3NG8A

Crystal structure of an abridged ser to ala mutant of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase ica512/ia-2 at ph 8.5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
b'EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINIAVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor-type tyrosine-protein phosphatase-like N
publication title Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ng8A00
4HTIA 3NG8A 3N01A 4HTJA 2QT7A 3N4WA 3NP5A
chains in the Genus database with same CATH superfamily
4CO0A 2HFSA 1U2RA 2QEXS 5C2CA 1JB0C 2DGSA 4PPDA 2DK2A 3BZQA 4YY3F 4AL5A 1GX6A 2Z4PA 5HVHA 4AL7A 4WFZA 5CD4H 3QZ7A 3OW2R 1EX8A 1S77D 4MT1A 5KOWA 1APSA 4AFFA 4F8RA 3DM2B 4KAIA 3A8KA 1Q4RA 4UOCA 3RRHA 3CJQA 1SJRA 3DXSX 5DGBA 1NHKL 3HKZD 4PG6A 4TVAB 1X0FA 1SV5B 3MUVP 1H2TZ 1RT6A 1BGXT 2F8EX 2OPQA 4H4MA 3S6EA 3Q89A 2RDJA 3PIOQ 1RWMB 1AZSA 3C19A 4I0WA 3PM9A 2AYGA 5KFWA 5J2QA 4JI2F 4OZ0A 1G1XA 3D6TB 2B5JA 2P6TA 2QL5B 4NYPA 4USVA 3GE9A 2FYXA 2UUAF 2WBRA 3QT5A 2VPYB 2ZBQA 2HNZA 1UJ4A 3E01A 1LFPA 4ZPWR 2MKSA 2YX1A 1WSVA 3MPYA 4ES2A 1O5JA 5KG0A 4B3RJ 5DM6Q 3HPOA 2VQEF 3ADAC 2YKMA 4DV2F 4JI8F 2OAUA 5KFVA 3G8SA 3SQGB 4RJVA 3R7BB 2DB1A 4K4UA 5DDOC 4QQBA 4MK7A 5K8OA 3W63A 4R0JA 3IG1A 3T5JA 1X9SA 4W4MA 5KFOA 1DQAA 3JSMA 2QZ8A 2VQFF 5HBMA 1Q16B 3IM9A 1LXNA 1CG2A 4WP8A 1BE4A 1VYAA 2QC3A 5KFFA 2G2OA 4MKVA 3GYNA 4RW4B 2YPZA 2XMVA 5ITHA 2GJFA 5JVHQ 2F9DA 3CCZA 1E6VB 1RTHA 3VGUA 1FRHA 1RAJA 2ZH3A 2NZ4A 1FJGJ 1SQGA 2IVYA 1T02A 1NDPA 3NKYA 1HD0A 2VA3A 3I0RA 1ZPWX 3L09A 2VFTA 4UW2A 1HIYA 2R8HA 4WWSA 2EBEA 1Z4UA 4DSLA 1D09B 4Z7YA 2RUGA 3NNHA 5K5MA 4DS4A 3ZTRA 1JWWA 3UPFA 3BB5A 3H5YA 4DMZA 2XLJA 4X84A 1MU2B 4DPXA 4X2BA 1U1RA 1FVQA 2P2CB 4KBIA 3W2WB 1LWXA 2XQCA 2F63A 3GWCA 4LUBA 2DNPA 4NCAA 1G2EA 3K8VA 4ED2A 4DX8H 2D9OA 5HP1A 2VODA 4WIIA 1S9EA 5F8GA 2J7KA 2HWTA 5KT4A 1X8DA 2CPYA 3BREA 1A0OB 2W9AA 3QLHA 3EXYA 1OYDA 1AT1B 4OX9J 4M5KA 2GMLA 2M9KA 2VOOA 1IKYA 3DLEA 2NXUA 4RNFA 5F8MA 2H5EA 2DHHA 5KT2A 1LW0A 1BHNA 3CJTA 1N5YB 3AH6A 4KPCA 1CULA 1O0PA 3B4DA 3J7YU 2OPPB 4L6V3 2XY7A 3GIMA 3M6XA 2DO4A 3PO4A 1QD1A 2KXFA 2MHNA 1DTTB 2OMLA 4LRAA 1ZAVA 4GKKF 4IH5A 3KK1A 3ZZYA 1O6XA 4J9MA 4KGKA 3AJ2A 2ROEA 3HKWA 4NA2A 2YWFA 5DG9A 1B7YB 4KFBA 1TKZB 1R8CA 1F9HA 2L9WA 4ANEA 2AQ4A 3FEZA 1HKAA 4BWMA 2KL8A 1JLCB 4FF2A 1ZZFA 3L7OA 4YR0A 5KFNA 5AJ3F 3FKBA 1R0BG 2VFUA 3DRPB 3IWXA 4DXLA 4F3OA 4GRSA 3SSSA 1X4DA 4JB8B 2FLPA 3D2WA 4WP9A 1B0TA 2HLUA 5AXMA 4K2XA 3CB4A 2KM8B 1HNIA 3TZZA 2RE1A 4UUWA 2I8EA 1WEXA 2UP1A 3MCNA 3BBCA 1NB7A 3DOKA 3MM8B 2E66A 4OIXA 5J1NA 5K9FA 2KT5A 4OX7A 3UCGA 4J91A 4DU7A 1NKCA 2XGPA 1U49A 3TW0A 5E0OA 1YJRA 4ZCMA 4C0HA 1PJ7A 4FZVA 4ZCIA 3G9CA 4CM0A 1WACA 2ILYA 2DNNA 3W9JA 4B9TA 3BN4A 3P45B 2B8PA 3TANA 1RT7A 2ZM6F 3HHEA 5HJYA 3VWSA 1Q8IA 2I5JB 3O2IA 2C2EA 2XSJA 3UNYA 4EFAC 3DOMA 5LSLA 5HAOA 1AB8A 1D9AA 5F9NA 2G13A 5SZTA 4BC9A 3G86A 3DNCA 1NK7A 3DFEA 4W90B 5CYJA 4PWUA 1RAHB 1FI4A 1YJ7A 1FX2A 4DF4A 1EQMA 2R8GA 4LFBJ 1QVFR 2V8PA 1NKEA 3MMAB 3T6JA 1F2HA 3KFWX 1NMEB 1DQ9A 1UL3A 3Q2TC 3NS7B 2EEYA 3HHKA 1HWIA 5IQ6A 3L7PA 2LXFA 2P9GA 5I3UA 1WKKA 2V2QA 2O66A 4E2FB 4N56A 1X4HA 1O51A 1ACMB 1X5OA 4YHHF 4LSLB 3HDSA 3KNAA 3QBCA 1FVSA 1M5HA 1UVMA 4ZPCA 1ZETA 2ZBCA 4LMZA 4ZOSA 4N5SA 3UI3A 4IO1A 1HR0J 5LL6d 4MIAA 2H51B 1IR1A 2ZZTA 3GZ7A 4JV0A 3R5DA 4OYMA 4O3RA 2J0WA 2KFNA 2BJ1A 2CIMA 4EO6A 4DEZA 2YNHB 2KT3A 3MM9A 3NGKA 4QBUA 3M30A 3G82A 1HNXF 3DRXA 2OJ3A 3BM7A 4ED5A 2C42A 5SUHA 2GIFA 1CSJA 4I7FA 4CWBA 2HIYA 2DCLA 4WFYA 4M5LA 4Y28C 1JLFB 3EVOA 2K06A 2V8GA 5DETA 2BQ3A 1FK9A 1VQ7S 1KVKA 4HDGA 4LF7J 3NRBA 4KQZA 3PNIA 1BWEA 3T1HF 5L9NA 3PXGa 4P2MA 4TXSA 2R7WA 4KJIA 1PYTA 3U1LA 2OGUA 4B9VA 2JVOA 4DBQA 2BKPA 5IT9U 1LW2A 3TNVA 1QAJA 3T5HA 1UA1A 4LF6J 5IM0B 1D8YA 3KJNB 3DGVA 4JI5F 2QYGA 4F4XA 2UVVA 2VDHA 2YH1A 3DKDA 4J9QA 1LWEA 2HVHA 2IDEA 3CXCR 1XIQA 3OLBA 3BKTA 4NLQA 1GMVA 1EETB 3PO5A 1KQFB 5KFRA 3NWRA 4TNOA 2DTJA 3G8TA 1GMWA 4DCOB 2XLIA 3VGTA 1FFSB 1S9GB 4R8UB 2HBRB 3GJQB 2ASDA 4ELUA 1RADB 3RAQA 2YNFA 1OWXA 2BYCA 1N52B 4RW7A 2NREA 2KN4A 3AXMA 4O3SA 1WORA 2NQPA 1Y3JA 3THVA 1WKLA 2RS2A 3KK2B 3EDRB 2JZ5A 2IM2A 1KN6A 5E5NA 3L7UA 2LEBA 3T9ZA 4I1TA 2V8DA 1LEOA 4L3KA 2ATCB 4ZCLA 4A46A 2YBVA 1RWNB 3QRQA 1VJQA 2HHVA 2GMHA 3GG0A 5DG8A 3NS6A 3ET6A 1T05A 3EGZA 2RKIB 1JXEA 2KFYA 2HYIB 2A3JA 5HROB 2FLOA 2KT2A 1QTNB 1S6OA 4U7UK 4IRDA 5T7LB 2RQKA 1IBCB 1R43A 2XB2D 2JX2A 1HMVA 1IBLJ 4F3MA 4OI3A 3F44A 4E98A 2M5YA 5I42A 5B0BA 4XPEA 3PG9A 1M5PC 4C3LA 4MK9A 3R5JB 3GIIA 4DUYF 1E6YA 1NU4A 1EARA 3M2RA 2AP6A 3V4MA 4O4GA 5A8KB 1XR5A 2AWZA 2IVMA 3UFCX 4P9SA 5HSPA 4CLYA 3WX4A 4QW9A 4G3IA 3K8WA 4ECVA 4QZVB 3MMBB 4K4WA 1M0SA 3P6YC 2MKIA 4OZJA 3D6MB 3X1LB 3SBMA 2FY1A 1PBAA 3P5BP 1JLBA 1Q7YT 2K1RB 3DN9A 2FD2A 1VC5A 5GMKa 4FXDA 3QATA 2R2SA 1C0TB 1VRTB 1YWXA 2E1MC 4ILMA 2BZ2A 4WXOA 2E7VA 1H2VZ 4ZHRA 4C8YA 5D6GA 1CC8A 4RNOA 1LOUA 2F3JA 1URNA 1TP7A 1TV6A 3Q86A 1YBUA 1XQIA 2KO1A 1NZ8A 1PO6A 3OUYB 2D74B 4N47A 3OVAA 2LDIA 3MEGB 1YRTA 3IS9B 2EVZA 2D3ZA 1Q95G 5K8PA 1G3OA 2W8LA 1Q81T 1RWXB 1S4FA 2WVFA 5D0EA 4DL7A 3NGRA 5FLXU 3QIDA 1OY6A 4C8NA 4TU8A 3RRKA 2H48B 2PC6A 2HHWA 4A48A 4CDIA 2AX0A 5FJ4A 4GVBA 3HXMA 2HHSA 2IBOA 5JVGQ 3VV2B 2Q6CA 5GVQA 3V4IB 3CD7A 2MDAA 1FJ7A 2C3UA 4ELVA 4MIBA 3RBZA 2XNRA 3EYZA 4X4TA 2HRUA 1CJTB 4OI0A 4WXWA 1NJWA 1I6JA 1RLDA 2IMOA 4KT0C 3MMCB 2VICA 2KXNB 4UUXA 1TTHB 3MR6A 3ILOA 3TRGA 4USWA 1OO0B 4FNHA 2ZZNA 2IYIA 4JBCA 2J9CA 4DV4F 2JDJA 3I32A 2HIQA 1FF2A 3THTA 1P9QC 2G1DA 2IHR1 3VAIA 4ZVGA 2M4MA 3P3DA 2P6SA 2FHMA 3CJ5A 1X7VA 2FJBB 2W9CB 2A18A 1VOMA 1VK3A 2D1CA 4FYYB 3CMAS 3ZFVA 2C2ZB 3UVJA 1VBKA 4HKQA 3IP0A 3CC2S 4TYAA 2ZH8A 3RU0A 2CZ4A 1HPZB 1HARA 4AXIA 3MR3A 3EVMA 4RW9B 3WBZA 2E1PA 3NCQA 3Q22A 4Q43A 1R8PA 3MOZA 1SKWA 3S7RA 2PMWA 3HVTB 3MHYA 1XR6A 2RMLA 4DV6F 4C8KA 3V81A 3N6MA 3W8GA 1HBUB 1T0TV 4PUOB 2YVSA 1I1GA 4KSEB 5J1PA 4X4PA 2KM8C 4WZQA 1F9EB 2XMJA 2B4PA 4RR5A 3G6YA 3E3XA 2XLKA 1X5PA 1TL7A 5A76A 2KDOA 4O3PA 3OVBA 4UZCA 2UUCJ 3B54A 2E1CA 1D9DA 5IT9Y 1HQEB 1T03A 2D3UA 3EJMA 2JC0A 4EI2A 7FD1A 1XMBA 1H38A 5L1LA 4QR0A 2M88A 4GO7X 3HHLB 5RUBA 3SV3A 2E5IA 1X31C 1ELOA 1GAOA 2MYFA 4KGZB 5ETSA 2CQ1A 5GMEA 3CJ3A 4DSFA 1S1XA 4ZIWA 4GC7A 3G8QA 2QFJA 4JYAF 4Q2MA 2CQ4A 4GO5X 4DX6A 1FXDA 4EBCA 2CQ0A 3TAMA 3KLHA 1CC7A 3VR1A 4PG4A 3D67A 4I64A 4TU9A 4OHXA 2W01A 3R5GA 4OYAA 3H5XA 2CJBA 1U0HB 3WIUA 4LR8A 1UPMB 1S48A 3BDPA 2F4VF 5KFEA 3D1HA 2BA9A 3FNNA 3AD8C 5CYQA 4NEZA 2HBZB 1MN7A 2KYXA 2YXLA 3FK4A 4QYZJ 1PSDA 3PJ9A 5DDQC 2DNZA 2XMWA 1C4CA 3NL0A 3CPWR 1VQNS 1RT1B 1X4EA 4Y2CA 1RU1A 1N32F 1UWBB 2ZUGA 2XM3A 3A1YG 3AXKA 4DV3F 4PQUB 3AA8A 1WKJA 1UAWA 1FJEB 1HNVB 3DOLB 2CZVC 2YWWA 2CQBA 4ZVFA 3UD3P 3CCRS 4QIWD 4RUCA 2MEWA 2Y1JA 5KFQA 3OV7A 3RW7A 4JI0J 1S72S 2AF6A 2JNJA 4IOCQ 5F8IA 3DLGB 1MSWD 1VBZA 2F8HA 4BDPA 1J5EF 1YJWS 1N54B 5KFHA 3F0NA 1NK0A 1U1PA 5HLFB 3J81U 1WWHA 1U02A 1R6YA 4M5DA 2JVRA 3I0SA 2WOMB 4B9MA 3MPVA 3BYPA 2AEMA 4NXNJ 3B6BA 4ZN1A 2JSXA 4MJKA 3GTYX 2VKZG 2FVSA 2QFIA 2UVUA 1RTZA 3F41A 2V8VA 2VASA 1AYEA 1QLNA 2HZCA 2LEPA 1K1SA 2BJ9A 2MXYA 1YBAA 4UQGA 2XMKA 2C2DA 1YX2A 4USKA 2KH9A 3DRRB 1SL2A 4ZK7M 1SBRA 1QY7A 2VH7A 2P9EA 2NSBA 2K8GA 4QU7A 2WB4A 4B17A 4FF4A 1NK9A 1PAEX 2Z2MA 4YR3A 4O44A 4YY3J 4NLGA 3KJVA 1CQMA 3TOQA 3PYEA 4U67Q 4EYIB 3QWUA 1U7LA 3H25A 2GHWA 2V4JB 2ZWPA 2HNDA 4Z2XA 1N8RT 1NHUA 1JLAB 3QMQA 3R2CJ 5IFMA 3I5BA 1UFWA 3J80U 3TO8A 1BXNA 2A10A 2SXLA 3AAWB 2V6AA 4B3RF 4ZVEA 3LW5C 2DJWA 2IRUA 2AJ0A 4QYRA 5KG6A 1SL0A 4IDKA 4QOTA 4RNNA 5LJ5Y 4RLEA 9ATCB 3BN7A 1N5VA 1T9UA 1ICEB 2HMIA 1XTZA 4JI2J 1VMBA 3CC7S 5CCMA 2LVWA 1GXTA 1ZA1B 3UDEA 5CA5A 4KKOA 1S6QB 1RU2A 2CNNB 5E3QA 3RBXA 5EX0A 3OFHA 3MMJA 2HHPA 3G87A 5KFGA 4FPIA 3FMBA 3KLIA 4NOHA 2DHXA 3T1AA 4HI2A 4ZP7A 5I4MA 4D3GA 1FJGF 3TJAA 3SDEA 3B82A 1WSRA 3C14B 3UDLA 2RRNA 3NBPA 2MHEA 1JMTA 3QPIA 2G0IA 3AJ1A 3OPKA 3TX8A 4YFUA 2Z8QA 3KMSA 2MLXA 1W7WA 3Q2SC 3KK3A 3RBDA 4Q0BB 2EPIA 3JS9A 3KUGA 4C97A 1RYRA 4LFAJ 1H3DA 3K89A 1XR7A 3SQOP 2E44A 2JC1A 1TL3B 4NCBA 1VLOA 3CJ2A 5HMYA 2CWKA 2HQDA 1SKUB 4QIFA 4GVLA 3N01A 2W2NP 2W1BA 3M32B 1RXOB 2PT0A 1JJ4A 1F2GA 1S1TB 3Q24A 2UVWA 3CJ4A 2YKQA 5E33A 4NCGB 2BRLA 3HSGA 3JQJA 2B9YA 4EWTA 4CO3A 3N6LA 1Q1KA 2HVDA 2CJ9A 1YIJS 4USIA 3IMQJ 3H4BA 1TKTB 2MQQA 4J9KA 1BC6A 1FEHA 1JIHA 3BS9A 2RS8A 1BY9A 2PI4A 1KWMA 2CDRB 1S6PB 3A8EA 4OJ1A 2XO6A 3LP1A 5GADU 3CJ8A 5BR8J 2E1RA 2MLYA 1R31A 2GGPB 2KXHA 3C2PA 1RHUB 5GAHI 3OHBA 2DXFA 1Q5YA 3MEDA 3FC9A 3GG1A 2VZ9A 3M9NB 2MZJA 5CHCB 1HWJA 1D9FA 1FRJA 1FNMA 2UXBJ 3VAGA 1FWLA 2V2KA 2A1BA 2RB7A 4G1IA 2ZUAA 1GXLA 1YITS 1S1UB 4DL2A 3AQOA 1UVNA 3BO4A 2K7JA 1VC6A 2FVCA 2GIRA 3GPAA 4ID8A 5J2NB 3FBEA 2KVQE 2ZC4A 1Y10A 2HHQA 1YDLA 2QIFA 4DL4A 3CJSA 1HI1A 1GEHA 2RD5C 2COLA 3EVWA 5CD4A 5GAEI 2OD6A 2VL1A 1MWYA 4C6AA 1VJWA 1E6VA 1U09A 1L3UA 4OHWA 3KYLA 4NEYA 2VV5A 2RRBA 1NHVA 3HT3A 2QLJB 3POTB 5AJ3J 2HVIA 2GC8A 2QYCA 2J6SA 1KDNA 1IM6A 3CCVS 3Q8RB 3B4MA 2GW8A 2EFOA 2R8KA 3FRZA 3AFGA 4NLSA 3C6TB 1D0EA 3E8OA 1WELA 1PYOB 2CPFA 1V5VA 3G6ES 2HGLA 2XY5A 4OI4A 4F50A 1OPZA 4ZVTB 2GFFA 1QVGR 3RB3A 3M8WA 3ONQA 1WC1A 4M5MA 3W64A 1MU2A 3R5AA 4O3QA 3RB4A 4R5PB 3GCWP 3KG1A 3W2WA 2PO4A 4ZKAA 3MM5B 3PKMA 4CIOA 1OYEA 6AT1B 1R89A 2FHJD 3NOGA 9RUBA 4LFBF 4ZP8A 2RVJA 1FJCA 4CYUB 4FVMA 4QPXA 4X4RA 2BV3A 2NS1B 1JLEA 3GFXA 1Y9OA 3MM7B 2IBKA 5IXUA 4ANCA 2OEJA 1KTVA 2VBZA 1F3VA 3M8YA 4IFVB 1N5YA 4M5IA 4LBIA 1P9YA 3W61A 2WVDA 3L9ZA 3OTCA 1SJ4P 3C15B 2ZH5A 5C2GA 4RUBA 4LBPA 3ITHA 3CCTA 1HR0F 2KHDA 2L9DA 1IKXA 1F6TA 2H9ZA 1TL5A 3HHLC 1Z2ZA 3HHNB 2OH2A 4WE1A 1D8ZA 2HPUA 2E9TA 1C2PA 3UN3A 2F5GA 5AE1A 4G1QB 3BV8A 2LKZA 1TKZA 4QU6A 1S7HA 1R0CB 1ZM9A 1QAYA 4G6VB 1RBLA 2CG4A 2FIUA 1N5SA 4C8OA 1EKRA 2XHCA 4PZVA 4U8YA 4DF8A 2UXDJ 3TA1A 1RTJA 2XYPB 1IKWA 3RB0A 5L46A 2C2KB 1WEZA 3H2VE 3J80Y 3BBFA 5K20B 4LF7F 3GV5B 1EP4A 2ZEJA 2Z2YB 4JUZA 1FDAA 3MM8A 1RAIB 1RT2A 1B0PA 3ILIA 2V67A 3HULA 4J9NA 1TFYA 3DRSA 1FDNA 4LF2A 5DQHA 3M6WA 4LF6F 3OVSA 1FHTA 2I0XA 1R27B 2HQIA 4Q45A 2D3O1 2N3OA 3GYXB 4KGVB 1FKPB 2IDLA 3VZHA 3LANA 3V6DA 5E3CA 4IRCA 4LF9F 2I5JA 3W60A 5ETKA 4DN0A 2WCXA 2X1AA 3FBCA 2GMJA 1VR6A 4OMFG 4LVNP 4TY8B 4K4VA 3ZTPA 3GFZA 2DRDA 4ED4A 2J9EA 1C1CA 1NDKA 3UO0A 5L38A 3VAMA 3KG4A 1VQLS 2FHKA 3MMAA 1T3NA 3KWMA 1RT3A 3BEGB 4F02A 1EIYB 2R7UA 1X9WA 4J9VA 4DHVA 2AGQA 1MWZA 2YNGB 1Z2LA 2B9EA 2CJAA 3FMWA 2IA0A 2RF2B 2DNGA 4K4TA 2M52A 5GAHU 4EZ9A 4OJHA 3BSNA 1FD8A 4LSLA 1TKXB 2W8KA 3JTPA 4F4YA 1VQ5S 4CT8A 1OY8A 4RW8B 3D1QA 3MFHA 2VPZB 2QA4S 2Q6BA 4IYQA 2CPEA 2V68A 2J6TA 2BANB 4KHRA 2YNHA 2UUWA 2ZOMA 3LO3A 4Q7AA 4WU2A 3UQSA 1QUPA 3M9MB 2YQ3A 1IBLF 6FDRA 1AFIA 4I6AA 2BW7A 3B8HA 2R4FA 2POKA 3MDFA 5B09A 4KR0B 3ETOA 2PN6A 5D3GA 1Q53A 1TL4A 2FJVA 1YKWA 1LK5A 5JJBA 1NK5A 1J2VA 4IG3A 4XO0A 3FCVA 3QFHA 3H90A 1VISA 2QL7B 2I6WA 3CCSS 1F1BB 1Y5IB 4OJGA 2QX0A 2HNYB 3OTBA 2ZHAA 4J5OA 3KLGA 2H4YB 1VC0A 3GP9A 3UN5A 2EW9A 3IXQA 4X62F 1DAXA 5BXIA 3CVKA 1U25A 2EBGA 4FKXA 1KKHA 2W4DA 2AGPA 1WC3A 3H5SA 5IM0A 4USTA 1HQUB 2DPIA 1BQMA 4RZRA 3NOCA 5DM7Q 3MR7A 2V9KA 2QJ3A 3T6BA 4JV2A 1K1QA 3D0GE 4J9UE 1EETA 4F7VA 2HQCA 2CPJA 3QFWA 1SCJB 1RKJA 1TAQA 1XNRJ 4IH7A 1PAUB 1YBTA 2MJUA 1S9GA 4R8UA 5HANA 2XGQA 4DL3A 3QRRA 2H1YA 4X4VA 2ZJPQ 3MEEB 4ED0A 4QIEA 3H0PA 4GKJJ 1PCAA 1IXKA 2Z0GA 1UJ5A 2ZBRA 2CJKA 2QLFB 1CPZA 3GJSB 1WHYA 1RT6B 1V5IB 3KK2A 1VRUB 2O01C 1TR0A 5A2QU 2VJVA 1C0UA 2GJIA 4JI7J 1XERA 4H4MB 2CAJA 3ZZUA 1AROP 4A8QA 2DGTA 2J0SD 4QR2A 4OZ3A 4NZ6A 4RWWA 3CD5A 2H4WB 3LOUA 4OYWA 1DHMA 1DQ8A 2VG6B 2VBWA 3DU5A 2GO8A 1DTQB 4B08A 2HNZB 2ILZA 1KLMB 3E01B 3CCES 1IBMJ 3MF5A 5K8NA 4KB7A 1KOHA 1BD6A 3A13A 2IY5B 1HD1A 2AJ1A 3QJLA 1ZM2A 4MH8A 3IR5B 1VQSA 1FDBA 4DFMA 1YJNS 2N7CA 2HVZA 2YKMB 1QUVA 2CQPA 2FJWA 1S1WB 1W25A 3C6UB 1RJJA 5IS2A 2R7QA 1B64A 1U1NA 1IBKJ 2DD8S 3G6XA 4N8NA 2NYIA 5A8KA 4XDCA 4A4JA 2HFVA 4PXBA 3JSMB 3UD5A 1RTDB 3TUPA 5HBMB 3G4SS 3K58A 1URRA 1F5CA 2VPXB 4ED3A 5T41A 4OFZA 3FUYA 1CJUA 3R5CA 2AMCB 4O0IA 2QL9B 1OSDA 4RO0A 4F25A 1CJVB 1Y4ZB 2RQ4A 2K1RA 1NO8A 2DVIA 5AXNA 1RTHB 3JQKA 4FYXB 3DLKB 1IVZA 3BO2A 3ENQA 1GNKA 2MQMA 2KTQA 1PILA 1NJXA 1RWKB 4HI1A 3TI0A 2XMAA 1Y5LB 3G6VA 4V1Ak 2BM0A 4FN5A 1U26A 4FF3A 1FKOA 2QA2A 2DGQA 5K14B 2WONA 3MEGA 2QE5A 3PTWA 4DS5A 3IS9A 2UUCF 3CF5Q 1DARA 2LP4A 1FKAF 2V4RA 4EBEA 3W62A 3I31A 1FWKA 4XIUA 2G9OA 8ATCB 1ZA2B 4PG7A 3R97A 4L3NA 2LQJA 4DZ6A 3V4IA 3O44A 3OTDA 5HP1B 4USUA 5KFSA 1S9EB 3KHRA 2J9DA 1V3SA 1LWFB 3NNCA 3ZZOA 3UE2A 1Q0NA 1KNZA 2QV6A 3GQCA 2C3YA 3FEXB 4CLPA 3QLHB 3I55S 3H98A 4ZJOA 4K4ZA 1IKYB 3QWPA 1Q8BA 2HFZA 4ZJLA 1WHWA 2VBYA 3TJ8A 3C16A 4W98A 1CULB 4X65J 4DFKA 3OJUA 5A8RA 3PYFA 5B0AA 4PR6A 3W9HA 4U96A 1TAUA 2LYVA 5E3AA 4NMXA 3LPEA 2WVEA 4WF9Q 3F73A 2BE7D 4WBFA 1NK6A 2CPXA 3KK1B 4DR7J 3W7BA 2DGWA 4A8KA 2YKNA 3P4UB 1SVDA 4F2SA 5JMNA 2B9WA 4JYAJ 1NSQA 4JI1J 3MPDA 3A12A 3S1TA 3MWBA 2E7WA 1M90T 4FYDA 3CSKA 3WQPA 1FRLA 3W66A 1UA0A 2OFHX 4K7QA 4WYLA 5KFJA 1TK8A 2YQ1A 4ECYA 3JSYA 1GT8A 3OD2A 4X4SA 3EGWB 4LVOP 1FEEA 2QG9B 2X51A 1HA1A 2GHVC 2H5IB 3HVTA 4TQSA 1S7IA 2HBYB 2ZH6A 5L39A 1N88A 4JI0F 3CC4S 3ILLA 2M3DA 3HJVA 3LH2S 3L3CA 3X3UA 4PUOA 2VFVA 3NY0A 5M2UA 3L95X 2OI2A 3BQ0A 2K7KA 3MTJA 2ZBIA 2Z2ZA 3MCSA 4DR1J 2NUHA 3S8SA 5F8HA 5KFBA 2C2OB 4USHA 3N5FA 4DV3J 3FEYB 2I1RA 3R3TA 3N0VA 5CYMA 3LA0A 1S4EA 4ZPTR 2W4PA 5I3PA 4NXNF 1YTYA 1KONA 3O1LA 3KJQB 3M8ZA 2UV8G 4P2FA 2I2YA 3TQ1A 4A8MP 4XTTA 5HL7Q 1KOOA 2XSJB 1N33J 3DOMB 4CI0B 4LSZB 4G65A 1HL6A 3Q23A 2OPSB 5D4PA 3V6JA 5F3ZA 1HQEA 1S0MA 1HBNA 3SV4A 3NWGA 2OD4A 4NX9A 2WVCA 5KFUA 1J5EJ 5ETLA 2OTJS 3HZGA 2DH9A 2FVPA 1FXLA 2VG5A 4I6YA 2JLFA 4LJMA 3NGTA 1I3OB 4OYOA 5GAGU 5LT5A 3DHWC 4C8LA 3SCIE 2J76E 2MGZB 4CLSA 3LWMA 2CKWA 1OS5A 2EWHA 3OFEA 4B9SA 1VIOA 4DSKA 2RDIA 1TK0A 2ZHBA 1SIWB 1PJ6A 2BRKA 1U0HA 3C46A 4ENOA 5BYQA 2HQGA 3DHXA 2KZZA 2KRBA 2ZKUA 2XCAA 5A0YB 1N6QB 2HBQB 3MM9B 5H9EJ 1GTHA 2W7OA 4P74A 3K57A 3AOCA 1R0AB 1HHTP 1REVB 4X4NA 1W2IA 1N34F 1YJVA 4B3OA 4I2QB 3M1VA 3MAHA 4DSJA 4JP8A 4X66J 3G71S 2D69A 1RBAA 4PQUA 4CLZA 1WI6A 4U6PA 3LALA 1RAGB 1FE4A 3DOLA 1SKRA 2V2VA 4QWCA 1N48A 3LP2A 4A8OA 4OZ5A 1B3TA 3KDOA 1UP1A 1IQTA 2AYBA 1VLYA 1XBWA 2EG2A 4NLVA 3VAJA 5J2MA 4F4AA 4CH0S 3RYLA 4MYUA 2DHAA 2CPZA 1EQ0A 2AW0A 1FRXA 2XMUA 4E0DA 2ZD1B 5ADZA 3DLGA 4LRCA 1G4CA 4CLFA 2GCFA 5MAOA 1M1KT 3EMTA 4P75A 4LFAF 5L1JA 1S97A 2WOMA 3RW6A 4ES3A 4FDFA 1LWEB 3IBFB 2BUNA 1TZ0A 4ZCKA 4MTPA 3Q8YA 5THWA 5H9EK 3EPIA 2ZITA 4CLTA 2WB1D 4Y0FA 2XTJP 5A6WA 2LA6A 3DDIA 4I2PA 1SH3A 3D4JA 1NNDA 3HFZB 3W2VB 3T5LA 3WC0A 2R7RA 4DFJA 2BJDA 3QQCD 1B4SA 2CA9A 2YNFB 4WP3A 2PFFB 2PA3A 2ASLA 3GR1A 4JI3J 4RW7B 4J9PA 2MZSA 1DURA 3M2UA 2HS0A 5KT6A 1UTAA 4X4UA 4Q5VA 4CM2A 3IN5A 2MKJA 3VZIA 3IAM9 3EZOA 2NXJA 1KQSR 1N36J 3TA0A 4U9RA 5B0DA 1X60A 1X9MA 1SH0A 4IH6A 5BR8F 4DR4J 1U48A 3DLBA 3FBBA 5KG2A 2NYHA 3ET6B 4AXJA 3AB4B 1T05B 2M8DB 4KRWA 4RUHA 1QTMA 4N77A 1WJ9A 3D6FB 1FERA 2DR7A 4NASA 2LXUA 2HVEA 3AOBA 4QR1A 4BC7A 2UXBF 4CZCA 4K4SA 4B3TJ 3FSIA 2W24A 5HATA 4UF4A 1HMVB 1VIXA 4DOZA 3IO1A 3JQMA 2X1GA 1BQNB 4QIGA 5KT3A 4FYWB 1SC1B 1Q79A 4IOAQ 3CDUA 3QJJA 2DNMA 3RG6A 3IRXB 2BE2B 4UY8T 3R7SB 5IQQA 5L1KA 1VS3A 2CXEA 2CPDA 3RRGA 4U8VA 5F3TA 1WF1A 3M2RB 5DDPC 2HK2A 4O4GB 2DHSA 4LIWA 3KLFB 4N8OA 3NXZA 2DISA 4M5HA 4QJVA 3CCQS 1YRUA 1FRKA 2HW3A 1ZH5A 1MMLA 2GA7A 1DY3A 1X4FA 2HAFA 1VI7A 1RHMB 2WW8A 2NZCA 1WHVA 3CDEA 1TKDA 4B9NA 5C25A 2FZCB 2FGCA 3LGHA 4FVCA 3TVZA 2EK1A 3V6HA 2HSEB 1KRPA 4YR2A 2XS7A 2XNQA 4CO2A 1RKIA 8RUCA 3PRBA 4KHMA 4URSA 4HYKA 4FXWA 1WEYA 3W8PA 1TL3A 1TV6B 2Q3PA 1XNQJ 2LEAA 1UZHA 4ECSA 3PW2A 4PG8A 3I56S 4PWDB 2J7UA 1R8BA 1DZ5A 3PACA 1SPBP 2KYZA 1TELA 2X3DA 4KC5A 2EI5A 3VF0B 4AD6A 5G0RB 2Y1LB 2FZGB 2ADCA 1TMJA 2ZH1A 3D28A 2WVBA 3A8IA 4F0HA 2WTFA 4GVBB 2X7IA 2RU3A 3HLUA 5IZHA 4FNIA 3WZ0A 2QTWA 4PG5A 4Z37A 4X4OA 1H74A 5J2PA 3VCDA 2D3OR 4YB6A 1VK8A 3GFHA 1ZS6A 3NMAA 3FBFA 1BMQB 2B9XA 3G2XA 1R3NA 2LQ9A 4ZLJA 5DQGA 5DLGA 1NKBA 2PDAA 1UKUA 5LOQA 5EX3A 2DR6A 4DSIA 1SC4B 1J27A 4NLDA 4CO5A 2RT3A 5B08A 3ENWA 5LMNJ 2Y9HA 2WHOA 2IJFA 5KFYA 2VB6A 1L5UA 2NSCA 4I56A 2W2PP 3H2LA 2QT7A 3OTOJ 3FZBA 2LXIA 3TA2A 2PD1A 2Y1RI 3O3LA 3AB2B 3QZ8A 2UXDF 1M5OC 4UOHA 4IQXA 3A3NB 4NYOA 2GHPA 5J2NA 3NS5A 1JLGB 4F3QA 5HMWA 3UVJB 1DRZA 2N4CA 2XHWA 2QRRA 3T1YJ 4NMLA 1LXJA 4WZMA 3EM1A 1S1VB 2HWHA 3P5TL 4HR2A 3BR9A 4NZ0A 2Q43A 3D9BA 4MAKA 3R7NB 2JEGA 1RACB 4ZPBA 2ZVIA 1I51B 2DHGA 3POTA 3HVRA 3CCWA 4HH1A 1U0SA 4K5SA 2MKHA 2OUGA 4WJBA 1FDDA 3V81B 4Y6IA 2MKKA 3CDAA 3BJYA 4ZJQA 3MECA 2A6MA 1H72C 3C6TA 2XYGB 3FQLA 4B3SF 3MEKA 3SEOA 5B0CA 1LFWA 2WW4A 2JFDA 4UQTA 1TFWA 5CH7B 5A8WA 1RQ0A 3K5PA 1G7CB 1X0PA 3W9IA 2FHJA 3EE3A 4F2RA 3ZZ0A 1Q82T 5F8NA 1U45A 2LQBA 4C8ZA 2GZOA 3KHLA 5LXYA 2BVZA 2G0JA 4CYUA 2OELA 4P2XA 4ECRA 2XS2A 2V9WA 2VD3A 2FLNA 1HBMB 3PRVA 3Q8SB 2DGOA 3O5TB 2HHTA 3MM7A 3Q8PB 4DFPA 4MYTA 5KG3A 3BF4A 4LF9J 1PIEA 2N4DA 3QGIA 3O8WA 3P8BB 2MQOA 1T8EA 2YKPA 4OV1A 4PPZA 4WFBQ 3HF5A 3KMQA 5M2RA 4ITSA 4CLUA 3MPUB 1HWKA 5IT4A 2HFNA 3MFIA 4V19X 5IT0A 3TAMB 3EZUA 3CJKB 3KLHB 5H9FJ 1ZOTA 2XG8A 4LT6A 2D9PA 1UEUA 4NA3A 4ZMMA 4RKUC 4OYZA 5LSRA 3CMES 3M8PB 2MZRA 3PW5A 4ILRA 4J37A 2LQ8A 2R8JA 3ISND 1RE1B 2QMWA 1GXUA 2FQQB 2IA6A 4CT9A 2ZFHA 2VKRA 2R7SA 1JXVA 4ECWA 1M5SA 4C11B 3IGVA 3R8YA 1T94A 2WSFC 1VBYA 4O3NA 3WDOA 1TUVA 2H54B 4P2SA 1UVJA 5E7OB 3GLJA 2GNKA 4HHUA 2J8AA 4N7TA 3H4DA 3DC2A 1KEKA 1B70B 3OLAA 3Q0AA 3NGUA 1N0VC 2EK6A 1RISA 4DUTA 4I6WA 4JI6J 3EGVA 2W9BB 4TY9A 1SC3B 5C42B 2HS3A 4CRJA 1NXIA 1KLNA 1F5BA 4RW6A 2CADA 5HMZA 1FT8A 5H9FK 1VQKS 3HP6A 2H5JB 4PXDA 3QO9A 3DCAA 4JV1A 1VHFA 3N28A 2FZKB 4Q8FA 1Y00A 1MG7A 3MTKA 1UFLA 1XJWB 4KIAA 1NSAA 5DRKA 4C8MA 1XNRF 3OTEA 2MY8A 3AOAA 4K59A 2CVEA 3PIPQ 4KO0A 4X62J 1QM9A 4DUZJ 4IG0A 3IRWP 2R8IA 4GKJF 2GVZB 1H7WA 1P8GA 4J9RA 2G0CA 3U27A 4AT1B 2MZ1A 2P8IA 2M2BA 2FJAB 2XI3A 8AT1B 2HRYA 2KFZA 1UEKA 3WHIA 5HMXA 2W25A 2U1AA 2B7BB 2HQFA 5HVFA 2BBEA 2OSRA 2BJ8A 1WNEA 3PYDA 5FD1A 4JI7F 4OZ1A 3HSZA 4HEA9 3TUZC 2CQGA 1S59A 3D0HE 2ATLA 2B4OA 3GR0A 1TKXA 3KJVB 1WD6A 2NCKL 4LRDA 2ZKTA 4J9LA 4RW8A 3RR7A 2B7CB 3PV8A 2CRLA 6FD1A 4ZVRB 3GJTB 5L1IA 1OIAA 4ZIVA 1KQGB 2FJXA 1VDHA 2QLWA 1NH7A 4FBTA 4CCHA 4PCQA 4N41A 4K2JA 3CULA 2AHOB 3I5CA 1IBMF 2X1BA 4JOUA 2MLZA 2UU9J 4DV1J 3BSOA 2V69A 4BLGA 1VQ4S 3QAEA 2YNIB 3KNGA 4MKBA 1FFWB 3R27A 3HX9A 2MB0B 5HQMA 4IDKB 1GX5A 4CLLA 1EB0A 2FGOA 2CQDA 4DQQA 5J1EB 2HMIB 1IBKF 1HQ2A 3CD0A 1REGX 3MI7X 3W5XA 2U2FA 2CZ9A 4Q2LA 2N7YA 2R7VA 4EYHB 4KKOB 1ZAWA 1KVIA 2ALZA 2MTLA 2CQHA 2QN6B 5D77A 5LMUF 3TEGA 1RT5A 2IAJA 1H0HB 5C24B 4PXCA 3SFGA 3KLIB 1LWCB 2XY6A 5C5JA 1ZTWA 1JQGA 2CFXA 4ECZA 3PY8A 4QWBA 3UW1A 1HNWJ 3SXLA 4PYDA 4D3HA 5E3RA 3K2YA 3OR2B 2B6AB 3AQPA 3JB9k 3S01A 4LR7A 3N4WA 4P7VA 3QT6A 3NBPB 2DRAA 1K47A 1HQUA 2B43A 4LSNB 3WIVA 5FDLB 3RBEA 4DQPA 2ASJA 4URGA 1JX4A 1UZDA 3KK3B 3NNAA 2GAGC 5DJBA 1RAEB 2AJ4A 1M1GA 4V19J 2IC3B 3LTOA 2PE8A 2DNKA 2RU9A 4CO4A 4QIVA 4URQU 3GU0A 3VQTA 1T9YA 1Q8LA 1RSCA 3GILA 3DI6A 5A6PA 1WG4A 2VF3A 2BACA 3MEEA 1S9FA 1GQEA 2OPRA 2AEFA 4DG1B 4DU8A 1CJKA 1YK9A 3CO0P 4ECQA 1XN9A 3BGFA 3QSYB 1JJ2R 3BQ2A 4H54A 5T14A 3EZ5A 4KV8A 2FVRA 4LBHA 4ICLA 1VRUA 3NAHA 2RDDA 3NAIA 2WK4A 3QSIA 2GQ2A 4EK2A 4ZLLA 2F8MA 1R8AA 4PXEA 4DQSA 3FSYA 4ZLPA 2J0XA 2FVQA 4RPFA 3ZTQA 1NAQA 1YGYA 4X65F 5KFXA 2HG4A 4XPCA 2IM3A 3OXFA 3MR5A 4MIWA 4OLPA 4LFCJ 4EBDA 2VG6A 4M5JA 1U6FA 5EHHA 1NUEA 1EJ7L 2BM1A 1DTQA 3LP1B 1QE1A 1Y5NB 3SSQA 2OIHA 2MPUA 1KLMA 3FVYA 4Y34A 1AW0A 1DLOA 3CTRA 3RJMB 4DR7F 4MFBA 3MEDB 4F36A 4M1KA 3OBIA 3MM6B 3HHLD 2KG1A 1IJFB 4JI1F 4O0NA 3CJRA 5MLCV 2DR8A 2ZDPA 3PR4A 1S1WA 3C6UA 3JYTA 4FS1A 2W2QP 1KVJA 4WTYA 1JNZB 3I96A 3KHGA 3K59A 1Q78A 4LQ9A 1U47A 3OR1A 4Y3CA 3AD9C 1HYSA 5CABA 4ANDA 1WI8A 5ETNA 3DYAB 1RTDA 3QIPB 5ETQA 3WX8A 3FRYA 5CZVA 3LP0B 3DGPB 1IM4A 2J0QD 1JJCB 3RUBL 4DR5F 2BQUA 2FPHX 1CJVA 3TZWA 3BSCA 2XZDB 2LU1A 3ZZTA 5CCLA 1V3RA 3D54A 4DX5A 3DLKA 3PZPA 2FY8A 2FJEB 4YN3B 4DR1F 3IGNA 2X3GA 1Q7LB 2DO0A 3D3CJ 4DN9A 4NL5A 1X5SA 1HI8A 5AXKA 5IWAJ 3FDSA 5D4OA 4MKAA 1HWUA 5K14A 4MMOA 1T9XA 4ECUA 3JSBA 4Y2AA 1CLFA 1N33F 3MAAA 1UVIA 2ROGA 3K5LA 3TAQA 4CNZA 2JLEA 2YWHA 4C9DA 4O3OA 3OXGA 2NXCA 4O23A 3SMZA 1KBRA 3K17A 2DGXA 1HNZF 1TUWA 1H2UX 3LF0A 4DWIA 2B8QA 5GMDA 2VPWB 1OQ3A 3M8SA 1LWFA 4DCPB 3PX4A 2CQCA 1JLEB 4X64J 1KC8T 5LSOA 2V2ZA 1U1MA 2HAIA 5L8RC 2WAQD 3GMGA 3I4PA 1NRKA 4C0OC 3PFEA 3SFUA 3B78A 4KE5A 3VHQA 3KJFB 4UTGA 2HFOA 2XWXA 3ZTSA 1SIZA 2E9ZA 3J7Z5 2LLZA 1ZBTA 3FFIB 3M2VB 3HVAA 1UMJA 1UCNA 2FHOB 3ITHB 4ZDNA 3J7ZT 2Y0SD 4JV5J 1IKXB 2IIHA 2MKCA 4WE1B 3H7HB 3M9OB 3CCMS 1FX4A 3UN2A 3US5A 1UETA 4R0EA 4DV7J 4PKDB 2ZE2A 4HTJA 1RT4A 1C1BA 4PYAA 2MQPA 3R6GB 4NLUA 4KY3A 2OEMA 1I94J 4LREA 4IKAA 1X4GA 3SSRA 1FESA 3PJXA 1WOPA 2NXEA 5FLXY 3AT1B 4ZPDA 3OL9A 4X66F 2KRRA 4S0MA 2E29A 1MROA 2Y8WA 3DMJA 3ICLA 2ZJQQ 2BABA 4P7TA 2IJRA 4P10A 1J5OA 4IQMA 1NCLA 4EUVA 2ZVSA 1RTJB 2Z57B 3ISNC 4FYVB 1IKWB 3HSDA 3QGPA 3KXDA 5H1SV 4LF1A 2HEKA 3BDEA 1EP4B 2DIUA 2DR9A 4NI2A 4K4YA 1HW9A 2GO9A 7AT1B 3D7SB 4HACA 1UW4A 1RT2B 1N34J 4TQRA 4RL1A 4DLGA 4ED1A 2DNLA 2Y3YA 1RAOA 2HHHJ 3HFKA 3DRSB 4U7CA 2VIHA 4ALZA 4J9OA 1JKHB 4OQJA 2XMTA 4ZPVR 2VG7A 4K5RA 3CDBA 2AJ2A 4ID5A 1NPRA 2V8HA 4J90A 1WF0A 3R6LB 3V6DB 1ZM4A 3ZXWA 2G1HA 3CCLS 1WTFA 4NPOA 4M8LA 3BYRA 2OPSA 3GV7B 4H4OA 2I9SA 1X4AA 1JK9B 2YWKA 2OFGX 4I4BA 4OX8A 3MURP 1C1CB 2DRBA 1IR2A 1XK8A 1NZAA 5KT5A 2CNKB 1YZ7A 4JI3F 2B51A 4KPYA 1WDTA 3CEDA 4LF4J 5KG1A 1RZMA 1RT3B 2VFRA 2W4CA 1W26A 2DKOB 1ZAXA 2MZQA 1N36F 3DM2A 4MK8A 4F4WA 1L3SA 4LRFA 1WC5A 2MGZA 4DR4F 3MUMP 1D1UA 2V4QA 2ZH4A 1EAYC 1SV5A 3TWZA 1TVRB 2VOPA 1IWGA 1T3OA 3RAMA 3AY0A 2EG1A 4RBTA 1R6VA 2B4VA 3RTVA 4BHQA 1X4BA 3ISZA 2VHGA 3CE8A 3HM9A 4B3TF 3FJ2A 5A0YA 1U24A 1N6QA 3BPDA 4CTAB 1R0AA 1REVA 2J8SA 1IQZA 3V5RA 4ER8A 3RR8A 3CT9A 3BBBA 4JI4J 3J7A1 2DR5A 3HSJA 2DXEA 2ACMA 2PMHA 3M7VA 4I2QA 2R7XA 5D3GB 3EWGA 1JLQB 3VVUA 4ERDA 4IG3B 3GONA 1WTBA 3K5NA 3T5KA 5M2PA 2DNRA 1NK4A 3OT9A 4LF5J 3SQGA 1S10A 5LJ3Y 3FCWA 3C3LA 1P6TA 4LR9A 3KLGB 2DGVA 2IM1A 4IRKA 5IV4A 4P6QA 2ZD1A 2KI2A 1QSSA 3T41A 2DY9A 5DS7A 5D4LA 3GV8B 5F41A 4OZLA 4RW4A 2AIRB 3CD6S 1PG5B 3SCJE 2AV5A 3UWTA 3T19A 2LU2A 2RQMA 5HQ8A 1BQMB 4YP3A 1KD1T 3HO1A 2OP5A 4OHVA 3U1NA 5F9LA 1XNQF 3KLEB 5K8MA 5EN1A 4FP9A 2EFGA 2RUSA 2HK3A 3M8QB 1YZ6A 2YPYA 2JHEA 3MCOA 1SJ1A 1VQ6S 2RAQA 3W2VA 1IR0A 3JSRA 4DR6J 1QSLA 4IOBA 4TU7A 1ITPA 1XMQJ 1YJTA 4LIRA 3NMRA 3DXBA 2ZNYA 3GB0A 2L08A 3D6HB 5U47A 3LGNA 2G2ZA 1C0UB 2YTCA 4NWBA 4IR1A 3NP5A 1LNQA 1YI2S 3DU6A 2AEJA 1FWPA 4NLPA 4ZVUB 2VFSA 3QT8A 5KFIA 1WF2A 1KHWA 1SUQB 1S76D 1MN9A 5LMNF 1BQXA 4IR9A 3AHPA 4DQIA 3J81Y 2AJFE 2QLXA 2RNEA 4IFYB 2UZAA 2IJNA 4XAKA 5AE3A 3OTOF 2L41A 3TVYA 4F04B 2UUBJ 1NJIT 2ZDOA 2W2OP 3EPGA 1VQ8S 4M95A 1JNRB 1BQNA 3CIZA 2OPPA 2LFVA 3BO3A 2P9CA 3IR6B 1TL1B 3A4TA 1GMUA 2BKNA 3N5BA 3IRXA 2BE2A 1SI9A 2OSQA 4DV0J 3QRPA 1FRIA 3H8YA 1H98A 1DTTA 1WOOA 2AX1A 4OYIA 2EFVA 4L74A 3EICA 3T1YF 4EEYA 2W2MP 2NPIA 4FXVA 3BQ1A 2EKYA 3KLFA 4LQ3A 3R5BA 4F67A 4ETZA 2DNQA 2KJWA 3EX7B 1UFKA 1NPPA 5IC4B 1K73T 1JLCA 1HI0P 2GAHC 2PEBA 1T7PA 4YDDB 2C3MA 3OSPA 1CJUB 3DRPA 1LKZA 1KSPA 5E3PA 1YSJA 1S5ZA 4LF8J 3DDNA 1H7XA 4I67A 2DT9A 4C7QA 1RWVB 1C4AA 2DNOA 3M6UA 1VQOS 3OXLA 1RAFB 2MQNA 3KKFA 2BR0A 2NUUG 1SC6A 1FKOB 1K0VA 2O3DA 1UW9A 2WONB 4UT4A 2WBMA 1KP6A 4PWDA 2EC2A 4ETXA 1U8WA 3TVKA 3GYGA 1TUGB 3IBCB 3PDNA 3QYYA 5ETVA 5G0RA 3EXCX 2VBXA 1KFDA 1OY9A 2Q79A 4AL6A 4B3SJ 2BKOA 4Q44A 2WSEC 1Q8KA 3N79A 5D8HB 1M5VC 1S0NA 3I6PA 4F0KA 2VUGA 1FCAA 5KAKA 1IKVB 3JTNA 2E5LJ 2D7SA 5DGAA 3LWLA 2ACYA 2CPHA 2R7OA 2ZOGA 2OLWA 2F1FA 3HJFA 3MZIA 4HVZA 3OHAA 4DR3J 3GSDA 2Y8YA 3RGIA 5IOLA 2G2YA 2XYHB 1DFDA 1T9WA 2PSZA 1AUSL 2GS8A 3C16B 4CO1A 2IYGA 4WK3A 2MJNA 3Q8VA 5A8RB 3RZAA 2RQCA 3PFOA 2ZC3A 1H6KX 1U1QA 1P1TA 4HL9A 3TARA 1TQLA 3P49B 1CVJA 1KHVA 3UD4P 1WC0A 4CLWA 2M8HA 2I38A 3AODA 3SI8A 2YKNB 4RUAA 3NLCA 2F7VA 2CJXB 2YX7A 1HLWA 1MW7A 2XC9A 5HO4A 2WSCC 1ZTTA 4K0KJ 1F0XA 1HBOB 2L3MA 4B3MJ 3BGOP 1MMDA 1JLGA 1VHIA 2UV8A 3H42A 2DEIA 2OTLS 4UZBA 2LDYA 4FBUA 4DV5F 1S1VA 2MQ8A 5DZ6A 2UXCJ 1ZYQA 3DLLQ 1TU0B 1U8SA 3CW2C 2HKEA 1EKSA 3MD3A 2BXJA 2VDIA 4L72B 4ELTA 3P96A 1ULRA 2GVDB 4B9LA 4JI6F 4DDFA 5GAEU 4ZVSB 1YLXA 1JLFA 5JUMA 2JEJA 2R7TA 5DZ7A 1HHSA 1WC4A 4NE9C 1CBKA 4QWAA 4ZN3A 4C3MA 4WIQA 4QWEA 3D66A 4ZVHA 1RA7A 1NDCA 5EWEA 1YHQS 1BWVA 1QJHA 5ETOA 4F4KA 1RTIB 3GIKA 1MMNA 1SH2A 3W5ZA 4AYBD 1HWLA 1IWAA 4KHPF 2JEIA 1AUDA 3BPSP 5CYMB 1XC9A 2P5VA 2Q66A 1S79A 3BGRB 4DUZF 5KFKA 2IFXA 2XMMA 5B7WA 2V50A 1FA0A 4UOGA 2LCWA 4NLOA 5B0EA 5KFMA 3H2UB 1Y7PA 5EWFA 3K5OA 1HBMA 3E2EA 1HBNB 1RHKB 3NCPA 1CS4B 1FNOA 3I82A 3UR0A 3TP2A 2VG5B 3U02A 4FKYA 2AZ1A 2B56A 2IPOB 5D4NA 3HI9A 2E7XA 1IUJA 4ECTA 1AXQA 3CJKA 4DZDA 4RNHA 3OJSA 2MSTA 2UU9F 4DV1F 2BJ7A 4ED8A 2BE9B 1PC4A 3OFGA 4I68A 5D78A 1S12A 5G4DA 3M8PA 2OPQB 1G6BA 2NR0A 3R1HA 4ZA1A 4DPTA 2R2UA 4G1PA 4TLQA 4OLOA 5GADI 1AZSB 2C2RA 5HQLA 3UDCA 4RWXA 3SIPB 5J2QB 2L48A 1UEVA 2B5JB 3EUNA 3TYTA 2RKIA 3KHHA 1AFJA 2HGMA 2O5DA 3CMQA 2HRTA 4ED7A 5HROA 4C11A 1SB6A 5T7LA 2ZJRQ 4DR2F 4B3OB 3M1VB 5C7PA 3SCKE 2K3IA 4KH0B 2ABYA 1SQFA 1PKUA 5E2QA 2DH8A 2IRYA 4YS2A 4TN2A 3J7AN 4USJC 3LP2B 1HNWF 1IN0A 4USMA 1U1KA 2W9BA 1L3TA 5C42A 5D0HA 4Y2IA 4BBYA 1Q86T 1SXLA 4OL8A 1S0VA 3IG1B 2AD9A 5J2MB 3MAQA 1XMOJ 2IMWP 1Q5VA 4NXMF 5LM7E 1RP5A 3TQEA 4FF1A 3I5AA 5KFTA 2MSSA 1B7FA 2H65B 5HI7A 3MMBA 5LMUJ 2WRMA 2GQQA 3LGMA 2CQ2A 2R2TA 2E5HA 2C22A 1RDRA 2ZBPA 1VQMS 1FTCA 1KS2A 1PJ5A 4ES1A 4H4KC 1RA6A 1OMSA 2QA4G 1C0TA 1VRTA 4AQYJ 2GVZA 1FE0A 3PYGA 4DCJB 5KFLA 3J81j 2VU5A 4QYZK 1N0UA 3HT0A 4I2PB 3W1YC 2OO4A 3GIJA 1M5KC 3I0RB 2EKNA 3M6VA 3IA0A 5EUHA 2VJUA 1VGYA 3OUYA 3KDNA 3M2UB 3IWNC 5D0RA 4C48A 2CJYB 2BW2A 5HN0A 4NLRA 1BLUA 2AZ3A 3NGSA 2QSFA 4YOEA 4HT5A 2UUTA 4LFCF 4F4ZA 3CWJA 3KG0A 3A3PB 5ETPA 3M8RA 3IBWA 4DL6A 4RNMA 2CQ3A 4ZVQB 4Y2KA 5B0FA 2QMUB 2YNIA 1CJTA 4HLBA 1MNEA 1P27B 3MMCA 4GC6A 3DLEB 1U6BA 2AKWB 4A47A 2R9LA 3M4XA 1LW0B 4OYXA 3HMJG 4QW8A 5J1EA 3U1MA 4W92B 2AGOA 2JL9A 2VC0A 2HZAA 4ZS6A 5KOXA 2JRSA 5CAAA 5DDRC 2UUAJ 3O6QA 2ZNZA 4DPUA 2VONA 2RHQB 3BR8A 4WCEQ 3MD1A 3VQSA 2Y0BB 2AJQA 2YKAA 1T9TA 3DLJA 1F3FA 3N9UC 2W9CA 5C24A 2XWYA 2QMXA 2VQEJ 4WKRA 1LWCA 5L9XA 4KFBB 3BH7B 4DV2J 4JI8J 2D41A 2VC1A 4KYZA 4YDXA 4RU2A 1NK8A 1B0VA 5F8LA 3MGJA 3OR2A 4DL5A 2B6AA 1HPZA 1F60B 2ZH9A 4LSNA 2QGFB 1RWWB 4RW9A 5FDLA 3TZYA 4HH0A 4C4WA 3NEKA 2G4BA 2VQFJ 1RCOB 1P1LA 5C25B 5IWAF 4ATNA 3VGSA 3AA9A 2A2CA 1HNIB 2IC3A 5BYRA 1YG0A 2DYAA 1OQ6A 4DR5J 4PRFA 3LPYA 3DOKB 1RHQB 5DO2A 1HBUA 2AYMA 4OI1A 2C28A 1OSCA 3GJRB 3PW0A 1GTEA 2M0GB 2JH3A 4HTIA 1Y11A 4DG1A 1UWAA 4FS2A 4OX6A 3U7JA 4CH1A 3C8YA 1NSKL 3BH6B 5IC6B 2K2PA 3CO9A 4X64F 2APOA 4I69A 1RT7B 3HCXA 3E51A 4KGXB 2CUYA 1V6HA 4A8YA 4OX9F 3OL6A 2J6UA 3HHDA 2KG0A 2GIQA 4NLXA 1BUXA 3QGHA 1N5TA 4ED6A 3ZC4A 3PW7A 2HURA 3V2UC 5J2PB 2EXUA 2GX8A 1H73A 2RIJA 4L76A 4JV5F 3HHLA 2MZTA 1HNZJ 4WKYA 2CNOB 2XBPA 4NRTA 3IC1A 1ROFA 1RGVA 3MM6A 4KGMA 4OYBA 3FCHA 2XZTB 4DV7F 4DLEA 4ZP9A 2W7PA 1SJFA 3TAPA 5I3UB 3I87A 3OFFA 1I94F 1YJUA 2JFKA 3K5MA 2BX6A 2GQCA 1FXRA 3IR7B 5LXRA 4BCAA 1F5AA 4M5GA 3DYAA 3QIPA 4L73A 1RI7A 1MLAA 2KZMA 1PGZA 3R2DJ 2OKQA 1NEEA 1RLCL 3LP0A 4GKKJ 2Z58B 3DGPA 3ZZPA 3M30B 3HD2A 3PX6A 1CEZA 4P71A 3G82B 5A2QY 1QDUB 5BJRA 1B99A 1LQ9A 1FO1A 2A0FB 3D0IE 3T3FA 2NXNA 4I7FB 3GIRA 3PHTA 2E9RX 4EMDA 1RT1A 4HHHA 5HVGA 3CUNA 2HHHF 1A6LA 2Z56B 1UWBA 5I3QA 1XWLA 4AUKA 2F65A 3MECB 4L75A 3UNGC 1HNVA 2QA1A 1FK9B 4OV6A 1DBDA 3CCUS 4ECXA 3QJPA 3F56A 3ULHA 5E41A 4CH7A 2JEFA 1NPKA 1F9FA 5A8WB 1DJ0A 5EWGA 2DCUB 2C1EB 1LW2B 1KR4A 4QWDA 2FC9A 5KFDA 2XULA 5HLFA 4GMKA 4E8UA 4BWJA 4LF4F 3MOJB 2RRAA 3DLHA 1OPIA 2JOQA 1WG1A 2Y1IA 4KTQA 2ZM6J 4NA1A 5CQGA 4P52A 1R7IA 3FGVA 3Q8UA 3UDVA 1U1OA 3SZ2A 2PIIA 4F0MA 2UVRA 2XCPA 1QAXA 1WDDA 4NLWA 4O4RA 1VQPS 5KFAA 2LQ5A 1S99A 4ZVOB 3DRRA 1GFWB 3FFIA 2CG8A 1HW8A 3M2VA 1Z1ZA 1RHRB 2CNLB 2L9NA 2GV1A 3IWLA 1RWPB 4WTOB 1GMWD 2OHDA 4OHZA 3QNWB 3ZZZA 3LQVA 1V3ZA 4NRUA 1RK8A 2DY1A 3Q83A 4TKTA 3TUJC 1QSYA 1KQKA 2XSFA 2C2NA 3OSNA 2V4JA 4EZ6A 2QLBB 4WFXA 4ZITA 4JI4F 2E5JA 2ERRA 3UCUP 2NLWA 4YHHJ 2KVIA 1JLAA 2DIVA 2YWGA 2W7AA 1NLKL 2XEXA 4ZP6A 1RBOB 1ZPVA 2PI5A 4K8RA 4WYWA 4MKYA 4LF5F 3D5MA 1NH8A 1U2CA 4NLTA 2DH7A 3W65A 5IV3A 1HNXJ 4DPOA 5F8JA 1WC6A 2Z2LA 4UY85 4K4XA 2DNYA 5I42B 4J9SA 3I9V9 4OI6A 1FD2A 4Q8EA 4KH1B 4UOFA 1VQYA 2J7WA 3PEJA 4YUDA 1S6QA 5KFPA 1N4LA 1E6YB 1JKHA 4RW6B 3TUIC 2ZZMA 1U2FA 1GH8A 3NG8A 1K8AT 2HGNA 4XDDA 3HZEA 1I5OB 2YH0A 2IVFB 3QO9B 4XK8C 2V63A 3RB6A 1UVLA 2KKHA 3HD1A 4OHYA 4CNYA 3C14A 3T1HJ 3ETMA 2M70A 2JLGA 2BQRA 1K44A 2DGUA 1JLBB 1RAAB 3VAFA 5DQIA 4KO0B 3JAMU 2A6OA 1ZM3A 4DR6F 4DQRA 3THPA 1NM2A 4IG0B 4F26A 1FFGB 2V5HG 4Q0BA 1WG5A 1XMQF 1VQ9S 4P73A 4ZHRB 4JI5J 5ETMA 3MR2A 2AT1B 3Q8QB 5KT7A 1EHWA 3A8JA 3N6NA 1SL1A 2HHXA 3HVWA 2PFDA 1Y3KA 3H59A 3NGDA 3SYZA 4YQWA 1A7GE 3SCLE 3PJWA 3UCZP 4QCLA 2DBBA 1RWUA 2EFPA 3OL8A 5DG7A 1KFSA 1S0OA 1NSPA 4HHJA 3M32A 4A8XA 5JXSA 1N5QA 1S1TA 2IM0A 2VA2A 3ILJA 4J7CA 1RYSA 1TVRA 3VVTA 3VAKA 1YJ9S 2DNHA 4NCGA 1AA1B 3MUTP 3PR5B 2PGCA 2ZHOA 3QGGA 2XZWA 2BOAA 3BSAA 2C3PA 3PKYA 2UUBF 3VGVA 5HJXA 3KUHA 1KTQA 1TKTA 4EU0A 1PYSB 3TEHB 3PX0A 4CTAA 4YMEA 1VCTA 1UVKA 2PA8D 1S6PA 4IUFA 2DPJA 3DRYA 3V6KA 4DV0F 1SKSA 4RU9A 1WOSA 3H5UA 3W5YA 2GGPA 4ZVPB 5AXLA 1SJ3P 1SQEA 1JLQA 3D3BJ 2B4UA 3EGNA 2DITA 2MMYA 3ENVA 3ZO7A 5KG4A 2DEJA 3TJ9A 2FJDB 2MQLA 1RB0A 5DLFA 4C2MA 5FIIA 1HFEL 2LA4A 1S1UA 1T11A 3K0JA 1RT5B 2IAJB 5AE2A 4IO9Q 1JXLA 2CWXA 3TZXA 4ZLNA 4H4KA 4C3KA 1XEZA 4LF8F 1NJYA 4YB1P 2HZVA 1NDLA 4DI6A 4DUYJ 3T9NA 3KTQA 2F9JA 4PWWA 1YVFA 4M94A 3DDKA 1RUSA 3I9ZA 1X4CA 1X5TA 3TR5A 4DPWA 3BKFA 2XO7A 4BS2A 3EDQB 4AE5A 1W2BR 3FQKA 2R42A 3KLEA 7FDRA 5KTQA 3AJDA 3M8QA 3GCXP 3KLVA 3IFEA 1NBEB 3MPWA 2V0NA 3DI6B 4RX6A 4P72A 4CLKA 3CIMA 4QPTA 2NPFA 3JXOA 2OPRB 1JJHA 4B9UA 1CJKB 2O1PA 2BJEA 3ZZRA 3H40A 2RILA 2FTRA 3HK2A 1LV5A 1PBUA 1L3KA 2E5LF 2OEKA 5F0UA 4KV8B 4R5PA 4OZNA 5AT1B 4ICLB 3A3OB 3PW4A 1M1HA 4DR3F 1TL7B 2F40A 2ZH2A 1CQNA 2X1FA 3MM5A 3WC2A 2RH3A 1YQHA 3D1OA 2KJVA 2FDNA 2ZWOA 3ENAA 4NYZA 5KFCA 3OL7A 1SUQA 5D15A 2AU0A 1S6UA 2ZH7A 1T03B 2CYYA 4ILLA 4NZ7A 5GAGI 2FUG9 2BDPA 1QE1B 4IFYA 4DSEA 2CDQA 3QAUA 5HK4A 2M7SA 3I4HX 4IFVA 2JJ4D 1EZZB 4PEOA 1DLOB 2EFNA 4MFBB 2HFUA 4YB7A 1S1XB 4RBVA 1IJEB 3C15A 1VBXA 1UPPA 4M63A 1U6ZA 1TL1A 2KU7A 1UJ6A 4K0KF 2GJ2A 2R3VA 4TLRA 1FTRA 4B3MF 4DPYA 4DL0C 3JYTB 2FB0A 1WHXA 1QAIA 3IM8A 3OR1B 2B0GA 3CCJS 4DV4J 2YY3A 4G1QA 1HYSB 2UXCF 3VAHA 5D0GA 4OJ3A 1PC5A 4HDHA 3BKUA 1RABB 3CJ0A 1VFJA 1N56A 5CYQB 4WFAQ 2O67A 3GFYA 2MY7A 3FSXA 2Q1LA 2E5GA 3ZNUA 3IAS9 3PVXA 3D68A 4CP5A 5KFZA 1T95A 4WK1A 5KG7A 2F4FA 3W3SA 1TMMA 2LMIA 4NLYA 4DV5J 1FNXH 4X4QA 2KB2A 3LAMA 1MWQA 2J5AA 2H3EB 2C3OA 2ALYB 2WZ1A 4A8WA 2XS5A 3OQ2A 2RHSB 2LECA 5BYSA 3C66A 3CNQP 3MAAB 2YWEA 4DV6J 3H20A 2JWNA 2ROPA 1RWOB 2RSQA 2HHUA 3CDWA 4YB5A 2E1AA 1FKPA 3LAKA 1SJQA 2K3KA 2FLLA 4PABA 3AD7C 2BJ3A 2J9DE 2MKYA 1V9OA 3K7RA 4M5DB 4KHPJ 1IKVA 3I0SB 2V34A 4TY8A 4B02A 4WPAA 1TK5A 3PHEA 2ZOFA 4EO8A 2BOPA 1L3VA 1U1LA 3TX0A 4A8SA 2C2MB 5EDWA 2CVIA 3LUYA 4CQ1A 4M5NA 1YRXA 2EC0A 3JAMY 1T9VA 2YX4A 2N3LA 2BMBA 2YNGA 4PQAA 4TYBA 5ETTA 4ZPAA 3L4BC 3R9LA 4R25A 2RF2A 4A8FA 1GK8A 1U4BA 4O44B 4OYPA 5ETRA 1D3WA 4U95A 2EFQA 1RHJB 3M05A 5B0GA 2B3TB 4Y65A 3BGLA 4EGLA 5KG5A 2PMZD 4FPRA 3PCOB 1VRQC 2AYEA 2A2DA 2CPIA 4RBUA 2ZE2B 1A9NB 1RT4B 3GSIA 1C1BB 2HNDB 1HBOA 2QSWA 4Y2MA 5CXTA 2KHCA 2BEFA 2BANA 3KUEA 4DX7A 2HLTA 1HHQA 1S57A 1WUUA 2FC8A 5F0WA 3HFVA 3QT7A 4U7UD 1MROB 3DMJB 3J7YI 1J5OB 2ASYA 1R8HA 1OJ4A 2HQ3A 3BGUA 3R1LA 2F4VJ 2HS4A 2RJZA 4K50A 1S49A 2GVDA 4HT7A 2HWIA 4NI2B 4YEAA 2R2RA 4WU3A 2QO3A 1XMOF 3VTIA 4HACB 3RAXA 2V94A 2Z30B 3PEHA 4Y00A 4DR2J 1LK7A 1N32J 2N82B 3JTOA 4PAAA 2PEHA 1RTIA 1FRMA 3PRDA 1ZZNA 2HNYA 4DJBA 4C98A 3ZNJ1 4OI2A 2VG7B 2XI2A 3MXHP 3MCMA 4ID5B 2ADBA 4LRBA 3BGRA 2YQ0A 1K0TA 2CJQA 3ZTOA 3G96A 5EGYA 1NJZA 3FZ2A 4AQYF 1O8BA 5CZXA 3KOAA 2OMOA 3CGIA 3ELHA 1RCXB 4N76A 3SDEB 4C0BA 3VALA 4OZ2A 3UR3C 2IRXA 4Z7CA 2DXDA 1K9MT 2YKOA 3NCRA 1NB2A 4H4OB 1Y0HA 2CQIA 4NXMJ 1CS4A 4WFNQ
chains in the Genus database with same CATH topology
2CJ9A 4C3MA 3QZ8A 4CO0A 1U2RA 2QEXS 4QWEA 1YIJS 4ZVHA 4USIA 1RA7A 1M5OC 2UXDF 3H4BA 1JB0C 5EWEA 1TKTB 2MQQA 4J9KA 2DGSA 1BC6A 1YHQS 1FEHA 4IQXA 4PPDA 2DK2A 4NYOA 1QJHA 3BZQA 4YY3F 4AL5A 1GX6A 1JIHA 2Z4PA 3BS9A 2GHPA 4AL7A 2RS8A 5J2NA 1BY9A 4F4KA 1RTIB 3NS5A 4WFZA 5CD4H 3GIKA 1MMNA 2PI4A 3QZ7A 3OW2R 1JLGB 1SH2A 1S6PB 4AYBD 1S77D 3A8EA 4F3QA 1HWLA 5HMWA 4OJ1A 1DRZA 2N4CA 4KHPF 3LP1A 5KOWA 5GADU 2JEIA 1APSA 2XHWA 4AFFA 1AUDA 4F8RA 2QRRA 5CYMB 3DM2B 4KAIA 2E1RA 4NMLA 1Q4RA 1XC9A 1R31A 2P5VA 4UOCA 1LXJA 2GGPB 2Q66A 4WZMA 2KXHA 3C2PA 5GAHI 3RRHA 3OHBA 1S79A 1S1VB 3MEDA 1SJRA 2HWHA 3DXSX 5DGBA 3BGRB 4DUZF 3P5TL 5KFKA 2IFXA 2XMMA 3HKZD 3BR9A 3GG1A 2VZ9A 3M9NB 2MZJA 4NZ0A 5B7WA 4PG6A 5CHCB 1FA0A 1X0FA 2LCWA 4NLOA 2Q43A 1SV5B 1HWJA 5B0EA 1D9FA 4MAKA 1FRJA 5KFMA 3MUVP 2JEGA 1H2TZ 1FNMA 4ZPBA 1RT6A 2DHGA 3H2UB 1BGXT 1Y7PA 3POTA 3CCWA 4HH1A 5EWFA 3HVRA 3VAGA 2V2KA 2A1BA 2RB7A 4K5SA 2F8EX 3K5OA 1HBMA 2MKHA 4G1IA 3E2EA 4WJBA 2OPQA 1GXLA 1FDDA 1HBNB 4H4MA 3S6EA 3V81B 1YITS 1S1UB 3NCPA 2RDJA 4Y6IA 2MKKA 3PIOQ 4DL2A 3CDAA 3BJYA 3AQOA 3MECA 1FNOA 4I0WA 3PM9A 1UVNA 3C6TA 2AYGA 3I82A 3BO4A 5KFWA 2K7JA 3UR0A 1VC6A 3TP2A 3FQLA 2FVCA 4JI2F 5J2QA 4OZ0A 4B3SF 1G1XA 2B5JA 2GIRA 2VG5B 3U02A 2P6TA 3MEKA 4ID8A 4NYPA 3SEOA 5J2NB 5B0CA 1LFWA 3GE9A 2ZC4A 2JFDA 4UQTA 2HHQA 2B56A 5D4NA 2QIFA 4DL4A 3HI9A 2UUAF 1TFWA 2E7XA 2WBRA 1HI1A 1IUJA 5CH7B 4ECTA 5A8WA 1RQ0A 3K5PA 1G7CB 2VPYB 2RD5C 2COLA 1X0PA 2FHJA 2HNZA 1UJ4A 3E01A 1LFPA 1AXQA 3ZZ0A 4F2RA 5GAEI 2OD6A 2VL1A 1Q82T 4ZPWR 1MWYA 2MKSA 2YX1A 3CJKA 5F8NA 3MPYA 1U45A 2LQBA 1VJWA 4ES2A 4C8ZA 1E6VA 1U09A 1L3UA 4RNHA 1O5JA 4OHWA 5KG0A 3KYLA 3KHLA 3OJSA 5LXYA 2MSTA 5DM6Q 2UU9F 4DV1F 2BVZA 3HPOA 2VQEF 4ED8A 2VV5A 2RRBA 4ECRA 2XS2A 1NHVA 3HT3A 1PC4A 3OFGA 2V9WA 2YKMA 3POTB 4DV2F 2VD3A 4JI8F 2HVIA 2OAUA 4I68A 5KFVA 2FLNA 5D78A 2GC8A 3G8SA 3SQGB 1HBMB 5G4DA 2QYCA 3M8PA 3Q8SB 2OPQB 2J6SA 1G6BA 2NR0A 2DGOA 2DB1A 3R1HA 3O5TB 4ZA1A 4K4UA 5DDOC 2HHTA 3MM7A 3CCVS 3Q8PB 4DFPA 2R2UA 4MYTA 4MK7A 4G1PA 4TLQA 4QQBA 5K8OA 4OLOA 5GADI 3Q8RB 3B4MA 2GW8A 2EFOA 5KG3A 2R8KA 4R0JA 2C2RA 3FRZA 3BF4A 3UDCA 3IG1A 3T5JA 4NLSA 3C6TB 2N4DA 4RWXA 1D0EA 3QGIA 3E8OA 1X9SA 5J2QB 1WELA 2L48A 2CPFA 3O8WA 1UEVA 5KFOA 2MQOA 1DQAA 2B5JB 3JSMA 3EUNA 1T8EA 2YKPA 2QZ8A 4OV1A 3TYTA 3G6ES 2RKIA 2HGLA 2VQFF 5HBMA 3KHHA 1Q16B 2XY5A 1LXNA 4OI4A 1CG2A 1AFJA 4PPZA 2HGMA 4F50A 2O5DA 1OPZA 4WFBQ 4ED7A 3HF5A 2GFFA 5HROA 1QVGR 3KMQA 5KFFA 3RB3A 5M2RA 3ONQA 4C11A 4ITSA 3GYNA 4RW4B 2XMVA 1SB6A 5IT4A 1HWKA 5T7LA 5ITHA 1MU2A 3R5AA 2HFNA 4O3QA 3MFIA 5JVHQ 2ZJRQ 3RB4A 4R5PB 2F9DA 4V19X 4DR2F 4B3OB 3KG1A 3M1VB 5IT0A 3TAMB 3W2WA 3EZUA 3CJKB 3SCKE 3KLHB 5H9FJ 2K3IA 2PO4A 3CCZA 1E6VB 2ABYA 4ZKAA 1RTHA 3MM5B 3PKMA 4CIOA 1ZOTA 2XG8A 1R89A 5E2QA 2FHJD 1FRHA 1RAJA 4LT6A 4LFBF 2D9PA 1UEUA 4ZP8A 2ZH3A 2DH8A 4NA3A 4ZMMA 4RKUC 2RVJA 1FJCA 2IRYA 4TN2A 4FVMA 4QPXA 4X4RA 2NZ4A 5LSRA 3CMES 2BV3A 4USJC 3LP2B 2NS1B 2IVYA 1JLEA 3M8PB 2MZRA 1T02A 3GFXA 1Y9OA 3PW5A 1HNWF 1IN0A 1U1KA 2W9BA 1L3TA 3MM7B 2IBKA 5C42A 4ILRA 4J37A 3NKYA 1HD0A 5IXUA 2VA3A 4Y2IA 4BBYA 1Q86T 1SXLA 3I0RA 1ZPWX 4OL8A 3L09A 2VFTA 4UW2A 1S0VA 3IG1B 2R8JA 2R8HA 1KTVA 2AD9A 5J2MB 2VBZA 3MAQA 2EBEA 1Z4UA 3ISND 2IMWP 4DSLA 2QMWA 4IFVB 2RUGA 1GXUA 1N5YA 4NXMF 2IA6A 4CT9A 3NNHA 1RP5A 5K5MA 4DS4A 4FF1A 3I5AA 1JWWA 2ZFHA 2VKRA 3OTCA 5KFTA 1SJ4P 2R7SA 3UPFA 4ECWA 2MSSA 3BB5A 3H5YA 1B7FA 4DMZA 1M5SA 2ZH5A 5HI7A 4C11B 3MMBA 3IGVA 2WRMA 2GQQA 2XLJA 1T94A 3ITHA 3LGMA 2CQ2A 3CCTA 1MU2B 4X84A 2R2TA 2WSFC 1HR0F 2KHDA 2E5HA 1U1RA 2L9DA 4X2BA 2C22A 1IKXA 1VBYA 1RDRA 4O3NA 3WDOA 1VQMS 2H9ZA 1TL5A 1FVQA 3HHLC 1FTCA 4KBIA 3W2WB 1Z2ZA 1TUVA 3HHNB 3GWCA 2OH2A 1KS2A 4WE1A 1D8ZA 4P2SA 4ES1A 1UVJA 4H4KC 5E7OB 1RA6A 2HPUA 2QA4G 4LUBA 2E9TA 2DNPA 4NCAA 1C0TA 1C2PA 1VRTA 2GNKA 3K8VA 1G2EA 2J8AA 4ED2A 3H4DA 4DX8H 2D9OA 1FE0A 3DC2A 1KEKA 5HP1A 2VODA 4WIIA 5AE1A 3OLAA 1S9EA 4G1QB 2J7KA 5KFLA 5F8GA 2HWTA 3Q0AA 1N0VC 5KT4A 1N0UA 2LKZA 2EK6A 1X8DA 1RISA 2CPYA 4I6WA 4I2PB 1TKZA 3BREA 2W9BB 2W9AA 1S7HA 4TY9A 4QU6A 2OO4A 3QLHA 5C42B 3GIJA 2HS3A 1M5KC 3EXYA 3I0RB 1KLNA 1F5BA 1ZM9A 1QAYA 4RW6A 4G6VB 2GMLA 2M9KA 3M6VA 1IKYA 2VOOA 2CG4A 2FIUA 3DLEA 1N5SA 2NXUA 3IA0A 5EUHA 4RNFA 5F8MA 2H5EA 4C8OA 5KT2A 5HMZA 1FT8A 1LW0A 1VQKS 1N5YB 1VGYA 3AH6A 3OUYA 4DF8A 3HP6A 4PXDA 3QO9A 3DCAA 4JV1A 3M2UB 1O0PA 3B4DA 1VHFA 3TA1A 3N28A 3J7YU 3IWNC 4Q8FA 1Y00A 2OPPB 3MTKA 2BW2A 1UFLA 4L6V3 2XY7A 5HN0A 1RTJA 4NLRA 4KIAA 1BLUA 1IKWA 3GIMA 3RB0A 3M6XA 2QSFA 2DO4A 5DRKA 1WEZA 3H2VE 4C8MA 3J80Y 4YOEA 4HT5A 4LF7F 2UUTA 1XNRF 3PO4A 3OTEA 3GV5B 4LFCF 2MY8A 4F4ZA 2KXFA 2MHNA 4K59A 2CVEA 1DTTB 3PIPQ 2OMLA 1EP4A 1ZAVA 4KO0A 4GKKF 4IH5A 3CWJA 3KG0A 1QM9A 4JUZA 3KK1A 1FDAA 3MM8A 3ZZYA 3M8RA 3IBWA 4DL6A 4J9MA 4IG0A 4KGKA 4RNMA 3IRWP 3AJ2A 1RT2A 2R8IA 4GKJF 2ROEA 3HKWA 2CQ3A 4NA2A 1B0PA 2YWFA 1H7WA 4Y2KA 1P8GA 5B0FA 4J9RA 2G0CA 3U27A 2MZ1A 5DG9A 4J9NA 2M2BA 2FJAB 1TFYA 2YNIA 4KFBA 2XI3A 1TKZB 3DRSA 1FDNA 1R8CA 2HRYA 3M6WA 5DQHA 2L9WA 2KFZA 5HMXA 2AQ4A 4LF6F 3FEZA 2W25A 2U1AA 2B7BB 3OVSA 4BWMA 1FHTA 1JLCB 2I0XA 4HLBA 1MNEA 1P27B 1R27B 1ZZFA 2HQIA 2BBEA 2OSRA 3L7OA 3MMCA 4Q45A 4YR0A 3DLEB 5KFNA 5AJ3F 2N3OA 4GC6A 1WNEA 1U6BA 3GYXB 4A47A 2VFUA 1FKPB 2R9LA 3DRPB 3IWXA 3M4XA 5FD1A 1LW0B 4JI7F 4OZ1A 4F3OA 3HMJG 4QW8A 4HEA9 3VZHA 3TUZC 3LANA 5J1EA 2CQGA 3U1MA 4W92B 3SSSA 1X4DA 2AGOA 2FLPA 3V6DA 5E3CA 2AYBA 3D2WA 4IRCA 4LF9F 2JL9A 2VC0A 3D0HE 2ATLA 2B4OA 3GR0A 1TKXA 3KJVB 1B0TA 2I5JA 1WD6A 2HLUA 4ZS6A 5KOXA 2JRSA 4DN0A 2WCXA 5AXMA 2X1AA 2GMJA 4K2XA 5DDRC 3CB4A 2KM8B 2ZKTA 3O6QA 4OMFG 2ZNZA 1HNIA 4LVNP 2RE1A 4TY8B 4RW8A 4J9LA 2VONA 2B7CB 2I8EA 4UUWA 3PV8A 6FD1A 3RR7A 4K4VA 1WEXA 3BR8A 4WCEQ 2UP1A 3GFZA 3MD1A 5L1IA 1OIAA 3VQSA 1KQGB 2FJXA 1NB7A 3DOKA 3MM8B 2J9EA 2QLWA 1NH7A 2E66A 4FBTA 2AJQA 4OIXA 4PCQA 4CCHA 2YKAA 1C1CA 4N41A 3DLJA 3N9UC 5J1NA 2W9CA 3CULA 5K9FA 2KT5A 3I5CA 5C24A 5L38A 4OX7A 1IBMF 2X1BA 4JOUA 3UCGA 3VAMA 3KG4A 1VQLS 2FHKA 2XWYA 2QMXA 3BSOA 4WKRA 1LWCA 1NKCA 5L9XA 1VQ4S 3QAEA 2XGPA 1U49A 2YNIB 4KFBB 3MMAA 3KNGA 4MKBA 1T3NA 3TW0A 3KWMA 5E0OA 1RT3A 2D41A 3BEGB 1YJRA 3R27A 4ZCMA 3HX9A 2VC1A 4C0HA 4F02A 4FZVA 4ZCIA 4YDXA 2MB0B 3G9CA 4RU2A 1NK8A 2R7UA 1WACA 4IDKB 1X9WA 1GX5A 1B0VA 2ILYA 2DNNA 4DHVA 2AGQA 1MWZA 2YNGB 4B9TA 5F8LA 1Z2LA 3MGJA 2CJAA 2FGOA 3OR2A 4DL5A 2B6AA 3BN4A 2CQDA 3FMWA 1HPZA 1F60B 4DQQA 2ZH9A 3TANA 1RT7A 2IA0A 2RF2B 2DNGA 2ZM6F 4K4TA 2M52A 5J1EB 3HHEA 4LSNA 2HMIB 5GAHU 4RW9A 4OJHA 5FDLA 4HH0A 4EZ9A 1IBKF 3BSNA 1FD8A 3CD0A 4C4WA 3VWSA 2G4BA 1Q8IA 4LSLA 1TKXB 2I5JB 3O2IA 2C2EA 2W8KA 3MI7X 1P1LA 3JTPA 5C25B 5IWAF 4F4YA 2U2FA 2XSJA 4EFAC 3DOMA 5LSLA 4Q2LA 2N7YA 1VQ5S 4ATNA 4CT8A 3AA9A 2A2CA 1D9AA 1HNIB 5F9NA 4EYHB 2R7VA 4RW8B 2IC3A 2G13A 1YG0A 3D1QA 4KKOB 5BYRA 5SZTA 1ZAWA 3MFHA 4BC9A 1KVIA 3G86A 2VPZB 1OQ6A 3DNCA 2ALZA 4PRFA 3LPYA 3DOKB 2CQHA 5D77A 1NK7A 5LMUF 5DO2A 1HBUA 3DFEA 1RT5A 2IAJA 2QA4S 1H0HB 2AYMA 2Q6BA 4OI1A 2C28A 5CYJA 4W90B 1OSCA 3PW0A 4PWUA 4IYQA 2CPEA 5C24B 2J6TA 4PXCA 2BANB 1GTEA 2YNHA 4KHRA 2M0GB 2UUWA 2ZOMA 3LO3A 2JH3A 3SFGA 4DF4A 4Q7AA 2R8GA 3KLIB 4HTIA 1LWCB 1QVFR 2XY6A 4WU2A 5C5JA 1ZTWA 1NKEA 3MMAB 4DG1A 2CFXA 3UQSA 1QUPA 3M9MB 3T6JA 4ECZA 2YQ3A 1IBLF 3KFWX 4QWBA 1DQ9A 1UL3A 3PY8A 3Q2TC 4FS2A 3UW1A 6FDRA 4OX6A 3U7JA 1AFIA 4CH1A 3SXLA 3C8YA 3HHKA 4D3HA 5E3RA 4I6AA 3K2YA 2K2PA 3B8HA 2R4FA 3OR2B 2POKA 2B6AB 1HWIA 3AQPA 3CO9A 3MDFA 5IQ6A 3S01A 4X64F 3JB9k 2APOA 3N4WA 4P7VA 4I69A 1RT7B 3L7PA 3NBPB 5B09A 2DRAA 4KR0B 3ETOA 2LXFA 2P9GA 5I3UA 2PN6A 1HQUA 2B43A 5D3GA 4LSNB 2O66A 3E51A 1V6HA 1Q53A 5FDLB 1TL4A 4N56A 4A8YA 4OX9F 1X4HA 3OL6A 1O51A 3RBEA 2FJVA 4DQPA 1X5OA 4YHHF 2ASJA 2J6UA 4LSLB 1LK5A 5JJBA 3HHDA 4URGA 1NK5A 1J2VA 4IG3A 3HDSA 2GIQA 4XO0A 2KG0A 1JX4A 3KNAA 4NLXA 1FVSA 1M5HA 3QGHA 4ZPCA 1UVMA 3KK3B 1ZETA 3NNAA 1N5TA 5DJBA 2ZBCA 2AJ4A 4LMZA 4ZOSA 4V19J 4ED6A 3ZC4A 2IC3B 4N5SA 3PW7A 3UI3A 4IO1A 2PE8A 5LL6d 2DNKA 2RU9A 3V2UC 4MIAA 3CCSS 5J2PB 3GZ7A 4JV0A 1Y5IB 2GX8A 4CO4A 4OJGA 2RIJA 3R5DA 4QIVA 4URQU 4O3RA 3VQTA 1Q8LA 2J0WA 2HNYB 2KFNA 3OTBA 4JV5F 3GILA 3DI6A 5A6PA 3HHLA 2ZHAA 4J5OA 2MZTA 2CIMA 4EO6A 1WG4A 4DEZA 4WKYA 2YNHB 3KLGA 1VC0A 2KT3A 2BACA 3MEEA 3MM9A 1S9FA 3NGKA 4QBUA 1GQEA 2OPRA 3M30A 2EW9A 3IXQA 1DAXA 2XBPA 4NRTA 4DG1B 4X62F 3IC1A 1HNXF 3DRXA 3CVKA 1U25A 2EBGA 2OJ3A 3BM7A 1ROFA 4ED5A 1RGVA 2C42A 3MM6A 5SUHA 2AGPA 2W4DA 4KGMA 4ECQA 1CSJA 4I7FA 1XN9A 3BGFA 3FCHA 1JJ2R 4DV7F 3BQ2A 4DLEA 4H54A 5T14A 3H5SA 5IM0A 3EZ5A 4KV8A 4ZP9A 2W7PA 2DCLA 1SJFA 2FVRA 4ICLA 1VRUA 3NAHA 3TAPA 5I3UB 1HQUB 3NAIA 3I87A 3OFFA 4WFYA 1I94F 1YJUA 4Y28C 2DPIA 1BQMA 1JLFB 2GQ2A 2WK4A 2JFKA 2F8MA 4RZRA 3K5MA 5DM7Q 1R8AA 4PXEA 4DQSA 3FSYA 4ZLPA 2J0XA 2V8GA 2V9KA 3T6BA 4JV2A 5DETA 2FVQA 1K1QA 3D0GE 1EETA