3NFFB

Crystal structure of extended dimerization module of rna polymerase i subcomplex a49/a34.5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
115
structure length
110
Chain Sequence
YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSKKETLKVATSKSVYFDRVFTISET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase I subunit A49
publication title RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Transcription
total genus 9
structure length 110
sequence length 115
chains with identical sequence D, F, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.140 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nffB00
3NFGB 3NFFB
chains in the Genus database with same CATH superfamily
3ZSGA 4U6RA 5FQDC 2PZIA 2UZLA 2W05A 3I1AA 2WMUA 2F9GA 4JQ7A 4XV2A 5JFXA 4QMUA 3AC1A 5HE2A 5LVMA 3QRKA 2HW7A 5EYKA 3VIDA 5GIPE 3RI1A 5AUZA 4USDA 3OVVA 3O8UA 2HENA 2VTLA 5AV1A 3EHAA 3KMUA 2XBAA 2XEYA 3PXZA 4PNKA 5IA1A 1FMKA 5HEZA 3FY0A 1H27A 5HG7A 3O96A 3CXWA 2BZKB 3ORNA 3JUHA 4Z7GA 2QOLA 2Y4IC 2C5NA 4BDEA 5IQDA 3PFYA 1ZARA 3K54A 2B54A 3D5WA 4GYIA 3R6XA 5I9UA 1PKDA 4RFMA 5ETAA 1ZYSA 2C6MA 2RFNA 4MQ1A 4LL0A 2QHNA 3F2NA 3OUNB 3N4UA 4ZTRA 4EUUA 5FDPA 3C51A 4ZOGA 2QOCA 1BKXA 2X9EA 4FG7A 4PTCA 5K3YA 3FKNA 3PXFA 3V8WA 3ANQA 4EH7A 3FLNC 5J7HA 4M67A 3FPMA 2X9FA 4HGSA 4BDCA 1IRKA 3LCSA 1Q41A 4IB0A 2XKEA 4AE9A 4WNPA 4BCHA 2ZV9A 4XUFA 4RPVA 5LVOA 2ZAZA 4FOCA 4PY1A 3U6JA 3MVHA 3DBCA 2GHGA 3KXHA 2OIBA 5D7AA 4HVGA 2PE0A 3ZRLA 3I6WA 4XJ0A 2J0MB 3SLSA 5JGBA 3OXIA 3CP9A 3TJCA 5AV4A 3NRMA 3TV6A 5CANA 1WBTA 3ACKA 3ULIA 2Y4IB 4ANBA 5HESA 3AC5A 4LFIA 2X2MA 5FD2A 5DR2A 4X2KA 3LHJA 4GS6A 3TKHA 3C0HA 4ARKA 4DFLA 3FLZA 1JNKA 4FSMA 4N4SA 1G8SA 4G5PA 2WQOA 2WFYA 4BZOA 2EU9A 4K77A 4ZTSA 2CHLA 4BICA 2JIVA 3LMHA 4TYGA 3WZDA 4PL4A 3EIDA 4U45A 4BCQA 3GUBA 4B8MA 3QALE 5HKMA 3SAYA 4TT7A 2RFEA 1OKZA 4LOQA 2FSLX 2ZFYA 3NVMB 4RX8A 2PZRA 4TYHA 3RNYA 4QT1A 4DFBA 3CCNA 1SVGA 3VJNA 5A4TA 3DQXA 3KVXA 5I9YA 2VGOA 2ETMA 3BWFA 4BI0A 2XUUA 3RPSA 3G2FA 3HGKA 3PA5A 4LI5A 4C38A 1XBCA 2CJMA 4O96A 5F95A 3D2KA 4Y95A 4I6HA 2LGCA 3CD3A 1QMZA 1UU9A 2WOTA 3ORIA 3TNIA 4C34A 4I24A 3V01A 3ZEPA 4CTBA 4I93A 4GFGA 3F69A 4JAJA 3PP1A 4MVFA 1JSTA 3QGWA 3LQ3A 1TVOA 3OC1A 4L68A 3LM5A 3RGFA 4ALWA 4ZTMA 5A4EA 3N4VA 4YGAA 4CKRA 4ERKA 5AUYA 4WBBB 5EH0A 5EQPA 3RZBA 3QCXA 2WQMA 4RMZA 1YI6A 2JKOA 2ITPA 3COIA 4XV9A 3O7LB 3JVSA 5ANKA 5HNBA 1PXNA 4GL9A 4XH6A 4IC7A 4X2FA 3KQ7A 3T9TA 4AOIA 4EOPA 4H3QA 4CFFA 2YWPA 3FXWA 4I0TA 5CT7A 3L1SA 4D2RA 4U44A 4DLJA 4QEBA 2NNWB 3R21A 4WT6A 3VBQA 3IW5A 4NTSA 3OOGA 2QNJA 2ETKA 4FTQA 4IZYA 1XO2B 5EK7A 1Y57A 3NAYA 3EYGA 3R9NA 3CPCA 3FQSA 4EWHA 1PXMA 3MFUA 5HD7A 2SRCA 5ANEA 4ZSEA 5CAPA 4PX6A 5HQ0A 1O6YA 4NSTA 3QUPA 4FTMA 4HYUA 1GZ8A 3P7CA 1GJOA 3QZGA 4UZDA 3CIKA 3GOPA 2RIOA 3Q9ZA 3QZHA 5H3QA 1H1WA 3OCBA 5TKDA 3SG8A 4O83A 1URCA 3D9VA 3RPOA 3Q32A 3DJ5A 3W55A 3LXPA 4FT0A 5HE0A 3W1FA 4AT4A 2C6IA 2UW8A 4MCVA 4FZAB 4U40A 4Y72A 4X3FC 5DE2A 1YQJA 3MV5A 1NT2A 1H1QA 2ZOQA 4YJNA 2CCIA 4JOAA 3F3WA 4J97A 1IAJA 1XBAA 2VWYA 3OBGA 3ZCLA 2W1GA 3GEQA 4QPAA 4BDFA 2CDZA 2PVRA 3REPA 2Q83A 4GSBA 3HKOA 4QPSA 4RWKA 3NNXA 4XS2A 3SRVA 4EHVA 3P5KA 1OUYA 4IQ6A 1KUTA 1GIHA 2BPMA 3F66A 3ODZX 4FV0A 3VC4A 2X81A 3CE3A 4QMTA 4FTCA 2J2IB 4QMNA 3DAJA 4F08A 3DY7A 2R9SA 3HMIA 4I6BA 1V0PA 4MXAA 3NFGB 3H9FA 3MJ1A 2JKQA 3CD8A 4L67A 2XK6A 4TWCA 4A4OA 3B8RA 4AT5A 4QMQA 1ZY5A 3FMMA 4E4LA 2CGUA 2UW4A 4NW5A 3D2IA 4QTAA 4EBVA 2XRUA 1K2PA 4O84A 4JRNA 4MEDA 3VS3A 3PSDA 3C0GA 3NUNA 3BKBA 4QP4A 3ZDUA 3UVQA 1RW8A 4YO6A 5HIDA 3R02A 5K5NA 4R6VA 2BRGA 2XM8A 2F7ZE 4GK3A 4FUXA 4AZWA 1LPUA 1KOAA 1NVQA 5L8JA 2DWBA 2I0VA 2ITYA 2WXVA 3SXSA 4FBXA 4G3FA 4ZTQA 4L3PA 3T3UA 4IANA 1OM1A 4DGGA 3ZDIA 3MESA 3Q3BA 2HOGA 2ZMCA 2XARA 5H9BA 4QMVA 3QX2A 4O38A 3ZRMA 4DEIA 2BZHB 3D15A 3VN9A 3E3PA 4O81A 1S9JA 4N6YA 3E8NA 2QD9A 4DGNA 4C2WA 4GH2A 4GK2A 4D4SA 3V5JA 2UW9A 3BLAA 3ALNA 4ALUA 2F2UA 2C69A 4LRMA 4PDSA 3DZQA 5EW8A 1U46A 1OL6A 4OBOA 4JDKA 4H3BA 1QPCA 4V01A 4W4YA 4A06A 3E64A 4IWPA 5EG3A 3R7VA 1HCKA 3LMIA 1J7IA 4GG7A 4EQMA 3HP5A 4WUAA 2Z7LA 2H8HA 5IUHA 3PRFA 2R3FA 2ZM3A 3BCEA 3G0EA 3LFCA 3QTZA 4PWNA 1W8CA 3VQUA 2VO7A 4FEXA 4H58A 2YDJA 4FV3A 3NEWA 2FSOX 4GFOA 3OWKA 4F63A 1BMKA 1MP8A 2C47A 3UNZA 4IFGA 4EJ7A 2RGPA 4XV1A 2GTMA 4FG8A 2XZSA 5F4NA 3BHUA 1IR3A 5E8YA 1Z57A 3LFQA 3BELA 3FLYA 3MB7A 1R78A 3HRCA 4YLKA 3ZM4A 5CVGA 5C4LA 3UDTA 3TTIA 4FTIA 2XNMA 2YACA 3G6GA 4FV5A 1JVPP 4RX7A 4E93A 5HX8A 2GHLA 3FLWA 3HUCA 3NWWA 5DT0A 3HNGA 2OI4X 2OFVA 3I0QA 4QP3A 4QMSA 3UNKA 3RNIA 1ZZLA 3ATTA 3W16A 4XG2A 3UP7A 2ZB0A 2RG6A 3UJGA 3TDVA 4YJTA 1MRVA 2FYSA 5LVPA 1YOLA 1H1PA 3D5UA 4H1MA 5CS6A 2BCJA 5BVDA 4AU8A 2VTHA 3COHA 4LOOA 4K0YA 4PP7A 4F9BA 2ITOA 4TWNA 4E20A 4IJPA 3PXQA 5D41A 4PMMA 3EZRA 3R2BA 2ITZA 1JWHA 2X8IA 2JBPA 1MQBA 1YKRA 1ZXEA 3EYHA 3FMDA 3NYXA 1Q3DA 2ACXA 3W10A 4YJVA 3C4CA 4U0IA 4FYOA 3NLBA 5CVHA 3C9WA 3WE8A 4C36A 1SM2A 2YITA 2J6MA 3BX5A 3CJGA 2BDWA 4LL5A 2WIHA 3H4JA 3KF7A 3QZIA 5CEQA 3ORXA 4JVGA 5BQ0A 3IOPA 1I44A 3AGMA 5E90A 3QBNA 4BY9E 4X3FA 1E1VA 2B55A 3O8PA 3ZU7A 2YCSA 5EDRA 1MRUA 3M11A 3UMXA 4DH1A 4EH3A 4IB5A 2AUHA 2XB7A 2CKPA 2PVJA 3GU6A 4LMUA 4CGAA 3AD6A 5IF1A 2VGPA 2ITVA 3LFFA 5J8IA 4M3QA 3LVPA 5DG5A 2I0YA 1Y8YA 3WOWA 5IA4A 1OITA 5C8MA 5DRDA 2R3OA 4M68A 2OJGA 4WRGA 3BBTB 4AW2A 3KCKA 3OMVA 4DCAA 3GP0A 5KZIA 5HD4A 2ITXA 1H1SA 2G2HA 3PFQA 2XM9A 4L45A 3C13A 4FEVA 3A99A 3VQHA 2RFDA 3OROA 3EQDA 3QRJA 4FKJA 4D5HA 3BL7A 2XJ2A 3OP5A 5GINE 2FGIA 5DOSA 5FTQA 4FK3A 4USEA 2Q0BA 4I22A 2UZWE 4I5MA 4O0YA 4CEGA 4QTCA 3W2CA 4DFXE 4X6RA 5BMMA 1OVEA 2BRHA 3SHEA 5CQUA 5FBOA 2WGJA 4QMWA 5KZ0A 4CKJA 4EHGA 3TZ8A 5BNJA 3UVRA 5I4NA 3FYJX 4WG4A 2O8YA 4EOIA 3DK7A 3NPCA 2I0HA 5CSWA 1JSVA 2HK5A 5EI6A 3W2OA 5JRSA 4CQEA 2VO3A 3GQIA 5DA3A 5HVYA 3IS5A 3ENMA 4BZDA 4EH4A 3COKA 1WBPA 3QUEA 4O0XA 5CAQA 4FNYA 4U81A 3O71A 1FPUA 3KULB 3SOAA 4XBRA 3PY3A 2BDJA 4TL0A 3OUKA 2JDOA 4FE2A 2W5AA 4CMOA 5J9ZA 4AZTA 5FM2A 3CQWA 4NM0A 3IQ7A 4U8ZA 4QO9A 1FQ1B 4FKGA 3ZM9A 2Z7RA 4F9CA 3AC3A 4XEYA 2YM8A 2VWWA 3FXXA 3QRIA 4RWIA 2QI8A 4FNWA 3MY1A 4IWOA 3LZBA 1SVHA 5JKGA 2ERKA 4XRJA 4YZDA 2E9OA 1ZWSA 2JKKA 3NW6A 1E9HA 2C1BA 2WAJA 4AA0A 5I9ZA 1IG1A 4YJSA 4F0GA 3HYHA 3CGFA 2WKMA 1IASA 4YUQA 4S30A 3Q60A 3THBA 3I6UA 3ZBFA 4ASZA 4RIYA 3P5JC 5EQEA 4C02A 2R3MA 2VWUA 3AC8A 1H24A 4UZHA 5G1XA 5BPYA 2WTDA 2GTNA 3DJ6A 3SA0A 2NO3A 4A9RA 3FKOA 2UW6A 4CFNA 3W0RA 3ZZEA 3LW0A 2R3IA 2VRXA 4M14A 5IUIA 5IU2A 5FTGA 3NIEA 2XIKA 5TR6A 4EL9A 2UZBA 3QUDA 3R04A 3E63A 2I7QA 3KA0A 4S32A 1JKSA 1JOWB 1X8BA 4FNXA 4M69B 1BX6A 3QRTA 3RAKA 3U9CA 3HV7A 5EHOA 4EOJA 2YZLA 2P2HA 3QQHA 4MHAA 2UVYA 4QRCA 3TCPA 5KNJA 2B9HA 4BDBA 4F09A 2HY81 3SD0A 2BZIB 3OW3A 1O6KA 3VS2A 3AD5A 4Q9SA 4E7WA 1VJYA 4MNEB 1V1KA 4HVHA 3MH0A 3OWJA 2W1EA 5H8GA 3VBYA 3D0EA 3Q96A 5AP0A 4R7BA 1OIRA 5GJGA 5CASA 3H0YA 4ONAA 4CLJA 4D58A 3R9RA 1VLRA 2E9VA 2PMNX 2Y6OA 4BYJA 1OKVA 5CSXA 1BYGA 5AWMA 4KIOA 4L53A 5DH3A 4NUSA 1YXSA 4M7IA 4ZXTA 2YFXA 4E5BA 2ITUA 3A8WA 1U5RA 4M97A 2JGZA 1ST4A 2W99B 5KMJA 5FRIA 4AXDA 5IA2A 3PE1A 1U5QA 4B9DA 4PNIA 4EI4A 4GMYA 2WMQA 1Q97A 3IW8A 2PSQA 3WBLA 4D4RA 1DI9A 4FKOA 1UNLA 5M53A 2UZDA 3C7QA 3LQ8A 3KMWA 3VUKA 4RX5A 4C7TA 4WUNA 1JLUE 5HU9A 2ZV8A 3E62A 4GVAA 3DXNA 2VTPA 2XYUA 3BL9A 4KNBA 1B38A 4B0GA 3DV3A 3KVWA 3OCGA 5B2MA 2HIWA 1OMWA 4EONA 2CLXA 4AZSA 1CKIA 2EXCX 2WTCA 5FUTA 3GXLA 5FM3A 3L8XA 3ORKA 3N9XA 3R63A 4AOJA 1YVJA 3UBDA 3KN5A 3P79A 1Q8YA 1M17A 2PUIA 4EK6A 2F4JA 4YR8A 3KULA 3EN7A 2P4IA 4EYMA 5IA3A 5J1VA 4YTIA 2YIRA 3KU2A 3PVBA 3U54A 3DNDA 1Z9XA 5KKRC 2ZV2A 4DH8A 4FTOA 2HZIA 4FIEA 2HCKA 3OTUA 1KE7A 3MB6A 3I81A 4Z55A 5HIEA 3IGGA 2X6EA 2BMCA 4MH7A 1OL2A 5E1SA 5E8XA 4G3EA 3MPAA 4FV2A 3RPVA 4AX8A 4EK4A 3PG1A 2UVZA 1WCCA 4MNFA 3ZSIA 3FSFA 4FKIA 4AS0A 4IZ7A 3NDMA 3V5WA 3S00A 3W18A 2R0IA 4U43A 5KHXA 5AM7A 2CNUA 5DR9A 4JL9A 4L01A 1MRYA 3KKVA 3S0OA 3P86A 3R22A 5HO7A 5JSMA 2PL0A 2HXQA 3QQKA 4H36A 3TL8A 2QHMA 4A9SA 2GNJA 4BDKA 5IPJA 4K6ZA 5KKRB 3GFEA 3PJ3A 3R1SA 1WAKA 4RJ7A 2ZM4A 2P2IA 3C4ZA 3UO6A 2QR8A 3R30A 3ULZA 2HZ0A 2OXXA 4EC9A 3FZRA 2XAOA 3O51A 3UIMA 4AA5A 4RJ6A 1OL5A 2XNOA 5L8KA 4RQVA 5AMNA 1WBSA 4MNEA 3WZEA 5BUEA 4G2FA 3NS9A 3QKKA 2Y7JA 3GFWA 2ZMDA 3K5VA 2ITQA 4XX9A 4TPTA 2WB8A 1ZYLA 3LKMA 4IAIA 1URWA 3CQEA 2BRMA 2WMWA 4LYNA 5FXQA 5AA9A 3QWKA 3CQUA 2CMWA 3E93A 4O0UA 4AZEA 5IQCA 4AN9A 4DT8A 4BCGA 3FPQA 3ORTA 5EM6A 3TN8A 1Q8WA 5D1JA 3F5PA 3LFBA 2IPXA 3A7JA 4MWHA 3VS6A 4CRLA 3FZSA 4FSUA 1ZMVA 3EZVA 2F7XE 2R3NA 3O17A 4RVTA 4D0WA 3D5XA 4BCKA 4F6UA 2XIXA 4XG4A 3KRLA 1OIYA 3K3IA 1FGIA 3HMMA 3BGPA 2VTMA 2X1NA 2FA2A 5HZNA 4CXAA 3QTSA 3QCYA 4DA5A 1F3MC 1OGUA 2B52A 3DB6A 4KIPA 4DT9A 4HVSA 4I6FA 2JFLA 4PTGA 5LWNA 5AM6A 5IEYA 2CCHA 3OOMA 4U80A 5CZIA 3FMNA 1KWPA 1R3CA 4C4GA 3H30A 1YI4A 3TMOA 1YHWA 3G9LX 2VD5A 2IO6A 3KB7A 3HMPA 2VTQA 4I92A 4YNOA 4AP7A 2CGWA 3AKKA 5I9VA 3PLAE 3R71A 2W4KA 4BB4A 2J9MA 5AP3A 4YZNA 4G6LA 4D5KA 5KUPA 5I5ZA 4Y73A 5CTPA 3HA8A 1UU8A 4GUEA 4H3PA 3DLZA 3FDNA 3ORMA 1DAYA 3LJ0A 3KXNA 4M13A 3W33A 1UWJA 4FV8A 3HL7A 5CQWA 4IM0A 5E8SA 1LP4A 2QKWB 3IO7A 1XBBA 2PVKA 3PPZA 5ACBC 4EKKA 3LCKA 4C3FA 4YBJA 2I0EA 4L52A 1G5SA 4CZTA 2R2PA 5JH6A 1ZY4A 1TKIA 3ZMMA 4OGRA 4BDGA 3W32A 3A7GA 4F6WA 5CI6A 3MI9A 4BRXA 2W9FB 3NNVA 1M2QA 2Y0AA 3TUCA 4L42A 3GC0A 4F65A 4YSJA 2XBJA 1FVVA 5LQFA 3I60A 3ZUTA 4C4IA 5AUUA 4HPTE 5CALA 4FKQA 2QOHA 4RRVA 5TT7A 5ANIA 4DEAA 3ORLA 4L44A 3I7BA 4G34A 2PE1A 4BCPA 4NFNA 1H00A 2UZTA 3UDSA 2Y4PA 4FGBA 4HGLA 4ASEA 2OBJA 2ZJWA 4FIGA 5EYMA 2J0LA 2QG7A 4NKSA 4L7SA 3ZONA 2OXYA 4USFA 2R3HA 1VYWA 3EN6A 3ETAA 4QQJA 3KFAA 5L3AA 4G9RA 3FC2A 3N4TA 1YDSE 5EDQA 4OTIA 4IX4A 3F9NA 4DTBA 3BEGA 3TYKA 1YDTE 3U9NA 1QL6A 5IMXA 4KD1A 3S2PA 3P08A 4ID7A 2B0QA 3EL8A 1F5QA 4LUEA 4HGEA 3ZLWA 5AIKA 1JKLA 2C1AA 3MH2A 3ZSHA 4QYYA 3DJ7A 4TRLA 4AN3A 3CKWA 2B9IA 2HWOA 5JFVA 2JIIA 4YJQA 2BFXA 2GNGA 1GZNA 4D1XA 4ALVA 2CKEA 3A60A 5HGIA 4KKEA 4MXZA 4NW6A 2YAKA 1Q8TA 4LG4A 2V55A 5M09A 2VNYA 2G2IA 4ITJA 1B39A 5EQYA 1O6LA 1R0PA 4FX3A 3KRRA 3PWYA 4I21A 3TG1A 5K9IA 4IHPA 3QQUA 3PXYA 2WHBA 4BGGA 5A4CA 2YABA 3TV4A 2V5QA 3E7VA 3UODA 5JZJA 3R9OA 4IC8A 4C4HA 3SRVB 3ZLSA 4JDIA 1OI9A 4RVMA 4X2JA 3NVKI 3E8CA 3KY2A 5F9EA 5K4IA 4IAYA 4CTCA 5M07A 1G8JA 5GNKA 3DOGA 3UPZA 3DK3A 3F3TA 1P4OA 3WI6A 4YPSA 5CXZA 4R3PA 3UDZA 3RHXA 2YWVA 3RM6A 4LQMA 3WF6A 4ANLA 3T9IA 1ZMUA 5AA8A 2XIYA 3BYOA 3NYOA 3R1NA 4MBJA 3O23A 5M51A 4GKHA 2XIZA 3ZO3A 5IDPA 4ZS4A 3QTUA 3KCFA 4DAWA 1KE9A 2GSFA 3MA3A 3UIBA 4Q2AA 2PULA 2X7FA 5AUVA 3F5GA 4W8EA 2QOBA 1FMOE 3F82A 3GCPA 2V7AA 3GCVA 4FKSA 4RLLA 3PZEA 5BMSA 4NWMA 3LOKA 3ZUVA 3LFAA 3VF9A 4EH8A 4ZMFA 2XNNA 2C3IB 3RK9A 2OGVA 4XRLA 4BCNA 4D0XA 3QLFA 3IK3A 1PMVA 4FIFA 3ZUUA 3AMYA 4GU9A 3PRIA 1PXJA 4APPA 3LLTA 3BZ3A 4ZJJA 1A06A 5BVNA 4L46A 3VW6A 1FBNA 1YOMA 4L00A 4O7LA 4UV0A 3FL4A 4XV3A 2PVNA 2WIPA 3RWQA 3TNHA 1BI8A 5EYCA 4AXAA 4J98A 3OWLA 4A9UA 4IE9A 3Q04A 5GIOE 4IBMA 3D94A 4J96A 5H8EA 4M84A 5CSHA 3UP2A 3G6HA 3R1YA 4K11A 4D2SA 3U6HA 4FT3A 4YNEA 3R8PA 2VTRA 2B7AA 3S3IA 2E2BA 3R01A 5J95A 3FI4A 2V62A 2NPQA 3Q9WA 4KABA 1ZOEA 3L8VA 3QTRA 4HCUA 4YTHA 2E9PA 2YCQA 2C5VA 4O21A 3DBQA 3OXZA 4WHZA 4ZAUA 4DTAA 1EH4A 2BAKA 4KIQA 5JMSA 4QTEA 3TUDA 2PTKA 3D83A 3NMUF 3ZYAA 3MIYA 4YU2A 2AC3A 1WBNA 1IA9A 1JPAA 2JBOA 3FHIA 3EQGA 5C03A 4LUDA 1PW2A 4ZLOA 4DHFA 3CBLA 4KA3A 4PDOA 3VRZA 2OF4A 4O7YA 4QQCA 5M4UA 3AG9A 4FJVA 4JG6A 4KS8A 4EOQA 4OTDA 4YZBA 3MJ2A 3I79A 4D9TA 2EXMA 3TZ7A 1OBDA 4WO5A 2A1AB 1ZAOA 2HAKA 3NW7A 2QLQA 2VTSA 2YM4A 4TN6A 4DFZE 2HYYA 2C0TA 4NZWB 5FXSA 1NVRA 3VHEA 3ZRKA 3ZXZA 2UW7A 4IMYA 3DCVA 3V8TA 3OF0A 1WBWA 4FMQA 3C5IA 4S31A 4QYEA 1XQZA 4X6QC 4XMOA 4B4LA 2BFYA 4Z9LA 3WZJA 4G6OA 3AMAA 3MWUA 4IX6A 3QGYA 1P5EA 4XP3A 4NM7A 3LFEA 4TZRA 2PMIA 1A9UA 3P1AA 5EYDA 5J1WA 4UB7A 4AWIA 4O0RA 4YJUA 3W0NA 5IQEA 3BRBA 5EM7A 5L6WL 1JSUA 3DXQA 4BTMA 3NUUA 2WD1A 4ZIMA 1H26A 1YXUA 5E4HA 3VS0A 4BDIA 3LE6A 4ZJIA 3RAHA 4O6LA 3VUHA 2QODA 3Q2MA 2GQRA 5D12A 3SOCA 4DTKA 2XJ1A 4ZTNA 5AV2A 3FXZA 4RIWB 2BVAA 5BYZA 4F7LA 1UWHA 4GU6A 3BEAA 3KXMA 3QA0A 1ZOGA 5E9EA 5IG1A 4G31A 4FKUA 4O7NA 4FODA 4NM3A 4JT3A 1ZZ2A 4L43A 2JAMA 2VO0A 2VWZA 3QX4A 3PP0A 4R3RA 4X2NA 5CWZA 3G51A 3A4OX 5CAVA 3VBXA 2O64A 3QTXA 3Q4TA 3LMGA 4X3FB 4R5YA 4M0ZA 1XMMA 5DT3A 3FHRA 4AGWA 3WYXA 3NUYA 4HJOA 5LMKC 3DPKA 2C3JA 3OBJA 4QMXA 3ZH8A 3Q6WA 4TKSA 1DM2A 4O22A 5LMBA 3DZOA 1PXKA 4DBXA 4BZNA 1QPJA 5KMMA 2RF9A 2G2FA 4ENXA 3QQJA 3O2MA 4U3YA 4FKRA 3QQLA 4D1ZA 3E8EA 4FI1A 4YP8A 4BCFA 5HLPA 2WTVA 2AC5A 5IQIA 4LM5A 2VTTA 2WELA 1VR2A 4TTHB 5E8TA 4BI1A 2GFCA 2GFSA 3HRFA 2CNQA 3JS2A 1U59A 5HBJA 3OTVA 3BQCA 4FV9A 4P5ZA 5ANGA 3A61A 1H28A 5ANOA 4G5JA 3KXGA 3PJCA 5E7RA 4Y85A 4FSQA 5AEPA 4H1JA 4EWQA 3CS9A 3T3VA 5EDPA 2IW8A 3HAVA 4BGQA 2P0CA 4YLJA 4ZSLA 4BTFA 3P4KA 3QHWA 3DFAA 2GPHA 4ANQA 4CCUA 2YM6A 4IAFA 2P33A 1JAMA 3HDNA 1J7LA 4RJ8A 5CYIA 5C26A 1KE8A 2IVUA 3R8UA 1GZKA 4WKQA 2NRYA 4ACGA 1A48A 3FLSA 4KSQA 4GKIA 3POZA 5D11A 3LXLA 1J1CA 5DEYA 4RA4A 3SG9A 1AQ1A 2UZUE 1PXOA 3F61A 2X4ZA 5AP6A 3ACJA 3V8SA 1WVWA 1GIIA 3H3CA 3E87A 2OJIA 4F99A 3NW5A 3ZFYA 1TQMA 5J9LA 3NR9A 5FG8A 4YHTA 2GMXA 2PVYA 3LCDA 3OS3A 4MXOA 3W0QA 2JAVA 3RHKA 4BCMA 1GZOA 3W2PA 1OL1A 4Z7HA 5IQFA 3F3VA 4FSNA 4FTAA 1OIQA 4IAZA 1APME 4ZY5A 4AF3A 4L9IA 3SX9A 2WNTA 3BU6A 5JFWA 5A54A 4O7RA 2GU8A 4RIYB 4DG0E 2DS1A 3OT3A 4TNDA 4YSMA 4ANSA 4AZVA 4Q9ZA 2CN8A 1PXPA 4S34A 2OFUA 4YC8A 3UMWA 3W2RA 5EOLA 3MVJA 2PYWA 3ALOA 3L9NA 1WFCA 4AGDA 2WMVA 2UZVA 3PJ8A 1NW1A 1TFFA 2R0UA 5BV3A 4GV1A 1Q8ZA 2OK1A 3JVRA 1OKWA 2QC6A 4XG6A 5LJJA 2R7IA 4C62A 4F0IA 3DDQA 3M42A 4JQEA 3K5UA 3ANRA 3NUPA 3EQRA 3DTCA 4BHZA 4IFCA 4RJ4A 3MA6A 5AX9A 3F3UA 5L2WA 3Q2JA 4IVAA 4RIWA 4F9AA 4HVIA 3B2WA 4EHZA 4YO4A 3C1XA 3HV3A 3ZLYA 3Q4ZA 4U5JA 2UV2A 3AXWA 2YM3A 3AC4A 3KIOC 4KRCA 5I0BA 4U79A 5C4KA 3EL7A 1R39A 1W84A 2GNLA 2X7OA 2JFMA 4HZRA 5AV3A 4WOVA 2BAQA 4JG7A 3A7HA 2F7EE 2A4LA 4Y5QA 1OPLA 2XKDA 3LCOA 4F9WA 4AN2A 4HCTA 4PUZA 4CLIA 3DGKA 3TV7A 5LCJA 1XHAA 3QD3A 2OZOA 3Q9YA 4YZMA 4QYFA 3K3JA 4TYEA 3EQFA 2WEIA 3FI2A 2C6TA 3IECA 2JC6A 4E6DA 3HLLA 4O0SA 2YN8A 3ZLXA 2AEGA 2JIUA 3BLQA 5FP5A 4HYSA 5M55A 3G0FA 3GOKA 2X8DA 4BCIA 2OU7A 4JBOA 4AQCA 3O0GA 4OT6A 3NNWA 5CEOA 4IIRA 4YMJA 3UOLA 1M52A 2GQSA 4KB8A 4Q5HA 1OL7A 3AOXA 3S1HA 2EWAA 4DINA 3DQWA 1YDRE 3IG7A 2W5BA 4OUCA 4UXQA 3LIJA 5KBRA 3EQBA 4WG5A 2QQ7A 3QQGA 2IVSA 5IQAA 4AOTA 4FEUA 2PPQA 4EOLA 3A62A 4JR7A 4I41A 3V04A 1SNXA 4KUJA 3KREA 4UX9A 5BX0A 5LMKA 5LVNA 3OW4A 4C35A 4HOKA 4FVQA 5BVKA 4LDTA 4MYGA 2C4GA 5GJDA 1YOJA 3ITZA 3UYSA 4DEHA 1KV2A 2GHMA 3QF9A 4QP2A 1OPKA 4HGTA 4GRBA 4JBQA 3NUSA 5DR6A 5IUGA 1YXTA 2UW5A 3F7WA 3FUPA 3UQGA 4ZY6A 5AIRA 2DQ7X 4E5WA 1CKJA 2VX1A 3E5AA 4O91A 4TYJA 2J0JA 4DN5A 4C61A 4IM3A 2C6KA 4J1RA 1OPJA 4JDHA 4K2RA 4DDIA 4DGOA 5J87A 4GW8A 3UZRA 5FXRA 3CKXA 1J91A 1PYEA 4TWOA 4XYFA 4IDVA 5HIBA 4AGCA 5CEPA 5A6OA 1XH5A 3PXKA 4P90A 3EB0A 3MYGA 4U9AA 3A7FA 3W0OA 2QURA 5FEEA 3EKNA 3DLSA 1L3RE 4FK6A 2OIDA 5FBNC 4FA2A 4B99A 4BIEA 1OKYA 1TQIA 3DB8A 4E8AA 1REJA 4ZTLA 2XANA 4K1BA 2FUMA 2VTIA 4JIKA 5HNGA 4QNYA 4RA5A 4U97A 4M12A 2H96A 4OTFA 5FLFA 2BRBA 4RLKA 2WMRA 3BIZA 2PUPA 1H07A 2HZNA 2UW0A 5HU3A 2H6DA 3RK5A 2IN6A 3G9NA 4C58A 2OH4A 2WQNA 3FZTA 4FSRA 4EOKA 4AZFA 2GS6A 4JI9A 5JGAA 3WARA 5TF9A 2OF2A 3R7YA 3ZO2A 4PRJA 2B53A 3BGQA 4H39A 3PIXA 2CGVA 3BHHA 2VU3A 4K8AA 1ZYJA 1XR1A 2C5XA 2X2KA 3EWHA 4IACA 1G8KA 2W1FA 4U41A 4ACMA 1FINA 2X8EA 2XRWA 2QOQA 1DAWA 4FKVA 2QOKA 3WF8A 4N0SA 3PDTA 2W17A 5HVJA 2VWXA 4ZSAA 1NVSA 3OHTA 4WBOA 4AACA 4AA4A 4CG8A 4XHKB 3O7LD 3HAMA 5AUWA 3QD4A 3Q4UA 3TKIA 4FG9A 3L8SA 3VAPA 4F7NA 3QRUA 3PYYA 3OEFX 3FMEA 5CU4A 2J0IA 4EORA 3WZUA 3ZO4A 2YIQA 2ETRA 5DVRA 1H1RA 2BDFA 1WBOA 4TWPA 3BLRA 1PRYA 3D14A 4L7FA 2QO9A 4KBCA 5H8BA 2PUNA 4BTJA 5CAUA 3U51A 3PVWA 2GS7A 3KC3A 3MFRA 4FZFB 3NUAA 1OZ1A 3C4FA 2UVXA 3ROCA 2YERA 3PY0A 2HXLA 4JBPA 3D5VA 3R7UA 1H01A 4OR5A 3RAIA 4IWDA 2J90A 4UWCA 4AAAA 4Y83A 4FVPA 2RFSA 4CRSA 2C5OA 2CKQA 3BYMA 3FV8A 2YEXA 4KBAA 2C6LA 1AGWA 2WTWA 3GC9A 2R3GA 3RAWA 2XK7A 3NCZA 5ITAA 2B1PA 3QA8A 1YXXA 5KMOA 1M2RA 2BRNA 3MY5A 4ASDA 3FWQA 3QLGA 3JPVA 1Y6BA 4MQ2A 2C30A 4Y8DA 5EHYA 3DXPA 4BJJB 3AKJA 2O2UA 2CKOA 2XS0A 4J8NA 2FH9A 1BI7A 4CV9A 4W4XA 1REKA 1STCE 4G3CA 3E8DA 2J50A 4MTAA 4TW9A 4ZZNA 3SKCA 5FP6A 2ERZE 4F1MA 3QD2B 5DHJA 1GAGA 3I7CA 2FSTX 3Q5ZA 4W4VA 5CENA 3WZKA 2QONA 4DCEA 3IONA 3C4WA 4JIAA 4FGRA 2BKZA 4FV6A 4C2VA 3UNJA 3KRWA 1LEZA 1YWNA 2J5EA 2YISA 5GJFA 3HMNA 5CY3A 4EZ5A 2OJJA 1CSNA 3MH3A 3WILA 2E9UA 2C6OA 1Z5MA 1ATPE 3FMKA 4BIBA 4N6ZA 4EH9A 4YURA 5IA0A 4RQKA 3LAUA 1UNHA 2O0UA 2Z8CA 4A7CA 3RVGA 4BBEA 4II5A 3SXRA 2PHKA 4FSTA 3POOA 2W1IA 3HV6A 3ID6C 4L6QA 4NK9A 4KKHA 2QLUA 4QDEA 4ITIA 3R7IA 5KHWA 5DGZA 4PF4A 3Q52A 3R2YA 3QXOA 3UO4A 3L9MA 4HCVA 2V0DA 3HUBA 5A46A 4AW5A 1Q8UA 2OZAB 3A4PA 3ET7A 3U4WA 4KS7A 3VUGA 4G1WA 2C3KA 5BYLA 2C0OA 3C50A 4F7SA 4FT7A 5ICPA 4YHFA 1UKHA 3DA6A 2WTJA 5AAGA 4FT9A 4RIOA 1OBGA 3OEZA 3HDMA 4JX7A 4QMZA 2Z60A 4ZK5A 2C68A 2GQGA 4FIHA 2JITA 3VUMA 4RFYA 4DEEA 3SW7A 1K3AA 1UV5A 2C0IA 4IX3A 4M0YA 5FDXA 5EI2A 3F7ZA 4O7ZA 5ETIA 2O65A 1XWSA 2OSCA 4CMUA 5M08A 3BE9A 3KL8A 3PSCA 5HLNA 5DYJA 5CU2A 3TNWA 4DHZA 2XCHA 5KO1A 3VS5A 5B2LA 3IPHA 5IEVA 3PVGA 3PXRA 3SXFA 3OCTA 5DI1A 3CEKA 1XKKA 3EFWA 3GU5A 3KXZA 2C6DA 1U54B 2YJSA 5KMIA 3R8LA 3NCGA 5HG8A 4JG8A 5JGDA 4C4EA 3RK7A 3IW4A 3FI8A 1AD5A 4KRDA 1Y6AA 4S2ZA 4I5PA 3V6SA 2VX0A 3R7OA 2NRUA 1BL6A 2ZDUA 3B2TA 3EN5A 3IDBA 2DUVA 3KK8A 2G9XA 3G15A 3UG2A 2Q0NA 3F5XA 3EOCA 3PA3A 5CLPA 3W0PA 3MPTA 3HVCA 3O8TA 4W4WA 2BHHA 4IJ9A 4PL5A 3COMA 3P78A 3PUFC 3QL8A 3AGLA 4LRKA 4F9YA 4MBIA 5DWRA 5L6OA 1XH9A 3C5UA 2QG5A 3MTFA 3PY1A 4LMNA 4EZ7A 4K9YA 5LVLA 1UKIA 1R0EA 4QTBA 5JK3A 3TACA 5CI7A 4BJJA 5EKOA 5KMKA 1V0BA 4RSSA 3ZXTA 3P23A 3FC1X 4TY1A 4DF3A 2IZRA 3IW6A 2PY3A 4WRSA 4R1YA 4O6EA 1G8AA 1K9AA 2XMYA 4HZSA 4FOBA 3BHYA 4MD8E 4LV5A 3TEIA 3W8QA 3TT0A 5AV0A 3O50A 3QQFA 1WMKA 3GB2A 3MDYA 2ONLA 4X3JA 3CGOA 3DS6A 4WNKA 3UC4A 3MPMA 5BUIA 5HORA 3IKAA 3DKOA 3QKLA 5IQGA 2O3PA 2V22A 3RM7A 3TIZA 5BVWA 4EUTA 2R4BA 5JEBA 3QZFA 3BYSA 4ZSGA 4O7VA 3LQ5A 4OTRA 5EM5A 5C1QB 3A7IA 4BYIA 3MN3A 4IH8A 4BC6A 4UBAA 5H2UA 4ZMEA 4QNAA 2XK8A 4MKCA 4GJ3A 4FTNA 3MS9A 4D1SA 2KULA 3BYVA 1LEWA 5ETCA 2BILB 2QOOA 4I4FA 5KMLA 4HYIA 3I0OA 4M8TA 4R3CA 2XA4A 4EZ3A 4AXEA 2QOIA 4B7TA 3QTIA 5CF4A 4FR4A 4IM2A 3KXXA 2A19B 2XNEA 2OZAA 4NH1A 1Q24A 3TUBA 2WPAA 3F2RA 4NYEA 2XVDA 1YW2A 3VRYA 3VULA 4D9UA 4G17A 4DLIA 2R3LA 3PG3A 3PA4A 4BCJA 4I5HA 5KE0A 2RKUA 4ANMA 5BYYA 3BU3A 3EQPA 3OT8A 3BHVA 4MF1A 4PP9A 5D10A 5AAFA 5A6NA 3RKBA 5IH5A 4EH6A 3UZTA 3PWDA 4JQ8A 1QPDA 5L6PA 3DBFA 5G6VA 3QYZA 4LRJA 3WF7A 4FT5A 3CTJA 3VS7A 3UQFA 5JRQA 3UOJA 4CMTA 3KRXA 5HCXA 4ZZMA 4FV7A 3ZEWA 3VHKA 2YAAA 2W1CA 5DRBA 3KGAA 1B6CB 4XLVA 5CNOA 4EK8A 2QOFA 4GVJA 4DFUA 2WU7A 3GBZA 5F20A 4DEGA 5CF5A 3BWJA 1LUFA 1JKKA 2VTNA 4P4CA 4YJOA 3MFTA 4C4FA 1U54A 2A0CX 2W96B 2P55A 4B6LA 5AP5A 2IVTA 2VV9A 2R3QA 4LV7A 4LOPA 2OJFE 2GCDA 2YIYA 2ITWA 3DBDA 3WF5A 3S95A 1TQPA 4FL2A 4ENYA 5CEIA 2W1DA 3FMJA 2ZDTA 1CDKA 2PE2A 3QYWA 4I0SA 4D28A 5LWMA 5AJQA 3VS4A 5M57A 4IEBA 1XMLA 2OXDA 5CSVA 4A07A 3ZC6A 3TI1A 2CPKE 4UN0C 3RWPA 3OFMA 4K33A 4YLLA 5AP2A 3ZFMA 4E4MA 4OTGA 1XH8A 4FVRA 4KINA 2X39A 4EYJA 1BUHA 3C4EA 4JJRA 2PVHA 4TNBA 3VONA 4IVDA 4E73A 4F1OA 2WMBA 3BBWA 3U8WA 5JQ5A 5IH6A 5L8LA 2XNPA 3BYUA 4EH5A 4PTEA 3HMOA 2XALA 1M2PA 4JDJA 3VW8A 3CLYA 4UY9A 2PK9A 1VZOA 2YDIA 4U7ZA 4CFUA 3VBTA 2WZJA 3LCTA 4WD5A 4RT7A 3TXOA 4BBMA 1PMNA 4QP9A 1YHSA 2EB2A 4UALA 3UO5A 4ZP5A 5L2IA 4C33A 3EQIA 1S9IA 4JBVA 4AFJA 3AQVA 3FMHA 4WIHA 1VYZA 4GUBA 3SQQA 3R28A 4F64A 4YTCA 4IZAA 3UVPA 2ZVAA 4DGLC 4PMPA 3TZ9A 4DEBA 3ORZA 3MTLA 1WVXA 3PTGA 4ORKA 3DAKA 1UU3A 5EM8A 1H4LA 4E6AA 4DHJA 1QPEA 3EKKA 4CNHA 4AUAA 4XOZA 4Z16A 3ATSA 3I5ZA 3VS1A 1UNGA 2HWPA 4J71A 2VWIA 5FEQA 2G01A 4N70A 1VEBA 3VUDA 4XLIA 3JY9A 5D9HA 4V0GB 3BGZA 4E4XA 4YZCA 2W1ZA 5JT2A 5DBXA 2G15A 2ZV7A 4FZDB 4YJRA 5T68A 4AXCA 2XIRA 3CY2A 4GYGA 4QOXA 4WNOA 4BR3A 3C0IA 1Q3WA 4XG8A 5HE3A 3FZPA 3E7OA 4AGUA 5E91A 4YHJA 3EH9A 3FY2A 5LOHA 3TJDA 4DDGA 5ANDA 1YWVA 3EQCA 4XOYA 2R64A 3LPBA 2OLCA 3GT8A 3MGYA 4FKLA 5IEXA 5DN3A 4O2ZA 4GIHA 2X0GA 1FOTA 2X7GA 3VJOA 5TO8A 2XNGA 4EHEA 4PMTA 3EQHA 4O7SA 2OG8A 5LCKA 2E9NA 2GNHA 3CY3A 3QCSA 3TNQB 5CU0A 5BVOA 4WNMA 3ZBXA 4LV8A 3BV3A 3NX8A 4RVKA 4EBWA 5B2KA 3MY0A 3NAXA 5E8UA 4NM5A 1H8FA 1Q5KA 4IW0A 4RFZA 3CR0A 3E88A 4Y5HA 3P7BA 3ROYA 3ZC5A 4IDTA 3GQLA 2Y6MA 2OWBA 2IZSA 2VWBA 2W4OA 4MWIA 4GT3A 3F3ZA 4S33A 1SZMA 5CEKA 2VZ6A 4KSPA 2VN9A 2WMXA 5EI8A 5AUXA 3ZS5A 3NZ0A 3DAEA 5CZHA 4BVUA 4DHIB 4E26A 2YJRA 4FTLA 3BI6A 2XAMA 3M1SA 2CN5A 4I6QA 1SYKA 2XCKA 5F1ZA 4HW7A 3ZO1A 3UC3A 4CSVA 4NKAA 5EFQA 3GCQA 5KCVA 2PVFA 2PUUA 2QR7A 3PPJA 3WE4A 3P9JA 3VVHA 4ZY4A 4DBNA 4DG3E 4DGMA 4J8MA 3G33A 4AG8A 3QAME 3JYAA 4O2PA 4O7WA 2CLQA 1CKPA 4FL3A 5JZNA 1P4FA 4YZ9A 3R8ZA 2X6DA 4D4VA 3U6IA 1MQ4A 5J9YA 2XP2A 4JLCA 4BCOA 5EKNA 1OGYA 4I0RA 3RCDA 5LXMA 4RC4A 2PZ5A 2BIYA 3DBEA 4BF2A 4F70A 1SVEA 3CC6A 4DE4A 3F6XA 4OW8A 4CFWA 3Q5IA 4CCBA 3FE3A 4KWPA 1J1BA 1PXIA 1BLXA 1O9UA 3I5NA 3FLQA 4QMYA 4RWLA 5HG5A 2DYLA 4JX3A 3RTPA 3UTOA 2R5TA 4GK4A 2VWVA 1P14A 3AMBA 3D4QA 4CFMA 3GU7A 5CNNA 3GC7A 2C3LA 2Y8OA 1F0QA 3H9RA 3L9PA 2XJ0A 2Z02A 3R00A 4P7EA 4DC2A 5IZFA 4DEDA 4R1VA 2P3GX 3NFFB 4BGHA 5AX3A 4UYNA 4J95A 3KRJA 4FIJA 4FSYA 1ZMWA 2VTAA 2QU5A 4K18A 1XJDA 4JXFA 4I23A 2W4JA 4JR3A 3EJ1A 2WMAA 3T8OA 1QCFA 2QVSE 4AE6A 4I1ZA 4A4LA 3PUPA 4XCUA 4JRVA 4V0GA 5ETFA 4IWQA 3CTHA 1IEPA 3FAAA 3D7ZA 2WEVA 4XG7A 4DITA 4EOSA 4UWBA 4MAOA 3F2AA 2JDRA 1KE5A 4MK0A 3SV0A 3VO3A 4YJPA 5CF6A 3B8QA 2R3PA 2YA9A 3DK6A 4EK5A 4BDHA 4QMOA 4ZEGA 3MVMA 1H0VA 4BTKA 4DYMA 2HZ4A 3UE4A 2HW6A 4C3RA 3QKMA 5J5SA 5JFSA 4AW1A 3DTWA 1DS5A 3QC9A 4ZTHA 5A14A 5M56A 1G3NA 3PPKA 2WTIA 4AAYA 4Y46A 5HVKA 4IAKA 5E8VA 3II5A 4AFEA 3FKLA 3VF8A 2ZYBA 4WG3A 4BN1A 3IOKA 2IZUA 4IX5A 3V3VA 3ZOSA 1ZLTA 3LM0A 2WQBA 3RPRA 3GU4A 3GCSA 3NIZA 4FUYA 5EHLA 3PJ2A 2ESMA 3JY0A 5CT0A 3MIAA 4R77A 4RIXB 5M4CA 1Q4LA 3GGFA 3LXKA 3OG7A 1ERKA 5DLSA 5A3XA 3DKGA 4AQKA 4X21A 2CGXA 2ZM1A 3DNEA 4UEUA 5T6KA 1KSWA 3WYYA 4CT1A 3KEXA 1YI3A 4PMSA 4QMLA 2BUJA 4NJ3A 4FZ6A 3OD6X 3UOHA 4D55A 4CFVA 4F7JA 4Z3VA 2YM7A 4YBKA 4XNEA 5AAEA 3IDPA 4RVLA 2ZB1A 3AD4A 4BDAA 1W7HA 1HCLA 2PZYA 2VTOA 3MFSA 4I4EA 3R8MA 3FZ1A 2QO7A 2JKMA 4QDVA 3D7TB 3QXPA 5K4JA 2PWLA 4CT2A 5DT4A 2W06A 3H0ZA 3W2SA 4ZLYA 4FTJA 4R5SA 3ZZWA 2WOUA 2C6EA 3ORPA 4I3ZA 1RJBA 3KMMA 2QO2A 1PMUA 4BDDA 3SW4A 5E8WA 2YDKA 2JLDA 3DT1A 4FZ7A 4IB3A 4L3LA 4U3ZA 3UGCA 4ZJVA 2FSMX 4QMMA 3TDWA 4ZSJA 3RMFA 4C3PA 5L2SA 1PJKA 1XH7A 3F88A 4XG9A 3SC1A 3PVUA 4GFMA 4DH7A 2JDTA 2I1MA 4O86A 2AYPA 1T45A 5HLWA 5AADA 4FV4A 3PJ1A 2WU6A 3FQEA 2Y9QA 2BIKB 2UZOA 4H05A 4IVBA 2O5KA 4FSZA 4FSWA 5CVFA 1YHVA 3LFSA 4J53A 2XYNA 1BL7A 1LR4A 1SMHA 2QKRA 4NIFB 4C37A 4QP7A 4YC3A 3AT2A 4G3GA 4RG0A 5KMNA 4CV8A 5CEMA 2GS2A 4MXCA 3CJFA 2Z7QA 2CSNA 4QYGA 2OJ9A 3V5QA 5BUJA 4QTDA 4ACDA 2B4SB 5M06A 4NL0A 3R9DA 3EFKA 1R1WA 4DG2E 4EH2A 2PZPA 4EQUA 1PY5A 3V5PA 1OUKA 3HV5A 5HO8A 2XKCA 5M4FA 2IJMA 1ZRZA 4O82A 3W8LA 5IQBA 2YM5A 3RCJA 3W0MA 1JBPE 4JMQA 3PIZA 5IH4A 4OTWA 5AP1A 3UPXA 1WZYA 4JNWA 3Q6UA 1H25A 2X2LA 4C59A 2FVDA 2EUFB 1PHKA 3TZMA 3P7AA 5T3QA 2BALA 3QWJA 3W2QA 5JN2A 3Q4CA 1M7QA 3UIUA 3H9OA 3HEGA 5HICA 3RALA 1PKGA 1CM8A 2BHEA 4OT5A 1E1XA 2GNFA 2XK9A 4AXFA 2BAJA 1PF8A 4FC0A 4RGJA 4RZWA 4X7QA 2WMTA 1W0XC 3L8PA 3P0MA 3OXTA 3TNPC 2XNBA 3HZTA 3FEGA 4TYIA 3U87A 4QQTA 5I9WA 5CF8A 3Q9XA 5EW9A 4EKLA 3R0TA 4EOMA 3G5DA 4E1ZA 1PMEA 3R1QA 2W0JA 4G16A 4ACHA 4C0TA 4F78A 3JR1A 2PVMA 3AKLA 4OTQA 3UDBA 4B8LA 4XBUA 3QFVA 4L3JA 5FGKA 2WTKC 4FTTA 3EMGA 2YZAA 4MXYA 5B0XA 5FEDA 5EOBA 5C01A 2R7BA 4RIXA 3V5TA 4BDJA 2OICA 5C8KA 4NFMA 3WIGA 4XP0A 3R8VA 5HHWA 2CNVA 3ODYX 3PZHA 4ZZOA 3MSSA 4R7HA 4E6CA 2FB8A 5HTBA 1RQQA 5DEWA 3MH1A 4RC3A 4E6QA 4FTUA 4RJ5A 4EQCA 2UUEA 2BKKA 4GT5A 3TKUA 5CX9A 4N57A 5BVFA 3D7TA 3UQCA 5A4QA 1OB3A 3ML1A 2JEDA 4QP1A 5CU3A 5I9XA 3PE2A 1W98A 2VTJA 4FYNA 3O5AA 2BROA 1FGKA 4OBPA 4G9CA 3VNTA 3R7EA 2OW3A 4EK3A 2WMSA 3PSBA 3FL5A 2UW3A 2Z7SA 4I20A 4P2KA 4Q5EA 5HNIX 2UZNA 3FQHA 4PL3A 5AP4A 2IVVA 2WTKB 4IADA 4DH5A 1M14A 4X0MA 3EFJA 4JAIA 3DKFA 2PMLX 3QTWA 4R7IA 5IA5A 4ASXA 3H10A 5ACKA 3QTQA 4MX9A 2XF0A 2OO8X 2KTYA 2WQEA 3GCUA 2YHVA 4J52A 2F2CB 3OY1A 4NTTA 4NCTC 2VUWA 4IAAA 5LMAA 3OY3A 5B7VA 4FTRA 2ONLC 4ZS0A 2R3RA 4WA9A 4F4PA 3NGAA 4FICA 3VWAA 4MXXA 4MUQA 2V7OA 4A9YA 2ITTA 3FMLA 3LJ2A 3MW1A 1KV1A 4F1TA 2J0KA 4ACCA 4HNIA 4GCJA 5D7VA 1WBVA 2RG5A 3GC8A 3R83A 3CTQA 1CTPE 5KBQA 3DKCA 4XP2A 3IW7A 3JXWA 1KOBA 1ND4A 4YC6A 5LARA 2H34A 1OIUA 2OIQA 2NP8A 3F5UA 3GVUA 3U4UA 3ZFXA 4IB1A 3QCQA 5HE1A 4PDPA 4GJ2A 3Q53A 2R3JA 3AT3A 4FTKA 1W83A 5M4IA 4F0FA 1J7UA 5ANJA 3TWJA 2IW6A 3GU8A 2J51A 4BHNA 4FKWA 4RJ3A 1Y8GA 4CKIA 2RL5A 3V51A 4EEVA 1M7NA 1Y91A 1U4DA 4MBLA 4CZUA 3DU8A 2O63A 3QC4A 1Q62A 2YCFA 3IDCA 2OKRA 1UU7A 1JQHA 3DFCB 1RE8A 4AT3A 5CU6A 4FNZA 5HG9A 3UOKA 3QU0A 5HCYA 4QYHA 5CSPA 3AT4A 1JKTA 1PYXA 3I4BA 4G6NA 4LGGA 4JS8A 4QP8A 3E3BX 1L8TA 4I5CA 4HVDA 2BR1A 2W1HA 2W7XA 2W9ZB 5IQHA 2X4FA 2PMOX 5HBEA 1XH4A 4IZ5A 1V0OA 5HBHA 2A27A 5TOZA 4YTFA 4DFNA 2J4ZA 3HP2A 1H0WA 3M2WA 4PQNA 4CFXA 1CMKE 1WVYA 3OZ6A 4OLIA 5AUTA 3TM0A 4FV1A 4MD7E 2IW9A 5HTCA 2FO0A 3K2LA 3AC2A 4UWYA 4J99A 4O27B 3WIKA 4HNFA 4J7BA 2QU6A 4BKJA 3ELJA 3L9LA 3GI3A 1NXKA 2XK3A 4FKPA 5A4LA 3G90X 3OCSA 3SVVA 3KK9A 4NU1A 2I6LA 4UXLA 2OH0E 2NYAA 4O0VA 1YRPA 4QP6A 2JD5A 4FEWA 4L8MA 3TTJA 1XH6A 1P2AA 3BU5A 2I40A 3R73A 3PIYA 2YIXA 4R78A 5IMEA 5DIAA 4NJDA 2W5HA 3BV2A 3CPBA 4EC8A 3KN6A 5HI2A 2YCRA 3RP9A 2HY0A 3MBLA 4HPUE 5IDNA 4NT4A 5E8ZA 5DNRA 3UZPA 3NNUA 2REIA 3W0SA 4QMPA 5F94A 4G3DA 1IAHA 2J5FA 2ITNA 4F6SA 3UYTA 4CD0A 3ENHA 2XH5A 2Z2WA 4FKTA 2J7TA 4PDYA 3EFLA 5K5XA 1HOWA 1ZYCA 1H08A 4EJNA 4C4JA 1RDQE 5C8NA 2F57A 3BPRA 3BE2A 4FL1A 5E92A 2IG7A 4APCA 4P5QA 1FVTA 1PXLA 3GENA 4RC2A 3HX4A 4ITHA 4ERWA 4O7TA 4KBKA 3SDJA 3VBVA 3HECA 5GHVA 4U42A 4GG5A 3SGCA 3RPYA 3FSKA 3PLSA 3FZOA 4X2GA 2VO6A 1OECA 1YWRA 2WO6A 3E92A 2IZTA 4W8DA 4E5AX 3LXNA 4GT4A 1FVRA 3GNIB 3LLAA 4GEOA 2GNIA 3N51A 4OTHA 1UA2A 1GNGA 2PU8A 4UYAA 3EN9A 3LJ1A 5AFVA 5CXHA 2JDVA 2XEZA 4HYHA 1T46A 2YIWA 4RWJA 5DFPA 1W82A 2QCSA 5DPVA 2BTSA 4LGHA 3RINA 3CSVA 4TXCA 3VUIA 3ZTXA 5C27A 2G1TA 4BIDA 5FTOA 3UG1A 1J3HA 4WSYA 5KX8A 4EOOA 1KE6A 4RX9A 3IGOA 3S4QA 5IISA 2VAGA 4MD9E 1ZOHA 4D4YA 1ZYDA 5AP7A 4ZLZA 3NUXA 4KKGA 2LAVA 5A9UA 1DI8A 2VX3A 3FBVA 4PV0A 4V04A 3LFNA 5HCZA 3VBWA 4DFYA 3A2CA 1GOLA 5JQ8A 1I09A 5L2TA 1Q61A 2HELA 1Q99A 1GIJA 4XG3A 2JDSA 1IA8A 3BHTA 1YXVA 2PVLA 5EW3A 4BBFA 3QD0A 3MVLA 4NCTA 3WF9A 4DH3A 3ZHPC 4I94A 3U55A 1GY3A 5HX6A 2IWIA 3A8XA 3ERKA 5BVEA 3NYVA 5CAOA 4CVAA 3OWPA 4FEQA 4TYHB 3V6RA 4O0TA 2XK4A 3EN4A 3TIYA 3V5LA 4QQ5A 3DDPA 2EVAA 5M44A 2UZEA 3C4XA 2GDOA 4IVCA 2B9JA 4V05A 3R9HA 4O0WA 3QHRA 3NYNA 4RBLA 5E1EA 5C9CA 4A9TA 2B9FA 2VNWA 4A4XA 4KAOA 4BI2A 4GIIA 4E4NA 1NA7A 3FI3A 2H9VA 1NY3A 3HRBA 3UIXA 1MUOA 2F49A 2BZJA 4YPDA 2A2AA 3RJCA 3HV4A 3HA6A 4OBQA 1SNUA 2BTRA 4FIIA 2EB3A 4RZVA 3BLHA 3KF4A 3NSZA 2XKFA 3BQRA 4I6LA 4CG9A 2R3KA 3FJQE 4M15A 4AW0A 2C5YA 1ST0A 3FYKX 3LFDA 1UVRA
chains in the Genus database with same CATH topology
3ZSGA 4U6RA 5FQDC 2PZIA 2UZLA 2W05A 3I1AA 2WMUA 2F9GA 4JQ7A 4XV2A 5JFXA 4QMUA 3AC1A 5HE2A 5LVMA 3QRKA 2HW7A 5EYKA 3VIDA 5GIPE 3RI1A 5AUZA 4USDA 3OVVA 3O8UA 2HENA 2VTLA 5AV1A 3EHAA 3KMUA 2XBAA 2XEYA 3PXZA 4PNKA 5IA1A 1FMKA 5HEZA 3FY0A 1H27A 5HG7A 3O96A 3CXWA 2BZKB 3ORNA 3JUHA 4Z7GA 2QOLA 2Y4IC 2C5NA 4BDEA 5IQDA 3PFYA 1ZARA 3K54A 2B54A 3D5WA 4GYIA 3R6XA 5I9UA 1PKDA 4RFMA 5ETAA 1ZYSA 2C6MA 2RFNA 4MQ1A 4LL0A 2QHNA 3F2NA 3OUNB 3N4UA 4ZTRA 4EUUA 5FDPA 3C51A 4ZOGA 2QOCA 1BKXA 2X9EA 4FG7A 4PTCA 5K3YA 3FKNA 3PXFA 3V8WA 3ANQA 4EH7A 3FLNC 5J7HA 4M67A 3FPMA 2X9FA 4HGSA 4BDCA 1IRKA 3LCSA 1Q41A 4IB0A 2XKEA 4AE9A 4WNPA 4BCHA 2ZV9A 4XUFA 4RPVA 5LVOA 2ZAZA 4FOCA 4PY1A 3U6JA 3MVHA 3DBCA 2GHGA 3KXHA 2OIBA 5D7AA 4HVGA 2PE0A 3ZRLA 3I6WA 4XJ0A 2J0MB 3SLSA 5JGBA 3OXIA 3CP9A 3TJCA 5AV4A 3NRMA 3TV6A 5CANA 1WBTA 3ACKA 3ULIA 2Y4IB 4ANBA 5HESA 3AC5A 4LFIA 2X2MA 5FD2A 5DR2A 4X2KA 3LHJA 4GS6A 3TKHA 3C0HA 4ARKA 4DFLA 3FLZA 1JNKA 4FSMA 4N4SA 1G8SA 4G5PA 2WQOA 2WFYA 4BZOA 2EU9A 4K77A 4ZTSA 2CHLA 4BICA 2JIVA 3LMHA 4TYGA 3WZDA 4PL4A 3EIDA 4U45A 4BCQA 3GUBA 4B8MA 3QALE 5HKMA 3SAYA 4TT7A 2RFEA 1OKZA 4LOQA 2FSLX 2ZFYA 3NVMB 4RX8A 2PZRA 4TYHA 3RNYA 4QT1A 4DFBA 3CCNA 1SVGA 3VJNA 5A4TA 3DQXA 3KVXA 5I9YA 2VGOA 2ETMA 3BWFA 4BI0A 2XUUA 3RPSA 3G2FA 3HGKA 3PA5A 4LI5A 4C38A 1XBCA 2CJMA 4O96A 5F95A 3D2KA 4Y95A 4I6HA 2LGCA 3CD3A 1QMZA 1UU9A 2WOTA 3ORIA 3TNIA 4C34A 4I24A 3V01A 3ZEPA 4CTBA 4I93A 4GFGA 3F69A 4JAJA 3PP1A 4MVFA 1JSTA 3QGWA 3LQ3A 1TVOA 3OC1A 4L68A 3LM5A 3RGFA 4ALWA 4ZTMA 5A4EA 3N4VA 4YGAA 4CKRA 4ERKA 5AUYA 4WBBB 5EH0A 5EQPA 3RZBA 3QCXA 2WQMA 4RMZA 1YI6A 2JKOA 2ITPA 3COIA 4XV9A 3O7LB 3JVSA 5ANKA 5HNBA 1PXNA 4GL9A 4XH6A 4IC7A 4X2FA 3KQ7A 3T9TA 4AOIA 4EOPA 4H3QA 4CFFA 2YWPA 3FXWA 4I0TA 5CT7A 3L1SA 4D2RA 4U44A 4DLJA 4QEBA 2NNWB 3R21A 4WT6A 3VBQA 3IW5A 4NTSA 3OOGA 2QNJA 2ETKA 4FTQA 4IZYA 1XO2B 5EK7A 1Y57A 3NAYA 3EYGA 3R9NA 3CPCA 3FQSA 4EWHA 1PXMA 3MFUA 5HD7A 2SRCA 5ANEA 4ZSEA 5CAPA 4PX6A 5HQ0A 1O6YA 4NSTA 3QUPA 4FTMA 4HYUA 1GZ8A 3P7CA 1GJOA 3QZGA 4UZDA 3CIKA 3GOPA 2RIOA 3Q9ZA 3QZHA 5H3QA 1H1WA 3OCBA 5TKDA 3SG8A 4O83A 1URCA 3D9VA 3RPOA 3Q32A 3DJ5A 3W55A 3LXPA 4FT0A 5HE0A 3W1FA 4AT4A 2C6IA 2UW8A 4MCVA 4FZAB 4U40A 4Y72A 4X3FC 5DE2A 1YQJA 3MV5A 1NT2A 1H1QA 2ZOQA 4YJNA 2CCIA 4JOAA 3F3WA 4J97A 1IAJA 1XBAA 2VWYA 3OBGA 3ZCLA 2W1GA 3GEQA 4QPAA 4BDFA 2CDZA 2PVRA 3REPA 2Q83A 4GSBA 3HKOA 4QPSA 4RWKA 3NNXA 4XS2A 3SRVA 4EHVA 3P5KA 1OUYA 4IQ6A 1KUTA 1GIHA 2BPMA 3F66A 3ODZX 4FV0A 3VC4A 2X81A 3CE3A 4QMTA 4FTCA 2J2IB 4QMNA 3DAJA 4F08A 3DY7A 2R9SA 3HMIA 4I6BA 1V0PA 4MXAA 3NFGB 3H9FA 3MJ1A 2JKQA 3CD8A 4L67A 2XK6A 4TWCA 4A4OA 3B8RA 4AT5A 4QMQA 1ZY5A 3FMMA 4E4LA 2CGUA 2UW4A 4NW5A 3D2IA 4QTAA 4EBVA 2XRUA 1K2PA 4O84A 4JRNA 4MEDA 3VS3A 3PSDA 3C0GA 3NUNA 3BKBA 4QP4A 3ZDUA 3UVQA 1RW8A 4YO6A 5HIDA 3R02A 5K5NA 4R6VA 2BRGA 2XM8A 2F7ZE 4GK3A 4FUXA 4AZWA 1LPUA 1KOAA 1NVQA 5L8JA 2DWBA 2I0VA 2ITYA 2WXVA 3SXSA 4FBXA 4G3FA 4ZTQA 4L3PA 3T3UA 4IANA 1OM1A 4DGGA 3ZDIA 3MESA 3Q3BA 2HOGA 2ZMCA 2XARA 5H9BA 4QMVA 3QX2A 4O38A 3ZRMA 4DEIA 2BZHB 3D15A 3VN9A 3E3PA 4O81A 1S9JA 4N6YA 3E8NA 2QD9A 4DGNA 4C2WA 4GH2A 4GK2A 4D4SA 3V5JA 2UW9A 3BLAA 3ALNA 4ALUA 2F2UA 2C69A 4LRMA 4PDSA 3DZQA 5EW8A 1U46A 1OL6A 4OBOA 4JDKA 4H3BA 1QPCA 4V01A 4W4YA 4A06A 3E64A 4IWPA 5EG3A 3R7VA 1HCKA 3LMIA 1J7IA 4GG7A 4EQMA 3HP5A 4WUAA 2Z7LA 2H8HA 5IUHA 3PRFA 2R3FA 2ZM3A 3BCEA 3G0EA 3LFCA 3QTZA 4PWNA 1W8CA 3VQUA 2VO7A 4FEXA 4H58A 2YDJA 4FV3A 3NEWA 2FSOX 4GFOA 3OWKA 4F63A 1BMKA 1MP8A 2C47A 3UNZA 4IFGA 4EJ7A 2RGPA 4XV1A 2GTMA 4FG8A 2XZSA 5F4NA 3BHUA 1IR3A 5E8YA 1Z57A 3LFQA 3BELA 3FLYA 3MB7A 1R78A 3HRCA 4YLKA 3ZM4A 5CVGA 5C4LA 3UDTA 3TTIA 4FTIA 2XNMA 2YACA 3G6GA 4FV5A 1JVPP 4RX7A 4E93A 5HX8A 2GHLA 3FLWA 3HUCA 3NWWA 5DT0A 3HNGA 2OI4X 2OFVA 3I0QA 4QP3A 4QMSA 3UNKA 3RNIA 1ZZLA 3ATTA 3W16A 4XG2A 3UP7A 2ZB0A 2RG6A 3UJGA 3TDVA 4YJTA 1MRVA 2FYSA 5LVPA 1YOLA 1H1PA 3D5UA 4H1MA 5CS6A 2BCJA 5BVDA 4AU8A 2VTHA 3COHA 4LOOA 4K0YA 4PP7A 4F9BA 2ITOA 4TWNA 4E20A 4IJPA 3PXQA 5D41A 4PMMA 3EZRA 3R2BA 2ITZA 1JWHA 2X8IA 2JBPA 1MQBA 1YKRA 1ZXEA 3EYHA 3FMDA 3NYXA 1Q3DA 2ACXA 3W10A 4YJVA 3C4CA 4U0IA 4FYOA 3NLBA 5CVHA 3C9WA 3WE8A 4C36A 1SM2A 2YITA 2J6MA 3BX5A 3CJGA 2BDWA 4LL5A 2WIHA 3H4JA 3KF7A 3QZIA 5CEQA 3ORXA 4JVGA 5BQ0A 3IOPA 1I44A 3AGMA 5E90A 3QBNA 4BY9E 4X3FA 1E1VA 2B55A 3O8PA 3ZU7A 2YCSA 5EDRA 1MRUA 3M11A 3UMXA 4DH1A 4EH3A 4IB5A 2AUHA 2XB7A 2CKPA 2PVJA 3GU6A 4LMUA 4CGAA 3AD6A 5IF1A 2VGPA 2ITVA 3LFFA 5J8IA 4M3QA 3LVPA 5DG5A 2I0YA 1Y8YA 3WOWA 5IA4A 1OITA 5C8MA 5DRDA 2R3OA 4M68A 2OJGA 4WRGA 3BBTB 4AW2A 3KCKA 3OMVA 4DCAA 3GP0A 5KZIA 5HD4A 2ITXA 1H1SA 2G2HA 3PFQA 2XM9A 4L45A 3C13A 4FEVA 3A99A 3VQHA 2RFDA 3OROA 3EQDA 3QRJA 4FKJA 4D5HA 3BL7A 2XJ2A 3OP5A 5GINE 2FGIA 5DOSA 5FTQA 4FK3A 4USEA 2Q0BA 4I22A 2UZWE 4I5MA 4O0YA 4CEGA 4QTCA 3W2CA 4DFXE 4X6RA 5BMMA 1OVEA 2BRHA 3SHEA 5CQUA 5FBOA 2WGJA 4QMWA 5KZ0A 4CKJA 4EHGA 3TZ8A 5BNJA 3UVRA 5I4NA 3FYJX 4WG4A 2O8YA 4EOIA 3DK7A 3NPCA 2I0HA 5CSWA 1JSVA 2HK5A 5EI6A 3W2OA 5JRSA 4CQEA 2VO3A 3GQIA 5DA3A 5HVYA 3IS5A 3ENMA 4BZDA 4EH4A 3COKA 1WBPA 3QUEA 4O0XA 5CAQA 4FNYA 4U81A 3O71A 1FPUA 3KULB 3SOAA 4XBRA 3PY3A 2BDJA 4TL0A 3OUKA 2JDOA 4FE2A 2W5AA 4CMOA 5J9ZA 4AZTA 5FM2A 3CQWA 4NM0A 3IQ7A 4U8ZA 4QO9A 1FQ1B 4FKGA 3ZM9A 2Z7RA 4F9CA 3AC3A 4XEYA 2YM8A 2VWWA 3FXXA 3QRIA 4RWIA 2QI8A 4FNWA 3MY1A 4IWOA 3LZBA 1SVHA 5JKGA 2ERKA 4XRJA 4YZDA 2E9OA 1ZWSA 2JKKA 3NW6A 1E9HA 2C1BA 2WAJA 4AA0A 5I9ZA 1IG1A 4YJSA 4F0GA 3HYHA 3CGFA 2WKMA 1IASA 4YUQA 4S30A 3Q60A 3THBA 3I6UA 3ZBFA 4ASZA 4RIYA 3P5JC 5EQEA 4C02A 2R3MA 2VWUA 3AC8A 1H24A 4UZHA 5G1XA 5BPYA 2WTDA 2GTNA 3DJ6A 3SA0A 2NO3A 4A9RA 3FKOA 2UW6A 4CFNA 3W0RA 3ZZEA 3LW0A 2R3IA 2VRXA 4M14A 5IUIA 5IU2A 5FTGA 3NIEA 2XIKA 5TR6A 4EL9A 2UZBA 3QUDA 3R04A 3E63A 2I7QA 3KA0A 4S32A 1JKSA 1JOWB 1X8BA 4FNXA 4M69B 1BX6A 3QRTA 3RAKA 3U9CA 3HV7A 5EHOA 4EOJA 2YZLA 2P2HA 3QQHA 4MHAA 2UVYA 4QRCA 3TCPA 5KNJA 2B9HA 4BDBA 4F09A 2HY81 3SD0A 2BZIB 3OW3A 1O6KA 3VS2A 3AD5A 4Q9SA 4E7WA 1VJYA 4MNEB 1V1KA 4HVHA 3MH0A 3OWJA 2W1EA 5H8GA 3VBYA 3D0EA 3Q96A 5AP0A 4R7BA 1OIRA 5GJGA 5CASA 3H0YA 4ONAA 4CLJA 4D58A 3R9RA 1VLRA 2E9VA 2PMNX 2Y6OA 4BYJA 1OKVA 5CSXA 1BYGA 5AWMA 4KIOA 4L53A 5DH3A 4NUSA 1YXSA 4M7IA 4ZXTA 2YFXA 4E5BA 2ITUA 3A8WA 1U5RA 4M97A 2JGZA 1ST4A 2W99B 5KMJA 5FRIA 4AXDA 5IA2A 3PE1A 1U5QA 4B9DA 4PNIA 4EI4A 4GMYA 2WMQA 1Q97A 3IW8A 2PSQA 3WBLA 4D4RA 1DI9A 4FKOA 1UNLA 5M53A 2UZDA 3C7QA 3LQ8A 3KMWA 3VUKA 4RX5A 4C7TA 4WUNA 1JLUE 5HU9A 2ZV8A 3E62A 4GVAA 3DXNA 2VTPA 2XYUA 3BL9A 4KNBA 1B38A 4B0GA 3DV3A 3KVWA 3OCGA 5B2MA 2HIWA 1OMWA 4EONA 2CLXA 4AZSA 1CKIA 2EXCX 2WTCA 5FUTA 3GXLA 5FM3A 3L8XA 3ORKA 3N9XA 3R63A 4AOJA 1YVJA 3UBDA 3KN5A 3P79A 1Q8YA 1M17A 2PUIA 4EK6A 2F4JA 4YR8A 3KULA 3EN7A 2P4IA 4EYMA 5IA3A 5J1VA 4YTIA 2YIRA 3KU2A 3PVBA 3U54A 3DNDA 1Z9XA 5KKRC 2ZV2A 4DH8A 4FTOA 2HZIA 4FIEA 2HCKA 3OTUA 1KE7A 3MB6A 3I81A 4Z55A 5HIEA 3IGGA 2X6EA 2BMCA 4MH7A 1OL2A 5E1SA 5E8XA 4G3EA 3MPAA 4FV2A 3RPVA 4AX8A 4EK4A 3PG1A 2UVZA 1WCCA 4MNFA 3ZSIA 3FSFA 4FKIA 4AS0A 4IZ7A 3NDMA 3V5WA 3S00A 3W18A 2R0IA 4U43A 5KHXA 5AM7A 2CNUA 5DR9A 4JL9A 4L01A 1MRYA 3KKVA 3S0OA 3P86A 3R22A 5HO7A 5JSMA 2PL0A 2HXQA 3QQKA 4H36A 3TL8A 2QHMA 4A9SA 2GNJA 4BDKA 5IPJA 4K6ZA 5KKRB 3GFEA 3PJ3A 3R1SA 1WAKA 4RJ7A 2ZM4A 2P2IA 3C4ZA 3UO6A 2QR8A 3R30A 3ULZA 2HZ0A 2OXXA 4EC9A 3FZRA 2XAOA 3O51A 3UIMA 4AA5A 4RJ6A 1OL5A 2XNOA 5L8KA 4RQVA 5AMNA 1WBSA 4MNEA 3WZEA 5BUEA 4G2FA 3NS9A 3QKKA 2Y7JA 3GFWA 2ZMDA 3K5VA 2ITQA 4XX9A 4TPTA 2WB8A 1ZYLA 3LKMA 4IAIA 1URWA 3CQEA 2BRMA 2WMWA 4LYNA 5FXQA 5AA9A 3QWKA 3CQUA 2CMWA 3E93A 4O0UA 4AZEA 5IQCA 4AN9A 4DT8A 4BCGA 3FPQA 3ORTA 5EM6A 3TN8A 1Q8WA 5D1JA 3F5PA 3LFBA 2IPXA 3A7JA 4MWHA 3VS6A 4CRLA 3FZSA 4FSUA 1ZMVA 3EZVA 2F7XE 2R3NA 3O17A 4RVTA 4D0WA 3D5XA 4BCKA 4F6UA 2XIXA 4XG4A 3KRLA 1OIYA 3K3IA 1FGIA 3HMMA 3BGPA 2VTMA 2X1NA 2FA2A 5HZNA 4CXAA 3QTSA 3QCYA 4DA5A 1F3MC 1OGUA 2B52A 3DB6A 4KIPA 4DT9A 4HVSA 4I6FA 2JFLA 4PTGA 5LWNA 5AM6A 5IEYA 2CCHA 3OOMA 4U80A 5CZIA 3FMNA 1KWPA 1R3CA 4C4GA 3H30A 1YI4A 3TMOA 1YHWA 3G9LX 2VD5A 2IO6A 3KB7A 3HMPA 2VTQA 4I92A 4YNOA 4AP7A 2CGWA 3AKKA 5I9VA 3PLAE 3R71A 2W4KA 4BB4A 2J9MA 5AP3A 4YZNA 4G6LA 4D5KA 5KUPA 5I5ZA 4Y73A 5CTPA 3HA8A 1UU8A 4GUEA 4H3PA 3DLZA 3FDNA 3ORMA 1DAYA 3LJ0A 3KXNA 4M13A 3W33A 1UWJA 4FV8A 3HL7A 5CQWA 4IM0A 5E8SA 1LP4A 2QKWB 3IO7A 1XBBA 2PVKA 3PPZA 5ACBC 4EKKA 3LCKA 4C3FA 4YBJA 2I0EA 4L52A 1G5SA 4CZTA 2R2PA 5JH6A 1ZY4A 1TKIA 3ZMMA 4OGRA 4BDGA 3W32A 3A7GA 4F6WA 5CI6A 3MI9A 4BRXA 2W9FB 3NNVA 1M2QA 2Y0AA 3TUCA 4L42A 3GC0A 4F65A 4YSJA 2XBJA 1FVVA 5LQFA 3I60A 3ZUTA 4C4IA 5AUUA 4HPTE 5CALA 4FKQA 2QOHA 4RRVA 5TT7A 5ANIA 4DEAA 3ORLA 4L44A 3I7BA 4G34A 2PE1A 4BCPA 4NFNA 1H00A 2UZTA 3UDSA 2Y4PA 4FGBA 4HGLA 4ASEA 2OBJA 2ZJWA 4FIGA 5EYMA 2J0LA 2QG7A 4NKSA 4L7SA 3ZONA 2OXYA 4USFA 2R3HA 1VYWA 3EN6A 3ETAA 4QQJA 3KFAA 5L3AA 4G9RA 3FC2A 3N4TA 1YDSE 5EDQA 4OTIA 4IX4A 3F9NA 4DTBA 3BEGA 3TYKA 1YDTE 3U9NA 1QL6A 5IMXA 4KD1A 3S2PA 3P08A 4ID7A 2B0QA 3EL8A 1F5QA 4LUEA 4HGEA 3ZLWA 5AIKA 1JKLA 2C1AA 3MH2A 3ZSHA 4QYYA 3DJ7A 4TRLA 4AN3A 3CKWA 2B9IA 2HWOA 5JFVA 2JIIA 4YJQA 2BFXA 2GNGA 1GZNA 4D1XA 4ALVA 2CKEA 3A60A 5HGIA 4KKEA 4MXZA 4NW6A 2YAKA 1Q8TA 4LG4A 2V55A 5M09A 2VNYA 2G2IA 4ITJA 1B39A 5EQYA 1O6LA 1R0PA 4FX3A 3KRRA 3PWYA 4I21A 3TG1A 5K9IA 4IHPA 3QQUA 3PXYA 2WHBA 4BGGA 5A4CA 2YABA 3TV4A 2V5QA 3E7VA 3UODA 5JZJA 3R9OA 4IC8A 4C4HA 3SRVB 3ZLSA 4JDIA 1OI9A 4RVMA 4X2JA 3NVKI 3E8CA 3KY2A 5F9EA 5K4IA 4IAYA 4CTCA 5M07A 1G8JA 5GNKA 3DOGA 3UPZA 3DK3A 3F3TA 1P4OA 3WI6A 4YPSA 5CXZA 4R3PA 3UDZA 3RHXA 2YWVA 3RM6A 4LQMA 3WF6A 4ANLA 3T9IA 1ZMUA 5AA8A 2XIYA 3BYOA 3NYOA 3R1NA 4MBJA 3O23A 5M51A 4GKHA 2XIZA 3ZO3A 5IDPA 4ZS4A 3QTUA 3KCFA 4DAWA 1KE9A 2GSFA 3MA3A 3UIBA 4Q2AA 2PULA 2X7FA 5AUVA 3F5GA 4W8EA 2QOBA 1FMOE 3F82A 3GCPA 2V7AA 3GCVA 4FKSA 4RLLA 3PZEA 5BMSA 4NWMA 3LOKA 3ZUVA 3LFAA 3VF9A 4EH8A 4ZMFA 2XNNA 2C3IB 3RK9A 2OGVA 4XRLA 4BCNA 4D0XA 3QLFA 3IK3A 1PMVA 4FIFA 3ZUUA 3AMYA 4GU9A 3PRIA 1PXJA 4APPA 3LLTA 3BZ3A 4ZJJA 1A06A 5BVNA 4L46A 3VW6A 1FBNA 1YOMA 4L00A 4O7LA 4UV0A 3FL4A 4XV3A 2PVNA 2WIPA 3RWQA 3TNHA 1BI8A 5EYCA 4AXAA 4J98A 3OWLA 4A9UA 4IE9A 3Q04A 5GIOE 4IBMA 3D94A 4J96A 5H8EA 4M84A 5CSHA 3UP2A 3G6HA 3R1YA 4K11A 4D2SA 3U6HA 4FT3A 4YNEA 3R8PA 2VTRA 2B7AA 3S3IA 2E2BA 3R01A 5J95A 3FI4A 2V62A 2NPQA 3Q9WA 4KABA 1ZOEA 3L8VA 3QTRA 4HCUA 4YTHA 2E9PA 2YCQA 2C5VA 4O21A 3DBQA 3OXZA 4WHZA 4ZAUA 4DTAA 1EH4A 2BAKA 4KIQA 5JMSA 4QTEA 3TUDA 2PTKA 3D83A 3NMUF 3ZYAA 3MIYA 4YU2A 2AC3A 1WBNA 1IA9A 1JPAA 2JBOA 3FHIA 3EQGA 5C03A 4LUDA 1PW2A 4ZLOA 4DHFA 3CBLA 4KA3A 4PDOA 3VRZA 2OF4A 4O7YA 4QQCA 5M4UA 3AG9A 4FJVA 4JG6A 4KS8A 4EOQA 4OTDA 4YZBA 3MJ2A 3I79A 4D9TA 2EXMA 3TZ7A 1OBDA 4WO5A 2A1AB 1ZAOA 2HAKA 3NW7A 2QLQA 2VTSA 2YM4A 4TN6A 4DFZE 2HYYA 2C0TA 4NZWB 5FXSA 1NVRA 3VHEA 3ZRKA 3ZXZA 2UW7A 4IMYA 3DCVA 3V8TA 3OF0A 1WBWA 4FMQA 3C5IA 4S31A 4QYEA 1XQZA 4X6QC 4XMOA 4B4LA 2BFYA 4Z9LA 3WZJA 4G6OA 3AMAA 3MWUA 4IX6A 3QGYA 1P5EA 4XP3A 4NM7A 3LFEA 4TZRA 2PMIA 1A9UA 3P1AA 5EYDA 5J1WA 4UB7A 4AWIA 4O0RA 4YJUA 3W0NA 5IQEA 3BRBA 5EM7A 5L6WL 1JSUA 3DXQA 4BTMA 3NUUA 2WD1A 4ZIMA 1H26A 1YXUA 5E4HA 3VS0A 4BDIA 3LE6A 4ZJIA 3RAHA 4O6LA 3VUHA 2QODA 3Q2MA 2GQRA 5D12A 3SOCA 4DTKA 2XJ1A 4ZTNA 5AV2A 3FXZA 4RIWB 2BVAA 5BYZA 4F7LA 1UWHA 4GU6A 3BEAA 3KXMA 3QA0A 1ZOGA 5E9EA 5IG1A 4G31A 4FKUA 4O7NA 4FODA 4NM3A 4JT3A 1ZZ2A 4L43A 2JAMA 2VO0A 2VWZA 3QX4A 3PP0A 4R3RA 4X2NA 5CWZA 3G51A 3A4OX 5CAVA 3VBXA 2O64A 3QTXA 3Q4TA 3LMGA 4X3FB 4R5YA 4M0ZA 1XMMA 5DT3A 3FHRA 4AGWA 3WYXA 3NUYA 4HJOA 5LMKC 3DPKA 2C3JA 3OBJA 4QMXA 3ZH8A 3Q6WA 4TKSA 1DM2A 4O22A 5LMBA 3DZOA 1PXKA 4DBXA 4BZNA 1QPJA 5KMMA 2RF9A 2G2FA 4ENXA 3QQJA 3O2MA 4U3YA 4FKRA 3QQLA 4D1ZA 3E8EA 4FI1A 4YP8A 4BCFA 5HLPA 2WTVA 2AC5A 5IQIA 4LM5A 2VTTA 2WELA 1VR2A 4TTHB 5E8TA 4BI1A 2GFCA 2GFSA 3HRFA 2CNQA 3JS2A 1U59A 5HBJA 3OTVA 3BQCA 4FV9A 4P5ZA 5ANGA 3A61A 1H28A 5ANOA 4G5JA 3KXGA 3PJCA 5E7RA 4Y85A 4FSQA 5AEPA 4H1JA 4EWQA 3CS9A 3T3VA 5EDPA 2IW8A 3HAVA 4BGQA 2P0CA 4YLJA 4ZSLA 4BTFA 3P4KA 3QHWA 3DFAA 2GPHA 4ANQA 4CCUA 2YM6A 4IAFA 2P33A 1JAMA 3HDNA 1J7LA 4RJ8A 5CYIA 5C26A 1KE8A 2IVUA 3R8UA 1GZKA 4WKQA 2NRYA 4ACGA 1A48A 3FLSA 4KSQA 4GKIA 3POZA 5D11A 3LXLA 1J1CA 5DEYA 4RA4A 3SG9A 1AQ1A 2UZUE 1PXOA 3F61A 2X4ZA 5AP6A 3ACJA 3V8SA 1WVWA 1GIIA 3H3CA 3E87A 2OJIA 4F99A 3NW5A 3ZFYA 1TQMA 5J9LA 3NR9A 5FG8A 4YHTA 2GMXA 2PVYA 3LCDA 3OS3A 4MXOA 3W0QA 2JAVA 3RHKA 4BCMA 1GZOA 3W2PA 1OL1A 4Z7HA 5IQFA 3F3VA 4FSNA 4FTAA 1OIQA 4IAZA 1APME 4ZY5A 4AF3A 4L9IA 3SX9A 2WNTA 3BU6A 5JFWA 5A54A 4O7RA 2GU8A 4RIYB 4DG0E 2DS1A 3OT3A 4TNDA 4YSMA 4ANSA 4AZVA 4Q9ZA 2CN8A 1PXPA 4S34A 2OFUA 4YC8A 3UMWA 3W2RA 5EOLA 3MVJA 2PYWA 3ALOA 3L9NA 1WFCA 4AGDA 2WMVA 2UZVA 3PJ8A 1NW1A 1TFFA 2R0UA 5BV3A 4GV1A 1Q8ZA 2OK1A 3JVRA 1OKWA 2QC6A 4XG6A 5LJJA 2R7IA 4C62A 4F0IA 3DDQA 3M42A 4JQEA 3K5UA 3ANRA 3NUPA 3EQRA 3DTCA 4BHZA 4IFCA 4RJ4A 3MA6A 5AX9A 3F3UA 5L2WA 3Q2JA 4IVAA 4RIWA 4F9AA 4HVIA 3B2WA 4EHZA 4YO4A 3C1XA 3HV3A 3ZLYA 3Q4ZA 4U5JA 2UV2A 3AXWA 2YM3A 3AC4A 3KIOC 4KRCA 5I0BA 4U79A 5C4KA 3EL7A 1R39A 1W84A 2GNLA 2X7OA 2JFMA 4HZRA 5AV3A 4WOVA 2BAQA 4JG7A 3A7HA 2F7EE 2A4LA 4Y5QA 1OPLA 2XKDA 3LCOA 4F9WA 4AN2A 4HCTA 4PUZA 4CLIA 3DGKA 3TV7A 5LCJA 1XHAA 3QD3A 2OZOA 3Q9YA 4YZMA 4QYFA 3K3JA 4TYEA 3EQFA 2WEIA 3FI2A 2C6TA 3IECA 2JC6A 4E6DA 3HLLA 4O0SA 2YN8A 3ZLXA 2AEGA 2JIUA 3BLQA 5FP5A 4HYSA 5M55A 3G0FA 3GOKA 2X8DA 4BCIA 2OU7A 4JBOA 4AQCA 3O0GA 4OT6A 3NNWA 5CEOA 4IIRA 4YMJA 3UOLA 1M52A 2GQSA 4KB8A 4Q5HA 1OL7A 3AOXA 3S1HA 2EWAA 4DINA 3DQWA 1YDRE 3IG7A 2W5BA 4OUCA 4UXQA 3LIJA 5KBRA 3EQBA 4WG5A 2QQ7A 3QQGA 2IVSA 5IQAA 4AOTA 4FEUA 2PPQA 4EOLA 3A62A 4JR7A 4I41A 3V04A 1SNXA 4KUJA 3KREA 4UX9A 5BX0A 5LMKA 5LVNA 3OW4A 4C35A 4HOKA 4FVQA 5BVKA 4LDTA 4MYGA 2C4GA 5GJDA 1YOJA 3ITZA 3UYSA 4DEHA 1KV2A 2GHMA 3QF9A 4QP2A 1OPKA 4HGTA 4GRBA 4JBQA