3NG7X

Complex of dithionite-reduced 6-hydroxy-l-nicotine oxidase with substrate bound at active site and inhibitor at exit cavity
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystallographic snapshots of the complete reaction cycle of nicotine degradation by an amine oxidase of the monoamine oxidase (MAO) family
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 145
structure length 427
sequence length 427
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ng7X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ng7X02
1JRZA 1NPXA 1TYPA 3AECA 1FCDA 1Q1RA 3H4KA 4YTPA 2QAEA 4A6NA 4D03A 3SM8A 3AE6A 5HY5A 1B5QA 4B1BA 5JCLA 1UKVG 4YSHA 4EMIA 2UZZA 4Z24A 2H88A 2XFNA 4CCQA 4Z2TA 3CPIG 3JSKA 5KXJA 4OPDA 1IUTA 4IV9A 5KOWA 1DOCA 2B9WA 4AT2A 3AWIA 2IVDA 3F8PA 3M12A 1DOEA 1GTHA 2YVGA 1ZY8A 1REOA 2B7SA 2GAHB 2JKCA 1MO9A 2C66A 5BRTA 1YKJA 1JRXA 2Q7VA 3CNSA 5J7XA 4TLXA 4U8OA 4ICYA 3VR9A 3BHKA 1EBDA 3NK1X 3UTGA 2OAMA 4NEVA 5M0ZA 4YSZA 3UOXA 1X31B 1IUVA 3FPZA 4X4JA 4H4WA 3NNEA 3NT6A 2GR0A 2ARDA 3UP4A 1K0JA 2C76A 3GSIA 3RHAA 4A7AA 4D04A 1NENA 5JCKA 4Y4MA 1B8SA 4XXGA 4UP3A 2VQBA 1DOBA 2VRLA 4YKGA 2FJBA 4H4PA 1D4DA 1NDAA 1H81A 2GRTA 2FJDA 2H89A 2RABA 2X99A 1TDOA 3DH9A 3AEBA 1F8SA 3BHFA 4H4VA 2WS3A 2WOVA 5GSNA 4U2TA 4CNJA 2YVFA 1DODA 1NHSA 5FS7A 1KF6A 1H6VA 2GAGB 3KVEA 4LU6A 4ZCDA 1DXLA 3ALMA 3S61A 3L8KA 3GMBA 4XWZA 1GPEA 1CC2A 1PBDA 2EQ7A 1H86A 1H82A 3VRAA 4CBQA 3D1CA 2E1MA 2GMJA 3NK2X 4U8LA 4ZCCA 2V60A 1BKWA 3NN0X 2YLWA 2OLNA 4E0VA 2X8HA 2WP6A 1COYA 3M13A 2WU5A 3NYEA 2JB3A 1LPFA 2XVHA 3K7MX 4M52A 4EIPA 3CNJA 2GH5A 1S2YA 2R0PA 2X8GA 4U8PA 1PS9A 1L9EA 5EB5A 5HYMA 1GOSA 3RP7A 3ADAB 4GRTA 2Q0KA 5FS8A 2BXSA 2XLRA 1EL8A 2B9YA 1BF3A 5ER0A 1JRYA 1GRGA 4J33A 1Y0PA 5C3JA 2NPXA 4X9MA 3PS9A 2YLXA 4K5SA 2Z5XA 3H8LA 1NHQA 3VRDB 1ZK7A 2OA1A 2XVJA 3NN6X 4I59A 4BV6A 4KPRA 4REKA 4TM4A 4OVIA 3UTFA 4EQWA 3NTDA 2YR5A 3IHMA 1F6MA 5FMHA 4CY6A 1GERA 1GRFA 1PXCA 4RG4A 1PBCA 1KFYA 4B65A 3UOYA 3QSEA 1NAAA 3KPFA 1JEHA 1D4CA 4GF7A 1YQZA 4DSGA 1AOGA 1N1PA 1CC4A 4U8KA 4ADWA 2E4GA 4B68A 3AE1A 3SFEA 2BA9A 2YLSA 3AYJA 5TR3A 1F8RA 1GREA 2JAEA 1NG3A 2VOUA 2XVIA 3G5RA 4AT0A 2VVLA 4EM3A 4NTCA 1CJ3A 1PHHA 1VG0A 5GRTA 3UKAA 1LQTA 3V3NA 1TYTA 3SQPA 1PJ6A 1Z6LA 2VQ7A 1GETA 4J31A 4APNA 4LIIA 5KOXA 3GRTA 1PBEA 3CIRA 2X8CA 3KU9A 4USRA 5IQ4A 3KA7A 2YG4A 3UCLA 4H2RA 1GT8A 3VRBA 4Z43A 2WDRA 2V6OA 1H84A 1PN0A 5U25A 2R45A 4JN9A 3ITJA 4DGKA 3K30A 1YQ3A 2FJEA 3P4RA 4Y4NA 2XLTA 3UTEA 5IQ1A 5U63A 3GWFA 1JU2A 2XDOA 3AD8B 4GUVA 2Q6UA 4H2PA 2VRMA 1L9CA 1TDFA 2YG6A 2YG5A 1EL9A 3QFBA 3UOZA 5JCMA 1KSUA 2GV8A 3L1RA 1H7WA 2B76A 5L46A 1E7PA 3LZXA 4B69A 2CDUA 4EQRA 3B3RA 4CRTA 1O95A 1L9DA 2J3NA 1B37A 4MJWA 1SEZA 2ZZCA 5J60A 2WPFA 4J34A 3IWAA 1LV0A 2GEWA 2OALA 3AE5A 2V5ZA 3BI2A 4AOSA 2FBWA 2WEUA 3NLCA 4DSHA 4H4ZA 2EQ8A 1E1MA 2BCGG 2JBVA 1GRTA 5CKUA 3QVPA 5KRQA 4RG3A 5IPYA 3GDPA 2O9ZA 2BCPA 3LADA 4KX6A 3EANA 4DNAA 1FEAA 3E1TA 1E6EA 2WOWA 2AQJA 4OPGA 3SFDA 1OJTA 2YLTA 3NYCA 4C74A 2R0CA 3URHA 3NTAA 3UTHA 2CVJA 1QJDA 5KWFA 1HYUA 3ABVA 2Y6QA 1IUWA 4OPCA 2GF3A 5BUKA 3NYFA 3NKSA 5BULA 3EF6A 2RGJA 4BJYA 3RP8A 1PJ7A 3T37A 1KNPA 5EB4A 3CN8A 1GNDA 3UKLA 4J36A 4EIQA 1H83A 1GXFA 4U2SA 1XPQA 4YWOA 4OPTA 3HZLA 2WP9A 3ICRA 3ICSA 4Z2RA 4YTMA 2AR8A 4Z44A 2GR3A 3AEAA 1TDKA 3UKKA 3NRNA 2GR2A 2C67A 1NEKA 3B6DA 4J56A 4YXDA 2R4EA 4A99A 1BWCA 4JY3A 3DJJA 2YQUA 3QJ4A 4C5OA 2QA2A 4USQA 1D5TA 2CFYA 1MXTA 1M6IA 1E1NA 1XDIA 3R9UA 1NG4A 2Z5YA 3ATQA 1VDCA 3CGDA 2GVCA 3BI4A 3FIMB 2ACZA 4H2QA 1NHPA 4B67A 4CNKA 4H4XA 2ZBWA 2C64A 1ZX9A 4C3XA 1O94A 3AE9A 3H8IA 1TDNA 2WBAA 2VVMA 2XFQA 4OPUA 3LOVA 3AD7B 1BGJA 1PBBA 1LVLA 1D7YA 1RP0A 2BC0A 3NHOX 3P4PA 3CPJG 1OJ9A 4UDRA 1W4XA 3LXDA 4PAAA 4FK1A 1OJCA 2NVKX 4LA1A 1VQWA 3QSMA 3GYJA 3DK8A 2XCGA 2XLPA 3ICTA 1QLBA 2C65A 2R46A 2WPEA 3LB8A 3M0OA 5KVIA 4N9XA 3P9UA 4J57A 1O5WA 4J2WA 3ALLA 4Y4LA 3QSSA 3GMCA 3FBSA 1GV4A 1JNRA 1F3PA 2C3DA 4I58A 3DGHA 2BYBA 4NTDA 1M64A 2TPRA 2A87A 3GYIA 3ATRA 2A8XA 5JCIA 1FECA 2BC1A 2BS3A 3CPHG 4AOXA 1GEUA 3UKQA 3S5WA 4GR1A 3AE3A 3OZ2A 4OCGA 4OPIA 2C70A 3DK9A 2GMHA 1FOHA 4U2LA 4B63A 1S3EA 2ZZ0A 1ZP0A 1EL5A 1E1LA 4FK1C 2DKHA 5KVHA 2YG3A 4TM0A 2XVEA 4H4YA 2XFPA 3DK4A 2APGA 1P2EA 2QCUA 2XLSA 2XYOA 2YLZA 4H50A 5CQFA 1PBFA 1Y56B 5BVAA 2BABA 2V3AA 1CJ4A 2W0HA 3AE7A 3WE0A 2WQYA 4Z26A 2BXRA 4FDCB 1BGNA 4IVMB 1S3BA 4CCRA 4AP3A 3CGBA 3ISHA 1XHCA 4NEWA 3AEGA 4BK2A 4JNQA 4BURA 3II4A 3P1WA 4P9SA 3ZDNA 4EQXA 1QO8A 4HA6A 4TLZA 1E39A 3UOVA 1B4VA 1FEBA 3DA1A 5DBJA 2WOIA 3AEEA 2YVJA 3G5SA 2WDVA 1TDEA 1CBOA 2IIDA 3GD3A 2BACA 2GB0A 2YAUA 2X3NA 1Q9IA 3LJPA 2YLRA 3REDA 1TRBA 3AE2A 4IA6A 1GTEA 2OLOA 2VVLG 3AE4A 1CJ2A 5EOWA 3NG7X 3C4NA 3G5QA 3NH3X 2R4JA 1JNZA 1FL2A 1DNCA 4B66A 1GRHA 3Q9TA 3K7QX 5HXIA 2EQ6A 3AYIA 1YY5A 1VRQB 1ZOVA 3UKFA 2GR1A 1Y56A 2XFUA 1KDGA 3UKHA 4YSXA 2R0GA 1H7XA 3AEFA 4JNAA 2B9XA 2V3BA 4NTEA 4WCTA 2F5ZA 2ZZBA 4ZN0A 4XWRA 2Q0LA 1P2HA 1IUXA 1GRAA 4YTNA 2V61A 4TM1A 4GDEA 4K5RA 3IC9A 4U8MA 1LTXR 2YR6A 3QVRA 1CL0A 1KNRA 4K8DA 2RGHA 3AYLA 4K2XA 4UDQA 4Z25A 2JK6A 4H4TA 4H4SA 4A9WA 2E5VA 1VG9A 2XVFA 1Q1WA 3CNPA 3CTYA 3DMEA 3P4SA 4Z2UA 3AXBA 2YWLA 1N4VA 3D8XA 3RNMA 4H7UA 2WP5A 3EAOA 5EBKA 2RGOA 4AP1A 3DJEA 1N4WA 3UP5A 3BI5A 4C3YA 1ZOYA 3O0HA 1CJCA 1GRBA 3CNDA 3ALJA 1OJAA 2I0ZA 3AB1A 2XLUA 3AE8A 1N4UA 4JDRA 4PABA 2BK4A 2YG7A 2WESA 4K22A 1IUSA 2R9ZA 3F8DA 4UDPA 3FMWA 3NGCX 4NZHA 4BK1A 2PHHA 1K4QA 2WHDA 3SGLA 3K7TA 3LZWA 4FX9A 2IVEA 4EQSA 3GRSA 4WX1A 4IA5A 4JY2A 1PXAA 2GQFA 4ECHA 2WDQA 2BS2A 5JCNA 3C96A 4GDPA 2WETA 1CF3A 3BNMA 5U1OA 4B64A 1YQ4A 4BK3A 1ZKQA 3CGEA 3DJDA 3F8RA 4EMJA 1ZMDA 2DKIA 1BZLA 2HQMA 3C4AA 4RSLA 1V59A 1PJ5A 2JB2A 4A65A 1ONFA 2JB1A 5HHFA 4X9NA 1E1KA 4TM3A 4YT0A 2PYXA 2A89A 1PDHA 2CULA 4JQ9A 1NHRA 1RSGA 1LJ1A 1PXBA 2VZ2A 3GDNA 3I3LA 3AD9B 5M10A 2GQWA 3EPTA 2WU2A 4GCMA 3V3OA 1CHUA 1D7LA 3V76A 3ZYXA 3I6DA 4U8IA 3UKPA 1DJQA 1XANA 2YR4A 3DGZA 3Q6JA 4H2NA 1L0VA 2WPCA 2B7RA 5FS9A 3IHGA 2C7GA 2BS4A 4A6NB 4A5LA 1K0IA 3P4QA 3RP6A 3QFAA 4A79A 3GWDA 5FS6A 2AAQA 2C72A 4BJZA 4YKFA 2X50A 4CY8A 4EMWA 3VQRA 3CNTA 1CC6A 3DJGX 1GALA 3VR8A 3AEDA 3PO7A 3BNUA 4O5UA 4O5QA 1IJHA 3OC4A 2YM1A 1ZMCA 3KLJA 3NK0X 2YM2A 3GD4A 3CGCA 2FJAA 1RYIA 1JOAA 3FG2P 3IF9A 2XFOA 1S2QA 1K0LA 3COXA 1OJDA 1F8WA 2BK3A 3PVCA 4HB9A 1KSSA 1DJNA 5C2TA 1GESA 4C77A 4U8JA 4EM4A 1EL7A 1GSNA 1ELIA 2EQ9A 2BK5A 4IVOB 5LV9A 3NIXA 1MOKA 2QA1A 2C3CA 4U8NA 2TMDA 1IUUA 4H4RA 2C75A 3KKJA 2Y6RA 3KD9A 4OPLA 4H4UA 1D4EA 4K7ZA 4YSYA 4H4QA 1LQUA 2C73A 1ZDLA
chains in the Genus database with same CATH superfamily
1JRZA 1NPXA 1TYPA 3AECA 1FCDA 1Q1RA 3H4KA 4YTPA 2QAEA 4A6NA 4D03A 3SM8A 3AE6A 5HY5A 1B5QA 4B1BA 5JCLA 1UKVG 4YSHA 4EMIA 2UZZA 4Z24A 2H88A 2XFNA 3T0KA 4CCQA 4Z2TA 3CPIG 3JSKA 5KXJA 4OPDA 1IUTA 4IV9A 5KOWA 1DOCA 2B9WA 4AT2A 3AWIA 2IVDA 3F8PA 3M12A 1DOEA 1GTHA 2YVGA 1ZY8A 1REOA 5KMQA 2B7SA 2GAHB 2JKCA 1MO9A 2C66A 5BRTA 1YKJA 1JRXA 2Q7VA 3CNSA 5J7XA 4TLXA 4U8OA 4ICYA 3VR9A 3BHKA 1EBDA 3NK1X 3UTGA 2OAMA 3HYXA 4NEVA 5M0ZA 4YSZA 3UOXA 1X31B 1IUVA 3FPZA 4X4JA 4H4WA 3NNEA 3NT6A 2GR0A 2ARDA 3UP4A 1K0JA 2C76A 3GSIA 3RHAA 4A7AA 4D04A 1NENA 5JCKA 4Y4MA 1B8SA 4XXGA 4UP3A 2VQBA 1DOBA 2VRLA 4YKGA 2FJBA 4H4PA 1D4DA 1NDAA 2BRYA 1H81A 2GRTA 2FJDA 2H89A 2RABA 2X99A 1TDOA 3DH9A 3AEBA 1F8SA 3BHFA 4H4VA 2WS3A 2WOVA 5GSNA 4U2TA 4CNJA 2YVFA 1DODA 1NHSA 5FS7A 1KF6A 1H6VA 2GAGB 3KVEA 4LU6A 4ZCDA 1DXLA 3ALMA 3S61A 3L8KA 3GMBA 4XWZA 1GPEA 1CC2A 1PBDA 2EQ7A 1H86A 1H82A 3VRAA 4CBQA 3D1CA 2E1MA 2GMJA 3NK2X 4U8LA 4ZCCA 2V60A 1BKWA 3NN0X 2YLWA 2OLNA 4E0VA 2X8HA 2WP6A 1COYA 3M13A 2WU5A 3NYEA 2JB3A 1LPFA 2XVHA 3K7MX 4M52A 4EIPA 3CNJA 2GH5A 1S2YA 2R0PA 2X8GA 4U8PA 1PS9A 1L9EA 5EB5A 5HYMA 1GOSA 3RP7A 3ADAB 4GRTA 2Q0KA 5FS8A 5KMSA 2BXSA 2XLRA 1EL8A 2B9YA 1BF3A 5ER0A 1JRYA 1GRGA 4J33A 1Y0PA 5C3JA 2NPXA 4X9MA 3PS9A 2YLXA 4K5SA 2Z5XA 3H8LA 1NHQA 3VRDB 1ZK7A 2OA1A 2XVJA 3NN6X 4I59A 3T14A 4KPRA 4REKA 4BV6A 4TM4A 4GAVA 4OVIA 3UTFA 4EQWA 3NTDA 2YR5A 3IHMA 1F6MA 5FMHA 4CY6A 1GERA 1GRFA 1PXCA 4RG4A 1PBCA 1KFYA 4B65A 3UOYA 3QSEA 1NAAA 3KPFA 1JEHA 1D4CA 4GF7A 1YQZA 4DSGA 1AOGA 1N1PA 1CC4A 4U8KA 4ADWA 2E4GA 4B68A 3AE1A 3SFEA 2BA9A 2YLSA 3AYJA 5TR3A 1F8RA 1GREA 2JAEA 1NG3A 2VOUA 2XVIA 3G5RA 4AT0A 2VVLA 4EM3A 4NTCA 1CJ3A 1PHHA 1VG0A 5GRTA 3UKAA 1LQTA 3V3NA 1TYTA 3SQPA 1PJ6A 1Z6LA 2VQ7A 1GETA 4J31A 4APNA 4LIIA 5KOXA 3SZFA 3GRTA 1PBEA 3CIRA 2X8CA 3KU9A 4USRA 5IQ4A 3KA7A 2YG4A 3UCLA 4H2RA 1GT8A 3VRBA 4Z43A 2WDRA 2V6OA 1H84A 1PN0A 5U25A 2R45A 4JN9A 3ITJA 4DGKA 3K30A 1YQ3A 2FJEA 3P4RA 4Y4NA 2XLTA 3SZWA 3UTEA 5IQ1A 5U63A 3GWFA 1JU2A 2XDOA 3AD8B 4GUVA 2Q6UA 4H2PA 2VRMA 1L9CA 1TDFA 2YG6A 2YG5A 1EL9A 3QFBA 3UOZA 5JCMA 5KMRA 1KSUA 4GAPA 2GV8A 3L1RA 1H7WA 2B76A 5L46A 1E7PA 3LZXA 5KNLA 4B69A 2CDUA 4EQRA 3B3RA 4CRTA 1O95A 1L9DA 2J3NA 1B37A 4MJWA 1SEZA 2ZZCA 5J60A 2WPFA 4J34A 3IWAA 1LV0A 2GEWA 2OALA 3AE5A 2V5ZA 3BI2A 4AOSA 2FBWA 2WEUA 3NLCA 4DSHA 4H4ZA 2EQ8A 1E1MA 2BCGG 2JBVA 1GRTA 5CKUA 3QVPA 5KRQA 4RG3A 5IPYA 3GDPA 2O9ZA 2BCPA 3LADA 4KX6A 3EANA 4DNAA 1FEAA 3E1TA 1E6EA 2WOWA 2AQJA 4OPGA 3SFDA 1OJTA 2YLTA 3NYCA 4C74A 2R0CA 3URHA 3NTAA 3UTHA 2CVJA 1QJDA 5KWFA 1HYUA 3ABVA 2Y6QA 1IUWA 4OPCA 2GF3A 5BUKA 3NYFA 3NKSA 5BULA 3EF6A 2RGJA 4BJYA 3RP8A 1PJ7A 3T37A 1KNPA 5EB4A 3CN8A 1GNDA 3UKLA 4J36A 4EIQA 1H83A 1GXFA 4U2SA 1XPQA 4YWOA 3GYXA 4OPTA 3HZLA 2WP9A 3ICRA 3ICSA 4G73A 4YTMA 2AR8A 4Z2RA 4Z44A 2GR3A 3AEAA 1TDKA 3UKKA 3NRNA 2GR2A 2C67A 1NEKA 3B6DA 4J56A 4YXDA 2R4EA 4A99A 1BWCA 4JY3A 3DJJA 2YQUA 3QJ4A 2BRAA 4C5OA 2QA2A 4USQA 1D5TA 2CFYA 1MXTA 1M6IA 1E1NA 1XDIA 3R9UA 1NG4A 2Z5YA 3ATQA 1VDCA 3CGDA 3CMMA 2GVCA 3BI4A 3FIMB 2ACZA 4H2QA 1NHPA 4B67A 4CNKA 4H4XA 2ZBWA 2C64A 1ZX9A 4C3XA 1O94A 3AE9A 3H8IA 1TDNA 2WBAA 2VVMA 2XFQA 4OPUA 3LOVA 3AD7B 5KMPA 3T2ZA 1BGJA 1PBBA 1LVLA 1D7YA 1RP0A 2BC0A 3NHOX 3P4PA 3CPJG 1OJ9A 4UDRA 1W4XA 3LXDA 4PAAA 3T2YA 4FK1A 1OJCA 2NVKX 4LA1A 4G74A 1VQWA 3QSMA 3GYJA 3DK8A 2XCGA 2XLPA 3ICTA 1QLBA 2C65A 2R46A 2WPEA 3LB8A 3M0OA 5KVIA 4N9XA 3P9UA 4J57A 1O5WA 4J2WA 3ALLA 4Y4LA 3QSSA 3GMCA 3FBSA 1GV4A 1JNRA 1F3PA 2C3DA 4I58A 3SY4A 3DGHA 2BYBA 4NTDA 1M64A 2TPRA 2A87A 3GYIA 3ATRA 2A8XA 5JCIA 1FECA 2BC1A 2BS3A 3CPHG 4AOXA 1GEUA 3UKQA 3S5WA 4GR1A 3T31A 3AE3A 3OZ2A 4OCGA 4OPIA 2C70A 3DK9A 2GMHA 1FOHA 4G6HA 4U2LA 4B63A 1S3EA 2ZZ0A 1ZP0A 1EL5A 1E1LA 4FK1C 2DKHA 5KVHA 2YG3A 4TM0A 2XVEA 4H4YA 2XFPA 3DK4A 2APGA 1P2EA 2QCUA 2XLSA 2XYOA 2YLZA 4H50A 5CQFA 1PBFA 1Y56B 5BVAA 2BABA 2V3AA 1CJ4A 2W0HA 4NWZA 3AE7A 3WE0A 2WQYA 4Z26A 2BXRA 4FDCB 1BGNA 4IVMB 1S3BA 4CCRA 4AP3A 3CGBA 3ISHA 1XHCA 4NEWA 4II2A 3AEGA 4BK2A 4JNQA 4BURA 3II4A 3P1WA 4P9SA 3ZDNA 4EQXA 1QO8A 4HA6A 3KPKA 1E39A 4TLZA 3UOVA 1B4VA 1FEBA 3DA1A 5DBJA 2WOIA 3AEEA 2YVJA 3G5SA 2WDVA 1TDEA 1CBOA 2IIDA 3GD3A 2BACA 2GB0A 2YAUA 2X3NA 1Q9IA 3LJPA 2YLRA 3REDA 1TRBA 3AE2A 4IA6A 1GTEA 2OLOA 2VVLG 3AE4A 1CJ2A 3HYWA 5EOWA 3NG7X 3C4NA 3G5QA 3NH3X 2R4JA 1JNZA 1FL2A 1DNCA 4B66A 1GRHA 3Q9TA 3K7QX 5HXIA 2EQ6A 3AYIA 1YY5A 1VRQB 1ZOVA 3UKFA 2GR1A 1Y56A 2XFUA 1KDGA 3UKHA 4YSXA 2R0GA 1H7XA 3AEFA 4JNAA 2B9XA 2V3BA 4NTEA 4WCTA 2F5ZA 2ZZBA 4ZN0A 4XWRA 2Q0LA 1P2HA 1IUXA 1GRAA 4YTNA 2V61A 4TM1A 4GDEA 4K5RA 3IC9A 4U8MA 1LTXR 2YR6A 3QVRA 1CL0A 1KNRA 4K8DA 2RGHA 3AYLA 4K2XA 4UDQA 4Z25A 2JK6A 4H4TA 4H4SA 4A9WA 2E5VA 1VG9A 2XVFA 1Q1WA 3CNPA 3CTYA 3DMEA 3P4SA 3SZCA 3AXBA 4Z2UA 2YWLA 1N4VA 3D8XA 4G9KA 3RNMA 4H7UA 2WP5A 3EAOA 5EBKA 2RGOA 4AP1A 3DJEA 1N4WA 3UP5A 3BI5A 4C3YA 1ZOYA 3O0HA 3SX6A 1CJCA 1GRBA 3CNDA 3ALJA 1OJAA 2I0ZA 3AB1A 2XLUA 3AE8A 3T2KA 1N4UA 4JDRA 4PABA 2BK4A 2YG7A 2WESA 4K22A 4II3A 3SXIA 1IUSA 2R9ZA 3F8DA 4UDPA 3FMWA 3NGCX 4NZHA 4BK1A 2PHHA 1K4QA 2WHDA 3SGLA 3K7TA 3LZWA 4FX9A 2IVEA 4EQSA 3GRSA 4WX1A 4IA5A 4JY2A 1PXAA 2GQFA 4ECHA 2WDQA 2BS2A 3HYVA 5JCNA 3C96A 4GDPA 2C4CA 1CF3A 2WETA 3BNMA 5U1OA 4B64A 1YQ4A 4G6GA 4BK3A 1ZKQA 3CGEA 3DJDA 3F8RA 4EMJA 1ZMDA 2DKIA 1BZLA 2HQMA 3C4AA 4RSLA 1V59A 1PJ5A 2JB2A 4A65A 1ONFA 2JB1A 4NNJA 4X9NA 1E1KA 4TM3A 5HHFA 4YT0A 2PYXA 2A89A 1PDHA 2CULA 4JQ9A 3SYIA 1NHRA 1RSGA 1LJ1A 1PXBA 2VZ2A 3GDNA 3I3LA 3AD9B 5M10A 2GQWA 3EPTA 2WU2A 4GCMA 3V3OA 1CHUA 1D7LA 3V76A 3ZYXA 3I6DA 4U8IA 3UKPA 1DJQA 1XANA 2YR4A 3DGZA 3Q6JA 4H2NA 1L0VA 2WPCA 2B7RA 5FS9A 3IHGA 2C7GA 2BS4A 4A6NB 4A5LA 1K0IA 3P4QA 3RP6A 3QFAA 4A79A 3GWDA 5FS6A 2AAQA 2C72A 4BJZA 4YKFA 2X50A 4CY8A 4EMWA 3VQRA 3CNTA 1CC6A 3DJGX 1GALA 3VR8A 3AEDA 3PO7A 3BNUA 4O5UA 4O5QA 1IJHA 3OC4A 2YM1A 1ZMCA 3KLJA 3NK0X 2YM2A 3GD4A 3CGCA 2FJAA 1RYIA 1JOAA 3FG2P 3IF9A 2XFOA 1S2QA 1K0LA 3COXA 1OJDA 1F8WA 2BK3A 3PVCA 4HB9A 1KSSA 1DJNA 5C2TA 1GESA 4C77A 4U8JA 3SZ0A 4EM4A 1EL7A 1GSNA 1ELIA 2EQ9A 2BK5A 4IVOB 5LV9A 3NIXA 1MOKA 2QA1A 2C3CA 4U8NA 2TMDA 1IUUA 4H4RA 2C75A 3KKJA 2Y6RA 3KD9A 4OPLA 4H4UA 1D4EA 4K7ZA 4YSYA 4H4QA 1LQUA 2C73A 1ZDLA
chains in the Genus database with same CATH topology
1JRZA 1NPXA 1TYPA 3AECA 1FCDA 1Q1RA 3H4KA 4YTPA 2QAEA 4A6NA 4D03A 3SM8A 3AE6A 5HY5A 1B5QA 4B1BA 5JCLA 1UKVG 4YSHA 4EMIA 2UZZA 4Z24A 2H88A 2XFNA 3T0KA 4CCQA 4Z2TA 3CPIG 3JSKA 5KXJA 4OPDA 1IUTA 4IV9A 5KOWA 1DOCA 2B9WA 4AT2A 3AWIA 2IVDA 3F8PA 3M12A 1DOEA 1GTHA 2YVGA 1ZY8A 1REOA 5KMQA 2B7SA 2GAHB 2JKCA 1MO9A 2C66A 5BRTA 1YKJA 1JRXA 2Q7VA 3CNSA 5J7XA 4TLXA 4U8OA 4ICYA 3VR9A 3BHKA 1EBDA 3NK1X 3UTGA 2OAMA 3HYXA 4NEVA 5M0ZA 4YSZA 3UOXA 1X31B 1IUVA 3FPZA 4X4JA 4H4WA 3NNEA 3NT6A 2GR0A 2ARDA 3UP4A 1K0JA 2C76A 3GSIA 3RHAA 4A7AA 4D04A 1NENA 5JCKA 4Y4MA 1B8SA 4XXGA 4UP3A 2VQBA 1DOBA 2VRLA 4YKGA 2FJBA 4H4PA 1D4DA 1NDAA 2BRYA 1H81A 2GRTA 2FJDA 2H89A 2RABA 2X99A 1TDOA 3DH9A 3AEBA 1F8SA 3BHFA 4H4VA 2WS3A 2WOVA 5GSNA 4U2TA 4CNJA 2YVFA 1DODA 1NHSA 5FS7A 1KF6A 1H6VA 2GAGB 3KVEA 4LU6A 4ZCDA 1DXLA 3ALMA 3S61A 3L8KA 3GMBA 4XWZA 1GPEA 1CC2A 1PBDA 2EQ7A 1H86A 1H82A 3VRAA 4CBQA 3D1CA 2E1MA 2GMJA 3NK2X 4U8LA 4ZCCA 2V60A 1BKWA 3NN0X 2YLWA 2OLNA 4E0VA 2X8HA 2WP6A 1COYA 3M13A 2WU5A 3NYEA 2JB3A 1LPFA 2XVHA 3K7MX 4M52A 4EIPA 3CNJA 2GH5A 1S2YA 2R0PA 2X8GA 4U8PA 1PS9A 1L9EA 5EB5A 5HYMA 1GOSA 3RP7A 3ADAB 4GRTA 2Q0KA 5FS8A 5KMSA 2BXSA 2XLRA 1EL8A 2B9YA 1BF3A 5ER0A 1JRYA 1GRGA 4J33A 1Y0PA 5C3JA 2NPXA 4X9MA 3PS9A 2YLXA 4K5SA 2Z5XA 3H8LA 1NHQA 3VRDB 1ZK7A 2OA1A 2XVJA 3NN6X 4I59A 3T14A 4KPRA 4REKA 4BV6A 4TM4A 4GAVA 4OVIA 3UTFA 4EQWA 3NTDA 2YR5A 3IHMA 1F6MA 5FMHA 4CY6A 1GERA 1GRFA 1PXCA 4RG4A 1PBCA 1KFYA 4B65A 3UOYA 3QSEA 1NAAA 3KPFA 1JEHA 1D4CA 4GF7A 1YQZA 4DSGA 1AOGA 1N1PA 1CC4A 4U8KA 4ADWA 2E4GA 4B68A 3AE1A 3SFEA 2BA9A 2YLSA 3AYJA 5TR3A 1F8RA 1GREA 2JAEA 1NG3A 2VOUA 2XVIA 3G5RA 4AT0A 2VVLA 4EM3A 4NTCA 1CJ3A 1PHHA 1VG0A 5GRTA 3UKAA 1LQTA 3V3NA 1TYTA 3SQPA 1PJ6A 1Z6LA 2VQ7A 1GETA 4J31A 4APNA 4LIIA 5KOXA 3SZFA 3GRTA 1PBEA 3CIRA 2X8CA 3KU9A 4USRA 5IQ4A 3KA7A 2YG4A 3UCLA 4H2RA 1GT8A 3VRBA 4Z43A 2WDRA 2V6OA 1H84A 1PN0A 5U25A 2R45A 4JN9A 3ITJA 4DGKA 3K30A 1YQ3A 2FJEA 3P4RA 4Y4NA 2XLTA 3SZWA 3UTEA 5IQ1A 5U63A 3GWFA 1JU2A 2XDOA 3AD8B 4GUVA 2Q6UA 4H2PA 2VRMA 1L9CA 1TDFA 2YG6A 2YG5A 1EL9A 3QFBA 3UOZA 5JCMA 5KMRA 1KSUA 4GAPA 2GV8A 3L1RA 1H7WA 2B76A 5L46A 1E7PA 3LZXA 5KNLA 4B69A 2CDUA 4EQRA 3B3RA 4CRTA 1O95A 1L9DA 2J3NA 1B37A 4MJWA 1SEZA 2ZZCA 5J60A 2WPFA 4J34A 3IWAA 1LV0A 2GEWA 2OALA 3AE5A 2V5ZA 3BI2A 4AOSA 2FBWA 2WEUA 3NLCA 4DSHA 4H4ZA 2EQ8A 1E1MA 2BCGG 2JBVA 1GRTA 5CKUA 3QVPA 5KRQA 4RG3A 5IPYA 3GDPA 2O9ZA 2BCPA 3LADA 4KX6A 3EANA 4DNAA 1FEAA 3E1TA 1E6EA 2WOWA 2AQJA 4OPGA 3SFDA 1OJTA 2YLTA 3NYCA 4C74A 2R0CA 3URHA 3NTAA 3UTHA 2CVJA 1QJDA 5KWFA 1HYUA 3ABVA 2Y6QA 1IUWA 4OPCA 2GF3A 5BUKA 3NYFA 3NKSA 5BULA 3EF6A 2RGJA 4BJYA 3RP8A 1PJ7A 3T37A 1KNPA 5EB4A 3CN8A 1GNDA 3UKLA 4J36A 4EIQA 1H83A 1GXFA 4U2SA 1XPQA 4YWOA 3GYXA 4OPTA 3HZLA 2WP9A 3ICRA 3ICSA 4G73A 4YTMA 2AR8A 4Z2RA 4Z44A 2GR3A 3AEAA 1TDKA 3UKKA 3NRNA 2GR2A 2C67A 1NEKA 3B6DA 4J56A 4YXDA 2R4EA 4A99A 1BWCA 4JY3A 3DJJA 2YQUA 3QJ4A 2BRAA 4C5OA 2QA2A 4USQA 1D5TA 2CFYA 1MXTA 1M6IA 1E1NA 1XDIA 3R9UA 1NG4A 2Z5YA 3ATQA 1VDCA 3CGDA 3CMMA 2GVCA 3BI4A 3FIMB 2ACZA 4H2QA 1NHPA 4B67A 4CNKA 4H4XA 2ZBWA 2C64A 1ZX9A 4C3XA 1O94A 3AE9A 3H8IA 1TDNA 2WBAA 2VVMA 2XFQA 4OPUA 3LOVA 3AD7B 5KMPA 3T2ZA 1BGJA 1PBBA 1LVLA 1D7YA 1RP0A 2BC0A 3NHOX 3P4PA 3CPJG 1OJ9A 4UDRA 1W4XA 3LXDA 4PAAA 3T2YA 4FK1A 1OJCA 2NVKX 4LA1A 4G74A 1VQWA 3QSMA 3GYJA 3DK8A 2XCGA 2XLPA 3ICTA 1QLBA 2C65A 2R46A 2WPEA 3LB8A 3M0OA 5KVIA 4N9XA 3P9UA 4J57A 1O5WA 4J2WA 3ALLA 4Y4LA 3QSSA 3GMCA 3FBSA 1GV4A 1JNRA 1F3PA 2C3DA 4I58A 3SY4A 3DGHA 2BYBA 4NTDA 1M64A 2TPRA 2A87A 3GYIA 3ATRA 2A8XA 5JCIA 1FECA 2BC1A 2BS3A 3CPHG 4AOXA 1GEUA 3UKQA 3S5WA 4GR1A 3T31A 3AE3A 3OZ2A 4OCGA 4OPIA 2C70A 3DK9A 2GMHA 1FOHA 4G6HA 4U2LA 4B63A 1S3EA 2ZZ0A 1ZP0A 1EL5A 1E1LA 4FK1C 2DKHA 5KVHA 2YG3A 4TM0A 2XVEA 4H4YA 2XFPA 3DK4A 2APGA 1P2EA 2QCUA 2XLSA 2XYOA 2YLZA 4H50A 5CQFA 1PBFA 1Y56B 5BVAA 2BABA 2V3AA 1CJ4A 2W0HA 4NWZA 3AE7A 3WE0A 2WQYA 4Z26A 2BXRA 4FDCB 1BGNA 4IVMB 1S3BA 4CCRA 4AP3A 3CGBA 3ISHA 1XHCA 4NEWA 4II2A 3AEGA 4BK2A 4JNQA 4BURA 3II4A 3P1WA 4P9SA 3ZDNA 4EQXA 1QO8A 4HA6A 3KPKA 1E39A 4TLZA 3UOVA 1B4VA 1FEBA 3DA1A 5DBJA 2WOIA 3AEEA 2YVJA 3G5SA 2WDVA 1TDEA 1CBOA 2IIDA 3GD3A 2BACA 2GB0A 2YAUA 2X3NA 1Q9IA 3LJPA 2YLRA 3REDA 1TRBA 3AE2A 4IA6A 1GTEA 2OLOA 2VVLG 3AE4A 1CJ2A 3HYWA 5EOWA 3NG7X 3C4NA 3G5QA 3NH3X 2R4JA 1JNZA 1FL2A 1DNCA 4B66A 1GRHA 3Q9TA 3K7QX 5HXIA 2EQ6A 3AYIA 1YY5A 1VRQB 1ZOVA 3UKFA 2GR1A 1Y56A 2XFUA 1KDGA 3UKHA 4YSXA 2R0GA 1H7XA 3AEFA 4JNAA 2B9XA 2V3BA 4NTEA 4WCTA 2F5ZA 2ZZBA 4ZN0A 4XWRA 2Q0LA 1P2HA 1IUXA 1GRAA 4YTNA 2V61A 4TM1A 4GDEA 4K5RA 3IC9A 4U8MA 1LTXR 2YR6A 3QVRA 1CL0A 1KNRA 4K8DA 2RGHA 3AYLA 4K2XA 4UDQA 4Z25A 2JK6A 4H4TA 4H4SA 4A9WA 2E5VA 1VG9A 2XVFA 1Q1WA 3CNPA 3CTYA 3DMEA 3P4SA 3SZCA 3AXBA 4Z2UA 2YWLA 1N4VA 3D8XA 4G9KA 3RNMA 4H7UA 2WP5A 3EAOA 5EBKA 2RGOA 4AP1A 3DJEA 1N4WA 3UP5A 3BI5A 4C3YA 1ZOYA 3O0HA 3SX6A 1CJCA 1GRBA 3CNDA 3ALJA 1OJAA 2I0ZA 3AB1A 2XLUA 3AE8A 3T2KA 1N4UA 4JDRA 4PABA 2BK4A 2YG7A 2WESA 4K22A 4II3A 3SXIA 1IUSA 2R9ZA 3F8DA 4UDPA 3FMWA 3NGCX 4NZHA 4BK1A 2PHHA 1K4QA 2WHDA 3SGLA 3K7TA 3LZWA 4FX9A 2IVEA 4EQSA 3GRSA 4WX1A 4IA5A 4JY2A 1PXAA 2GQFA 4ECHA 2WDQA 2BS2A 3HYVA 5JCNA 3C96A 4GDPA 2C4CA 1CF3A 2WETA 3BNMA 5U1OA 4B64A 1YQ4A 4G6GA 4BK3A 1ZKQA 3CGEA 3DJDA 3F8RA 4EMJA 1ZMDA 2DKIA 1BZLA 2HQMA 3C4AA 4RSLA 1V59A 1PJ5A 2JB2A 4A65A 1ONFA 2JB1A 4NNJA 4X9NA 1E1KA 4TM3A 5HHFA 4YT0A 2PYXA 2A89A 1PDHA 2CULA 4JQ9A 3SYIA 1NHRA 1RSGA 1LJ1A 1PXBA 2VZ2A 3GDNA 3I3LA 3AD9B 5M10A 2GQWA 3EPTA 2WU2A 4GCMA 3V3OA 1CHUA 1D7LA 3V76A 3ZYXA 3I6DA 4U8IA 3UKPA 1DJQA 1XANA 2YR4A 3DGZA 3Q6JA 4H2NA 1L0VA 2WPCA 2B7RA 5FS9A 3IHGA 2C7GA 2BS4A 4A6NB 4A5LA 1K0IA 3P4QA 3RP6A 3QFAA 4A79A 3GWDA 5FS6A 2AAQA 2C72A 4BJZA 4YKFA 2X50A 4CY8A 4EMWA 3VQRA 3CNTA 1CC6A 3DJGX 1GALA 3VR8A 3AEDA 3PO7A 3BNUA 4O5UA 4O5QA 1IJHA 3OC4A 2YM1A 1ZMCA 3KLJA 3NK0X 2YM2A 3GD4A 3CGCA 2FJAA 1RYIA 1JOAA 3FG2P 3IF9A 2XFOA 1S2QA 1K0LA 3COXA 1OJDA 1F8WA 2BK3A 3PVCA 4HB9A 1KSSA 1DJNA 5C2TA 1GESA 4C77A 4U8JA 3SZ0A 4EM4A 1EL7A 1GSNA 1ELIA 2EQ9A 2BK5A 4IVOB 5LV9A 3NIXA 1MOKA 2QA1A 2C3CA 4U8NA 2TMDA 1IUUA 4H4RA 2C75A 3KKJA 2Y6RA 3KD9A 4OPLA 4H4UA 1D4EA 4K7ZA 4YSYA 4H4QA 1LQUA 2C73A 1ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRZ A;  1NPX A;  1TYP A;  3AEC A;  1FCD A;  1Q1R A;  3H4K A;  4YTP A;  2QAE A;  4A6N A;  4D03 A;  3SM8 A;  3AE6 A;  5HY5 A;  1B5Q A;  4B1B A;  5JCL A;  1UKV G;  4YSH A;  4EMI A;  2UZZ A;  4Z24 A;  2H88 A;  2XFN A;  4CCQ A;  4Z2T A;  3CPI G;  3JSK A;  5KXJ A;  4OPD A;  1IUT A;  4IV9 A;  5KOW A;  1DOC A;  2B9W A;  4AT2 A;  3AWI A;  2IVD A;  3F8P A;  3M12 A;  1DOE A;  1GTH A;  2YVG A;  1ZY8 A;  1REO A;  2B7S A;  2GAH B;  2JKC A;  1MO9 A;  2C66 A;  5BRT A;  1YKJ A;  1JRX A;  2Q7V A;  3CNS A;  5J7X A;  4TLX A;  4U8O A;  4ICY A;  3VR9 A;  3BHK A;  1EBD A;  3NK1 X;  3UTG A;  2OAM A;  4NEV A;  5M0Z A;  4YSZ A;  3UOX A;  1X31 B;  1IUV A;  3FPZ A;  4X4J A;  4H4W A;  3NNE A;  3NT6 A;  2GR0 A;  2ARD A;  3UP4 A;  1K0J A;  2C76 A;  3GSI A;  3RHA A;  4A7A A;  4D04 A;  1NEN A;  5JCK A;  4Y4M A;  1B8S A;  4XXG A;  4UP3 A;  2VQB A;  1DOB A;  2VRL A;  4YKG A;  2FJB A;  4H4P A;  1D4D A;  1NDA A;  1H81 A;  2GRT A;  2FJD A;  2H89 A;  2RAB A;  2X99 A;  1TDO A;  3DH9 A;  3AEB A;  1F8S A;  3BHF A;  4H4V A;  2WS3 A;  2WOV A;  5GSN A;  4U2T A;  4CNJ A;  2YVF A;  1DOD A;  1NHS A;  5FS7 A;  1KF6 A;  1H6V A;  2GAG B;  3KVE A;  4LU6 A;  4ZCD A;  1DXL A;  3ALM A;  3S61 A;  3L8K A;  3GMB A;  4XWZ A;  1GPE A;  1CC2 A;  1PBD A;  2EQ7 A;  1H86 A;  1H82 A;  3VRA A;  4CBQ A;  3D1C A;  2E1M A;  2GMJ A;  3NK2 X;  4U8L A;  4ZCC A;  2V60 A;  1BKW A;  3NN0 X;  2YLW A;  2OLN A;  4E0V A;  2X8H A;  2WP6 A;  1COY A;  3M13 A;  2WU5 A;  3NYE A;  2JB3 A;  1LPF A;  2XVH A;  3K7M X;  4M52 A;  4EIP A;  3CNJ A;  2GH5 A;  1S2Y A;  2R0P A;  2X8G A;  4U8P A;  1PS9 A;  1L9E A;  5EB5 A;  5HYM A;  1GOS A;  3RP7 A;  3ADA B;  4GRT A;  2Q0K A;  5FS8 A;  2BXS A;  2XLR A;  1EL8 A;  2B9Y A;  1BF3 A;  5ER0 A;  1JRY A;  1GRG A;  4J33 A;  1Y0P A;  5C3J A;  2NPX A;  4X9M A;  3PS9 A;  2YLX A;  4K5S A;  2Z5X A;  3H8L A;  1NHQ A;  3VRD B;  1ZK7 A;  2OA1 A;  2XVJ A;  3NN6 X;  4I59 A;  4BV6 A;  4KPR A;  4REK A;  4TM4 A;  4OVI A;  3UTF A;  4EQW A;  3NTD A;  2YR5 A;  3IHM A;  1F6M A;  5FMH A;  4CY6 A;  1GER A;  1GRF A;  1PXC A;  4RG4 A;  1PBC A;  1KFY A;  4B65 A;  3UOY A;  3QSE A;  1NAA A;  3KPF A;  1JEH A;  1D4C A;  4GF7 A;  1YQZ A;  4DSG A;  1AOG A;  1N1P A;  1CC4 A;  4U8K A;  4ADW A;  2E4G A;  4B68 A;  3AE1 A;  3SFE A;  2BA9 A;  2YLS A;  3AYJ A;  5TR3 A;  1F8R A;  1GRE A;  2JAE A;  1NG3 A;  2VOU A;  2XVI A;  3G5R A;  4AT0 A;  2VVL A;  4EM3 A;  4NTC A;  1CJ3 A;  1PHH A;  1VG0 A;  5GRT A;  3UKA A;  1LQT A;  3V3N A;  1TYT A;  3SQP A;  1PJ6 A;  1Z6L A;  2VQ7 A;  1GET A;  4J31 A;  4APN A;  4LII A;  5KOX A;  3GRT A;  1PBE A;  3CIR A;  2X8C A;  3KU9 A;  4USR A;  5IQ4 A;  3KA7 A;  2YG4 A;  3UCL A;  4H2R A;  1GT8 A;  3VRB A;  4Z43 A;  2WDR A;  2V6O A;  1H84 A;  1PN0 A;  5U25 A;  2R45 A;  4JN9 A;  3ITJ A;  4DGK A;  3K30 A;  1YQ3 A;  2FJE A;  3P4R A;  4Y4N A;  2XLT A;  3UTE A;  5IQ1 A;  5U63 A;  3GWF A;  1JU2 A;  2XDO A;  3AD8 B;  4GUV A;  2Q6U A;  4H2P A;  2VRM A;  1L9C A;  1TDF A;  2YG6 A;  2YG5 A;  1EL9 A;  3QFB A;  3UOZ A;  5JCM A;  1KSU A;  2GV8 A;  3L1R A;  1H7W A;  2B76 A;  5L46 A;  1E7P A;  3LZX A;  4B69 A;  2CDU A;  4EQR A;  3B3R A;  4CRT A;  1O95 A;  1L9D A;  2J3N A;  1B37 A;  4MJW A;  1SEZ A;  2ZZC A;  5J60 A;  2WPF A;  4J34 A;  3IWA A;  1LV0 A;  2GEW A;  2OAL A;  3AE5 A;  2V5Z A;  3BI2 A;  4AOS A;  2FBW A;  2WEU A;  3NLC A;  4DSH A;  4H4Z A;  2EQ8 A;  1E1M A;  2BCG G;  2JBV A;  1GRT A;  5CKU A;  3QVP A;  5KRQ A;  4RG3 A;  5IPY A;  3GDP A;  2O9Z A;  2BCP A;  3LAD A;  4KX6 A;  3EAN A;  4DNA A;  1FEA A;  3E1T A;  1E6E A;  2WOW A;  2AQJ A;  4OPG A;  3SFD A;  1OJT A;  2YLT A;  3NYC A;  4C74 A;  2R0C A;  3URH A;  3NTA A;  3UTH A;  2CVJ A;  1QJD A;  5KWF A;  1HYU A;  3ABV A;  2Y6Q A;  1IUW A;  4OPC A;  2GF3 A;  5BUK A;  3NYF A;  3NKS A;  5BUL A;  3EF6 A;  2RGJ A;  4BJY A;  3RP8 A;  1PJ7 A;  3T37 A;  1KNP A;  5EB4 A;  3CN8 A;  1GND A;  3UKL A;  4J36 A;  4EIQ A;  1H83 A;  1GXF A;  4U2S A;  1XPQ A;  4YWO A;  4OPT A;  3HZL A;  2WP9 A;  3ICR A;  3ICS A;  4Z2R A;  4YTM A;  2AR8 A;  4Z44 A;  2GR3 A;  3AEA A;  1TDK A;  3UKK A;  3NRN A;  2GR2 A;  2C67 A;  1NEK A;  3B6D A;  4J56 A;  4YXD A;  2R4E A;  4A99 A;  1BWC A;  4JY3 A;  3DJJ A;  2YQU A;  3QJ4 A;  4C5O A;  2QA2 A;  4USQ A;  1D5T A;  2CFY A;  1MXT A;  1M6I A;  1E1N A;  1XDI A;  3R9U A;  1NG4 A;  2Z5Y A;  3ATQ A;  1VDC A;  3CGD A;  2GVC A;  3BI4 A;  3FIM B;  2ACZ A;  4H2Q A;  1NHP A;  4B67 A;  4CNK A;  4H4X A;  2ZBW A;  2C64 A;  1ZX9 A;  4C3X A;  1O94 A;  3AE9 A;  3H8I A;  1TDN A;  2WBA A;  2VVM A;  2XFQ A;  4OPU A;  3LOV A;  3AD7 B;  1BGJ A;  1PBB A;  1LVL A;  1D7Y A;  1RP0 A;  2BC0 A;  3NHO X;  3P4P A;  3CPJ G;  1OJ9 A;  4UDR A;  1W4X A;  3LXD A;  4PAA A;  4FK1 A;  1OJC A;  2NVK X;  4LA1 A;  1VQW A;  3QSM A;  3GYJ A;  3DK8 A;  2XCG A;  2XLP A;  3ICT A;  1QLB A;  2C65 A;  2R46 A;  2WPE A;  3LB8 A;  3M0O A;  5KVI A;  4N9X A;  3P9U A;  4J57 A;  1O5W A;  4J2W A;  3ALL A;  4Y4L A;  3QSS A;  3GMC A;  3FBS A;  1GV4 A;  1JNR A;  1F3P A;  2C3D A;  4I58 A;  3DGH A;  2BYB A;  4NTD A;  1M64 A;  2TPR A;  2A87 A;  3GYI A;  3ATR A;  2A8X A;  5JCI A;  1FEC A;  2BC1 A;  2BS3 A;  3CPH G;  4AOX A;  1GEU A;  3UKQ A;  3S5W A;  4GR1 A;  3AE3 A;  3OZ2 A;  4OCG A;  4OPI A;  2C70 A;  3DK9 A;  2GMH A;  1FOH A;  4U2L A;  4B63 A;  1S3E A;  2ZZ0 A;  1ZP0 A;  1EL5 A;  1E1L A;  4FK1 C;  2DKH A;  5KVH A;  2YG3 A;  4TM0 A;  2XVE A;  4H4Y A;  2XFP A;  3DK4 A;  2APG A;  1P2E A;  2QCU A;  2XLS A;  2XYO A;  2YLZ A;  4H50 A;  5CQF A;  1PBF A;  1Y56 B;  5BVA A;  2BAB A;  2V3A A;  1CJ4 A;  2W0H A;  3AE7 A;  3WE0 A;  2WQY A;  4Z26 A;  2BXR A;  4FDC B;  1BGN A;  4IVM B;  1S3B A;  4CCR A;  4AP3 A;  3CGB A;  3ISH A;  1XHC A;  4NEW A;  3AEG A;  4BK2 A;  4JNQ A;  4BUR A;  3II4 A;  3P1W A;  4P9S A;  3ZDN A;  4EQX A;  1QO8 A;  4HA6 A;  4TLZ A;  1E39 A;  3UOV A;  1B4V A;  1FEB A;  3DA1 A;  5DBJ A;  2WOI A;  3AEE A;  2YVJ A;  3G5S A;  2WDV A;  1TDE A;  1CBO A;  2IID A;  3GD3 A;  2BAC A;  2GB0 A;  2YAU A;  2X3N A;  1Q9I A;  3LJP A;  2YLR A;  3RED A;  1TRB A;  3AE2 A;  4IA6 A;  1GTE A;  2OLO A;  2VVL G;  3AE4 A;  1CJ2 A;  5EOW A;  3NG7 X;  3C4N A;  3G5Q A;  3NH3 X;  2R4J A;  1JNZ A;  1FL2 A;  1DNC A;  4B66 A;  1GRH A;  3Q9T A;  3K7Q X;  5HXI A;  2EQ6 A;  3AYI A;  1YY5 A;  1VRQ B;  1ZOV A;  3UKF A;  2GR1 A;  1Y56 A;  2XFU A;  1KDG A;  3UKH A;  4YSX A;  2R0G A;  1H7X A;  3AEF A;  4JNA A;  2B9X A;  2V3B A;  4NTE A;  4WCT A;  2F5Z A;  2ZZB A;  4ZN0 A;  4XWR A;  2Q0L A;  1P2H A;  1IUX A;  1GRA A;  4YTN A;  2V61 A;  4TM1 A;  4GDE A;  4K5R A;  3IC9 A;  4U8M A;  1LTX R;  2YR6 A;  3QVR A;  1CL0 A;  1KNR A;  4K8D A;  2RGH A;  3AYL A;  4K2X A;  4UDQ A;  4Z25 A;  2JK6 A;  4H4T A;  4H4S A;  4A9W A;  2E5V A;  1VG9 A;  2XVF A;  1Q1W A;  3CNP A;  3CTY A;  3DME A;  3P4S A;  4Z2U A;  3AXB A;  2YWL A;  1N4V A;  3D8X A;  3RNM A;  4H7U A;  2WP5 A;  3EAO A;  5EBK A;  2RGO A;  4AP1 A;  3DJE A;  1N4W A;  3UP5 A;  3BI5 A;  4C3Y A;  1ZOY A;  3O0H A;  1CJC A;  1GRB A;  3CND A;  3ALJ A;  1OJA A;  2I0Z A;  3AB1 A;  2XLU A;  3AE8 A;  1N4U A;  4JDR A;  4PAB A;  2BK4 A;  2YG7 A;  2WES A;  4K22 A;  1IUS A;  2R9Z A;  3F8D A;  4UDP A;  3FMW A;  3NGC X;  4NZH A;  4BK1 A;  2PHH A;  1K4Q A;  2WHD A;  3SGL A;  3K7T A;  3LZW A;  4FX9 A;  2IVE A;  4EQS A;  3GRS A;  4WX1 A;  4IA5 A;  4JY2 A;  1PXA A;  2GQF A;  4ECH A;  2WDQ A;  2BS2 A;  5JCN A;  3C96 A;  4GDP A;  2WET A;  1CF3 A;  3BNM A;  5U1O A;  4B64 A;  1YQ4 A;  4BK3 A;  1ZKQ A;  3CGE A;  3DJD A;  3F8R A;  4EMJ A;  1ZMD A;  2DKI A;  1BZL A;  2HQM A;  3C4A A;  4RSL A;  1V59 A;  1PJ5 A;  2JB2 A;  4A65 A;  1ONF A;  2JB1 A;  5HHF A;  4X9N A;  1E1K A;  4TM3 A;  4YT0 A;  2PYX A;  2A89 A;  1PDH A;  2CUL A;  4JQ9 A;  1NHR A;  1RSG A;  1LJ1 A;  1PXB A;  2VZ2 A;  3GDN A;  3I3L A;  3AD9 B;  5M10 A;  2GQW A;  3EPT A;  2WU2 A;  4GCM A;  3V3O A;  1CHU A;  1D7L A;  3V76 A;  3ZYX A;  3I6D A;  4U8I A;  3UKP A;  1DJQ A;  1XAN A;  2YR4 A;  3DGZ A;  3Q6J A;  4H2N A;  1L0V A;  2WPC A;  2B7R A;  5FS9 A;  3IHG A;  2C7G A;  2BS4 A;  4A6N B;  4A5L A;  1K0I A;  3P4Q A;  3RP6 A;  3QFA A;  4A79 A;  3GWD A;  5FS6 A;  2AAQ A;  2C72 A;  4BJZ A;  4YKF A;  2X50 A;  4CY8 A;  4EMW A;  3VQR A;  3CNT A;  1CC6 A;  3DJG X;  1GAL A;  3VR8 A;  3AED A;  3PO7 A;  3BNU A;  4O5U A;  4O5Q A;  1IJH A;  3OC4 A;  2YM1 A;  1ZMC A;  3KLJ A;  3NK0 X;  2YM2 A;  3GD4 A;  3CGC A;  2FJA A;  1RYI A;  1JOA A;  3FG2 P;  3IF9 A;  2XFO A;  1S2Q A;  1K0L A;  3COX A;  1OJD A;  1F8W A;  2BK3 A;  3PVC A;  4HB9 A;  1KSS A;  1DJN A;  5C2T A;  1GES A;  4C77 A;  4U8J A;  4EM4 A;  1EL7 A;  1GSN A;  1ELI A;  2EQ9 A;  2BK5 A;  4IVO B;  5LV9 A;  3NIX A;  1MOK A;  2QA1 A;  2C3C A;  4U8N A;  2TMD A;  1IUU A;  4H4R A;  2C75 A;  3KKJ A;  2Y6R A;  3KD9 A;  4OPL A;  4H4U A;  1D4E A;  4K7Z A;  4YSY A;  4H4Q A;  1LQU A;  2C73 A;  1ZDL A; 
#chains in the Genus database with same CATH topology
 1JRZ A;  1NPX A;  1TYP A;  3AEC A;  1FCD A;  1Q1R A;  3H4K A;  4YTP A;  2QAE A;  4A6N A;  4D03 A;  3SM8 A;  3AE6 A;  5HY5 A;  1B5Q A;  4B1B A;  5JCL A;  1UKV G;  4YSH A;  4EMI A;  2UZZ A;  4Z24 A;  2H88 A;  2XFN A;  3T0K A;  4CCQ A;  4Z2T A;  3CPI G;  3JSK A;  5KXJ A;  4OPD A;  1IUT A;  4IV9 A;  5KOW A;  1DOC A;  2B9W A;  4AT2 A;  3AWI A;  2IVD A;  3F8P A;  3M12 A;  1DOE A;  1GTH A;  2YVG A;  1ZY8 A;  1REO A;  5KMQ A;  2B7S A;  2GAH B;  2JKC A;  1MO9 A;  2C66 A;  5BRT A;  1YKJ A;  1JRX A;  2Q7V A;  3CNS A;  5J7X A;  4TLX A;  4U8O A;  4ICY A;  3VR9 A;  3BHK A;  1EBD A;  3NK1 X;  3UTG A;  2OAM A;  3HYX A;  4NEV A;  5M0Z A;  4YSZ A;  3UOX A;  1X31 B;  1IUV A;  3FPZ A;  4X4J A;  4H4W A;  3NNE A;  3NT6 A;  2GR0 A;  2ARD A;  3UP4 A;  1K0J A;  2C76 A;  3GSI A;  3RHA A;  4A7A A;  4D04 A;  1NEN A;  5JCK A;  4Y4M A;  1B8S A;  4XXG A;  4UP3 A;  2VQB A;  1DOB A;  2VRL A;  4YKG A;  2FJB A;  4H4P A;  1D4D A;  1NDA A;  2BRY A;  1H81 A;  2GRT A;  2FJD A;  2H89 A;  2RAB A;  2X99 A;  1TDO A;  3DH9 A;  3AEB A;  1F8S A;  3BHF A;  4H4V A;  2WS3 A;  2WOV A;  5GSN A;  4U2T A;  4CNJ A;  2YVF A;  1DOD A;  1NHS A;  5FS7 A;  1KF6 A;  1H6V A;  2GAG B;  3KVE A;  4LU6 A;  4ZCD A;  1DXL A;  3ALM A;  3S61 A;  3L8K A;  3GMB A;  4XWZ A;  1GPE A;  1CC2 A;  1PBD A;  2EQ7 A;  1H86 A;  1H82 A;  3VRA A;  4CBQ A;  3D1C A;  2E1M A;  2GMJ A;  3NK2 X;  4U8L A;  4ZCC A;  2V60 A;  1BKW A;  3NN0 X;  2YLW A;  2OLN A;  4E0V A;  2X8H A;  2WP6 A;  1COY A;  3M13 A;  2WU5 A;  3NYE A;  2JB3 A;  1LPF A;  2XVH A;  3K7M X;  4M52 A;  4EIP A;  3CNJ A;  2GH5 A;  1S2Y A;  2R0P A;  2X8G A;  4U8P A;  1PS9 A;  1L9E A;  5EB5 A;  5HYM A;  1GOS A;  3RP7 A;  3ADA B;  4GRT A;  2Q0K A;  5FS8 A;  5KMS A;  2BXS A;  2XLR A;  1EL8 A;  2B9Y A;  1BF3 A;  5ER0 A;  1JRY A;  1GRG A;  4J33 A;  1Y0P A;  5C3J A;  2NPX A;  4X9M A;  3PS9 A;  2YLX A;  4K5S A;  2Z5X A;  3H8L A;  1NHQ A;  3VRD B;  1ZK7 A;  2OA1 A;  2XVJ A;  3NN6 X;  4I59 A;  3T14 A;  4KPR A;  4REK A;  4BV6 A;  4TM4 A;  4GAV A;  4OVI A;  3UTF A;  4EQW A;  3NTD A;  2YR5 A;  3IHM A;  1F6M A;  5FMH A;  4CY6 A;  1GER A;  1GRF A;  1PXC A;  4RG4 A;  1PBC A;  1KFY A;  4B65 A;  3UOY A;  3QSE A;  1NAA A;  3KPF A;  1JEH A;  1D4C A;  4GF7 A;  1YQZ A;  4DSG A;  1AOG A;  1N1P A;  1CC4 A;  4U8K A;  4ADW A;  2E4G A;  4B68 A;  3AE1 A;  3SFE A;  2BA9 A;  2YLS A;  3AYJ A;  5TR3 A;  1F8R A;  1GRE A;  2JAE A;  1NG3 A;  2VOU A;  2XVI A;  3G5R A;  4AT0 A;  2VVL A;  4EM3 A;  4NTC A;  1CJ3 A;  1PHH A;  1VG0 A;  5GRT A;  3UKA A;  1LQT A;  3V3N A;  1TYT A;  3SQP A;  1PJ6 A;  1Z6L A;  2VQ7 A;  1GET A;  4J31 A;  4APN A;  4LII A;  5KOX A;  3SZF A;  3GRT A;  1PBE A;  3CIR A;  2X8C A;  3KU9 A;  4USR A;  5IQ4 A;  3KA7 A;  2YG4 A;  3UCL A;  4H2R A;  1GT8 A;  3VRB A;  4Z43 A;  2WDR A;  2V6O A;  1H84 A;  1PN0 A;  5U25 A;  2R45 A;  4JN9 A;  3ITJ A;  4DGK A;  3K30 A;  1YQ3 A;  2FJE A;  3P4R A;  4Y4N A;  2XLT A;  3SZW A;  3UTE A;  5IQ1 A;  5U63 A;  3GWF A;  1JU2 A;  2XDO A;  3AD8 B;  4GUV A;  2Q6U A;  4H2P A;  2VRM A;  1L9C A;  1TDF A;  2YG6 A;  2YG5 A;  1EL9 A;  3QFB A;  3UOZ A;  5JCM A;  5KMR A;  1KSU A;  4GAP A;  2GV8 A;  3L1R A;  1H7W A;  2B76 A;  5L46 A;  1E7P A;  3LZX A;  5KNL A;  4B69 A;  2CDU A;  4EQR A;  3B3R A;  4CRT A;  1O95 A;  1L9D A;  2J3N A;  1B37 A;  4MJW A;  1SEZ A;  2ZZC A;  5J60 A;  2WPF A;  4J34 A;  3IWA A;  1LV0 A;  2GEW A;  2OAL A;  3AE5 A;  2V5Z A;  3BI2 A;  4AOS A;  2FBW A;  2WEU A;  3NLC A;  4DSH A;  4H4Z A;  2EQ8 A;  1E1M A;  2BCG G;  2JBV A;  1GRT A;  5CKU A;  3QVP A;  5KRQ A;  4RG3 A;  5IPY A;  3GDP A;  2O9Z A;  2BCP A;  3LAD A;  4KX6 A;  3EAN A;  4DNA A;  1FEA A;  3E1T A;  1E6E A;  2WOW A;  2AQJ A;  4OPG A;  3SFD A;  1OJT A;  2YLT A;  3NYC A;  4C74 A;  2R0C A;  3URH A;  3NTA A;  3UTH A;  2CVJ A;  1QJD A;  5KWF A;  1HYU A;  3ABV A;  2Y6Q A;  1IUW A;  4OPC A;  2GF3 A;  5BUK A;  3NYF A;  3NKS A;  5BUL A;  3EF6 A;  2RGJ A;  4BJY A;  3RP8 A;  1PJ7 A;  3T37 A;  1KNP A;  5EB4 A;  3CN8 A;  1GND A;  3UKL A;  4J36 A;  4EIQ A;  1H83 A;  1GXF A;  4U2S A;  1XPQ A;  4YWO A;  3GYX A;  4OPT A;  3HZL A;  2WP9 A;  3ICR A;  3ICS A;  4G73 A;  4YTM A;  2AR8 A;  4Z2R A;  4Z44 A;  2GR3 A;  3AEA A;  1TDK A;  3UKK A;  3NRN A;  2GR2 A;  2C67 A;  1NEK A;  3B6D A;  4J56 A;  4YXD A;  2R4E A;  4A99 A;  1BWC A;  4JY3 A;  3DJJ A;  2YQU A;  3QJ4 A;  2BRA A;  4C5O A;  2QA2 A;  4USQ A;  1D5T A;  2CFY A;  1MXT A;  1M6I A;  1E1N A;  1XDI A;  3R9U A;  1NG4 A;  2Z5Y A;  3ATQ A;  1VDC A;  3CGD A;  3CMM A;  2GVC A;  3BI4 A;  3FIM B;  2ACZ A;  4H2Q A;  1NHP A;  4B67 A;  4CNK A;  4H4X A;  2ZBW A;  2C64 A;  1ZX9 A;  4C3X A;  1O94 A;  3AE9 A;  3H8I A;  1TDN A;  2WBA A;  2VVM A;  2XFQ A;  4OPU A;  3LOV A;  3AD7 B;  5KMP A;  3T2Z A;  1BGJ A;  1PBB A;  1LVL A;  1D7Y A;  1RP0 A;  2BC0 A;  3NHO X;  3P4P A;  3CPJ G;  1OJ9 A;  4UDR A;  1W4X A;  3LXD A;  4PAA A;  3T2Y A;  4FK1 A;  1OJC A;  2NVK X;  4LA1 A;  4G74 A;  1VQW A;  3QSM A;  3GYJ A;  3DK8 A;  2XCG A;  2XLP A;  3ICT A;  1QLB A;  2C65 A;  2R46 A;  2WPE A;  3LB8 A;  3M0O A;  5KVI A;  4N9X A;  3P9U A;  4J57 A;  1O5W A;  4J2W A;  3ALL A;  4Y4L A;  3QSS A;  3GMC A;  3FBS A;  1GV4 A;  1JNR A;  1F3P A;  2C3D A;  4I58 A;  3SY4 A;  3DGH A;  2BYB A;  4NTD A;  1M64 A;  2TPR A;  2A87 A;  3GYI A;  3ATR A;  2A8X A;  5JCI A;  1FEC A;  2BC1 A;  2BS3 A;  3CPH G;  4AOX A;  1GEU A;  3UKQ A;  3S5W A;  4GR1 A;  3T31 A;  3AE3 A;  3OZ2 A;  4OCG A;  4OPI A;  2C70 A;  3DK9 A;  2GMH A;  1FOH A;  4G6H A;  4U2L A;  4B63 A;  1S3E A;  2ZZ0 A;  1ZP0 A;  1EL5 A;  1E1L A;  4FK1 C;  2DKH A;  5KVH A;  2YG3 A;  4TM0 A;  2XVE A;  4H4Y A;  2XFP A;  3DK4 A;  2APG A;  1P2E A;  2QCU A;  2XLS A;  2XYO A;  2YLZ A;  4H50 A;  5CQF A;  1PBF A;  1Y56 B;  5BVA A;  2BAB A;  2V3A A;  1CJ4 A;  2W0H A;  4NWZ A;  3AE7 A;  3WE0 A;  2WQY A;  4Z26 A;  2BXR A;  4FDC B;  1BGN A;  4IVM B;  1S3B A;  4CCR A;  4AP3 A;  3CGB A;  3ISH A;  1XHC A;  4NEW A;  4II2 A;  3AEG A;  4BK2 A;  4JNQ A;  4BUR A;  3II4 A;  3P1W A;  4P9S A;  3ZDN A;  4EQX A;  1QO8 A;  4HA6 A;  3KPK A;  1E39 A;  4TLZ A;  3UOV A;  1B4V A;  1FEB A;  3DA1 A;  5DBJ A;  2WOI A;  3AEE A;  2YVJ A;  3G5S A;  2WDV A;  1TDE A;  1CBO A;  2IID A;  3GD3 A;  2BAC A;  2GB0 A;  2YAU A;  2X3N A;  1Q9I A;  3LJP A;  2YLR A;  3RED A;  1TRB A;  3AE2 A;  4IA6 A;  1GTE A;  2OLO A;  2VVL G;  3AE4 A;  1CJ2 A;  3HYW A;  5EOW A;  3NG7 X;  3C4N A;  3G5Q A;  3NH3 X;  2R4J A;  1JNZ A;  1FL2 A;  1DNC A;  4B66 A;  1GRH A;  3Q9T A;  3K7Q X;  5HXI A;  2EQ6 A;  3AYI A;  1YY5 A;  1VRQ B;  1ZOV A;  3UKF A;  2GR1 A;  1Y56 A;  2XFU A;  1KDG A;  3UKH A;  4YSX A;  2R0G A;  1H7X A;  3AEF A;  4JNA A;  2B9X A;  2V3B A;  4NTE A;  4WCT A;  2F5Z A;  2ZZB A;  4ZN0 A;  4XWR A;  2Q0L A;  1P2H A;  1IUX A;  1GRA A;  4YTN A;  2V61 A;  4TM1 A;  4GDE A;  4K5R A;  3IC9 A;  4U8M A;  1LTX R;  2YR6 A;  3QVR A;  1CL0 A;  1KNR A;  4K8D A;  2RGH A;  3AYL A;  4K2X A;  4UDQ A;  4Z25 A;  2JK6 A;  4H4T A;  4H4S A;  4A9W A;  2E5V A;  1VG9 A;  2XVF A;  1Q1W A;  3CNP A;  3CTY A;  3DME A;  3P4S A;  3SZC A;  3AXB A;  4Z2U A;  2YWL A;  1N4V A;  3D8X A;  4G9K A;  3RNM A;  4H7U A;  2WP5 A;  3EAO A;  5EBK A;  2RGO A;  4AP1 A;  3DJE A;  1N4W A;  3UP5 A;  3BI5 A;  4C3Y A;  1ZOY A;  3O0H A;  3SX6 A;  1CJC A;  1GRB A;  3CND A;  3ALJ A;  1OJA A;  2I0Z A;  3AB1 A;  2XLU A;  3AE8 A;  3T2K A;  1N4U A;  4JDR A;  4PAB A;  2BK4 A;  2YG7 A;  2WES A;  4K22 A;  4II3 A;  3SXI A;  1IUS A;  2R9Z A;  3F8D A;  4UDP A;  3FMW A;  3NGC X;  4NZH A;  4BK1 A;  2PHH A;  1K4Q A;  2WHD A;  3SGL A;  3K7T A;  3LZW A;  4FX9 A;  2IVE A;  4EQS A;  3GRS A;  4WX1 A;  4IA5 A;  4JY2 A;  1PXA A;  2GQF A;  4ECH A;  2WDQ A;  2BS2 A;  3HYV A;  5JCN A;  3C96 A;  4GDP A;  2C4C A;  1CF3 A;  2WET A;  3BNM A;  5U1O A;  4B64 A;  1YQ4 A;  4G6G A;  4BK3 A;  1ZKQ A;  3CGE A;  3DJD A;  3F8R A;  4EMJ A;  1ZMD A;  2DKI A;  1BZL A;  2HQM A;  3C4A A;  4RSL A;  1V59 A;  1PJ5 A;  2JB2 A;  4A65 A;  1ONF A;  2JB1 A;  4NNJ A;  4X9N A;  1E1K A;  4TM3 A;  5HHF A;  4YT0 A;  2PYX A;  2A89 A;  1PDH A;  2CUL A;  4JQ9 A;  3SYI A;  1NHR A;  1RSG A;  1LJ1 A;  1PXB A;  2VZ2 A;  3GDN A;  3I3L A;  3AD9 B;  5M10 A;  2GQW A;  3EPT A;  2WU2 A;  4GCM A;  3V3O A;  1CHU A;  1D7L A;  3V76 A;  3ZYX A;  3I6D A;  4U8I A;  3UKP A;  1DJQ A;  1XAN A;  2YR4 A;  3DGZ A;  3Q6J A;  4H2N A;  1L0V A;  2WPC A;  2B7R A;  5FS9 A;  3IHG A;  2C7G A;  2BS4 A;  4A6N B;  4A5L A;  1K0I A;  3P4Q A;  3RP6 A;  3QFA A;  4A79 A;  3GWD A;  5FS6 A;  2AAQ A;  2C72 A;  4BJZ A;  4YKF A;  2X50 A;  4CY8 A;  4EMW A;  3VQR A;  3CNT A;  1CC6 A;  3DJG X;  1GAL A;  3VR8 A;  3AED A;  3PO7 A;  3BNU A;  4O5U A;  4O5Q A;  1IJH A;  3OC4 A;  2YM1 A;  1ZMC A;  3KLJ A;  3NK0 X;  2YM2 A;  3GD4 A;  3CGC A;  2FJA A;  1RYI A;  1JOA A;  3FG2 P;  3IF9 A;  2XFO A;  1S2Q A;  1K0L A;  3COX A;  1OJD A;  1F8W A;  2BK3 A;  3PVC A;  4HB9 A;  1KSS A;  1DJN A;  5C2T A;  1GES A;  4C77 A;  4U8J A;  3SZ0 A;  4EM4 A;  1EL7 A;  1GSN A;  1ELI A;  2EQ9 A;  2BK5 A;  4IVO B;  5LV9 A;  3NIX A;  1MOK A;  2QA1 A;  2C3C A;  4U8N A;  2TMD A;  1IUU A;  4H4R A;  2C75 A;  3KKJ A;  2Y6R A;  3KD9 A;  4OPL A;  4H4U A;  1D4E A;  4K7Z A;  4YSY A;  4H4Q A;  1LQU A;  2C73 A;  1ZDL A; 
#chains in the Genus database with same CATH homology
 1JRZ A;  1NPX A;  1TYP A;  3AEC A;  1FCD A;  1Q1R A;  3H4K A;  4YTP A;  2QAE A;  4A6N A;  4D03 A;  3SM8 A;  3AE6 A;  5HY5 A;  1B5Q A;  4B1B A;  5JCL A;  1UKV G;  4YSH A;  4EMI A;  2UZZ A;  4Z24 A;  2H88 A;  2XFN A;  3T0K A;  4CCQ A;  4Z2T A;  3CPI G;  3JSK A;  5KXJ A;  4OPD A;  1IUT A;  4IV9 A;  5KOW A;  1DOC A;  2B9W A;  4AT2 A;  3AWI A;  2IVD A;  3F8P A;  3M12 A;  1DOE A;  1GTH A;  2YVG A;  1ZY8 A;  1REO A;  5KMQ A;  2B7S A;  2GAH B;  2JKC A;  1MO9 A;  2C66 A;  5BRT A;  1YKJ A;  1JRX A;  2Q7V A;  3CNS A;  5J7X A;  4TLX A;  4U8O A;  4ICY A;  3VR9 A;  3BHK A;  1EBD A;  3NK1 X;  3UTG A;  2OAM A;  3HYX A;  4NEV A;  5M0Z A;  4YSZ A;  3UOX A;  1X31 B;  1IUV A;  3FPZ A;  4X4J A;  4H4W A;  3NNE A;  3NT6 A;  2GR0 A;  2ARD A;  3UP4 A;  1K0J A;  2C76 A;  3GSI A;  3RHA A;  4A7A A;  4D04 A;  1NEN A;  5JCK A;  4Y4M A;  1B8S A;  4XXG A;  4UP3 A;  2VQB A;  1DOB A;  2VRL A;  4YKG A;  2FJB A;  4H4P A;  1D4D A;  1NDA A;  2BRY A;  1H81 A;  2GRT A;  2FJD A;  2H89 A;  2RAB A;  2X99 A;  1TDO A;  3DH9 A;  3AEB A;  1F8S A;  3BHF A;  4H4V A;  2WS3 A;  2WOV A;  5GSN A;  4U2T A;  4CNJ A;  2YVF A;  1DOD A;  1NHS A;  5FS7 A;  1KF6 A;  1H6V A;  2GAG B;  3KVE A;  4LU6 A;  4ZCD A;  1DXL A;  3ALM A;  3S61 A;  3L8K A;  3GMB A;  4XWZ A;  1GPE A;  1CC2 A;  1PBD A;  2EQ7 A;  1H86 A;  1H82 A;  3VRA A;  4CBQ A;  3D1C A;  2E1M A;  2GMJ A;  3NK2 X;  4U8L A;  4ZCC A;  2V60 A;  1BKW A;  3NN0 X;  2YLW A;  2OLN A;  4E0V A;  2X8H A;  2WP6 A;  1COY A;  3M13 A;  2WU5 A;  3NYE A;  2JB3 A;  1LPF A;  2XVH A;  3K7M X;  4M52 A;  4EIP A;  3CNJ A;  2GH5 A;  1S2Y A;  2R0P A;  2X8G A;  4U8P A;  1PS9 A;  1L9E A;  5EB5 A;  5HYM A;  1GOS A;  3RP7 A;  3ADA B;  4GRT A;  2Q0K A;  5FS8 A;  5KMS A;  2BXS A;  2XLR A;  1EL8 A;  2B9Y A;  1BF3 A;  5ER0 A;  1JRY A;  1GRG A;  4J33 A;  1Y0P A;  5C3J A;  2NPX A;  4X9M A;  3PS9 A;  2YLX A;  4K5S A;  2Z5X A;  3H8L A;  1NHQ A;  3VRD B;  1ZK7 A;  2OA1 A;  2XVJ A;  3NN6 X;  4I59 A;  3T14 A;  4KPR A;  4REK A;  4BV6 A;  4TM4 A;  4GAV A;  4OVI A;  3UTF A;  4EQW A;  3NTD A;  2YR5 A;  3IHM A;  1F6M A;  5FMH A;  4CY6 A;  1GER A;  1GRF A;  1PXC A;  4RG4 A;  1PBC A;  1KFY A;  4B65 A;  3UOY A;  3QSE A;  1NAA A;  3KPF A;  1JEH A;  1D4C A;  4GF7 A;  1YQZ A;  4DSG A;  1AOG A;  1N1P A;  1CC4 A;  4U8K A;  4ADW A;  2E4G A;  4B68 A;  3AE1 A;  3SFE A;  2BA9 A;  2YLS A;  3AYJ A;  5TR3 A;  1F8R A;  1GRE A;  2JAE A;  1NG3 A;  2VOU A;  2XVI A;  3G5R A;  4AT0 A;  2VVL A;  4EM3 A;  4NTC A;  1CJ3 A;  1PHH A;  1VG0 A;  5GRT A;  3UKA A;  1LQT A;  3V3N A;  1TYT A;  3SQP A;  1PJ6 A;  1Z6L A;  2VQ7 A;  1GET A;  4J31 A;  4APN A;  4LII A;  5KOX A;  3SZF A;  3GRT A;  1PBE A;  3CIR A;  2X8C A;  3KU9 A;  4USR A;  5IQ4 A;  3KA7 A;  2YG4 A;  3UCL A;  4H2R A;  1GT8 A;  3VRB A;  4Z43 A;  2WDR A;  2V6O A;  1H84 A;  1PN0 A;  5U25 A;  2R45 A;  4JN9 A;  3ITJ A;  4DGK A;  3K30 A;  1YQ3 A;  2FJE A;  3P4R A;  4Y4N A;  2XLT A;  3SZW A;  3UTE A;  5IQ1 A;  5U63 A;  3GWF A;  1JU2 A;  2XDO A;  3AD8 B;  4GUV A;  2Q6U A;  4H2P A;  2VRM A;  1L9C A;  1TDF A;  2YG6 A;  2YG5 A;  1EL9 A;  3QFB A;  3UOZ A;  5JCM A;  5KMR A;  1KSU A;  4GAP A;  2GV8 A;  3L1R A;  1H7W A;  2B76 A;  5L46 A;  1E7P A;  3LZX A;  5KNL A;  4B69 A;  2CDU A;  4EQR A;  3B3R A;  4CRT A;  1O95 A;  1L9D A;  2J3N A;  1B37 A;  4MJW A;  1SEZ A;  2ZZC A;  5J60 A;  2WPF A;  4J34 A;  3IWA A;  1LV0 A;  2GEW A;  2OAL A;  3AE5 A;  2V5Z A;  3BI2 A;  4AOS A;  2FBW A;  2WEU A;  3NLC A;  4DSH A;  4H4Z A;  2EQ8 A;  1E1M A;  2BCG G;  2JBV A;  1GRT A;  5CKU A;  3QVP A;  5KRQ A;  4RG3 A;  5IPY A;  3GDP A;  2O9Z A;  2BCP A;  3LAD A;  4KX6 A;  3EAN A;  4DNA A;  1FEA A;  3E1T A;  1E6E A;  2WOW A;  2AQJ A;  4OPG A;  3SFD A;  1OJT A;  2YLT A;  3NYC A;  4C74 A;  2R0C A;  3URH A;  3NTA A;  3UTH A;  2CVJ A;  1QJD A;  5KWF A;  1HYU A;  3ABV A;  2Y6Q A;  1IUW A;  4OPC A;  2GF3 A;  5BUK A;  3NYF A;  3NKS A;  5BUL A;  3EF6 A;  2RGJ A;  4BJY A;  3RP8 A;  1PJ7 A;  3T37 A;  1KNP A;  5EB4 A;  3CN8 A;  1GND A;  3UKL A;  4J36 A;  4EIQ A;  1H83 A;  1GXF A;  4U2S A;  1XPQ A;  4YWO A;  3GYX A;  4OPT A;  3HZL A;  2WP9 A;  3ICR A;  3ICS A;  4G73 A;  4YTM A;  2AR8 A;  4Z2R A;  4Z44 A;  2GR3 A;  3AEA A;  1TDK A;  3UKK A;  3NRN A;  2GR2 A;  2C67 A;  1NEK A;  3B6D A;  4J56 A;  4YXD A;  2R4E A;  4A99 A;  1BWC A;  4JY3 A;  3DJJ A;  2YQU A;  3QJ4 A;  2BRA A;  4C5O A;  2QA2 A;  4USQ A;  1D5T A;  2CFY A;  1MXT A;  1M6I A;  1E1N A;  1XDI A;  3R9U A;  1NG4 A;  2Z5Y A;  3ATQ A;  1VDC A;  3CGD A;  3CMM A;  2GVC A;  3BI4 A;  3FIM B;  2ACZ A;  4H2Q A;  1NHP A;  4B67 A;  4CNK A;  4H4X A;  2ZBW A;  2C64 A;  1ZX9 A;  4C3X A;  1O94 A;  3AE9 A;  3H8I A;  1TDN A;  2WBA A;  2VVM A;  2XFQ A;  4OPU A;  3LOV A;  3AD7 B;  5KMP A;  3T2Z A;  1BGJ A;  1PBB A;  1LVL A;  1D7Y A;  1RP0 A;  2BC0 A;  3NHO X;  3P4P A;  3CPJ G;  1OJ9 A;  4UDR A;  1W4X A;  3LXD A;  4PAA A;  3T2Y A;  4FK1 A;  1OJC A;  2NVK X;  4LA1 A;  4G74 A;  1VQW A;  3QSM A;  3GYJ A;  3DK8 A;  2XCG A;  2XLP A;  3ICT A;  1QLB A;  2C65 A;  2R46 A;  2WPE A;  3LB8 A;  3M0O A;  5KVI A;  4N9X A;  3P9U A;  4J57 A;  1O5W A;  4J2W A;  3ALL A;  4Y4L A;  3QSS A;  3GMC A;  3FBS A;  1GV4 A;  1JNR A;  1F3P A;  2C3D A;  4I58 A;  3SY4 A;  3DGH A;  2BYB A;  4NTD A;  1M64 A;  2TPR A;  2A87 A;  3GYI A;  3ATR A;  2A8X A;  5JCI A;  1FEC A;  2BC1 A;  2BS3 A;  3CPH G;  4AOX A;  1GEU A;  3UKQ A;  3S5W A;  4GR1 A;  3T31 A;  3AE3 A;  3OZ2 A;  4OCG A;  4OPI A;  2C70 A;  3DK9 A;  2GMH A;  1FOH A;  4G6H A;  4U2L A;  4B63 A;  1S3E A;  2ZZ0 A;  1ZP0 A;  1EL5 A;  1E1L A;  4FK1 C;  2DKH A;  5KVH A;  2YG3 A;  4TM0 A;  2XVE A;  4H4Y A;  2XFP A;  3DK4 A;  2APG A;  1P2E A;  2QCU A;  2XLS A;  2XYO A;  2YLZ A;  4H50 A;  5CQF A;  1PBF A;  1Y56 B;  5BVA A;  2BAB A;  2V3A A;  1CJ4 A;  2W0H A;  4NWZ A;  3AE7 A;  3WE0 A;  2WQY A;  4Z26 A;  2BXR A;  4FDC B;  1BGN A;  4IVM B;  1S3B A;  4CCR A;  4AP3 A;  3CGB A;  3ISH A;  1XHC A;  4NEW A;  4II2 A;  3AEG A;  4BK2 A;  4JNQ A;  4BUR A;  3II4 A;  3P1W A;  4P9S A;  3ZDN A;  4EQX A;  1QO8 A;  4HA6 A;  3KPK A;  1E39 A;  4TLZ A;  3UOV A;  1B4V A;  1FEB A;  3DA1 A;  5DBJ A;  2WOI A;  3AEE A;  2YVJ A;  3G5S A;  2WDV A;  1TDE A;  1CBO A;  2IID A;  3GD3 A;  2BAC A;  2GB0 A;  2YAU A;  2X3N A;  1Q9I A;  3LJP A;  2YLR A;  3RED A;  1TRB A;  3AE2 A;  4IA6 A;  1GTE A;  2OLO A;  2VVL G;  3AE4 A;  1CJ2 A;  3HYW A;  5EOW A;  3NG7 X;  3C4N A;  3G5Q A;  3NH3 X;  2R4J A;  1JNZ A;  1FL2 A;  1DNC A;  4B66 A;  1GRH A;  3Q9T A;  3K7Q X;  5HXI A;  2EQ6 A;  3AYI A;  1YY5 A;  1VRQ B;  1ZOV A;  3UKF A;  2GR1 A;  1Y56 A;  2XFU A;  1KDG A;  3UKH A;  4YSX A;  2R0G A;  1H7X A;  3AEF A;  4JNA A;  2B9X A;  2V3B A;  4NTE A;  4WCT A;  2F5Z A;  2ZZB A;  4ZN0 A;  4XWR A;  2Q0L A;  1P2H A;  1IUX A;  1GRA A;  4YTN A;  2V61 A;  4TM1 A;  4GDE A;  4K5R A;  3IC9 A;  4U8M A;  1LTX R;  2YR6 A;  3QVR A;  1CL0 A;  1KNR A;  4K8D A;  2RGH A;  3AYL A;  4K2X A;  4UDQ A;  4Z25 A;  2JK6 A;  4H4T A;  4H4S A;  4A9W A;  2E5V A;  1VG9 A;  2XVF A;  1Q1W A;  3CNP A;  3CTY A;  3DME A;  3P4S A;  3SZC A;  3AXB A;  4Z2U A;  2YWL A;  1N4V A;  3D8X A;  4G9K A;  3RNM A;  4H7U A;  2WP5 A;  3EAO A;  5EBK A;  2RGO A;  4AP1 A;  3DJE A;  1N4W A;  3UP5 A;  3BI5 A;  4C3Y A;  1ZOY A;  3O0H A;  3SX6 A;  1CJC A;  1GRB A;  3CND A;  3ALJ A;  1OJA A;  2I0Z A;  3AB1 A;  2XLU A;  3AE8 A;  3T2K A;  1N4U A;  4JDR A;  4PAB A;  2BK4 A;  2YG7 A;  2WES A;  4K22 A;  4II3 A;  3SXI A;  1IUS A;  2R9Z A;  3F8D A;  4UDP A;  3FMW A;  3NGC X;  4NZH A;  4BK1 A;  2PHH A;  1K4Q A;  2WHD A;  3SGL A;  3K7T A;  3LZW A;  4FX9 A;  2IVE A;  4EQS A;  3GRS A;  4WX1 A;  4IA5 A;  4JY2 A;  1PXA A;  2GQF A;  4ECH A;  2WDQ A;  2BS2 A;  3HYV A;  5JCN A;  3C96 A;  4GDP A;  2C4C A;  1CF3 A;  2WET A;  3BNM A;  5U1O A;  4B64 A;  1YQ4 A;  4G6G A;  4BK3 A;  1ZKQ A;  3CGE A;  3DJD A;  3F8R A;  4EMJ A;  1ZMD A;  2DKI A;  1BZL A;  2HQM A;  3C4A A;  4RSL A;  1V59 A;  1PJ5 A;  2JB2 A;  4A65 A;  1ONF A;  2JB1 A;  4NNJ A;  4X9N A;  1E1K A;  4TM3 A;  5HHF A;  4YT0 A;  2PYX A;  2A89 A;  1PDH A;  2CUL A;  4JQ9 A;  3SYI A;  1NHR A;  1RSG A;  1LJ1 A;  1PXB A;  2VZ2 A;  3GDN A;  3I3L A;  3AD9 B;  5M10 A;  2GQW A;  3EPT A;  2WU2 A;  4GCM A;  3V3O A;  1CHU A;  1D7L A;  3V76 A;  3ZYX A;  3I6D A;  4U8I A;  3UKP A;  1DJQ A;  1XAN A;  2YR4 A;  3DGZ A;  3Q6J A;  4H2N A;  1L0V A;  2WPC A;  2B7R A;  5FS9 A;  3IHG A;  2C7G A;  2BS4 A;  4A6N B;  4A5L A;  1K0I A;  3P4Q A;  3RP6 A;  3QFA A;  4A79 A;  3GWD A;  5FS6 A;  2AAQ A;  2C72 A;  4BJZ A;  4YKF A;  2X50 A;  4CY8 A;  4EMW A;  3VQR A;  3CNT A;  1CC6 A;  3DJG X;  1GAL A;  3VR8 A;  3AED A;  3PO7 A;  3BNU A;  4O5U A;  4O5Q A;  1IJH A;  3OC4 A;  2YM1 A;  1ZMC A;  3KLJ A;  3NK0 X;  2YM2 A;  3GD4 A;  3CGC A;  2FJA A;  1RYI A;  1JOA A;  3FG2 P;  3IF9 A;  2XFO A;  1S2Q A;  1K0L A;  3COX A;  1OJD A;  1F8W A;  2BK3 A;  3PVC A;  4HB9 A;  1KSS A;  1DJN A;  5C2T A;  1GES A;  4C77 A;  4U8J A;  3SZ0 A;  4EM4 A;  1EL7 A;  1GSN A;  1ELI A;  2EQ9 A;  2BK5 A;  4IVO B;  5LV9 A;  3NIX A;  1MOK A;  2QA1 A;  2C3C A;  4U8N A;  2TMD A;  1IUU A;  4H4R A;  2C75 A;  3KKJ A;  2Y6R A;  3KD9 A;  4OPL A;  4H4U A;  1D4E A;  4K7Z A;  4YSY A;  4H4Q A;  1LQU A;  2C73 A;  1ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...