 4ZTJA 1VQ4A 2RI3A 1VQ9A 5FRMA 5I2MA 2DAQA 4EMKB 3CCQA 4IKFA 5HKCA 2RK1A 4OMFB 5GAN2 2JTFA 3QO3A 3MEAA 3LWIA 2D6FA 3I55T 1BIAA 1YJWA 2KY9A 4N4GA 4M77D 4ZN3A 3TCJA 4IURA 1QVPA 5CO7A 3HFNA 1K73U 1VQ5T 4C5EA 4VUBA 3CBOA 5FU6C 4C8QE 3MEUA 3VV0A 2ZPHB 3E9FA 2DZ9A 3OB9A 4OB2B 3FIFA 2E70A 1VQ8T 3CCET 1B34B 1WPYA 4O5VA 5CQXA 1XTDA 4IUQA 4EMKA 4NS5A 2QQ9A 4XTVA 4M7DG 1JJ2S 2KK4A 2RHYA 5D6YA 5GAN4 1VQLA 3NTKA 4BE1A 3JCMW 5FU7C 4DA4A 3H6ZA 5LJ5j 2PVOB 2F5KA 1PSFA 3V7RA 2RI5A 1Q86C 3CC2T 3E9GA 2X4YA 1WJQA 3OYAA 3NTHA 3X28B 2EQMA 3J7AF 4J83A 4M7DB 3SD4A 3ZFJA 2QEXT 2X4WA 3PGGA 5J3BA 4E7KA 2HD0A 2E64A 3SWNB 3LYIA 4FU6A 4R56A 3OYEA 1YIJT 1NPPA 3SB2A 3PT9A 3E19A 1ZQ1A 2CZ7B 2Y4XA 3KUFA 5AYFA 1BI1A 3WXMB 5LJ5d 1YITT 3KXTA 3CMAT 3JCMh 3HRSA 3ME9A 3V7CA 2FVUA 2V8KA 1G3WA 1R8OB 1N27A 4HCCA 3MHXA 1QP3A 3VYGA 5GAOl 5GANh 3PTAA 1U8RA 2E12A 4DQ2A 4C5HA 4F7UG 2OTLA 2VXFA 2R5MA 4N0AC 3UWNA 3QJ6A 3CEYA 1VQKT 4E7LA 2DPPB 2GFUA 2FHDA 1D3BB 4IUTA 2XHCA 4MMLA 1XNIA 1WJRA 1QVFS 2E5QA 3CXCS 1SSFA 3V8KA 1K73C 4C0DB 5I21A 4PJOE 1VQOT 1QW1A 3CPFA 4CRIA 1JB0E 4OF1A 2RHIA 5GMKm 3J80E 4A54A 2VV5A 3ER0A 3BY7A 3H8ZA 3OYBA 4M7AE 2R5AA 2QDYB 1N6AA 3PNWC 4BDZA 5DLQE 3R6OA 4XU2A 3RUXA 3RMSA 3X20B 5CKDA 1K9MC 1D3BA 4JLGA 3OYCA 1UGQB 4JRQA 3CCVA 4Z02A 2Y90A 5LJ5e 5A2QE 2HAXA 2XICA 2PU9B 4BI3A 1IREB 3L1AA 2K57A 1QVGA 4LDYA 1S72T 1VUBA 2BKDN 5DLOA 4J5YA 1Y7XA 4KBMB 2WACA 1YJNT 2B8AA 1VQMA 2JOYA 5CKFA 3LH0A 3S6WA 5GMKj 4JJNK 1V29B 4OP0A 4FSXA 2ZZDA 3FDRA 4JS4A 4D6WA 3JCMc 2DTIA 3RERA 3UPUA 2YHTA 5FLXE 3M58A 4XTWA 3UDCA 5C0MA 2K5FA 3OYDA 2K5IA 2ZPFB 1O9SA 3M55A 4XTUA 5D6XA 4C5IA 5LL6S 1FWZA 2XK0A 2XDDA 1N9RA 3LGLA 3OS5A 2QA4T 3EAEA 3SFMA 3CC4T 2LT1A 3FLGA 3RIRA 1N8RU 3RKXA 3QKJA 4M75D 3QHSA 4Y28E 2RB6A 5CIUA 4M7DF 3CPWA 3HSBA 5J26A 3JCMV 3VUZA 3A8LB 3EFRA 3ASKA 3QZ9B 4J6WA 3OMCA 5CAIA 3JCMf 2WSCE 1YJ9A 4OGCA 3CCJT 3M9QA 4EMHA 3QZ5B 2PVDB 4M75B 1OZ2A 5GANf 3OYFA 1K8AU 3LWHA 1OZ3A 3CCMA 2E1HA 2RO0A 1W2BS 3VUBA 1UGPB 3ZBDA 3HHTB 3L42A 4ELYC 1Q7YC 3DKMA 4HT8A 2PQWA 4M78G 3OW2A 2L89A 5GAMh 1Y07A 3CCUA 2QQRA 3G4ST 4JRKA 1U1SA 2R57A 2CZ0B 2VYTA 1XOVA 3META 4M77C 4X34A 4JS5A 1Q81U 4EPCA 3VJPA 5A0DA 3L2WA 1M90U 2DK3A 1KD1C 1G5VA 2EQUA 1X75C 4N4HA 4Q5WA 1N9SA 1KG1A 1VQNT 2EKOA 3P8HA 3V8LA 4FIBA 4M75A 5KCOA 4M78B 4ELZC 3CMET 3MEVA 3OYKA 3I56A 3HRTA 4FT4A 3SDZA 3X24B 4BY6C 4GLKA 2ZPGB 5GMKe 3JB9I 4XQ3A 2XIDA 5HY6A 5GAOm 2LX9A 3BW1A 3M5AA 3FB9A 3MO8A 5A0GA 3CD6T 2MMPA 2DXBA 4P5NA 3MCAB 3WVDB 3OMGA 2RJCA 3QBYA 3JSCA 3JCMg 5GAOn 5LJ3h 4M7DD 2MWPA 2E6ZA 2HBPA 3BDLA 2FL7A 3G6ET 4II1A 2JZ2A 4QQGA 4C92G 5GANg 4CI0C 2V8IA 3JCMP 1WQ7A 2K5LA 1K9MU 5CCAA 4RMOA 4E7JA 3Q1JA 3GNFB 4C8QC 4M78A 2VUBA 3LW5E 4ME7A 1N8RC 3RESA 3URGA 3CCLA 2XDPA 1LNXA 2RA2A 4LD6A 2LDMA 5KE3A 4QVCA 3NTIA 1KC8U 1NZ9A 2FB7A 3MP6A 1G3TA 2LTOA 4A4GA 4B9XA 4C92B 4LD9K 3TREA 2EAYA 1B34A 5IAYA 5M9OA 2X35A 5KCHA 1VQ7A 2VGMA 4X9CA 2GCXA 4RCCA 3HPWA 2OTJT 2WSEE 2E41A 1MGQA 1XQHA 3G7ZA 3OYNA 1K8AC 1YHQA 2DD4A 2RJFA 1QP2A 2RM4A 2FYKA 5A0LA 2QTXA 1WQWA 4FM4B 5KH6A 1H641 3G71T 4OB0B 3DB4A 5GAN6 4IUUA 1ZBXA 4BE2A 3PMTA 2EFIA 4HT9A 4M7DA 3I55A 3F70A 3HKSA 1Q81C 1M90C 3L2VA 2M1HA 5GAN5 5FU6B 1VQPT 3SWNA 4C8QG 1VQ5A 4NOYA 3CCST 4J8OA 4BDYA 2Y4YA 2F69A 2QQBA 2AHJB 2M0OA 5GAN3 4F7UB 1DJ7B 4UC4A 3C4SA 3OYLA 1Q82U 3OBYA 1YI2T 1VQ8A 2PUOB 4M75F 4PLLA 4QVZA 4YTLA 4DOWA 4JRPA 2RK2A 2EQJA 5FU7B 2O01E 5GAMf 4C0FA 3FC3A 3S3OA 1Q7YU 3CCRT 2X4XA 2IG0A 3QXEB 3CC2A 2RJEA 3FRNA 4NL3A 1M8VA 1WGSA 1VQ6T 4Y91A 1JJ2A 3CC7T 4PJOC 1G3YA 2ZPIB 4XTYA 4N4IA 2QEXA 2ZGWA 1UB4A 4HA8A 4F7UA 2HQEA 2R58A 3PIOA 1KD1U 3JB9G 4X9DA 1KC8C 1YIJA 4M75E 4M78F 4M7AC 4ZTFA 2RHXA 2YLCA 2WSFE 2GQVA 4HCZA 4A4HA 1LJOA 4GY5A 1YITA 3CMAA 3QUIA 4TVRA 1JRIA 2MF2A 5CKBA 5LJ3f 2BIVA 3OW2S 2DTOA 4HCBA 1M4ZA 4LDWA 5CVIA 2EJGA 3KBGA 1VQKA 2KSSA 5GAOq 3QG1A 4MDWA 4E7HA 3M56A 1H3ZA 2HNIA 2XD0A 2VGNA 4QQDA 5GAMg 4M78E 2PUKB 1VQ4T 1VQ9T 3LLRA 3OYGA 2DIQA 4FT2A 1I5LA 4A4KA 2CZ6B 1W4SA 3CCQT 4PJOG 5LJ5h 2D9TA 3TEEA 5GAOr 1FXXA 3V7SA 5EG2A 4EMKC 1PSEA 4FL6A 1M1KC 1BIBA 4JUVA 4C92F 2EIFA 5CR2A 3QIIA 4N0AA 2MAMA 1BKBA 5CKEA 1YJWT 3HP9A 1Q82C 4EDUA 1QVFA 2QI2A 2C06A 4M7AG 1VIFA 1KHIA 3JCMQ 3VKIA 3OYIA 3BFMA 5GANj 2CGHA 2EWNA 4MZTA 2L8DA 4IUVA 2DXTA 4OVAA 2XU8A 3JCMb 4IUPA 5LJ3g 1I4K1 4M78D 3ZEHA 2K3YA 1HXDA 1NE8A 2K3XA 3DB3A 3L2UA 4M7DE 1KHCA 4KUDK 3JCMd 1S72A 1VQLT 3FJPA 5DM7R 2ZCFB 2RI2A 2DKGA 4OB3B 4C92E 3L2RA 4V2SA 2VC8A 1YJNA 5GANd 3OSSC 3S3NA 4F7UF 4OGEA 5C6SA 1IZ6A 3OYYA 3JCMJ 4C5GA 2PVGB 2GF7A 5IT9E 3GPLA 2QXFA 3A8MB 2E6NA 4QW2A 1M1FA 1OYXA 4C92A 3JCMX 2LC4A 4MZPA 4A4EA 4BACA 1UEBA 4C8QF 1EIFA 3SWNC 1BI3A 2XDBA 1G3SA 1X6OA 3NFCA 3EFSA 3PMIA 5CK9A 2JN0A 2QA4A 3QJYA 2P0PA 3CC4A 1WJSA 5IN1A 2CYZB 4KT0E 2LVMA 3OY9A 2LCCA 2RHZA 3P8DA 4ZGJB 4C92D 2XKOC 2MWOA 5GAN8 3S3MA 3OBWA 5DY9A 1KQSA 2OTLT 4F7UE 5GMKi 2ZPBB 4RG8A 1BYMA 1ZHIA 3GLXA 4M77G 1U1TA 3VU3C 5HK0A 3CCJA 3AHUA 4EMGA 1NPRA 3JCMe 3A8OB 5I2SA 4RG2A 1YBYA 4KUIA 3C12A 3VYHB 2EYQA 2YLBA 4BUGA 1NJIU 4PL6A 5GMKh 3JB9F 2H3JA 5GANe 4C0DC 2RHUA 1LOJA 4M77B 2F5TX 4J7FA 4NL2A 3V8JA 3OS0A 3C95A 4XTXA 4J7IA 1RI0A 3JRZA 3QPHA 1WNLA 1HK9A 1O75A 1W2BA 3RKYA 2EJ9A 5LJ5f 1QVGS 1KQ1A 3E1SA 2A3LA 3LX7A 1VQNA 1UGSB 2NLUA 5KE2A 2M9UA 4MMKA 4A53A 3CMEA 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZM A;  1VUB A;  4HKE A;  5HK0 A;  4MDX A;  2KMT A;  5DLO A;  3TCJ A;  5CR2 A;  5CO7 A;  4ELZ C;  5HK3 A;  5CKE A;  5CKF A;  4VUB A;  5CKH A;  2C06 A;  2MF2 A;  5CKB A;  4OF1 A;  3HPW A;  1M1F A;  4MZP A;  4MZT A;  3G7Z A;  5CQX A;  3NFC A;  3VUB A;  5CK9 A;  3JSC A;  4ELY C;  3JRZ A;  5CKD A;  1NE8 A;  5CCA A;  5CQY A;  5HKC A;  2VUB A;  4ME7 A;  1UB4 A;  1X75 C; 
#chains in the Genus database with same CATH topology
 4C8Q D;  1TSF A;  4LDV A;  4LUE A;  1BI0 A;  2X3X D;  2E3H A;  4LDU A;  4PFP A;  4EIK A;  4PJO F;  3G6E A;  2VXE A;  4O6J A;  2EJF A;  1TH7 A;  4M7A F;  4E7Z A;  3BDU A;  2EGA A;  4RKU E;  1VIE A;  1PD1 A;  3JB9 J;  2LT4 A;  1BB9 A;  3UT1 A;  1OV3 A;  5KYY B;  3MEW A;  2RH2 A;  2GFA A;  5FRN A;  3O8V A;  2P4T A;  4PK4 A;  4JZ4 A;  1RLP C;  4J9F A;  4C8Q A;  4F16 A;  1FMV A;  1NJI C;  1P92 A;  2JTM A;  1R0C B;  3DLM A;  3LGF A;  1WHG A;  2DFU A;  3VS4 A;  1CSK A;  2QYZ A;  2L2P A;  5D6W A;  3GOX A;  3CCS A;  1MMG A;  1PWT A;  3THK A;  1B3Q A;  3PIP A;  1PKS A;  2EKH A;  2CP6 A;  2HBW A;  2VB6 A;  5HK3 A;  4OMN A;  2DET A;  2HDA A;  3CXC A;  1GXI E;  3MP8 A;  2E10 A;  2K4Y A;  2JTE A;  2HEQ A;  1QWE A;  1AHJ B;  4DEX A;  4PJO B;  5GMK l;  2O4X B;  1KQS S;  1VQN Q;  1NYG A;  1AEY A;  3EG2 A;  1T3L A;  3N5B B;  3J81 E;  1WYX A;  1NLO C;  4DBQ A;  1Q86 U;  4M7A B;  4KGV B;  4ZGE B;  2X3W D;  5IHK A;  1MND A;  4PJN A;  3CD6 Q;  2YUN A;  4XAX B;  4J6Y A;  5CKH A;  2M16 A;  3GNG A;  8AT1 B;  4KH0 B;  5LJ3 e;  1WX6 A;  2YUQ A;  2ZPE B;  3C94 A;  1RUW A;  3ULR B;  1M1G A;  1VQ9 A;  2RK1 A;  2JTF A;  3QO3 A;  2A37 A;  5GJW B;  3H0F A;  1BIA A;  3I55 T;  1YJW A;  1KFZ A;  5AT1 B;  2LQW A;  1ZX6 A;  2V26 A;  3G71 Q;  1VQ5 T;  1WHL A;  2X9H A;  3MEU A;  3VV0 A;  2DL8 A;  3CCE T;  1VQ8 T;  1B34 B;  2RQT A;  1GBR A;  2JS0 A;  2DM1 A;  2CP7 A;  4EMK A;  4XTV A;  1AVZ C;  1VQP Q;  1J3T A;  2RHY A;  1VQL A;  3A1P A;  4BE1 A;  4RTV A;  1Q86 C;  3V7R A;  1PSF A;  4J9C A;  1YI2 Q;  2GNC A;  3SHW A;  3ZFJ A;  1WIE A;  4OMP A;  3VS2 A;  5J3B A;  1I1J A;  3R6N A;  3LYI A;  4R56 A;  1YIJ T;  3CCR Q;  3SB2 A;  2Y4X A;  1YIT T;  3CC7 Q;  3HRS A;  4HCC A;  3MHX A;  1QP3 A;  3PTA A;  1QCN A;  4DQ2 A;  2R5M A;  3UWN A;  4KH1 B;  1AWX A;  1K0S A;  1QMC A;  5I21 A;  4OF1 A;  5GMK m;  2A0F B;  1N6A A;  2DF6 A;  2DER A;  4XU2 A;  4J9B A;  1D0Y A;  3RMS A;  3RUX A;  1RLQ C;  2O88 A;  1VA7 A;  1K9M C;  2AZV A;  2YDL A;  5LJ5 e;  2NUP A;  1IRE B;  2K57 A;  4LDY A;  1HD3 A;  3MJX A;  3CPW P;  2WAC A;  1VQM A;  2JOY A;  5CKF A;  3LH0 A;  3S6W A;  5GMK j;  4JJN K;  1GRI A;  2YXY A;  2DTI A;  1TS9 A;  2YHT A;  5FLX E;  3M58 A;  5C0M A;  1Y0M A;  1U5S A;  4XTU A;  4K11 A;  3I5R A;  4C5I A;  4CC3 A;  2PTK A;  2D8J A;  2H3E B;  1WHM A;  2MOX A;  1C6V X;  2HCK A;  1X27 A;  3SFM A;  3CC4 T;  3RIR A;  3RKX A;  4M75 D;  1I0C A;  4M7D F;  1WXB A;  1JXM A;  1W70 A;  2FPF A;  2KEA A;  1BK2 A;  5L23 A;  3LWH A;  3CCM A;  1W2B S;  1BCM A;  3D7S B;  3M0U A;  3VUB A;  2FZC B;  4HT8 A;  5FW9 A;  2PQW A;  4M78 G;  3G1J A;  4J9I A;  1HYO A;  2DVJ A;  4JRK A;  3MPU B;  2CZ0 B;  2L3Q A;  5A0D A;  2V1Q A;  1KD1 C;  1G5V A;  2EQU A;  1X75 C;  3EG9 A;  1N8R R;  4ANJ A;  4M75 A;  4M78 B;  1MUZ A;  3OYK A;  3I56 A;  4BY6 C;  4D8D A;  2XID A;  2LX9 A;  3M5A A;  4CC2 A;  4KGX B;  5GAO n;  3MCA B;  3OMG A;  1ZA2 B;  3QBY A;  3JCM g;  2MWP A;  3G6E T;  1WQ7 A;  2RQV A;  1KIK A;  5CCA A;  1RAE B;  4RMO A;  4E7J A;  2LCS A;  2VUB A;  3URG A;  1SPK A;  1Z9Q A;  4QVC A;  1Q81 R;  2COW A;  3TRE A;  5IAY A;  1VQ7 A;  4X9C A;  2CUD A;  2WSE E;  2FPE A;  2RJF A;  1QP2 A;  2DBK A;  2QTX A;  4FM4 B;  1WDX A;  1H92 A;  4OMO A;  4HT9 A;  1NEB A;  1D1A A;  2NWM A;  5GAN 5;  2Z0W A;  3CCS T;  1FMK A;  2P84 A;  4PJM A;  2M0O A;  5GAN 3;  4F7U B;  1ZSZ B;  3OBY A;  1OOT A;  4M75 F;  4QVZ A;  4YTL A;  4DOW A;  3I35 A;  1M2V B;  4HCK A;  4JRP A;  2RK2 A;  3EGU A;  2HQH A;  1YP5 A;  1LCK A;  2BE9 B;  1Q7Y U;  1I5O B;  3CC2 A;  2RJE A;  4NL3 A;  1M8V A;  1M2O A;  1QCF A;  4DBR A;  2RPN A;  1JQQ A;  1X2K A;  2DEU A;  2HQE A;  4RUG A;  1UTI A;  2AKK A;  2WSF E;  4A4H A;  1M1K R;  2FZG B;  2BIV A;  3OW2 S;  1QKW A;  3CXC P;  2EPD A;  2AIR B;  1VQK A;  1D0X A;  4AFU C;  3M56 A;  1H3Z A;  2XD0 A;  2VGN A;  1VQ9 T;  3LLR A;  1AZG B;  3AHU A;  3EFO A;  3V7S A;  1PKT A;  4FL6 A;  4JUV A;  5CR2 A;  2A08 A;  1YJW T;  3EHR A;  1VIF A;  3JCM Q;  3VKI A;  1K4U S;  4MZT A;  2DXT A;  4OVA A;  3ZL7 C;  2B86 A;  1UHF A;  3I55 Q;  1G2B A;  4IUP A;  1H3H A;  5LJ3 g;  1M30 A;  1HXD A;  2K3X A;  2HSP A;  1KHC A;  2ENM A;  3JCM d;  1S72 A;  1VQ5 Q;  1VQL T;  2RI2 A;  4FYX B;  1YJN A;  1VQ8 Q;  1BBZ A;  1T3S A;  4OGE A;  3GPL A;  1UEB A;  1BI3 A;  3EFS A;  4E6R A;  3VRY A;  2GQI A;  3QWY A;  4C92 D;  2MWO A;  5GAN 8;  1YIJ Q;  5DY9 A;  2KRM A;  1BYM A;  1YIT Q;  3VU3 C;  1QQJ A;  3CCJ A;  2ZAE A;  2KRS A;  2COY A;  4EMG A;  2KT1 A;  4RG2 A;  1UDL A;  4KUI A;  3VYH B;  3JB9 F;  5GAN e;  4C0D C;  1LOJ A;  4NL2 A;  4J7F A;  3OS0 A;  2NUT B;  1HK9 A;  1W2B A;  3RNJ A;  1TG0 A;  1PHT A;  3LX7 A;  2M9U A;  3CME A;  4C92 A;  2L3S A;  3L2Z A;  2I2L A;  4M77 A;  4L59 A;  3CCE A;  1VQO A;  1VQM T;  2LCL A;  2JMA A;  4XTZ A;  2LRQ A;  2L5Q A;  3OA6 A;  4R55 A;  3I5S A;  1FX7 A;  2HKQ B;  2KGT A;  2KQW A;  1X69 A;  1RAA B;  3T9N A;  2A7Y A;  5LJ5 g;  1VYV A;  1R0B G;  1VOM A;  2K79 A;  2BZY A;  4AFS C;  3OYM A;  2P0K A;  4E7I A;  2K7A A;  3INZ A;  2BUD A;  2M51 A;  5GJV B;  3HRU A;  3CC4 Q;  1M5Q 1;  2RJD A;  2DIG A;  3CCM T;  4IIO A;  4JDS A;  5CQY A;  1W6X A;  3M54 A;  2GBQ A;  4JJC A;  2F2W A;  2DO3 A;  2PNI A;  5LJ3 d;  2XI9 A;  2DE0 X;  4PJO D;  3CBM A;  1Y57 A;  1UGR B;  1X01 A;  1ZA1 B;  4F14 A;  3OS2 A;  4FYV B;  4M7A D;  1SEM A;  3I56 T;  4X1V A;  4DOV A;  3ZBD A;  2KAF A;  4M77 F;  4FYW B;  1VQ6 A;  5GAM e;  2QK0 A;  1OQK A;  3PE0 A;  5KYN A;  2DEQ A;  2LNV A;  5HCK A;  3WVE B;  1JO8 A;  1RAG B;  3X26 B;  4JLI A;  1K9A A;  2XG8 D;  4BI8 B;  2DTH A;  1TUD A;  2JS2 A;  2QTV A;  3G6E Q;  4PJO A;  3RMQ A;  2O4X A;  3A8G B;  4C92 C;  3MP1 A;  1VQ7 T;  2GGR A;  3A5Z B;  4QQ6 A;  4M7A A;  2JT4 A;  2MI6 A;  4BE0 A;  2J6F A;  4ZGD B;  1VQ4 A;  2RI3 A;  5I2M A;  3H41 A;  1PG5 B;  4OMF B;  3MEA A;  2D6F A;  1SG5 A;  1WFW A;  5CO7 A;  4VUB A;  1UGV A;  2E70 A;  2FO0 A;  5CQX A;  4IUQ A;  3VS3 A;  4NS5 A;  1K8A R;  2KR3 A;  1JJ2 S;  5D6Y A;  3SEM A;  3CCS Q;  2KNB B;  2RNA A;  1ABQ A;  2F5K A;  3CC2 T;  3OYA A;  2DL3 A;  4J9H A;  2ROT A;  1OPL A;  1G83 A;  2E64 A;  5FWC A;  3SWN B;  2QGG A;  3PT9 A;  1ZQ1 A;  1K73 R;  2BTT A;  5AYF A;  1BI1 A;  3WXM B;  5LJ5 d;  3KXT A;  1T0H A;  3JCM h;  2FVU A;  1R8O B;  4PFZ A;  1PC0 A;  2E12 A;  2VXF A;  2K9G A;  2J05 A;  3QJ6 A;  3CEY A;  1VQK T;  2GFU A;  2FZK B;  1D3B B;  1AOJ A;  1XNI A;  5I22 A;  1QVG P;  3V8K A;  2CSQ A;  2KYB A;  4CRI A;  3EGD B;  1VQ9 Q;  3ER0 A;  1N5Z A;  3PNW C;  2MYS A;  4BDZ A;  2RQW A;  3R6O A;  1M3B A;  3OYC A;  2DIL A;  1YJW Q;  3CCV A;  1ZUU A;  2LX7 A;  2LJ3 A;  5ECA A;  1M3A A;  1S72 T;  1VUB A;  2YWW A;  2BKD N;  1YJN T;  4AG1 C;  1UUE A;  4FSX A;  2ZZD A;  3RER A;  3UDC A;  2K5F A;  1VQL Q;  5D6X A;  2DL7 A;  1FWZ A;  3OS5 A;  1N8R U;  3QHS A;  4AG2 C;  5CIU A;  1UE9 A;  1AWW A;  2G6F X;  1AWO A;  5J26 A;  3EFR A;  3QZ9 B;  5CAI A;  1OU9 A;  3JCM f;  2FRW A;  1RAB B;  1YWO A;  3CCJ T;  1B07 A;  3M9Q A;  2PVD B;  1OZ2 A;  3OYF A;  4HVV A;  3JV3 A;  2D8H A;  1NLP C;  1JU5 C;  2ED1 A;  2QQR A;  4X34 A;  1Q81 U;  4EPC A;  3VJP A;  1M90 U;  3L2W A;  4RTT A;  4N4H A;  1N9S A;  1KG1 A;  2EKO A;  1BU1 A;  1TWB A;  5KYW B;  3CME T;  3MEV A;  3HRT A;  3X24 B;  3KFV A;  3FJ5 A;  2YUO A;  3BW1 A;  4P5N A;  1VQO T;  2RJC A;  1NBE B;  3JSC A;  5LJ3 h;  4M7D D;  2KI7 A;  3BDL A;  4QQG A;  5GAN g;  2RQU A;  2V8I A;  3JCM P;  1K9M U;  4ORZ A;  1GCQ A;  4C8Q C;  4M78 A;  1N8R C;  3CCL A;  1YWP A;  2XDP A;  1LNX A;  1EZZ B;  1VQM Q;  1KC8 U;  1G3T A;  2LTO A;  1FYN A;  4B9X A;  1GCP A;  2X35 A;  3HPW A;  2CP0 A;  2E41 A;  2AZS A;  1XQH A;  3OYN A;  2FYK A;  2ESW A;  2KBT A;  4IUU A;  3PMT A;  2EFI A;  4M7D A;  5IHN A;  1Q81 C;  1M90 C;  1RAD B;  4C8Q G;  4BDY A;  2Y4Y A;  2F69 A;  2QQB A;  2EGE A;  2O31 A;  3CCM Q;  4PLL A;  3S3O A;  2O01 E;  3FC3 A;  3EGX B;  2J6O A;  2F2V A;  1WXU A;  2IG0 A;  3FRN A;  1NYF A;  1WGS A;  1VQ6 T;  1WZO A;  1JJ2 A;  1G3Y A;  2LJ1 A;  2QEX A;  2ZGW A;  1UB4 A;  4JJB A;  4F7U A;  1KD1 U;  3I56 Q;  1KC8 C;  4M78 F;  1QCO A;  1SHG A;  2YLC A;  2M0Y A;  1M2V A;  2FRY A;  1JRI A;  2MF2 A;  5LJ3 f;  1QVF P;  2DTO A;  4AMC A;  4LDW A;  5CVI A;  4RTZ A;  3KBG A;  5GAO q;  1C1A A;  1IXD A;  1KK7 A;  5GAM g;  2J06 A;  1VQ4 T;  1UG1 A;  2DIQ A;  4FT2 A;  1IHV A;  4A4K A;  5LJ5 h;  3TEE A;  1LPL A;  1FXX A;  4EMK C;  2QG9 B;  1M1K C;  1VQ7 Q;  4N0A A;  2MAM A;  4DBH A;  1GCQ C;  1KHI A;  4PJJ A;  4QKU A;  4Y92 A;  3BFM A;  2CGH A;  1X2Q A;  3JCM b;  1I4K 1;  3ZEH A;  2K3Y A;  2JM8 A;  3DB3 A;  3C0C A;  3FJP A;  5DM7 R;  3L2R A;  4C92 E;  3M0P A;  5GAN d;  1UHC A;  4F7U F;  5C6S A;  4C5G A;  5I11 A;  1ACM B;  4QW2 A;  4A4E A;  1TU0 B;  3CC2 Q;  1X6O A;  3EG0 A;  3NFC A;  2JN0 A;  2QA4 A;  2CP2 A;  1WJS A;  3H0H A;  2LVM A;  3OY9 A;  2QGF B;  4ZGJ B;  3OBW A;  1Q86 R;  1KQS A;  2ZPB B;  1ZHI A;  3GLX A;  2D0N A;  1SRM A;  5KYU A;  2O9S A;  1NPR A;  2W10 A;  2EW3 A;  3A8O B;  2KXD A;  1VQK Q;  2YLB A;  2H3J A;  4E7S A;  4J9G A;  2I0N A;  2RHU A;  3V8J A;  2LZ6 B;  3C95 A;  4J7I A;  1RI0 A;  2EJ9 A;  5LJ5 f;  1UGS B;  2J6K A;  2NLU A;  1OEB A;  2P4R A;  4BY6 B;  2SRC A;  3CCV T;  2KRO A;  2NYS A;  3M53 A;  4JRI A;  2EYY A;  2JJ9 A;  4BB7 A;  3JAM E;  1B7T A;  2DD5 A;  3FEO A;  3G4S A;  3M4G A;  2NUT A;  4PKC C;  3CBP A;  1S72 Q;  2X4J A;  2G3R A;  1WLP B;  4RTU A;  3CPW S;  1YJN Q;  2OAW A;  3M0Q A;  4J6X A;  3EHQ A;  4KUL A;  2EQK A;  3JB9 D;  3VS7 A;  4MDX A;  5GAM d;  2DJZ A;  1I8F A;  1OPK A;  2OTJ A;  2LQ8 A;  3QYG B;  5LJ3 j;  3OSV A;  1RL2 A;  1ZUY A;  2JXB A;  5GAN 7;  4JZ3 A;  2AKL A;  4LXC A;  4M75 C;  1JBM A;  1Y96 B;  2D1X A;  6AT1 B;  2E65 A;  2QQS A;  1IB8 A;  5L8R E;  1I81 A;  3PFS A;  2HQX A;  3CCJ Q;  5EC7 A;  2L3R A;  3X25 B;  4LE9 A;  1X43 A;  2JVV A;  2O9V A;  2KDS A;  4C0Z A;  3OYJ A;  4BI4 A;  4PNO A;  4Z89 A;  4C0G A;  2VKN A;  4LUD A;  2YRV A;  4A4F A;  5J39 A;  2CS7 A;  1CKA A;  1Y71 A;  3CME Q;  4M75 G;  1F1B B;  3M4Y A;  3HFO A;  4RTX A;  3DLL A;  4HXJ A;  3CCL T;  3CCE Q;  3OQ5 A;  1VQO Q;  3M57 A;  2YRC A;  2A36 A;  2P0Q A;  5GAO p;  2LQK A;  3L2Q A;  2CKK A;  3VRZ A;  3CCQ A;  4IKF A;  5HKC A;  3LWI A;  4A63 B;  4D8K A;  4DBF A;  4N4G A;  4M77 D;  4ZN3 A;  4IUR A;  1X6G A;  3VS5 A;  1JXO A;  1K73 U;  3U23 A;  2KYM A;  4FYY B;  5FU6 C;  4C8Q E;  2ZPH B;  3E9F A;  3OB9 A;  4OB2 B;  2NUZ A;  2CT4 A;  5KYX B;  1K0X A;  1YN8 A;  1V1C A;  5GAN 4;  5FU7 C;  4DA4 A;  3H6Z A;  5LJ5 j;  2PVO B;  1KQ2 A;  2RI5 A;  1WJQ A;  1IGQ A;  2AT1 B;  1PD0 A;  2EQM A;  3J7A F;  4J83 A;  3SD4 A;  2QEX T;  2X4W A;  2EGC A;  3H0I A;  2CZ7 B;  3KUF A;  4IIM A;  4WTO B;  2V8K A;  3VYG A;  5GAN h;  1U8R A;  4C5H A;  2OTL A;  4E7L A;  1YNZ A;  4LNP A;  2HMA A;  1JEG A;  2FHD A;  4MML A;  2XHC A;  1RAI B;  3CXC S;  1SSF A;  1K73 C;  4C0D B;  1QW1 A;  3CPF A;  1JB0 E;  3J80 E;  1IHW A;  4A54 A;  2VV5 A;  1VQ4 Q;  3H8Z A;  3BY7 A;  1SSH A;  3OYB A;  2KRN A;  5DLQ E;  3X20 B;  5CKD A;  1D3B A;  5KYY A;  1UGQ B;  3UF4 A;  4Z02 A;  5A2Q E;  2XIC A;  2YT6 A;  1K1Z A;  3EGD A;  4J5Y A;  3EFO B;  4OP0 A;  4JS4 A;  4XTW A;  2K5I A;  4AFQ C;  1Q7Y R;  2XK0 A;  2XDD A;  1N9R A;  2EVR A;  2QA4 T;  4Y28 E;  2RB6 A;  3RDV A;  1SHF A;  3CPW A;  5FWB A;  3JCM V;  3VUZ A;  3ASK A;  4J6W A;  2FG0 A;  3NPF A;  1YJ9 A;  4OGC A;  1GFC A;  4EMH A;  5GAN f;  4E2F B;  7AT1 B;  1UGP B;  2MK5 A;  3HHT B;  3L42 A;  4ELY C;  3DKM A;  3RR6 A;  1UEC A;  3OW2 A;  5GAM h;  1Y07 A;  3CCU A;  2VYT A;  4M77 C;  4JS5 A;  1SKU B;  1AZE A;  2DK3 A;  4Q5W A;  4RTW A;  4FIB A;  5KCO A;  2MPX C;  4ELZ C;  1KSW A;  2CH4 W;  4GLK A;  2ZPG B;  5GMK e;  3JB9 I;  4XQ3 A;  1PRM C;  5HY6 A;  1NEG A;  2DRM A;  5A0G A;  2MMP A;  2DXB A;  3WVD B;  3G4S T;  3JCM W;  3MKD A;  2HBP A;  2FL7 A;  3CCV Q;  2F1L A;  4C92 G;  2K5L A;  4M4Z A;  3GNF B;  5KYW A;  3RES A;  1A0N B;  2RA2 A;  4LD6 A;  3NTI A;  4B6M A;  2FB7 A;  4C92 B;  4LD9 K;  1D1B A;  2EAY A;  1B34 A;  2GCX A;  4RCC A;  2OTJ T;  2OX7 A;  4Z8A A;  1YHQ A;  2L0A A;  5A0L A;  1H64 1;  2ECZ A;  4ESR A;  3EH2 A;  2DNU A;  2FPD A;  1MMD A;  5GAN 6;  8ATC B;  4BE2 A;  3L2V A;  2M1H A;  4NOY A;  4J8O A;  1D0Z A;  2EYW A;  2AHJ B;  1DJ7 B;  2FEI A;  4UC4 A;  2PUO B;  2LP5 A;  1KJW A;  3VS0 A;  3QDF A;  3LH5 A;  1Z9Z A;  5GAM f;  1U3O A;  2X4X A;  3QXE B;  1WHH A;  1ARK A;  4PJO C;  3EG3 A;  1E6G A;  2ZPI B;  4XTY A;  4N4I A;  4HA8 A;  1X6B A;  2MCN A;  1GL5 A;  4M75 E;  4M7A C;  2RHX A;  3NGP A;  2GQV A;  4HCZ A;  1LJO A;  4GY5 A;  3CMA A;  2CT3 A;  4TVR A;  2OI3 A;  3EGX A;  1RAF B;  3M0R A;  1BCO A;  1Q82 R;  4CC7 A;  1D09 B;  3QG1 A;  4KGZ B;  2JW4 A;  3CCL Q;  4QQD A;  2GTJ A;  2E4H A;  1W1F A;  1W4S A;  3CCQ T;  1WHK A;  4PJO G;  2D9T A;  5IH2 A;  2DYB A;  1BIB A;  1YCS B;  4F04 B;  4M7A G;  3REA B;  3OYI A;  1ABO A;  1WI7 A;  3PVL A;  1AWJ A;  1OU8 A;  4FW1 A;  5GAN j;  2XU8 A;  1SF9 A;  2L3P A;  4M78 D;  3L2U A;  2F2X A;  2DKG A;  1PCX A;  2YUP A;  2VC8 A;  1LVK A;  3E2U A;  1IZ6 A;  2COZ A;  3JCM J;  1MMN A;  4FW2 A;  5IT9 E;  2PZ1 A;  2JM9 A;  2QXF A;  3A8M B;  1OYX A;  2LC4 A;  3M0S A;  4C8Q F;  5CK9 A;  2KXC A;  2RN8 A;  2P0P A;  1RI9 A;  5IN1 A;  2CYZ B;  2V1R A;  4KT0 E;  2QEX Q;  2RHZ A;  3P8D A;  1QLY A;  4Z88 A;  2XKO C;  2VWF A;  3S3M A;  1HSQ A;  2OTL T;  1W2B P;  5GMK i;  4RG8 A;  1XJW B;  1U1T A;  5HK0 A;  2DX1 A;  2KE9 A;  4R0K A;  5I2S A;  1YFN A;  4BUG A;  3C12 A;  2QDL A;  2QAS A;  3EG1 A;  3M0T A;  1VYT A;  3JRZ A;  3QPH A;  1WNL A;  1O75 A;  2BZ8 A;  2M02 A;  1QVG S;  1KQ1 A;  1QWF A;  2A3L A;  1VQN A;  2XMF A;  4MMK A;  4A53 A;  1EFN A;  3OS1 A;  3TSW A;  2RMO A;  1M1K U;  3QDR B;  3A98 A;  3P8B B;  3CD6 A;  2JMC A;  4CC4 B;  4KRT A;  2DJQ A;  2LMJ A;  4PLI A;  3OYH A;  4ZN1 A;  5GAM j;  4J9E A;  1M8M A;  1NJI R;  4C8Q B;  4RCB A;  4E47 A;  3GP8 A;  1GBQ A;  3GF5 A;  2CUB A;  4JPB W;  1MMA A;  1RAC B;  3M59 A;  1ZSZ A;  4MZM A;  4HKE A;  2K2V A;  4BD3 A;  2JUF A;  3TU4 K;  2CDT A;  2CZ1 B;  2QA4 Q;  4XU0 A;  4XU1 A;  3G71 A;  1YJ9 T;  2SEM A;  2DXU A;  2QQA A;  4L5G A;  3HL8 A;  4PJL A;  3RBB B;  2DLP A;  2D0Q B;  4ATO A;  1NM7 A;  1VQP A;  1MHN A;  1UFF A;  4OB1 B;  3CCU T;  4XK8 E;  4QVD A;  2IVW A;  4LN2 A;  5FRO A;  4L6V 5;  2HZY A;  1YCY A;  1M3C A;  1YI2 A;  2KMT A;  4WCI A;  3JB9 H;  2LQN A;  3GBQ A;  2RD1 A;  1IRX A;  2KVQ G;  4FSS A;  1Y96 A;  2V8J A;  2JNG A;  4M78 C;  3CCR A;  1IGU A;  3CC7 A;  3GIB A;  3QYH B;  2DVE A;  2DXC A;  4B9W A;  3OW2 P;  3RKW A;  4LDX A;  2A28 A;  2CRE A;  2DZC A;  2LNH B;  1U06 A;  3G4S Q;  2ATC B;  4M77 E;  2K2M A;  2OAU A;  1M9S A;  4WF2 A;  1OI1 A;  4M7D C;  3UA6 A;  4XU3 A;  3QSU A;  1BI2 A;  2DMO A;  1YHQ T;  3A8H B;  5FRM A;  4ZTJ A;  4OMM A;  3AT1 B;  4AFZ C;  2DAQ A;  4EMK B;  5GAN 2;  2OTJ Q;  2KY9 A;  3TCJ A;  1QVP A;  3HFN A;  2DL4 A;  4C5E A;  3CBO A;  1ZBJ A;  2DRK A;  2DZ9 A;  2C0T A;  2EYX A;  3FIF A;  1WPY A;  4O5V A;  1ZSZ C;  1XTD A;  4M7D G;  2QQ9 A;  2KK4 A;  3NTK A;  1ZLM A;  1MV0 B;  3E9G A;  2X4Y A;  3NTH A;  1ZSG A;  3X28 B;  1M90 R;  4M7D B;  2YRD A;  2ABL A;  3PGG A;  5KYX A;  2HD0 A;  4E7K A;  2CP3 A;  4FU6 A;  3OYE A;  1NPP A;  2GTO A;  3E19 A;  3CMA T;  2LJ0 A;  3ME9 A;  4ZNX A;  3V7C A;  1G3W A;  1N27 A;  5GAO l;  2O2O A;  3TQ7 P;  4F7U G;  4N0A C;  1WA7 A;  2DPP B;  4OMQ A;  3UA7 A;  1K9M R;  1GFD A;  1E7O A;  1TXQ A;  4IUT A;  1WJR A;  1QVF S;  2E5Q A;  2ED0 A;  1KC8 R;  1WXT A;  5D7U A;  2NUP B;  1MV3 A;  4RTY A;  4PJO E;  4GBQ A;  5IXF A;  2RHI A;  1ZUK A;  1PNJ A;  1H8K A;  4M7A E;  2R5A A;  2QDY B;  3CCQ Q;  4DEY A;  1PM3 A;  4JLG A;  2K6D A;  4JRQ A;  4PFO A;  2HAX A;  2Y90 A;  2PU9 B;  4BI3 A;  3L1A A;  1QVG A;  2EYZ A;  5DLO A;  1CKB A;  1Y7X A;  4KBM B;  2B8A A;  3O5Z A;  2VAS A;  1V29 B;  3FDR A;  4D6W A;  3JCM c;  3UPU A;  3OYD A;  1TOV A;  2ZPF B;  1O9S A;  3M55 A;  5LL6 S;  3UAT A;  2KT8 A;  1I07 A;  3LGL A;  3EAE A;  1S1N A;  2LT1 A;  3FLG A;  3QKJ A;  2IPO B;  4J9D A;  2MIO A;  1KD1 R;  3HSB A;  3A8L B;  3OMC A;  2WSC E;  3EG9 B;  3QZ5 B;  4M75 B;  1K8A U;  1OZ3 A;  2E1H A;  2VVK A;  2RO0 A;  1Q7Y C;  2OTL Q;  1C0M A;  2QAZ A;  2C0I A;  2L89 A;  5IXB A;  1SRL A;  1U1S A;  2R57 A;  3MET A;  1XOV A;  2YSQ A;  1VQN T;  3P8H A;  3V8L A;  4JJD A;  3I9Q A;  1OUL A;  4FT4 A;  3SDZ A;  5KYU B;  1Q95 G;  5GAO m;  2HL3 A;  2DL5 A;  3FB9 A;  3MO8 A;  4GLM A;  3CD6 T;  1PRL C;  2AK5 A;  2E6Z A;  1T0J A;  3NMZ C;  2JZ2 A;  4II1 A;  4CI0 C;  3Q1J A;  3LW5 E;  4ME7 A;  3HTR A;  2HL5 C;  5KE3 A;  2LDM A;  1NZ9 A;  2X51 A;  2H8H A;  2DA9 A;  3MP6 A;  4A4G A;  3EH1 A;  2BE7 D;  2CH4 A;  5M9O A;  5KCH A;  2VGM A;  1RAH B;  1VQ6 Q;  1MGQ A;  2K3B A;  3G7Z A;  2HKN A;  1K8A C;  2DD4 A;  2RM4 A;  2CP5 A;  1WQW A;  4OML A;  5KH6 A;  3G71 T;  3QWX X;  2OJ2 A;  4OB0 B;  3DB4 A;  1ZBX A;  1UJY A;  3I55 A;  3F70 A;  3HKS A;  2EBP A;  1JJ2 P;  5FU6 B;  1VQP T;  3SWN A;  1VQ5 A;  3PVQ A;  1YJ9 Q;  2BZX A;  2E5K A;  2IIM A;  3OYL A;  3C4S A;  1Q82 U;  1YI2 T;  1VQ8 A;  2C0O A;  1AD5 A;  1D1C A;  2RQR A;  2EQJ A;  5FU7 B;  4C0F A;  3CCU Q;  3CCR T;  4QT7 A;  4Y91 A;  3CC7 T;  1OX8 A;  1FMW A;  3TVT A;  2R58 A;  3PIO A;  3JB9 G;  4X9D A;  1YIJ A;  4ZTF A;  2W0Z A;  1YIT A;  1G8X A;  2EQI A;  3QUI A;  9ATC B;  5CKB A;  4HCB A;  1M4Z A;  2EJG A;  2DYI A;  2KSS A;  1TTH B;  4MDW A;  4E7H A;  2HNI A;  4M78 E;  2PUK B;  3OYG A;  1NG2 A;  1EX4 A;  1I5L A;  2CZ6 B;  5GAO r;  5EG2 A;  1PSE A;  4HVW A;  4C92 F;  2EIF A;  1OX9 A;  3QII A;  5CKE A;  1BKB A;  1HJD A;  3HP9 A;  1Q82 C;  4EDU A;  1V76 A;  2QI2 A;  1YHQ Q;  2C06 A;  1QVF A;  4F17 A;  2EWN A;  2L8D A;  4IUV A;  3VS6 A;  4FCY A;  3BE3 A;  1MNE A;  1NE8 A;  1TUG B;  4M7D E;  4KUD K;  2CSI A;  2ZCF B;  4OB3 B;  4V2S A;  2DBM A;  3IQL A;  1KQS P;  3OSS C;  3S3N A;  1QKX A;  3OYY A;  2PVG B;  2GF7 A;  1VYU A;  1IO6 A;  2RF0 A;  2E6N A;  4BAC A;  1M1F A;  3JCM X;  4MZP A;  1EIF A;  1M27 C;  3SWN C;  1TUC A;  2XDB A;  1G3S A;  3PMI A;  3QJY A;  2HSE B;  3CC4 A;  3VS1 A;  2LCC A;  3CQT A;  5IHI A;  4F7U E;  2J7I A;  1WHJ A;  3CMA Q;  3H9N A;  4M77 G;  3JCM e;  1UJ0 A;  4AT1 B;  1YBY A;  2EYQ A;  1NJI U;  4PL6 A;  5GMK h;  3NHN A;  4M77 B;  2F5T X;  4XTX A;  2E3I A;  3REB B;  4HVU A;  3TSZ A;  2ROL A;  3RKY A;  1E6H A;  1AT1 B;  3E1S A;  1R77 A;  5KE2 A;  1K76 A; 
#chains in the Genus database with same CATH homology
 3CCV T;  3OS1 A;  3M53 A;  4C8Q D;  4LDV A;  4JRI A;  1BI0 A;  1M1K U;  4BB7 A;  3QDR B;  3JAM E;  3L2Z A;  2I2L A;  2DD5 A;  3P8B B;  4M77 A;  3FEO A;  4L59 A;  3CCE A;  3CD6 A;  3G4S A;  3M4G A;  4LDU A;  1VQM T;  1VQO A;  2LCL A;  4PKC C;  4PJO F;  4PLI A;  3G6E A;  2VXE A;  4ZN1 A;  4O6J A;  5GAM j;  4XTZ A;  2LRQ A;  3OYH A;  3CBP A;  2L5Q A;  2EJF A;  4C8Q B;  3OA6 A;  4R55 A;  1FX7 A;  1TH7 A;  2X4J A;  4RCB A;  4M7A F;  2G3R A;  4E47 A;  3GP8 A;  3BDU A;  3CPW S;  3GF5 A;  4RKU E;  1VIE A;  3JB9 J;  2LT4 A;  3UT1 A;  4J6X A;  4KUL A;  2KQW A;  3M59 A;  3T9N A;  3MEW A;  4MZM A;  2RH2 A;  2EQK A;  2GFA A;  4HKE A;  3JB9 D;  3O8V A;  5FRN A;  2A7Y A;  5LJ5 g;  2K2V A;  2P4T A;  5GAM d;  2DJZ A;  1I8F A;  4MDX A;  2OTJ A;  4BD3 A;  3OYM A;  2P0K A;  4E7I A;  3INZ A;  2JUF A;  2LQ8 A;  3QYG B;  4C8Q A;  3TU4 K;  2CZ1 B;  2BUD A;  4XU0 A;  5LJ3 j;  4XU1 A;  3G71 A;  3OSV A;  1P92 A;  1YJ9 T;  1NJI C;  3HRU A;  1RL2 A;  2DXU A;  2QQA A;  4L5G A;  1M5Q 1;  3HL8 A;  5GAN 7;  2JTM A;  2RJD A;  4M75 C;  3DLM A;  1JBM A;  1Y96 B;  2DIG A;  3LGF A;  3CCM T;  2D0Q B;  2E65 A;  2QQS A;  4JDS A;  4ATO A;  5L8R E;  5CQY A;  1VQP A;  1MHN A;  3M54 A;  5D6W A;  3GOX A;  1I81 A;  4OB1 B;  3CCS A;  3CCU T;  4XK8 E;  2DO3 A;  4QVD A;  3PFS A;  2HQX A;  2IVW A;  5FRO A;  2L3R A;  4L6V 5;  5LJ3 d;  1YCY A;  2XI9 A;  3X25 B;  3PIP A;  4PJO D;  1YI2 A;  3CBM A;  1UGR B;  1X01 A;  2KMT A;  5HK3 A;  2JVV A;  3JB9 H;  2KDS A;  2RD1 A;  3OS2 A;  2KVQ G;  4C0Z A;  3OYJ A;  4M7A D;  3I56 T;  3CXC A;  1GXI E;  4DOV A;  1Y96 A;  2V8J A;  2JNG A;  2KAF A;  3MP8 A;  4M78 C;  4PNO A;  2E10 A;  2K4Y A;  4M77 F;  4BI4 A;  3CCR A;  1AHJ B;  4PJO B;  1VQ6 A;  4C0G A;  5GAM e;  5GMK l;  3CC7 A;  2O4X B;  2YRV A;  1KQS S;  4A4F A;  3GIB A;  5J39 A;  2CS7 A;  3QYH B;  2DVE A;  1Y71 A;  2DXC A;  3N5B B;  4B9W A;  2DEQ A;  3J81 E;  1Q86 U;  4M75 G;  4M7A B;  3RKW A;  2LNV A;  3WVE B;  4ZGE B;  4LDX A;  3M4Y A;  3X26 B;  3HFO A;  4JLI A;  3DLL A;  1KQ2 A;  2DZC A;  2XG8 D;  4BI8 B;  3CCL T;  2DTH A;  3OQ5 A;  3M57 A;  4XAX B;  4J6Y A;  4M77 E;  5CKH A;  2OAU A;  2M16 A;  3GNG A;  3RMQ A;  1M9S A;  4WF2 A;  4PJO A;  1OI1 A;  4M7D C;  2O4X A;  3A8G B;  2P0Q A;  5LJ3 e;  5GAO p;  4C92 C;  2LQK A;  2ZPE B;  3MP1 A;  1VQ7 T;  3A5Z B;  3C94 A;  4XU3 A;  4QQ6 A;  4M7A A;  2MI6 A;  3QSU A;  1BI2 A;  3L2Q A;  4BE0 A;  1M1G A;  2CKK A;  1YHQ T;  3A8H B;  4ZGD B;  4ZTJ A;  1VQ4 A;  2RI3 A;  1VQ9 A;  5FRM A;  5I2M A;  2DAQ A;  4EMK B;  3CCQ A;  4IKF A;  5HKC A;  2RK1 A;  4OMF B;  5GAN 2;  2JTF A;  3QO3 A;  3MEA A;  3LWI A;  2D6F A;  3I55 T;  1BIA A;  1YJW A;  2KY9 A;  4N4G A;  4M77 D;  4ZN3 A;  3TCJ A;  4IUR A;  1QVP A;  5CO7 A;  3HFN A;  1K73 U;  1VQ5 T;  4C5E A;  4VUB A;  3CBO A;  5FU6 C;  4C8Q E;  3MEU A;  3VV0 A;  2ZPH B;  3E9F A;  2DZ9 A;  3OB9 A;  4OB2 B;  3FIF A;  2E70 A;  1VQ8 T;  3CCE T;  1B34 B;  1WPY A;  4O5V A;  5CQX A;  1XTD A;  4IUQ A;  4EMK A;  4NS5 A;  2QQ9 A;  4XTV A;  4M7D G;  1JJ2 S;  2KK4 A;  2RHY A;  5D6Y A;  5GAN 4;  1VQL A;  3NTK A;  4BE1 A;  3JCM W;  5FU7 C;  4DA4 A;  3H6Z A;  5LJ5 j;  2PVO B;  2F5K A;  1PSF A;  3V7R A;  2RI5 A;  1Q86 C;  3CC2 T;  3E9G A;  2X4Y A;  1WJQ A;  3OYA A;  3NTH A;  3X28 B;  2EQM A;  3J7A F;  4J83 A;  4M7D B;  3SD4 A;  3ZFJ A;  2QEX T;  2X4W A;  3PGG A;  5J3B A;  4E7K A;  2HD0 A;  2E64 A;  3SWN B;  3LYI A;  4FU6 A;  4R56 A;  3OYE A;  1YIJ T;  1NPP A;  3SB2 A;  3PT9 A;  3E19 A;  1ZQ1 A;  2CZ7 B;  2Y4X A;  3KUF A;  5AYF A;  1BI1 A;  3WXM B;  5LJ5 d;  1YIT T;  3KXT A;  3CMA T;  3JCM h;  3HRS A;  3ME9 A;  3V7C A;  2FVU A;  2V8K A;  1G3W A;  1R8O B;  1N27 A;  4HCC A;  3MHX A;  1QP3 A;  3VYG A;  5GAO l;  5GAN h;  3PTA A;  1U8R A;  2E12 A;  4DQ2 A;  4C5H A;  4F7U G;  2OTL A;  2VXF A;  2R5M A;  4N0A C;  3UWN A;  3QJ6 A;  3CEY A;  1VQK T;  4E7L A;  2DPP B;  2GFU A;  2FHD A;  1D3B B;  4IUT A;  2XHC A;  4MML A;  1XNI A;  1WJR A;  1QVF S;  2E5Q A;  3CXC S;  1SSF A;  3V8K A;  1K73 C;  4C0D B;  5I21 A;  4PJO E;  1VQO T;  1QW1 A;  3CPF A;  4CRI A;  1JB0 E;  4OF1 A;  2RHI A;  5GMK m;  3J80 E;  4A54 A;  2VV5 A;  3ER0 A;  3BY7 A;  3H8Z A;  3OYB A;  4M7A E;  2R5A A;  2QDY B;  1N6A A;  3PNW C;  4BDZ A;  5DLQ E;  3R6O A;  4XU2 A;  3RUX A;  3RMS A;  3X20 B;  5CKD A;  1K9M C;  1D3B A;  4JLG A;  3OYC A;  1UGQ B;  4JRQ A;  3CCV A;  4Z02 A;  2Y90 A;  5LJ5 e;  5A2Q E;  2HAX A;  2XIC A;  2PU9 B;  4BI3 A;  1IRE B;  3L1A A;  2K57 A;  1QVG A;  4LDY A;  1S72 T;  1VUB A;  2BKD N;  5DLO A;  4J5Y A;  1Y7X A;  4KBM B;  2WAC A;  1YJN T;  2B8A A;  1VQM A;  2JOY A;  5CKF A;  3LH0 A;  3S6W A;  5GMK j;  4JJN K;  1V29 B;  4OP0 A;  4FSX A;  2ZZD A;  3FDR A;  4JS4 A;  4D6W A;  3JCM c;  2DTI A;  3RER A;  3UPU A;  2YHT A;  5FLX E;  3M58 A;  4XTW A;  3UDC A;  5C0M A;  2K5F A;  3OYD A;  2K5I A;  2ZPF B;  1O9S A;  3M55 A;  4XTU A;  5D6X A;  4C5I A;  5LL6 S;  1FWZ A;  2XK0 A;  2XDD A;  1N9R A;  3LGL A;  3OS5 A;  2QA4 T;  3EAE A;  3SFM A;  3CC4 T;  2LT1 A;  3FLG A;  3RIR A;  1N8R U;  3RKX A;  3QKJ A;  4M75 D;  3QHS A;  4Y28 E;  2RB6 A;  5CIU A;  4M7D F;  3CPW A;  3HSB A;  5J26 A;  3JCM V;  3VUZ A;  3A8L B;  3EFR A;  3ASK A;  3QZ9 B;  4J6W A;  3OMC A;  5CAI A;  3JCM f;  2WSC E;  1YJ9 A;  4OGC A;  3CCJ T;  3M9Q A;  4EMH A;  3QZ5 B;  2PVD B;  4M75 B;  1OZ2 A;  5GAN f;  3OYF A;  1K8A U;  3LWH A;  1OZ3 A;  3CCM A;  2E1H A;  2RO0 A;  1W2B S;  3VUB A;  1UGP B;  3ZBD A;  3HHT B;  3L42 A;  4ELY C;  1Q7Y C;  3DKM A;  4HT8 A;  2PQW A;  4M78 G;  3OW2 A;  2L89 A;  5GAM h;  1Y07 A;  3CCU A;  2QQR A;  3G4S T;  4JRK A;  1U1S A;  2R57 A;  2CZ0 B;  2VYT A;  1XOV A;  3MET A;  4M77 C;  4X34 A;  4JS5 A;  1Q81 U;  4EPC A;  3VJP A;  5A0D A;  3L2W A;  1M90 U;  2DK3 A;  1KD1 C;  1G5V A;  2EQU A;  1X75 C;  4N4H A;  4Q5W A;  1N9S A;  1KG1 A;  1VQN T;  2EKO A;  3P8H A;  3V8L A;  4FIB A;  4M75 A;  5KCO A;  4M78 B;  4ELZ C;  3CME T;  3MEV A;  3OYK A;  3I56 A;  3HRT A;  4FT4 A;  3SDZ A;  3X24 B;  4BY6 C;  4GLK A;  2ZPG B;  5GMK e;  3JB9 I;  4XQ3 A;  2XID A;  5HY6 A;  5GAO m;  2LX9 A;  3BW1 A;  3M5A A;  3FB9 A;  3MO8 A;  5A0G A;  3CD6 T;  2MMP A;  2DXB A;  4P5N A;  3MCA B;  3WVD B;  3OMG A;  2RJC A;  3QBY A;  3JSC A;  3JCM g;  5GAO n;  5LJ3 h;  4M7D D;  2MWP A;  2E6Z A;  2HBP A;  3BDL A;  2FL7 A;  3G6E T;  4II1 A;  2JZ2 A;  4QQG A;  4C92 G;  5GAN g;  4CI0 C;  2V8I A;  3JCM P;  1WQ7 A;  2K5L A;  1K9M U;  5CCA A;  4RMO A;  4E7J A;  3Q1J A;  3GNF B;  4C8Q C;  4M78 A;  2VUB A;  3LW5 E;  4ME7 A;  1N8R C;  3RES A;  3URG A;  3CCL A;  2XDP A;  1LNX A;  2RA2 A;  4LD6 A;  2LDM A;  5KE3 A;  4QVC A;  3NTI A;  1KC8 U;  1NZ9 A;  2FB7 A;  3MP6 A;  1G3T A;  2LTO A;  4A4G A;  4B9X A;  4C92 B;  4LD9 K;  3TRE A;  2EAY A;  1B34 A;  5IAY A;  5M9O A;  2X35 A;  5KCH A;  1VQ7 A;  2VGM A;  4X9C A;  2GCX A;  4RCC A;  3HPW A;  2OTJ T;  2WSE E;  2E41 A;  1MGQ A;  1XQH A;  3G7Z A;  3OYN A;  1K8A C;  1YHQ A;  2DD4 A;  2RJF A;  1QP2 A;  2RM4 A;  2FYK A;  5A0L A;  2QTX A;  1WQW A;  4FM4 B;  5KH6 A;  1H64 1;  3G71 T;  4OB0 B;  3DB4 A;  5GAN 6;  4IUU A;  1ZBX A;  4BE2 A;  3PMT A;  2EFI A;  4HT9 A;  4M7D A;  3I55 A;  3F70 A;  3HKS A;  1Q81 C;  1M90 C;  3L2V A;  2M1H A;  5GAN 5;  5FU6 B;  1VQP T;  3SWN A;  4C8Q G;  1VQ5 A;  4NOY A;  3CCS T;  4J8O A;  4BDY A;  2Y4Y A;  2F69 A;  2QQB A;  2AHJ B;  2M0O A;  5GAN 3;  4F7U B;  1DJ7 B;  4UC4 A;  3C4S A;  3OYL A;  1Q82 U;  3OBY A;  1YI2 T;  1VQ8 A;  2PUO B;  4M75 F;  4PLL A;  4QVZ A;  4YTL A;  4DOW A;  4JRP A;  2RK2 A;  2EQJ A;  5FU7 B;  2O01 E;  5GAM f;  4C0F A;  3FC3 A;  3S3O A;  1Q7Y U;  3CCR T;  2X4X A;  2IG0 A;  3QXE B;  3CC2 A;  2RJE A;  3FRN A;  4NL3 A;  1M8V A;  1WGS A;  1VQ6 T;  4Y91 A;  1JJ2 A;  3CC7 T;  4PJO C;  1G3Y A;  2ZPI B;  4XTY A;  4N4I A;  2QEX A;  2ZGW A;  1UB4 A;  4HA8 A;  4F7U A;  2HQE A;  2R58 A;  3PIO A;  1KD1 U;  3JB9 G;  4X9D A;  1KC8 C;  1YIJ A;  4M75 E;  4M78 F;  4M7A C;  4ZTF A;  2RHX A;  2YLC A;  2WSF E;  2GQV A;  4HCZ A;  4A4H A;  1LJO A;  4GY5 A;  1YIT A;  3CMA A;  3QUI A;  4TVR A;  1JRI A;  2MF2 A;  5CKB A;  5LJ3 f;  2BIV A;  3OW2 S;  2DTO A;  4HCB A;  1M4Z A;  4LDW A;  5CVI A;  2EJG A;  3KBG A;  1VQK A;  2KSS A;  5GAO q;  3QG1 A;  4MDW A;  4E7H A;  3M56 A;  1H3Z A;  2HNI A;  2XD0 A;  2VGN A;  4QQD A;  5GAM g;  4M78 E;  2PUK B;  1VQ4 T;  1VQ9 T;  3LLR A;  3OYG A;  2DIQ A;  4FT2 A;  1I5L A;  4A4K A;  2CZ6 B;  1W4S A;  3CCQ T;  4PJO G;  5LJ5 h;  2D9T A;  3TEE A;  5GAO r;  1FXX A;  3V7S A;  5EG2 A;  4EMK C;  1PSE A;  4FL6 A;  1M1K C;  1BIB A;  4JUV A;  4C92 F;  2EIF A;  5CR2 A;  3QII A;  4N0A A;  2MAM A;  1BKB A;  5CKE A;  1YJW T;  3HP9 A;  1Q82 C;  4EDU A;  1QVF A;  2QI2 A;  2C06 A;  4M7A G;  1VIF A;  1KHI A;  3JCM Q;  3VKI A;  3OYI A;  3BFM A;  5GAN j;  2CGH A;  2EWN A;  4MZT A;  2L8D A;  4IUV A;  2DXT A;  4OVA A;  2XU8 A;  3JCM b;  4IUP A;  5LJ3 g;  1I4K 1;  4M78 D;  3ZEH A;  2K3Y A;  1HXD A;  1NE8 A;  2K3X A;  3DB3 A;  3L2U A;  4M7D E;  1KHC A;  4KUD K;  3JCM d;  1S72 A;  1VQL T;  3FJP A;  5DM7 R;  2ZCF B;  2RI2 A;  2DKG A;  4OB3 B;  4C92 E;  3L2R A;  4V2S A;  2VC8 A;  1YJN A;  5GAN d;  3OSS C;  3S3N A;  4F7U F;  4OGE A;  5C6S A;  1IZ6 A;  3OYY A;  3JCM J;  4C5G A;  2PVG B;  2GF7 A;  5IT9 E;  3GPL A;  2QXF A;  3A8M B;  2E6N A;  4QW2 A;  1M1F A;  1OYX A;  4C92 A;  3JCM X;  2LC4 A;  4MZP A;  4A4E A;  4BAC A;  1UEB A;  4C8Q F;  1EIF A;  3SWN C;  1BI3 A;  2XDB A;  1G3S A;  1X6O A;  3NFC A;  3EFS A;  3PMI A;  5CK9 A;  2JN0 A;  2QA4 A;  3QJY A;  2P0P A;  3CC4 A;  1WJS A;  5IN1 A;  2CYZ B;  4KT0 E;  2LVM A;  3OY9 A;  2LCC A;  2RHZ A;  3P8D A;  4ZGJ B;  4C92 D;  2XKO C;  2MWO A;  5GAN 8;  3S3M A;  3OBW A;  5DY9 A;  1KQS A;  2OTL T;  4F7U E;  5GMK i;  2ZPB B;  4RG8 A;  1BYM A;  1ZHI A;  3GLX A;  4M77 G;  1U1T A;  3VU3 C;  5HK0 A;  3CCJ A;  3AHU A;  4EMG A;  1NPR A;  3JCM e;  3A8O B;  5I2S A;  4RG2 A;  1YBY A;  4KUI A;  3C12 A;  3VYH B;  2EYQ A;  2YLB A;  4BUG A;  1NJI U;  4PL6 A;  5GMK h;  3JB9 F;  2H3J A;  5GAN e;  4C0D C;  2RHU A;  1LOJ A;  4M77 B;  2F5T X;  4J7F A;  4NL2 A;  3V8J A;  3OS0 A;  3C95 A;  4XTX A;  4J7I A;  1RI0 A;  3JRZ A;  3QPH A;  1WNL A;  1HK9 A;  1O75 A;  1W2B A;  3RKY A;  2EJ9 A;  5LJ5 f;  1QVG S;  1KQ1 A;  3E1S A;  2A3L A;  3LX7 A;  1VQN A;  1UGS B;  2NLU A;  5KE2 A;  2M9U A;  4MMK A;  4A53 A;  3CME A;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...