The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
115
|
structure length |
110
|
Chain Sequence |
YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSKKETLKVATSKSVYFDRVFTISET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex.
pubmed doi rcsb |
molecule keywords |
RNA polymerase I subunit A49
|
source organism |
Candida glabrata
|
molecule tags |
Transcription
|
total genus |
9
|
structure length |
110
|
sequence length |
115
|
chains with identical sequence |
D, F, H
|
ec nomenclature |
ec
2.7.7.6: DNA-directed RNA polymerase. |
pdb deposition date | 2010-06-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |