3NG8A

Crystal structure of an abridged ser to ala mutant of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase ica512/ia-2 at ph 8.5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINIAVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor-type tyrosine-protein phosphatase-like N
publication title Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ng8A00
4HTIA 2QT7A 3NG8A 3N01A 3NP5A 3N4WA 4HTJA
chains in the Genus database with same CATH superfamily
1ZTWA 5A76A 1XMOJ 2O01C 5EN1A 2V94A 1NXIA 5GADI 2R2RA 3BR8A 3V4IA 1F1BB 1S57A 2XSJB 4JBCA 4LF1A 4I0WA 3SYZA 1DAXA 2HBZB 3N6MA 3L7PA 3SFUA 3D4JA 2B9WA 3UD5A 4R5PA 2VOPA 2J9EA 1RISA 5IZHA 2QLXA 4LT6A 3PKMA 5ITHA 2MQMA 3DRRB 1TK5A 4ZPTR 1K0TA 4YB1P 3SMZA 3H5UA 2WCXA 1S9GA 1DTQA 2VODA 2EVZA 2O66A 5JXSA 5C25B 3D0GE 3J81U 2W9CA 3IMQJ 2PFDA 1NJZA 2MQQA 1U8SA 1HWJA 3IGNA 2DPJA 2RKIB 3CD7A 1RAAB 1MN7A 4DOZA 4CT8A 5J1EA 1LW2A 2NXNA 5KFIA 1XR5A 3PIPQ 1N88A 5I3UA 3N6NA 3U7JA 3LAMA 3O5TB 1G2EA 2DIVA 1U6FA 3AOAA 5D0EA 3NAIA 4MYTA 1I1GA 3ITHA 3K89A 2B8QA 5SUHA 3HZEA 1GXLA 2I8EA 4EI2A 3SEOA 5HATA 2WSEC 3IRXA 4X4VA 2V8GA 3PIOQ 2DNHA 3FSIA 1RTIA 4NMLA 2J5AA 2IDLA 3ZC4A 5A0YA 3CCJS 3WZ0A 3GYXB 1HYSA 3TX0A 2ZH2A 1X9SA 3FBBA 1IM6A 3FRZA 2NSCA 3O44A 3T6BA 2MQNA 5KFEA 1GMUA 2KB2A 3NGKA 2IJRA 1SV5A 1SQFA 3EYZA 3NBPB 2QMWA 1E6VA 4WE1A 3QNWB 5I3PA 2ZZMA 4NCGA 1CJTB 1RCOB 2ILYA 2WW8A 4X62J 2AW0A 1PJ7A 3PJXA 1RKJA 3R97A 2VC1A 3J80U 2GJ2A 4ANDA 3OLAA 2C2KB 5M2PA 4WKRA 1PYOB 4ED8A 3D6FB 2LKZA 3TVKA 4YEAA 4FS2A 4EMDA 2ZHAA 2R7QA 3RAXA 2HAIA 4KGXB 1BY9A 3L3CA 4CLSA 2C3OA 2C2MB 2CZ9A 2KHDA 1VQ9S 1BWEA 2CQ1A 1CULB 1N8RT 4U8YA 3OUYA 4FBUA 2RRNA 1D8ZA 1XMOF 4MMOA 2KYXA 3FNNA 2LA4A 1FERA 1JKHA 3DLKA 2GMLA 3CO9A 3GJSB 1WC5A 4CTAA 3G82A 2FVRA 2F3JA 3EZOA 2DBBA 2Z0GA 4B9NA 4IRDA 2MY7A 4ZHRB 3RBXA 3IGVA 1XR6A 4C2MA 3KK3A 3HFVA 4GMKA 3QATA 2B8PA 1XR7A 4FXWA 3CCUS 3P49B 4WFAQ 1HIYA 1Q0NA 2J7UA 2QRRA 2YH1A 3TA2A 1S7HA 1FWLA 2FZKB 1Q8BA 2C2EA 2JEGA 1RU2A 1UP1A 1B7FA 1VI7A 4OZ1A 1VHFA 4NZ7A 1D09B 3KHGA 3TR5A 3OFFA 2RUSA 4KH1B 3Q83A 1NK0A 3AB2B 3MTJA 3AQPA 3KJVB 3DYAA 4J9SA 4LIRA 5A2QY 1TVRA 1SJ4P 3DMJA 2OPRA 4W92B 1RT7B 3HJFA 3S1TA 1UVKA 1AXQA 3J81j 1T05A 1U0HB 3R2CJ 1EQMA 1LKZA 1V3ZA 2FHKA 4DG1B 4YQWA 1Q4RA 3DRSB 2OUGA 2VBYA 5KG3A 3QBCA 1IKXA 1RTJB 3C46A 2UVWA 1X0PA 1EHWA 4B3TJ 5DDQC 2YWEA 1PSDA 5DG8A 2ZHBA 2IBKA 2ZJPQ 4X62F 2DK2A 2DRAA 3M30A 1VIXA 4C8KA 3DLEA 3MMCB 2CFXA 2VKRA 4F0MA 3R7BB 4AL7A 4NLTA 1RB0A 3DDNA 1R8CA 2FLOA 3UW1A 3D6TB 1X5OA 3QT5A 3NP5A 1BQNB 1DRZA 4DCJB 2BX6A 3HHLD 1S10A 1Y10A 5HROA 2ZOMA 2XMTA 3N79A 1IBCB 3IR5B 2UUBJ 4U96A 3N01A 1JLGA 2ASJA 5IM0A 3CVKA 1HHSA 2J7WA 2DPIA 1QLNA 4CLYA 3RRKA 3T19A 1TZ0A 1ZYQA 1WF0A 2M4MA 2AEJA 1TV6A 2FY1A 1X7VA 4V19X 2C2DA 4NLWA 3FCHA 1WDDA 3G86A 1HD1A 4FDFA 2V67A 3AQOA 4F8RA 2NREA 3OVBA 3LANA 4TXSA 1BQMA 2B6AA 2Z2MA 1JLFA 4RW8A 2M2BA 4WCEQ 2BE9B 1M1KT 2EG2A 4Q45A 3TUJC 1CJUA 4RLEA 3J81Y 1J5EJ 4QIEA 1RT6A 4C8LA 1Y9OA 5L1LA 3M1VA 1HWKA 3ISNC 1UWAA 4O3PA 1CJVA 4ECUA 3POTA 2QEXS 2C2OB 2B4OA 1GXTA 1VOMA 1A9NB 3GYNA 2CPXA 3CXCR 2XULA 1HI0P 3C2PA 1S48A 3G87A 2UXCJ 2EWHA 4M5NA 2V0NA 4MIAA 3MEGB 5GMEA 3G8SA 1HBOB 4I56A 1RDRA 4HKQA 1QSYA 2ZDOA 3QZ8A 4WBFA 2B9XA 3H8YA 4G1QA 1WACA 3S01A 4NL5A 1X9WA 3G9CA 3FSXA 2IYGA 3DRYA 3AJ1A 3PTWA 2IIHA 5GAHU 2D41A 2R42A 3IM8A 2R3VA 2B5JA 4ECXA 4ER8A 2Y9HA 2XZDB 2BACA 4B3TF 4ERDA 1C4CA 4DV2J 4RW7A 1URNA 2RT3A 1FE4A 1KVIA 2QSFA 5ETQA 4CO1A 1WWHA 2HNZA 1TTHB 1C1BA 2MHNA 3J80Y 2WTFA 3R5CA 1RZMA 5D4NA 2DISA 3MMJA 3R7SB 1T03A 5C5JA 2AYGA 3GG1A 2DO0A 2YNIA 5J2PA 4KAIA 4RNHA 5J1PA 1NM2A 2XZWA 2LQ8A 1HI1A 3BH6B 3BPSP 1FTCA 3DU5A 3ENQA 3KLGA 3CF5Q 3MURP 4H4OA 3NG8A 2GZOA 1LXJA 1YSJA 5DDOC 4A8WA 3KG1A 3A4TA 2C2NA 2XO7A 2HRYA 2ROEA 2UUBF 1BD6A 2VFTA 5D4LA 4LJMA 4I4BA 1T9XA 3PHEA 1Q95G 3I96A 1YBTA 4AFFA 1LWEA 1JX4A 1FK9A 1KRPA 2KYZA 2IY5B 3QWPA 2J6UA 5KFOA 5DZ6A 2QGFB 2W2MP 5H1SV 3TZXA 3ENWA 3NY0A 1J5EF 2W4CA 2F8EX 3GJQB 2B3TB 4DFPA 3OJSA 4DI6A 2HG4A 2J9CA 2DGOA 3C15B 4PKDB 1VQNS 2FB0A 1IKYA 3KLIA 2CYYA 4WFXA 2OPQB 1C0TA 4YP3A 1T9YA 3CWJA 4C0OC 5LMNJ 4R8UB 3DM2A 2NYIA 3NRBA 2AEMA 1ZAVA 3DRXA 2UXCF 1RWVB 2XM3A 4DUTA 4DV6J 4KPCA 5BYQA 1WNEA 3HK2A 2DH8A 2V8DA 1ICEB 2EFPA 2AMCB 1HMVA 4F4ZA 5FDLA 2IC3A 4O4GB 4ES3A 4TN2A 3T3FA 3MUTP 1KLMA 2N3LA 1JJ4A 3I0RA 4TVAB 4KFBA 4PABA 1Q16B 3J7Z5 4L76A 3NCRA 4HI2A 2R2UA 5KT6A 4DV2F 1S97A 1IBLJ 2K1RB 3KG4A 1YI2S 2RD5C 3MMAA 3TUPA 2V8HA 2HZVA 4PWDA 1U6BA 3HKWA 4JV1A 4HTJA 2UUCJ 4NZ6A 3R9LA 4LRBA 3Q89A 3C16A 2N3OA 1F5BA 4Y2AA 3M32A 1P8GA 4CLKA 1V3RA 3ZZTA 2B7BB 1ZAWA 1XBWA 5HMZA 2CZ4A 3Q0AA 1MW7A 2X1FA 3CJKA 5EHHA 4E8UA 1A7GE 4F26A 2CRLA 3MMBA 3DXSX 4H4KC 1MWQA 5LT5A 2XBPA 4A8SA 1JLAB 4ED6A 3DRPA 2MZRA 1DJ0A 3NWRA 1FKAF 3QFHA 4QIGA 5AXKA 2BKNA 3C14A 1FKOA 3W7BA 5CXTA 3K57A 2XYHB 2MGZA 2MZ1A 1MU2A 5KFVA 1UWBA 2MXYA 1LWCA 2LECA 4ZLPA 2QIFA 3OHBA 4CM0A 4AXJA 3FUYA 5A6WA 5L8RC 3KK2A 3QT8A 3I56S 1HQUA 1EKSA 2LP4A 1S1WA 2FZCB 3FSYA 4ZLJA 2RMLA 4QWDA 1NDKA 2P9CA 2XCAA 4Q0BA 4PXCA 1FT8A 1TUWA 4NE9C 2QT7A 1HNIB 4TY8B 1WUUA 4C4WA 2YNFB 4ZPVR 2EFQA 2P6SA 2LU1A 3BZQA 1K73T 3HJVA 3K5OA 5LMNF 3MPYA 1BMQB 4ZVHA 4DPWA 2VFRA 4DL3A 2M8HA 3ELHA 5HVFA 4J7CA 2WSCC 4DSEA 4DV6F 3EPIA 3W2WA 4ZCMA 4K4YA 2Z8QA 1JJHA 4CO3A 5F9LA 5LJ3Y 3BREA 1HQEB 2V9KA 5T7LB 5AE3A 1OYEA 2P5VA 4B3OA 4F2RA 4NASA 3D67A 4IUFA 2LYVA 1VC6A 2E7WA 4ID5A 2E1RA 4USKA 2DVIA 4I6WA 2EI5A 5ETPA 3HVTA 5J1NA 2KXFA 1N34J 2WONB 1IBLF 4LQ3A 5HAOA 3GPAA 1UA1A 3BKTA 2FPHX 4AT1B 3BH7B 2PD1A 4U6PA 2VIHA 3RB3A 2I1RA 3N9UC 2UU9J 2GVDB 2HBYB 4E0DA 3M2VA 4PG6A 2UUCF 1RTHB 2ASYA 1H2TZ 3M2RB 5D3GB 3G6XA 1Q8LA 2YKOA 3GU0A 3K5MA 3GCXP 4RUCA 3ZTOA 1YRUA 3DI6B 2VU5A 3L4BC 1RT5A 3SCLE 1B3TA 4DX5A 4OHYA 5BYSA 4XIUA 3CD5A 1URRA 4IFYB 4JUZA 1SH0A 1LFWA 3LPYA 5LSRA 4CM2A 1GH8A 4N76A 2CUYA 3MOZA 4X4SA 3PX4A 1FEHA 1FA0A 3WX8A 5E3AA 2AX0A 1X4BA 4LSNA 3SBMA 1UCNA 3L7OA 4ZPDA 3OJUA 2CJXB 5AE1A 3LF0A 4I67A 4WU3A 5ADZA 3ETMA 2G1HA 4XPCA 3HP6A 1DFDA 2VQFJ 1WTFA 1W2BR 1OS5A 4J9MA 3PZPA 4OLOA 3M2UB 1RYSA 1VISA 2L3MA 4TYBA 3MR5A 4QQBA 3SCKE 2J0QD 1EB0A 2N7CA 3DOKB 2HW3A 1FNOA 5D77A 3MPVA 1KOOA 1X8DA 2K8GA 2DR8A 4Z7CA 1KQGB 2H5EA 3GCWP 4CRJA 4KGZB 2PSZA 3CCZA 4DX7A 4Q5VA 2ZH4A 4ES1A 1VMBA 2M9KA 3EE3A 1UVIA 3NBPA 2VBWA 3KUHA 3AA8A 4YMEA 3PFOA 3VAJA 2HFNA 2CQ2A 4ZJLA 2OKQA 2XB2D 2MQ8A 1Q5YA 1SUQB 4OZLA 1SJRA 1WSRA 4CLZA 2WSFC 4O44A 2A2CA 2QA2A 5KFHA 4Y3CA 4P7VA 4FNHA 3S7RA 3W2VA 3UFCX 1A0OB 3R27A 1IBMJ 2BJ8A 1JMTA 5K14B 2FJWA 2YTCA 5JVHQ 1R0CB 2G2YA 3QRRA 3NCQA 1JNZB 2FC8A 2V69A 3PX6A 1N34F 1VC5A 3VGSA 3Q2TC 3D0IE 4RNNA 3PW0A 4Q8EA 1JXEA 3OR2B 4X4QA 3DLLQ 3H4BA 5J2QA 2Y8YA 1O0PA 2UU9F 1L3KA 4C3KA 1FJ7A 4CLPA 3JQMA 5DG9A 4P9SA 3M6XA 4X66J 2BUNA 2UVUA 4UOHA 2L9NA 2YH0A 1O5JA 3H40A 1RHJB 3BR9A 1YVFA 2NS1B 3IP0A 1WI8A 3CJ3A 2IVFB 1K1SA 2A6MA 1T9VA 3PFEA 2DR5A 1X4GA 3CDUA 4NXNJ 3CD6S 3AJDA 3M8ZA 4WXOA 3OBIA 2GAHC 5DS7A 2PA3A 3KDOA 1U1RA 3P3DA 1ZBTA 2OSRA 3CCSS 2G2ZA 4NYZA 1OQ3A 3D6MB 2RH3A 4RW6B 1H7XA 2PEHA 2CNOB 4F4YA 2CJAA 3GR1A 2IAJA 1OO0B 4RJVA 2DXFA 2LQBA 3AD9C 3W61A 3ENAA 1FF2A 3CDBA 1MWZA 3IXQA 3TZWA 3TI0A 4PUOB 5KG1A 2VQFF 1NB7A 2WVCA 1CQMA 3KLHA 1WKKA 3RB6A 1LQ9A 4WFNQ 2QLJB 2ZVSA 2DR9A 1D9DA 1FRXA 1S99A 2YKQA 4OI4A 1V5VA 4WK3A 2XY7A 4OJHA 2V63A 3RU0A 2JC0A 3DRSA 4U9RA 4ZVGA 1RA6A 2J6SA 1HBUA 2AJFE 3LGHA 2AQ4A 3SQGB 4WKYA 2UUWA 2UXBJ 3K7RA 1WTBA 2KFYA 1VRQC 5D6GA 4NYOA 4M5GA 4Q2MA 4KGMA 2ABYA 2R8HA 4RX6A 4HH0A 1MLAA 2KG0A 3TAPA 1Y00A 2E1AA 1CPZA 2LA6A 2Y1LB 5K8MA 4PZVA 1QSSA 2D7SA 1S12A 2QV6A 3R5BA 3TA1A 3HSDA 1WKLA 5L1JA 1IR2A 3BV8A 3KLVA 1UVJA 4IOBA 2HNYB 2CQHA 3EGZA 4QJVA 2E29A 1Q7YT 2W9BB 4OZ0A 2HHWA 3F44A 4ILLA 3IAS9 3KHHA 3ISZA 2VV5A 2W7AA 1IBMF 1C1CA 2DXEA 3HT0A 4F67A 5KFBA 3N5FA 3H42A 3RTVA 2ZBRA 3Q8VA 2HVDA 4QBUA 1BQNA 1SIZA 5D78A 3HHLA 1Y4ZB 2FHJD 4CH7A 4HDGA 1SQEA 2OEMA 1G4CA 4GVBB 4FPIA 3TZZA 2IM1A 1GMWA 2Q1LA 1OJ4A 4KR0B 3B4DA 3GG0A 3DLHA 1ITPA 1FRJA 5C24A 1EKRA 4X66F 2CG8A 3GYGA 1W2IA 3GQCA 4U7UD 2HVHA 2LEBA 4RUHA 3AT1B 1SKRA 4ZVSB 1S6PA 4NXNF 4K5RA 5DGAA 3CCLS 1N5SA 1TL3A 2W2OP 2KFNA 2CJ9A 4PG5A 3AXKA 4PQAA 1BWVA 3DNCA 3M7VA 1APSA 3OFGA 1TFYA 1T02A 4LF6J 2B43A 4PAAA 1HI8A 5HJXA 2AYMA 5J2MA 5LM7E 1NO8A 3V4MA 2UVVA 2Q3PA 1NHVA 3QJJA 3I4HX 4K4XA 3MEEB 2JEJA 4RW4A 2NZ4A 2HFSA 2E66A 4RPFA 1RWMB 1S0OA 2HBRB 2FDNA 2GCFA 2WK4A 2CPHA 1FNMA 1RGVA 3Q8SB 2CA9A 1B0TA 4O3RA 3TAQA 3LP2A 4KSEB 3FK4A 3ET6B 3MM9A 3BM7A 1KS2A 1NHUA 1WHXA 5KG0A 2W4PA 2N4CA 4CH0S 2JFDA 2UXBF 4HACB 4K4WA 1SC3B 1S9EA 4ATNA 1YBUA 3LALA 1VQ8S 3DU6A 2FVPA 2XMWA 5F0WA 3NGDA 4IG0B 4TKTA 3PO4A 2ZD1A 2E1MC 2YNGB 5CYMA 4KBIA 3RW7A 4ECTA 2XO6A 2XMAA 1FJCA 3W5ZA 3BS9A 5IS2A 2VG7B 1M5OC 2ZM6J 3JTPA 1FD2A 5G0RB 3ZTPA 1F5AA 3KFWX 3W3SA 1JLBB 3D3BJ 2C3MA 4ZP7A 3SV4A 2DYAA 1VQPS 1NK9A 3VTIA 3GFHA 2GGPB 5KAKA 2DTJA 4OX6A 3UD4P 2HS0A 3CJ4A 4QCLA 1X31C 2KTQA 3ENVA 5KG2A 1XTZA 4USVA 4F4AA 4ILMA 2IA6A 1N5YA 4IFVA 1AB8A 1KQSR 3DDKA 1QSLA 4KQZA 1XN9A 2W2NP 2FLNA 2R7XA 5FD1A 2Q43A 2OD4A 2JJ4D 4HHJA 1GTHA 3TVZA 1Y7PA 1NDLA 5D0HA 3TW0A 2WW4A 3TJ9A 1NCLA 2HS3A 1S77D 2JVRA 1FJGJ 1IUJA 3DCAA 1Q8IA 3IBCB 2V4RA 1SL0A 1OYDA 1RWOB 3OVAA 3MCSA 2FIUA 3C6UB 3ZFVA 4YB7A 3HLUA 4XO0A 1RU1A 3JYTB 4LF6F 2YWFA 5F8GA 2QLBB 5CYQA 3D5MA 2DRBA 1C0UA 2EPIA 2OPQA 5KFUA 3HVWA 5KOXA 2BE2A 1KONA 4DR5J 3BGRB 4NA2A 1UVLA 4M5IA 4ZMMA 1RWWB 5ETRA 3LW5C 1H74A 3RJMB 2RE1A 1GQEA 1FRIA 1ZM9A 4K4SA 3SSRA 2FC9A 4H54A 2PO4A 8RUCA 4CP5A 3GJRB 4U7CA 2AJ1A 1P9YA 1R6VA 3FEZA 1GMVA 4DSJA 2I38A 1CS4B 2HNDB 3FBCA 5B0AA 5F8LA 2HHQA 4IG3B 4A8QA 1H72C 2NLWA 3QLHB 2M7SA 1Y5LB 4HHUA 1ULRA 2XTJP 2M52A 2YKNB 2C2ZB 5DETA 3MECA 4QIFA 3FVYA 1RAIB 4J9QA 1UA0A 4I2PA 1LW0B 1SJQA 2GO8A 4RO0A 2QA4G 3QRQA 3GFXA 4KH0B 4DV3J 2ZM6F 1RT2B 4ZJOA 3PKYA 4V19J 3VZIA 2HYIB 2ZUGA 1K8AT 1QUVA 3PW7A 2E44A 5C7PA 1PAEX 3RB0A 2VF3A 2B0GA 3MM7B 1JJ2R 2FGOA 2HGMA 4S0MA 3LH2S 4ZP8A 4K2XA 3M6VA 4L3NA 4P2FA 2PDAA 2YX1A 4J9RA 4N5SA 1H73A 1REGX 4Z7YA 1YZ7A 3OSNA 2OFHX 2Z58B 2OPPA 3D1QA 3WC0A 3N28A 3K5PA 1R8AA 3EZUA 1VQKS 4LRFA 2QL7B 4DN0A 4JI2J 1HWLA 1GX6A 1JXLA 1DY3A 3PYFA 1LWXA 5B0BA 1KR4A 3PEJA 4PQUB 4UQTA 5HVGA 3BQ1A 5C42A 1ZAXA 3G8QA 4MKAA 1MN9A 1VIOA 2E5GA 1FJGF 3WDOA 3KK1A 1B0PA 4M94A 4L75A 3Q8YA 4DU8A 3E51A 5F3ZA 3FBEA 3M8QB 2YKMA 4EO8A 3DGPA 3KJFB 4ZIWA 2XZTB 1XMQJ 2P9GA 4MKBA 1HBMB 2Z30B 2H4WB 1DBDA 4DR5F 3W5YA 9ATCB 4B9UA 2FJBB 1HWUA 4DV0J 4MIBA 3MFIA 3Q23A 1GNKA 5A8WA 2WZ1A 1N5TA 3NNAA 5JJBA 3IN5A 3UQSA 1NBEB 1CJKB 3P5BP 4ZVFA 2MKHA 3CJ5A 2CPZA 3CB4A 1S1XB 2BYCA 2DH7A 2RDJA 2F5GA 2R7WA 3GSDA 4URQU 2VBZA 3PRBA 1KFDA 5B7WA 2D1CA 4DX6A 4KIAA 3NGUA 2ASLA 4KYZA 1IBKJ 4ILRA 4DV4J 1E6YA 3BF4A 3M2RA 1VFJA 2RNEA 4W90B 1SC6A 1WOPA 4DV3F 3UPFA 1FRMA 4K5SA 2HURA 3O1LA 1O51A 5EUHA 5DLFA 1S6QB 2OMOA 2VJUA 1S4EA 4LF2A 3JSBA 1AROP 1TL1A 4IH7A 4EUVA 2D9OA 4USHA 4DR3J 4K0KJ 3DHWC 4OQJA 2Z57B 3AAWB 2J7KA 2VBXA 4FKYA 1CC8A 2M88A 2YWKA 1Q1KA 1TUGB 3B78A 4MK7A 2VA2A 1LV5A 3VGTA 5GAGU 2NZCA 5K9FA 4JI2F 3OVSA 3GJTB 1PBAA 4OZ5A 2DHXA 1VRTB 1D9AA 2ZBPA 3D6HB 1TQLA 3W60A 2DNOA 2IPOB 3KHRA 1N32J 3LWLA 3E01B 4ID8A 2JZ5A 3I0SA 1X0FA 2YQ1A 1YLXA 3VAFA 2WBMA 3FBFA 3HHEA 2UV8G 4ZVRB 1WG5A 4LR7A 5HLFB 1KP6A 3C6TB 3LP0B 1RKIA 2O1PA 4DR2J 4P6QA 2ZFHA 2QX0A 1VC0A 3OPKA 1BGXT 3WHIA 4R0JA 3K5LA 1G7CB 2ZH3A 2XWYA 3OL6A 4OYWA 3EVWA 1XMQF 4RNMA 2MZJA 4UY8T 2DGWA 5AE2A 1C4AA 2LMIA 4Y2MA 3W8GA 2BJ9A 4ZDNA 3TX8A 3PYDA 2ZH8A 1XK8A 1LWFB 2XSFA 3MPDA 3TO8A 1NUEA 1DURA 2VG5A 1U4BA 4YY3J 1FWPA 1IXKA 4DV0F 3H5SA 5AXNA 2CWKA 4LRDA 4ANEA 2CPFA 2KZZA 4DL6A 3TJAA 2GIRA 1S7IA 1VBKA 2FVSA 4L72B 5BR8J 3PW4A 1R43A 2KVQE 3T1HJ 5L9XA 1GFWB 1RXOB 2VPWB 1WC1A 3BSOA 4X84A 3M6UA 4RU2A 3THTA 5K14A 3BJYA 3BBCA 4TU7A 1NJWA 3B6BA 3BO4A 3RAMA 2VFSA 3OR2A 5A8RA 2AD9A 2RUGA 1TKTA 1IBKF 3PXGa 4FYVB 2RQMA 1NB2A 4DV4F 2ZC3A 3WC2A 3ILIA 2VONA 1YJUA 5KFJA 4GO5X 5ETTA 4LVOP 3GIKA 4P74A 4C8YA 2APOA 4DR3F 4K0KF 3VGVA 5CHCB 4WP8A 2K3KA 5HMXA 1WJ9A 4M5KA 2C28A 3DLGA 3QRPA 3JSRA 3M6WA 3BSNA 2A10A 4CYUB 1B64A 3JSMB 2WRMA 5DQIA 2DH9A 1S49A 2WOMB 5HMYA 2K06A 3I82A 1Y11A 3VWSA 1HBNB 3UWTA 2I0XA 4DFMA 4X65J 1YK9A 2I5JB 3X3UA 3AXMA 3WBZA 1AZSA 1T7PA 1SKUB 1BLUA 4E98A 3RZAA 1N32F 4H4MB 2JOQA 2ASDA 4QU7A 4JV2A 4LSLB 2R8KA 2V4JB 2Y0BB 1M5VC 3UDVA 4NLPA 2YKPA 1UEKA 3UD3P 3VGUA 4DR2F 5CQGA 3DOLB 2LDIA 3THVA 1NJYA 4G6VB 2YBVA 4LBPA 4DV1J 2UVRA 4LFCJ 2XI2A 2ZE2A 2BOAA 4DSKA 2XLKA 2DCUB 1M0SA 3EDRB 3DLJA 4IQXA 2J76E 4V1Ak 1P6TA 2LU2A 2BJ3A 4JYAJ 3VAIA 2GX8A 3CE8A 2ZWPA 4URSA 1UJ6A 5E7OB 2BXJA 2R8JA 2HQFA 4YY3F 3KTQA 3IS9B 3OT9A 1NJXA 4N47A 4PYAA 4MK8A 3IRWP 2RQ4A 2CQBA 1RWNB 2E7XA 2DNQA 3MR7A 2QJ3A 4AE5A 2GVZB 4D3HA 1DTTB 4N7TA 1YIJS 2HGLA 4I7FB 3IFEA 1U09A 5BR8F 2C42A 3T1HF 3PY8A 1S1VA 3I5CA 5DO2A 4WFBQ 2VHGA 4CWBA 1QAJA 2XNRA 3PJ9A 2SXLA 4O0IA 1O8BA 4FYYB 3T5KA 1UFKA 3TZYA 1TKXB 3K8WA 4JI7J 5KFNA 1GK8A 2MSTA 2H3EB 2EC0A 1U24A 3RB4A 1U02A 2B56A 1JLEA 4P7TA 4RU9A 4F02A 5M2RA 1A6LA 2EK1A 3JTOA 4RNFA 5KFRA 1J27A 5A2QU 2YWWA 1NKCA 2DGQA 1KDNA 3U1MA 1S6UA 3I31A 2NXJA 2CJQA 3CC2S 4WYLA 5A8KA 2COLA 4MFBB 2VICA 1FVSA 3QIPB 5GAEU 3MXHP 1QE1A 4CT9A 2R8GA 2OGUA 2F1FA 3MR3A 2EBEA 1QY7A 1IKWB 1NRKA 3NMAA 1Z2ZA 1P27B 3CMAS 2ILZA 3HSGA 3VR1A 4TLQA 4QWBA 5LXRA 1HNVA 1RTDB 4JI8J 2ATCB 2MSSA 4X65F 2OTJS 1BQXA 2CG4A 5I42B 2ROGA 4WTYA 5BXIA 1N6QA 3V6DB 2HVEA 2AX1A 3F73A 1XIQA 3FFIB 3QQCD 2R9LA 3W65A 2HFOA 4A8YA 1XWLA 1SVDA 4P75A 1KBRA 4EWTA 2X1GA 4EBCA 2AZ3A 3RRHA 1NLKL 1X4HA 5GMDA 3MEKA 1G6BA 2W25A 4HEA9 3MAAB 3HT3A 5G4DA 2EKNA 2BE7D 1MROB 4DV1F 3K58A 3LP1B 4LFCF 3DOMA 4MAKA 1SPBP 4OI2A 1JXVA 1SL1A 1REVA 2CPDA 2KH9A 3KLEB 4HACA 4EYHB 1L3UA 4JYAF 4ED0A 2KL8A 4FBTA 5RUBA 2ZBIA 1J5OB 4ECYA 2DGTA 3ILLA 1S72S 1FESA 4IYQA 4DQPA 5FLXY 3OR1A 3D0HE 4P2SA 2BANA 2YWGA 5KFTA 4A48A 4IH5A 1ZH5A 3V4IB 1JLBA 3AB4B 4NLDA 3Q8PB 1IQZA 2QN6B 1C2PA 2KRRA 4N8OA 1VQLS 3UCGA 1S59A 2ZHOA 1Q78A 5AXLA 1R89A 4R5PB 2EK6A 1TK0A 5HL7Q 4DF8A 4PXBA 3O2IA 5D4OA 4JI7F 3Q8UA 2HWIA 4ALZA 3JAMY 4OX9J 4Y65A 3HMJG 3HD1A 3H90A 5IT0A 3CC4S 3NS6A 3R1HA 1S9GB 3DC2A 4LVNP 4DPTA 1FRLA 2W9CB 3KG0A 2OLWA 1IWGA 5GADU 5HBMB 1I94J 2XLIA 5ETKA 5J1EB 1M5PC 1UETA 1LW2B 2CQ0A 4NEYA 5M2UA 3T1YJ 4CO0A 5I3UB 4Y28C 4LF9J 3H5YA 1VK8A 2CNNB 2R7TA 4QWAA 4FVMA 1UFWA 5KFLA 1SIWB 1NKBA 3ITHB 1U45A 1MMNA 3HHDA 3NNHA 3MAHA 3UN5A 3CCTA 3CIZA 3H2VE 1T9UA 4GC6A 4JI8F 3JQJA 2V34A 1D8YA 2KXNB 3IRXB 1DQAA 4A8MP 4RNOA 1TKDA 2ZC4A 1RTIB 3UVJB 2XS2A 3EGVA 4CLLA 4I6YA 5A0YB 3HHNB 1HYSB 3BGRA 2XLJA 1FXLA 3R3TA 5CYJA 1M1HA 4ELVA 2RS2A 1BHNA 2ZNYA 1L5UA 1N48A 3PX0A 3EJMA 4LF7J 3Q8QB 4NLYA 1M1GA 1SV5B 1OMSA 2CAJA 1RAEB 1E6VB 5JUMA 5IWAJ 4WE1B 4QIVA 1WD6A 1S4FA 4Y2CA 1NK8A 4OYBA 1CS4A 2HNDA 3JTNA 7AT1B 4IG3A 2VG6A 1EARA 5CAAA 2J8SA 1EJ7L 4RWXA 1BXNA 2X51A 2JLEA 2DB1A 1NSQA 4G1IA 3RAQA 1N52B 2YKNA 2AJ0A 3AA9A 1TKZA 4ZVPB 4OLPA 1DZ5A 2MB0B 4UUWA 3OUYB 4YN3B 3MM6A 1G3OA 1H2UX 1VGYA 2GJIA 4ETXA 1JKHB 2MY8A 1DQ8A 3DLKB 5IT9Y 2FD2A 3MCNA 2HHHJ 2YKAA 1JK9B 4GKJJ 3M05A 2JWNA 4CTAB 4ZP6A 2UV8A 2AIRB 1RT1A 4F50A 4ZJQA 2IMOA 4O23A 2E9ZA 3T9NA 1VQ7S 3OW2R 5K5MA 2H9ZA 2HGNA 3ISND 2KU7A 4IO1A 2A2DA 3KK3B 4OX9F 3CPWR 1D9FA 2RDDA 1WF1A 5T41A 1AUDA 4KJIA 5A6PA 4C3MA 3TANA 5HMWA 4K4UA 2AWZA 3OL8A 4KKOA 4NWBA 4DWIA 3CJTA 1RLCL 2DHGA 1VLOA 3DFEA 1I94F 3A8EA 2CQGA 3T1YF 1LEOA 3MCOA 5CH7B 1NPPA 1HNXJ 4M5JA 3Q24A 2KI2A 3QJLA 4LF9F 2D3ZA 1OY8A 4EU0A 5CCLA 4JV0A 3GZ7A 4F4XA 1PCAA 4UTGA 1TVRB 4ED2A 4I69A 2E5JA 4O0NA 4RW9A 2OPRB 1T9WA 2C1EB 2BKPA 2F65A 4AL5A 2EFGA 3A3PB 2OELA 4ZITA 1KKHA 3IM9A 2JEIA 3W9IA 1T8EA 1OWXA 3FCWA 4GKKJ 1DLOA 2C3UA 4KY3A 1IN0A 4IO9Q 3H2UB 1OPIA 4BC7A 2XC9A 1IKXB 4RWWA 3KNAA 3U1NA 3AHPA 1YX2A 1VHIA 7FDRA 3BEGB 1ZZNA 4LF7F 2VKZG 2OP5A 1N0VC 2CPIA 2G0IA 3BB5A 5IWAF 2JVOA 5KFZA 1T9TA 3IAM9 4UY85 4P2MA 3DLEB 2J0SD 4USJC 1U2CA 4AD6A 3RYLA 2MKJA 2MZTA 2MHEA 2MTLA 5JMNA 3EPGA 2XCPA 3UN2A 4DV7J 4NLRA 4P10A 1Q7LB 1ZA1B 3EVOA 2H1YA 4PYDA 4WXWA 1PKUA 4USWA 4N56A 1HNZJ 2CQIA 1RQ0A 1ZA2B 5AXMA 3FJ2A 4IH6A 2I9SA 3VCDA 5HROB 2MQPA 2HHHF 2X3GA 4E2FB 4GKJF 1JLGB 3HCXA 4OHVA 2WVEA 5IM0B 3HVRA 1TL4A 2JDJA 2DNYA 3A1YG 3WIUA 2HQ3A 3NCPA 4HH1A 1SH2A 1TV6B 2M5YA 3TQEA 2QZ8A 3A12A 4PXEA 5THWA 4EFAC 4OV6A 2LCWA 3NOCA 4W4MA 3G96A 2JEFA 4DQSA 2CPEA 3GFZA 1BQMB 1KQKA 1JLFB 4RW8B 1RJJA 4KO0A 5KOWA 4XTTA 1CJUB 1AW0A 2F8MA 4J9PA 1VBYA 1V3SA 3CIMA 2CXEA 3DHXA 4NLSA 1RT6B 4DPOA 2R7OA 3M1VB 1M90T 3BO2A 5HLFA 1HNXF 1QJHA 1PG5B 1CJVB 2AJ2A 5B0EA 3POTB 5E3QA 2AT1B 3KKFA 3E8OA 2GC8A 3D9BA 4DJBA 2P6TA 5KFWA 1KQFB 1EP4A 3BBBA 3OL7A 3CCES 4DUYJ 4J37A 4BCAA 4GKKF 4G1QB 1YJTA 4QR0A 1AUSL 2VDIA 4B02A 3UCZP 4A4JA 3ZZ0A 4IR1A 5E41A 3C8YA 3BYRA 2B5JB 4PPDA 3T5LA 5KFKA 3BDEA 2EG1A 3QAUA 3QT7A 3EZ5A 1UTAA 1NMEB 4QWEA 4RW7B 3IWNC 4TU9A 3W5XA 3Q22A 3CW2C 3QO9A 2ATLA 1IJFB 1R0AB 2HMIA 3W66A 2UZAA 2RJZA 2HNZB 3A8JA 1C1BB 2R7UA 2ZH1A 2HZCA 3CDAA 1NH7A 1NK7A 3GFYA 1T03B 1JNRB 4ZLNA 3KUEA 2YNIB 5J2PB 8AT1B 3FDSA 1TUVA 3HFKA 4DV7F 5EWGA 1K9MT 1SQGA 2MLZA 3PNIA 1WKJA 1SKSA 2W4DA 3CJ0A 2CPJA 4H4OB 4IDKB 4ZP9A 4CNZA 3MM5A 1RHRB 3TVYA 4DPXA 3BGFA 4MT1A 1HNZF 2Q66A 1FFGB 3HFZB 2J0WA 4ZCKA 1SBRA 3GV5B 4WP3A 4B9SA 3CMQA 1FNXH 5B0DA 4L6V3 2OSQA 5E2QA 1KSPA 3ZNUA 3GLJA 4W98A 4DCOB 3UI3A 1YJ9S 3W1YC 2BQRA 1LWEB 1FK9B 3M9OB 1XQIA 5HK4A 2Y0SD 2F9JA 2F63A 3JSMA 4GO7X 4OJ3A 1Y3KA 1HBNA 1NAQA 3IG1A 4XDCA 3TEHB 1U2RA 4CO2A 2QMUB 4CQ1A 3RBZA 4U95A 5BJRA 2RF2B 4OYZA 2ERRA 3M4XA 3MEDA 3J7YI 2R2TA 5H9EJ 4DXLA 3PEHA 4LSLA 2GHPA 1L3SA 1IKYB 3IA0A 2WHOA 5F8NA 3D1OA 3R2DJ 2FYXA 3AODA 1RTZA 3M9MB 1FD8A 1C0TB 3DM2B 4ZN3A 3V81A 3GTYX 1JLCA 2QE5A 3GR0A 3MCMA 3RGIA 4HHHA 2IRYA 1UKUA 4ECVA 4DUYF 4C8MA 3HF5A 2XWXA 1TR0A 4DR6J 1YBAA 1P1TA 2HFUA 1CC7A 5B08A 3KMSA 1HMVB 5FDLB 2BRKA 5CD4A 3HD2A 3ZZYA 2DNLA 1KLMB 2HLUA 2ZUAA 4N77A 3I0RB 1TK8A 1O6XA 1HR0J 4KFBB 2ZVIA 2DGSA 4RZRA 1WG1A 2IYIA 4YFUA 2ZBQA 3LWMA 3A3OB 1VBZA 1X4FA 4J9UE 4OL8A 3EWGA 3NAHA 1UW9A 3MMAB 4ECSA 4PWDB 5IQQA 3AH6A 3TUIC 3NMRA 1OSCA 3CDWA 3CJRA 2NPFA 1S1UB 1V9OA 1L3VA 4LSZB 4B3SJ 3HPOA 3C16B 2GHWA 2POKA 3M32B 5LXYA 4YDXA 1SCJB 1EETA 2QL5B 4J9KA 2HHUA 2ZWOA 2AV5A 3VALA 3H20A 5I4MA 4C11A 3CJKB 1FDAA 2BQUA 4Y0FA 2QA4S 2DGVA 3MMBB 4DZDA 1GXUA 2DNPA 3BGLA 2IFXA 2KG1A 3RG6A 3K17A 2NSBA 3DRPB 5IOLA 2HBQB 1W7WA 1F9FA 4LQ9A 2N4DA 5ETVA 1RBAA 4LF4J 1IM4A 1RABB 2OPSA 4J9OA 2VL1A 1L3TA 2LVWA 1MU2B 3TOQA 3NL0A 3CJ8A 1LWCB 2FQQB 1WHVA 1TL7A 2DNKA 2N7YA 2BV3A 2CJKA 1P9QC 3KK2B 4OI0A 2FZGB 1HQUB 5KT4A 2Y3YA 4PG4A 2JL9A 1VQYA 3OL9A 4KC5A 1F9EB 4FNIA 1S1TB 1UW4A 4PWWA 3EXYA 4FF3A 2ZDPA 5AT1B 1XNRJ 3UNYA 1HLWA 1RWPB 2HS4A 1P1LA 4DPUA 2CDRB 4Q0BB 2DNNA 1VQSA 4YUDA 3K8VA 1B70B 4QWCA 1RT4B 5HSPA 1U0SA 2E1CA 4JB8B 2LQJA 1U2FA 4NOHA 1K1QA 1LFPA 5L38A 4K4TA 4PPZA 2GAGC 3RR8A 3ICLA 2ACYA 1YG0A 4R0EA 5HP1A 4JI4J 4LUBA 2CDQA 3VHQA 6AT1B 2JC1A 1VLYA 5U47A 1JLQA 3W2WB 2HQGA 4RL1A 4DR6F 5IC6B 3RR7A 1NSKL 4OIXA 5J2NA 4UUXA 2L41A 4AQYJ 4B3OB 5KT7A 2ZKTA 4IQMA 2QL9B 3KJNB 4ID5B 1PC5A 1PO6A 1QDUB 1YITS 1X5TA 1HR0F 2BR0A 1WEZA 3GMGA 2XSJA 3GONA 1RE1B 3HVTB 4DSLA 4UF4A 5DJBA 2DRDA 1K0VA 4P2XA 3V5RA 2O3DA 2XEXA 3D68A 4NA1A 3ZZUA 3QSYB 3M2VB 3DRRA 3IWXA 4HT5A 5EX3A 3LTOA 4B3SF 1TU0B 3PHTA 1XJWB 2KM8C 2NR0A 5C25A 1RT5B 9RUBA 3F41A 3K0JA 3D66A 5HI7A 1HHTP 2A1BA 1UAWA 2BEFA 3NKYA 5E33A 2RKIA 4AXIA 1KVJA 4MYUA 1T3OA 2GFFA 1QTNB 1X4DA 5C2GA 2XYGB 3HDSA 3SFGA 4A8OA 4L73A 1H3DA 3IBFB 5HBMA 2MLYA 5KFCA 2RDIA 3FQLA 4ZKAA 2FY8A 3HKZD 4LSNB 3HI9A 1IQTA 4QU6A 4LF4F 2X1AA 4JI6J 1IKVB 2A6OA 4OZNA 2DEIA 4Q44A 3IR7B 3FMWA 3TA0A 4NLVA 2CJYB 3M8RA 2GA7A 1WHYA 2A18A 5GVQA 3TAMB 3UVJA 1EIYB 1ZZFA 3JXOA 4QR1A 3R7NB 1IR1A 1QAXA 1X5PA 3I87A 3MHYA 2QYGA 3X1LB 1XNRF 4DUZJ 2V4QA 1UPMB 4FF4A 2FTRA 1CJTA 4CLTA 3HZGA 4HR2A 4F4WA 4UT4A 1NK4A 1RAOA 2QSWA 1QAYA 3ULHA 3K59A 1AFIA 3TWZA 2WB4A 4JI4F 1F3VA 4KB7A 2GV1A 1ZPVA 2HK3A 3UE2A 2NCKL 1WOOA 4HVZA 2LXFA 3EM1A 1QM9A 3QPIA 2GMHA 4OJGA 1FXRA 4O44B 4KGVB 1CULA 1N5VA 1TAQA 4AQYF 3OTCA 3FMBA 4BC9A 3G71S 1Z4UA 2U2FA 3W2VB 2YXLA 4EYIB 4B9TA 3US5A 4ECWA 2DGUA 2PGCA 3AJ2A 4J9LA 2OMLA 4FVCA 1Q5VA 2YNHB 1GEHA 4KT0C 1IR0A 4ZHRA 3M8SA 4DDFA 1JJCB 2XI3A 5J2QB 2VPZB 2IRXA 2XG8A 1HW8A 4BWMA 5KT3A 5KG7A 1B0VA 3DN9A 2DHSA 5H9EK 2ZBCA 4X4NA 1KVKA 2OFGX 4OI1A 2AKWB 3KLFB 4GC7A 3KUGA 4IRCA 4TY9A 3MOJB 3VV2B 1S0VA 3QGGA 3AD8C 2AEFA 3DGVA 4NLUA 2JLGA 4M5MA 4PR6A 3T5HA 4ICLB 2JFKA 4O3OA 3KJVA 2IBOA 2DNGA 2IAJB 2RB7A 3HSZA 1PC4A 3MPUB 1RT7A 2LLZA 4D3GA 3W64A 4JI6F 1U0HA 3KLHB 3JS9A 4WIIA 4XAKA 4DG1A 1Y5IB 2F4FA 1X4AA 1VQOS 2FHMA 2FJXA 4KHMA 2UUAJ 3LA0A 3BN7A 4DN9A 3L09A 1RTJA 2G4BA 2RILA 5HQLA 1HBUB 3G6YA 1WOSA 3PG9A 2HEKA 3GIIA 4DUZF 5KFPA 2KT2A 3P45B 3GP9A 3SSSA 2OEJA 4JOUA 2VFUA 2DCLA 3MMCA 2C22A 3GIRA 4LF5J 1NSPA 4KE5A 3JSYA 3GIMA 1XEZA 3J7A1 3CEDA 1RHMB 3MI7X 3I4PA 2KRBA 3MM8B 4QR2A 2RIJA 4RKUC 4OI3A 2NUUG 3M8PB 1YJNS 2OIHA 3MGJA 1OY6A 1CLFA 1YJRA 4ZCLA 3DKDA 2MJNA 4LFAJ 2IMWP 2GS8A 1VJWA 3QMQA 4NLOA 3D28A 4FXDA 2B9YA 3N4WA 1C1CB 5B0GA 2BJDA 1LOUA 1RI7A 2FLPA 2LDYA 4PG7A 3HHLB 1KNZA 2IJFA 2ZZTA 1I3OB 2KXHA 4OHWA 4EZ9A 2Z2LA 1PILA 4C8ZA 5DG7A 2KKHA 1BUXA 4CO4A 1FJEB 3H7HB 1GMWD 2XY6A 3TRGA 5C24B 1U1KA 3ZZOA 1X60A 3CUNA 2XHWA 3QJPA 2NPIA 1SI9A 4JI1J 3PR5B 1YRXA 4F3QA 4DZ6A 2ALZA 1S6PB 3RUBL 4ECQA 1F5CA 4YHHJ 4Q43A 2FJDB 3U02A 3B8HA 4MIWA 5GAHI 1N54B 3EMTA 4Y6IA 2JRSA 1TL3B 2KN4A 3ZZPA 3F56A 3ZXWA 2HZAA 1NK6A 3C66A 2KVIA 5D8HB 2OEKA 5L9NA 4WF9Q 1R8BA 1XNQJ 3ZTSA 2JNJA 3DLBA 4KGKA 2Q79A 1PJ5A 5J2MB 3GSIA 3MEGA 3NS7B 1UFLA 1HBOA 4X4OA 4Y00A 3OTBA 2EFOA 2E5HA 3VAMA 4RW4B 3RBDA 2KJWA 5DLGA 5T14A 2EBGA 3J7AN 4EBEA 2YQ0A 4ZVOB 2GO9A 2G1DA 2UUAF 3LOUA 1U26A 2Z2YB 2WVDA 3PVXA 1VR6A 3ZO7A 1NJIT 3VVUA 1NKEA 2DKOB 4YB6A 3LP2B 2ZITA 4ECZA 1RADB 5CD4H 2ZJQQ 3MM9B 2H4YB 2HFZA 1RYRA 4Y34A 3MZIA 3V6HA 2AYBA 3FEXB 3NWGA 4TYAA 4O3QA 1SKWA 3B82A 3V6JA 4F0HA 1S9EB 2L08A 4LF5F 1S0MA 1U6ZA 2HVIA 4LFBJ 4C8NA 4USUA 3EDQB 1R0AA 5CABA 5D0RA 4CLUA 1RACB 5ETOA 2ZD1B 3M8YA 1TMJA 1RWUA 2YWHA 4H4KA 4U8VA 3LPEA 5CYMB 2XYPB 3P8BB 3HHKA 2B7CB 1RT3B 1SC4B 4BBYA 1UL3A 4WK1A 2ZH7A 1FDNA 4LFAF 2VA3A 1KN6A 2K7KA 3EUNA 1VBXA 2OH2A 4DFJA 1FX2A 3CCWA 4HI1A 3UCUP 1TAUA 4IDKA 1VCTA 1V6HA 4NI2B 2HKEA 1SH3A 2AJQA 2CWXA 3MD1A 5EX0A 4DL4A 1MSWD 2VZ9A 2RU3A 1RA7A 4DQQA 2BKOA 4NEZA 3RW6A 3BGUA 1U8WA 1N5YB 4IFVB 4UZCA 1Q79A 3HHLC 3OD2A 4F3MA 2MKSA 5IQ6A 4JI1F 2ZOFA 1MWYA 4EZ6A 2BZ2A 3PW2A 4YHHF 1AYEA 4Q8FA 1ROFA 3KMQA 3N0VA 2RHQB 3FEYB 4ZPWR 3IWLA 4C8OA 2ROPA 4YR0A 2AU0A 2ZH6A 3C15A 4B9MA 2XGPA 5E3CA 2RF2A 4FF2A 3CD0A 4WFZA 2BQ3A 2BJ1A 3QGIA 4Z37A 1M5HA 1XNQF 1ACMB 3OFEA 4R8UA 4FS1A 4ZS6A 5CYQB 4X4PA 3H59A 2NYHA 1C0UB 4NRUA 4DV5J 3UDEA 2BE2B 2BDPA 5IV4A 1U47A 4ED1A 1T95A 2HHTA 4IRKA 4O4GA 5DRKA 4URGA 1EQ0A 3N6LA 2I6WA 1QAIA 3I5BA 1CG2A 1HPZB 1IWAA 3SSQA 3EVMA 5CCMA 5MAOA 2VJVA 2NXEA 2WVBA 2PI4A 2V50A 3UDLA 3SZ2A 2EXUA 4HTIA 2GW8A 1PYTA 2W7OA 2NXUA 1PBUA 4I2QB 1N0UA 1N4LA 2HHPA 2K1RA 2V6AA 5E5NA 4L3KA 1R7IA 4OJ1A 1HNWJ 3W9JA 2RQKA 1GX5A 4MK9A 3KJQB 4OX7A 4LFBF 4EO6A 1NPKA 2R7VA 3MAQA 1VQ4S 3HSJA 5KT2A 2ACMA 2J8AA 3KNGA 1YKWA 4HT7A 3MECB 5KFFA 5KFQA 4I2PB 2IHR1 2HHXA 1B7YB 1S1UA 2VH7A 2V2QA 5F8MA 2GHVC 1FHTA 3VAHA 2HRUA 2MYFA 3D1HA 5SZTA 5LSOA 4C48A 2JX2A 4DFKA 4QYZJ 1JLAA 4F2SA 2UP1A 3EGNA 2RS8A 4M63A 4YR2A 2KJVA 2OPPB 1VQ5S 4NLXA 5K20B 3FGVA 2MPUA 2HQCA 3BN4A 3VZHA 4X4TA 3ZTQA 5ETMA 3QYYA 1R31A 3O8WA 2K3IA 4ZVEA 2B4PA 2FUG9 1YJVA 3TUZC 1VJQA 4M8LA 5CA5A 2VASA 1FVQA 5EWFA 5C42B 4JI5J 2HIYA 4TQRA 3CC7S 2W24A 2P9EA 2ADCA 3OQ2A 5F0UA 3GWCA 3G8TA 4OYXA 1HNIA 4TY8A 5B0CA 4J5OA 4X2BA 4Q7AA 3KK1B 1KTVA 2YNFA 3H4DA 1S1TA 2PA8D 1TELA 3PDNA 3FQKA 1KHVA 2YKMB 4OHXA 3DGPB 4F36A 2MLXA 3OV7A 1RT4A 1I51B 2MZSA 4K50A 4DV5F 3GV7B 3SXLA 3IBWA 3CMES 3UDCA 1WC4A 1DARA 3T6JA 4OI6A 3DDIA 3S8SA 2GQ2A 3PACA 2JH3A 1HQEA 2GIFA 5T7LA 5KFSA 1R27B 3PW5A 2AHOB 2FVCA 2WBRA 5DZ7A 5A8WB 1ZTTA 2XNQA 3M8WA 1SJ3P 3KWMA 2W8LA 2G2OA 4WFYA 2CQ4A 4NPOA 4USIA 2WONA 4DSIA 3TP2A 2BMBA 3FRYA 1HNWF 4U7UK 3RBEA 3R1LA 4FZVA 4JI3J 4ZA1A 2GVDA 2B4VA 2J9DA 1VRUB 4QOTA 4XK8C 1RTHA 2WAQD 1HQ2A 5D3GA 2HAFA 2V2ZA 1VK3A 2BRLA 4ECRA 5L46A 1F2HA 2ZKUA 3DI6A 3D3CJ 3OXGA 4Y2KA 1E6YB 5LMUJ 1JWWA 3LQVA 2DNMA 3VAGA 3L7UA 3WX4A 2B51A 1CVJA 3BKFA 2QLFB 4IFYA 4NLGA 1TL1B 2HK2A 2FJAB 3LGMA 4K8RA 3LAKA 3QGPA 2H48B 1SJ1A 1UPPA 2GMJA 3BKUA 2BW2A 2DR6A 3QIDA 3D7SB 4FPRA 4DX8H 3PRDA 2EFNA 1QUPA 4CO5A 3CULA 1X4EA 2VOOA 4UOGA 2WB1D 4HL9A 2EFVA 1ZM2A 3EX7B 1N33J 1U1QA 4PG8A 1FTRA 2HQDA 4RR5A 3SQOP 3Q2SC 1ZM4A 3CSKA 4DS5A 3NGTA 1R8PA 1RAFB 3QWUA 3M2UA 2XMUA 1IKVA 1DHMA 3DOKA 3I0SB 4C9DA 5F8IA 2QLWA 2Y1JA 1W26A 4A47A 1CEZA 3FKBA 4JI5F 3TAMA 2RQCA 2MZQA 4M5HA 5LSLA 4Y2IA 2RAQA 3UR3C 5HVHA 4GVLA 4KPYA 1H38A 3K5NA 1F2GA 3C3LA 5IXUA 4DQRA 2V8PA 4RUBA 2GIQA 3M9NB 3OSPA 1FKPB 1EAYC 2HHSA 1SUQA 5FLXU 3W9HA 2BJ7A 4C6AA 1PIEA 3PM9A 1RHUB 3P4UB 5D4PA 2VG5B 2OHDA 4DS4A 4B9LA 1WC6A 2FHOB 3MUMP 2PT0A 4U67Q 3IC1A 2BJEA 2HRTA 2QMXA 1R8HA 1LK5A 2CADA 3W63A 4IOAQ 2VFVA 1Q53A 3OTEA 2MJUA 2QTWA 3MPWA 2KHCA 4O3SA 2MEWA 3JAMU 3T5JA 3CCVS 4LBHA 1TP7A 1WC0A 1WORA 1WDTA 2LEPA 4JI3F 1I6JA 2CZVC 2YNHA 1RLDA 1X5SA 2VB6A 5A8RB 4NYPA 1TKTB 2AGPA 4M5DB 2OI2A 2GQCA 1BC6A 5LMUF 3A8KA 2U1AA 2ALYB 4AL6A 2X1BA 3KOAA 1T3NA 2FJEB 1XMBA 2EW9A 3D54A 4RUAA 2W1BA 4QYRA 2IM3A 4WP9A 1H6KX 2A0FB 3KLFA 4J91A 1HD0A 1SJFA 2KDOA 4RW6A 4N41A 2XS5A 5DQHA 2RRAA 3WQPA 4DF4A 3DLGB 3EGWB 4B3RJ 1WSVA 2Q6CA 4ICLA 2L9DA 1R3NA 3TQ1A 3LO3A 2PC6A 2R7SA 1N33F 4PUOA 3LGNA 1QVGR 3PRVA 4DL7A 4EK2A 3T9ZA 1AZSB 4UOFA 1CQNA 3K2YA 2Q6BA 2Z56B 3CCRS 2A3JA 4B17A 4DLGA 4AYBD 2QG9B 4K4ZA 1G1XA 5EGYA 2CVIA 4KHRA 3SQGA 3MDFA 2IDEA 1S9FA 4WWSA 6FD1A 2OO4A 1HFEL 4A8XA 4HYKA 4RBUA 2XMMA 4N8NA 2H5IB 2R7RA 4ZVTB 2PMWA 3R5AA 2YX4A 2ZE2B 4I6AA 2LEAA 1H98A 3W8PA 5IT4A 4UZBA 3CCMS 2C2RA 3GB0A 1PGZA 1N5QA 1HW9A 3JQKA 3I6PA 2Z2ZA 2BA9A 5IT9U 1ZPWX 2PIIA 4PCQA 2HNYA 2PE8A 3MM8A 4WJBA 1TMMA 2ZZNA 1NSAA 2D3O1 4MKVA 2IJNA 4ZOSA 4QYZK 2W9BA 1X4CA 4TU8A 3M8PA 2H65B 5IC4B 1RWKB 4DBQA 2XY5A 4I64A 2FHJA 4JV5J 2JHEA 4AUKA 4OZ2A 1S1VB 1VS3A 3OTOJ 5KT5A 4GVBA 2XMVA 5HO4A 1KHWA 2D74B 2NXCA 3FZ2A 2W7PA 4C3LA 1FI4A 5EDWA 2E1PA 2HSEB 2K2PA 3D2WA 1VQ6S 1RUSA 1JLEB 1FX4A 3R6GB 4QPXA 3SDEB 2DJWA 2HPUA 2Y1IA 3UR0A 3OXLA 3TNVA 3BQ2A 3A3NB 2RU9A 5EWEA 3MD3A 5DQGA 4USMA 1U49A 3VVTA 5A8KB 4G1PA 1Y5NB 6FDRA 3TYTA 2DT9A 3CTRA 3BBFA 3KYLA 1QE1B 1ZOTA 4YS2A 2W01A 4Z2XA 4TNOA 4B3RF 4KV8B 3H2LA 2HQIA 3I9ZA 1FFSB 2QC3A 1VQMS 1RBOB 1HNVB 2CPYA 3MEEA 4ETZA 2DXDA 3O6QA 4OZ3A 1YZ6A 2OTLS 1N6QB 4OV1A 1RWXB 4OFZA 2IVMA 4LBIA 2O67A 5L1IA 1GAOA 1Z2LA 4LRAA 4ED5A 3ET6A 1PYSB 3OHAA 4UW2A 1AA1B 1XERA 2D3UA 3OFHA 2Z4PA 4NXMJ 4DR7J 3MFHA 3ZZZA 2LXIA 1HKAA 3C19A 1M5KC 2ZEJA 4DPYA 3P5TL 2V68A 5K8PA 1OQ6A 3DOMB 1F3FA 4LMZA 1H7WA 2PEBA 3DXBA 1REVB 4A8FA 1V5IB 1RP5A 3MWBA 4KHPJ 4IG0A 3V6KA 1FDDA 1NNDA 2EEYA 2YNGA 1M5SA 1WC3A 1VYAA 4B9VA 2VG7A 1QVFR 2X3DA 3I5AA 2KZMA 2CIMA 4DSFA 3HM9A 5G0RA 1TL5A 3PJWA 4OHZA 1MMLA 2J0XA 1Q82T 3OR1B 4R25A 5F8JA 2BANB 1RT3A 4PEOA 2Y8WA 2PMZD 2GGPA 4CLWA 3AOCA 2X7IA 4JV5F 1YQHA 2MQLA 1S6OA 3OTOF 1NZ8A 3MF5A 4J9VA 3R5DA 5KFGA 4NI2A 1VDHA 1DTQB 2MMYA 5KFXA 1SL2A 1EX8A 3L9ZA 1WI6A 4WTOB 1LK7A 1UJ5A 3OLBA 2BBEA 5H9FJ 3MTKA 5C2CA 4ED3A 1CSJA 3VAKA 3BPDA 5F9NA 4TQSA 4CIOA 1HA1A 2O5DA 5ETNA 1U25A 3T1AA 1YTYA 4LREA 1RK8A 2NQPA 1Q86T 4DL2A 5CZXA 4M95A 3C6UA 1SC1B 3QAEA 1J2VA 4NLQA 5E3RA 3JYTA 5KG5A 4OMFG 5LL6d 1FDBA 3PCOB 2C3PA 1WEXA 3SCJE 3FCVA 3E3XA 4OZJA 3CGIA 3ZTRA 3MUVP 2DHHA 5I3QA 5CZVA 2ZJRQ 4FP9A 3ONQA 3L95X 3TARA 1NDPA 3HVAA 1S0NA 4C98A 4LIWA 1FE0A 4A8KA 2V8VA 4NCGB 4K2JA 2QYCA 2F8HA 5KFDA 4MTPA 1GT8A 1MG7A 1KLNA 2I2YA 3UNGC 4NXMF 4DR7F 4ZK7M 1HPZA 2F7VA 4M1KA 1T94A 1ELOA 3AFGA 2MKCA 2W9AA 3QLHA 2MKKA 1AT1B 1OPZA 4I2QA 3HXMA 1LNQA 1WEYA 2VG6B 4KHPF 1KWMA 4YR3A 2R8IA 3A8IA 1D3WA 2BOPA 2M70A 1LW0A 1MMDA 3U27A 1U7LA 4HDHA 1RT2A 1KD1T 1OSDA 5DM6Q 3PYEA 1TKZB 4QW8A 1N56A 3G6VA 4QZVB 4DQIA 4LRCA 4RBVA 5DDPC 3MM6B 2E7VA 1B4SA 1RBLA 3MR6A 4FN5A 3G82B 4DL0C 3MM7A 4OYPA 4NZ0A 4K7QA 3CCQS 4KTQA 1YJ7A 2BM1A 1AFJA 1YHQS 5KFAA 4BWJA 4ITSA 3CJQA 3KDNA 3VQSA 2ZOGA 1YWXA 1RT1B 1F0XA 2EC2A 2V2KA 3EXCX 3R5GA 5MLCV 2F4VJ 2BM0A 5KG4A 4CDIA 5E3PA 3TJ8A 3SIPB 3H98A 4PQUA 2CNLB 2IRUA 1U1LA 2YPYA 1UJ4A 3SCIE 2XHCA 4KKOB 2YVSA 3H0PA 4F4KA 5L39A 3I55S 2KT5A 3DYAB 1U1MA 2NUHA 4DCPB 3DMJB 2W8KA 1RAHB 1D0EA 2YY3A 3E2EA 3I32A 3PR4A 3M8QA 1T05B 4WIQA 4LF8J 2AZ1A 5ETSA 4RW9B 4F7VA 4P72A 4WZMA 5DM7Q 1HBMA 1ZS6A 2G13A 5D0GA 4GRSA 4NCAA 3THPA 1Q8KA 4FKXA 4C0BA 2DITA 4ZIVA 4J90A 2VC0A 3BGOP 1DLOB 1YDLA 4ZPCA 5HQ8A 4UQGA 4F3OA 3JB9k 2QO3A 3G4SS 3N5BA 2GNKA 3UN3A 5BYRA 5LOQA 1NU4A 4B08A 5D15A 3M30B 1CJKA 2B4UA 3TEGA 3OTDA 1T11A 2UUTA 1S1XA 2DO4A 2VQEJ 5F41A 2VD3A 1NZAA 3BSCA 5B09A 2XQCA 3Q86A 2PFFB 2VPXB 2CJBA 2ZNZA 1FCAA 3UO0A 1R6YA 4X4RA 4WPAA 2GJFA 5GAGI 2CQDA 2MKYA 5LJ5Y 4EEYA 3HX9A 4B3MJ 1UZHA 1JIHA 1VRUA 2OAUA 5JVGQ 3H5XA 2H54B 3NOGA 2AGQA 4G65A 5KFYA 4PXDA 2BABA 1S6QA 4OYOA 2K7JA 2PN6A 4CH1A 3NGSA 1QD1A 3AOBA 5DDRC 2WVFA 5HJYA 2DY1A 2DGXA 4NRTA 2IM0A 3CDEA 4MJKA 3KHLA 2KO1A 7FD1A 4KRWA 4ZVQB 2N82B 4NX9A 4IKAA 2D69A 3B54A 4ELTA 5AJ3J 2E5IA 3T41A 4ZPBA 1RAJA 4MH8A 3H25A 2OJ3A 2FLLA 3G6ES 3GIJA 1HARA 2C3YA 2F4VF 3KXDA 3NXZA 1RSCA 1VRTA 2B6AB 2HVZA 3GV8B 4MKYA 4BLGA 1KOHA 2CKWA 1H2VZ 5DGBA 3E01A 4DL5A 4C0HA 3CO0P 2UXDJ 2P8IA 4F25A 4DEZA 1RHKB 5KG6A 1FXDA 3R5JB 5FIIA 1U1OA 4KO0B 3NEKA 2D9PA 1CBKA 2G0CA 3CJ2A 3C6TA 1NH8A 3LP0A 4ED4A 1NPRA 1U1NA 2XMJA 2QFIA 3WIVA 1XC9A 2E5LJ 4C97A 4K4VA 2HHVA 2MKIA 4X64J 1K44A 2H51B 8ATCB 1NDCA 4LF8F 2G0JA 1GTEA 4FXVA 3ILOA 2YQ3A 4ENOA 3NNCA 1JB0C 2J9DE 4QPTA 2GQQA 2V9WA 3ZZRA 1LWFA 1SXLA 2JSXA 1JQGA 1EP4B 1Z1ZA 5ETLA 1Q81T 2DEJA 1PJ6A 1FKPA 4ZN1A 2ZH9A 1NK5A 2IA0A 1F6TA 2KFZA 1EZZB 2BW7A 4FYDA 3NS5A 1ZETA 5F3TA 2DHAA 5E0OA 1YJWS 3QGHA 1BE4A 4DHVA 4A46A 2HWTA 4EGLA 2DIUA 4DR4J 1NHKL 4JP8A 1OIAA 3PV8A 1UEUA 2VQEF 4IR9A 3QFWA 3QO9B 5H9FK 4YB5A 2HMIB 4FF1A 2PI5A 4ZVUB 5KTQA 4DR1J 3O3LA 2VPYB 2P2CB 2VDHA 5K8OA 3PYGA 4C7QA 4O3NA 4B3MF 3OXFA 2ZH5A 3KLGB 4L74A 5HANA 2L48A 3SI8A 2R2SA 4JI0J 1T0TV 1HL6A 4ZPAA 1FWKA 4PWUA 4M5DA 1FFWB 3MM5B 4WZQA 2Y1RI 4DMZA 4DU7A 1ZM3A 4G3IA 2MDAA 4NA3A 4CZCA 2H5JB 4NMXA 3I9V9 1DQ9A 2FJVA 1H0HB 4QIWD 4J9NA 5AJ3F 4I68A 1N36J 4CYUA 4LR9A 1LXNA 2WOMA 4OX8A 1Y3JA 1B99A 3V2UC 4DLEA 2LXUA 2I5JA 2RSQA 2V2VA 2XS7A 1W25A 4FYWB 4O4RA 4H4MA 3IG1B 2UXDF 3CNQP 4XDDA 2M8DB 2BVZA 5HQMA 1FEEA 5IV3A 4BS2A 1UZDA 3W62A 2V4JA 3CT9A 1K47A 1S76D 4WU2A 3KLIB 3ETOA 3MEDB 3DOLA 1F9HA 5KFMA 4WYWA 2E5LF 4ANCA 2E9RX 4PRFA 1UMJA 4X64F 2ADBA 3NLCA 3FZBA 1KC8T 4ZCIA 2QFJA 3Q8RB 1RAGB 2AF6A 2FVQA 3V81B 1JLCB 1F60B 3BSAA 2D3OR 3QT6A 1KFSA 2XGQA 1KEKA 3VQTA 5HN0A 2L9WA 4RBTA 4TLRA 1YGYA 2IC3B 4ES2A 1D1UA 2AYEA 3NGRA 4NCBA 4CLFA 3IS9A 3SV3A 2RHSB 5FJ4A 2E9TA 3G2XA 4P71A 4CCHA 2W2PP 2XMKA 3J7YU 2GVZA 1DTTA 2M3DA 2V5HG 3AY0A 2KM8B 2EKYA 4I7FA 1TFWA 1WG4A 3PO5A 5GAEI 1MNEA 2YPZA 4XPEA 4ZLLA 4DR4F 2R4FA 2DNZA 3ILJA 4K59A 3ZNJ1 2FGCA 4ELUA 2LQ5A 5GMKa 1TKXA 3MR2A 4DR1F 2B9EA 1HHQA 1PAUB 1WHWA 1UEVA 2VUGA 5L1KA 2AGOA 3GILA 2F9DA 5F8HA 3VF0B 4Q2LA 2PMHA 2IVYA 2CQ3A 4LR8A 4JI0F 3FC9A 5K8NA 4F04B 1UVNA 4EBDA 4YOEA 4OYIA 4OYAA 1EETB 2YX7A 3R8YA 4F0KA 2J6TA 3P96A 4I1TA 3GE9A 2HFVA 3ADAC 1RHQB 4C11B 4UOCA 3SDEA 1U48A 2LQ9A 1IVZA 3BO3A 4MFBA 3QIPA 5IFMA 3C14B 1FKOB 4BHQA 4ED7A 4IOCQ 3P6YC 1FRHA 2HIQA 3F0NA 1IKWA 4CNYA 1FRKA 3IR6B 2MGZB 2KT3A 1UVMA 1N36F 2HLTA 1WF2A 1UWBB 1R0BG 3EICA 5B0FA 4M5LA 1RTDA 2OPSB 3QSIA 3R6LB 4BDPA 4KV8A 1FO1A 2W2QP 4HLBA 3BYPA 5I42A 4YDDB 1S1WB 1X9MA 2DD8S 3V6DA 4P52A 1TL7B 2AJ4A 2JLFA 1OY9A 4OYMA 2RRBA 1RCXB 3FFIA 1HWIA 4X4UA 2AP6A 3HO1A 3CJSA 1NEEA 2M0GB 3RRGA 1YRTA 2OD6A 2CNKB 4FYXB 1WELA 1U1PA 1SB6A 2DR7A 1IJEB 3LUYA 2CVEA 1QTMA 4P73A 2CQCA 3MAAA 2HWHA 1S5ZA 1S79A 2RVJA 2DY9A 4USTA 2QA1A 2LFVA 1MROA 3QZ7A 3LP1A 1I5OB 3J7ZT 4CI0B 3BDPA 3U1LA 1Y0HA 3AD7C 3KLEA 1KTQA 2DNRA 3S6EA 4QW9A 5HP1B 2CQPA 2IM2A 1JLQB 2F40A 1J5OA 3IO1A 3B4MA 3A13A 2MQOA 3HULA 5J2NB 2G9OA 3BQ0A
chains in the Genus database with same CATH topology
4O3RA 1ZTWA 4NLGA 3TAQA 1AW0A 2O01C 3LP2A 5EN1A 2F8MA 4J9PA 1TL1B 1VBYA 4KSEB 2V94A 2FJAB 1V3SA 3LGMA 3LAKA 3QGPA 5GADI 3MM9A 3BM7A 3CIMA 3DHXA 4NLSA 1RT6B 1SJ1A 2R2RA 3BR8A 2GMJA 1KS2A 3V4IA 1NHUA 2BW2A 2R7OA 3M1VB 4DPOA 1M90T 1WHXA 2XSJB 4JBCA 3BO2A 3QIDA 2W4PA 4I0WA 5KG0A 5HLFA 2N4CA 1QJHA 1HNXF 4FPRA 3SYZA 4DX8H 1DAXA 3PRDA 5B0EA 4CH0S 2JFDA 3N6MA 3POTB 3L7PA 2EFNA 3SFUA 1QUPA 2UXBF 4CO5A 5E3QA 3KKFA 3CULA 1X4EA 4K4WA 2VOOA 2WB1D 4HL9A 2EFVA 2B9WA 4R5PA 3E8OA 2VOPA 1S9EA 4ATNA 2J9EA 1RISA 5IZHA 1ZM2A 2GC8A 3LALA 1VQ8S 2QLXA 3EX7B 3DU6A 4LT6A 1U1QA 4PG8A 1FTRA 3PKMA 3Q2SC 2FVPA 5ITHA 2XMWA 2MQMA 5F0WA 1ZM4A 2P6TA 3CSKA 4DJBA 4DS5A 5KFWA 1KQFB 3DRRB 1TK5A 1R8PA 4ZPTR 3NGDA 4IG0B 4TKTA 3PO4A 1K0TA 1EP4A 2ZD1A 2E1MC 3QWUA 3OL7A 4YB1P 3M2UA 3SMZA 3H5UA 2WCXA 3CCES 1S9GA 2YNGB 1DTQA 5CYMA 4KBIA 3RW7A 2VODA 2EVZA 2O66A 4J37A 4ECTA 5JXSA 4BCAA 2XMUA 4GKKF 1IKVA 1FJCA 4G1QB 1YJTA 4QR0A 5C25B 3BS9A 3D0GE 4B02A 5IS2A 2VG7B 1M5OC 1DHMA 3JTPA 2W9CA 3UCZP 3DOKA 1FD2A 1NJZA 2MQQA 3I0SB 4C9DA 5F8IA 5G0RB 1F5AA 3KFWX 3W3SA 2QLWA 2Y1JA 4A47A 1JLBB 4A4JA 3ZZ0A 1U8SA 4IR1A 1HWJA 5E41A 3IGNA 2DPJA 2RKIB 3C8YA 3CD7A 2C3MA 4ZP7A 3SV4A 1CEZA 4DOZA 1VQPS 4JI5F 4CT8A 5J1EA 1LW2A 2B5JB 3TAMA 4PPDA 5KFIA 2RQCA 5KFKA 3T5LA 1NK9A 1XR5A 3BDEA 3VTIA 3PIPQ 2EG1A 3GFHA 2GGPB 2MZQA 1N88A 5I3UA 3N6NA 3QAUA 3U7JA 5LSLA 5KAKA 3LAMA 3O5TB 2DTJA 4Y2IA 3EZ5A 4QWEA 4OX6A 1G2EA 2DIVA 4RW7B 3UD4P 1U6FA 3UR3C 3IWNC 3NAIA 4MYTA 2HS0A 4TU9A 3Q22A 1I1GA 3K5NA 3CJ4A 1H38A 4KPYA 4QCLA 3QO9A 2ATLA 1IJFB 3ITHA 1R0AB 2HMIA 2KTQA 3ENVA 2UZAA 5SUHA 5KG2A 3C3LA 1F2GA 1XTZA 5IXUA 2RJZA 4DQRA 3HZEA 1GXLA 2I8EA 2HNZB 2GIQA 3SEOA 3M9NB 1C1BB 2R7UA 3OSPA 2ZH1A 2HZCA 1FKPB 3CDAA 1NH7A 1NK7A 3GFYA 4ILMA 2IA6A 2HHSA 1SUQA 2WSEC 3IRXA 1T03B 1N5YA 4IFVA 4X4VA 1KQSR 2V8GA 3DDKA 1JNRB 3PIOQ 1QSLA 4KQZA 2DNHA 3PM9A 3FSIA 1RTIA 2YNIB 5J2PB 4NMLA 2J5AA 1XN9A 3FDSA 5D4PA 1TUVA 2FLNA 2R7XA 3ZC4A 3HFKA 2VG5B 5A0YA 5FD1A 3CCJS 4DV7F 3WZ0A 5EWGA 4DS4A 4B9LA 2Q43A 2OD4A 1K9MT 3GYXB 2JJ4D 2FHOB 4HHJA 1GTHA 3MUMP 2ZH2A 3PNIA 2PT0A 1M1KT 1HYSA 3TVZA 1SKSA 2W4DA 3CJ0A 4U67Q 1Y7PA 1X9SA 2CPJA 3IC1A 2BJEA 3FRZA 2NSCA 3O44A 2QMXA 1R8HA 4H4OB 4IDKB 3TW0A 4ZP9A 1LK5A 3T6BA 2MQNA 3MM5A 4CNZA 5KFEA 3TVYA 4IOAQ 3BGFA 2KB2A 2HS3A 2VFVA 1S77D 2JVRA 1Q53A 3OTEA 1HNZF 2MJUA 3NGKA 2Q66A 3EYZA 1SV5A 3MPWA 3NBPB 2J0WA 1IUJA 2QMWA 3DCAA 4ZCKA 1Q8IA 2KHCA 2V4RA 1E6VA 1SBRA 4O3SA 3GV5B 4WE1A 1SL0A 4B9SA 3OVAA 3MCSA 2FIUA 3C6UB 3ZFVA 5I3PA 4YB7A 4NCGA 3T5JA 1FNXH 2ZZMA 3CCVS 3HLUA 2ILYA 2WW8A 2AW0A 4XO0A 1TP7A 3PJXA 3JYTB 1RKJA 4LF6F 2VC1A 2YWFA 5F8GA 5B0DA 2GJ2A 4L6V3 2OSQA 5E2QA 2LEPA 5CYQA 3OLAA 1KSPA 1I6JA 4JI3F 3D5MA 2DRBA 1C0UA 3UI3A 2CZVC 5M2PA 1YJ9S 4WKRA 2BQRA 2EPIA 2OPQA 4ED8A 1LWEB 1FK9B 2LKZA 3M9OB 5KFUA 3HVWA 2Y0SD 3TVKA 5KOXA 2BE2A 2F9JA 1KONA 2YNHA 4YEAA 3JSMA 1X5SA 2VB6A 3BGRB 4GO7X 4NA2A 5A8RB 1UVLA 4FS2A 4OJ3A 2ZHAA 4ZMMA 2R7QA 4NYPA 3RAXA 2HAIA 1TKTB 1Y3KA 2AGPA 1BY9A 3L3CA 3LW5C 1HBNA 1NAQA 4M5DB 3IG1A 2C3OA 2KHDA 2GQCA 4XDCA 1VQ9S 1BWEA 1BC6A 5LMUF 1U2RA 2CQ1A 4CO2A 2RE1A 4CQ1A 1GQEA 1FRIA 1ZM9A 2U1AA 4K4SA 1N8RT 3OUYA 5BJRA 3SSRA 4FBUA 4AL6A 2X1BA 3KOAA 1T3NA 2FC9A 1XMBA 2FJEB 2RRNA 2PO4A 4H54A 1D8ZA 1XMOF 4MMOA 2RF2B 2EW9A 2KYXA 3D54A 3FNNA 2AJ1A 4U7CA 2ERRA 4RUAA 3M4XA 4QYRA 3MEDA 2IM3A 1H6KX 3FEZA 3J7YI 2LA4A 3KLFA 2R2TA 5H9EJ 1HD0A 1SJFA 1FERA 1JKHA 4DSJA 3DLKA 2GMLA 2KDOA 4RW6A 2I38A 4N41A 2HNDB 2XS5A 3PEHA 4LSLA 5B0AA 5DQHA 2RRAA 4DF4A 3CO9A 5F8LA 2HHQA 2GHPA 3DLGB 1L3SA 1IKYB 4IG3B 3IA0A 2WHOA 4CTAA 4A8QA 5F8NA 3D1OA 3EGWB 2NLWA 2FVRA 3QLHB 2Q6CA 2F3JA 4ICLA 3M9MB 2DBBA 1FD8A 1C0TB 2M7SA 2Z0GA 4B9NA 4IRDA 2MY7A 2L9DA 3DM2B 1R3NA 3V81A 4ZHRB 3TQ1A 3LO3A 2PC6A 1JLCA 3IGVA 2QE5A 2R7SA 1N33F 1Y5LB 1XR6A 4C2MA 4PUOA 1ULRA 3GR0A 3KK3A 2M52A 3LGNA 4GMKA 1QVGR 2IRYA 2YKNB 1XR7A 5DETA 1UKUA 4FXWA 3CCUS 3P49B 3MECA 4WFAQ 4QIFA 4ECVA 4DL7A 3FVYA 4J9QA 4DUYF 4C8MA 2J7UA 1UA0A 2QRRA 3HF5A 4I2PA 2XWXA 1LW0B 2YH1A 1TR0A 3T9ZA 1SJQA 3TA2A 2GO8A 1YBAA 1P1TA 1S7HA 2QA4G 1CC7A 1CQNA 5B08A 1Q8BA 3K2YA 2Q6BA 2C2EA 3GFXA 3KMSA 2ZM6F 2JEGA 1RT2B 1HMVB 1UP1A 3PKYA 5FDLB 3CCRS 1B7FA 1VI7A 2A3JA 4B17A 4V19J 2BRKA 4OZ1A 3VZIA 4AYBD 1VHFA 4DLGA 2HYIB 2ZUGA 1K8AT 4K4ZA 1G1XA 5EGYA 1QUVA 2CVIA 4KHRA 3ZZYA 3PW7A 2DNLA 4LFBF 1KLMB 2E44A 2HLUA 4NZ7A 4N77A 3KHGA 3I0RB 3TR5A 3SQGA 1TK8A 3MDFA 3OFFA 4KFBB 2DGSA 4RZRA 3RB0A 1WG1A 1S9FA 6FD1A 1NK0A 2B0GA 2OO4A 3MM7B 1JJ2R 2FGOA 1HFEL 2HGMA 2IYIA 3AB2B 3MTJA 4A8XA 4YFUA 4HYKA 4RBUA 2XMMA 3LWMA 3LH2S 3AQPA 4K2XA 4ZP8A 3M6VA 4L3NA 3KJVB 4N8NA 2PDAA 3DYAA 2YX1A 2R7RA 4J9SA 1X4FA 1VBZA 4J9RA 4N5SA 4OL8A 3NAHA 4LIRA 5A2QY 3MMAB 4ECSA 1TVRA 3R5AA 2YX4A 2ZE2B 3OSNA 2OFHX 1SJ4P 3D1QA 2OPPA 3DMJA 3WC0A 2OPRA 3N28A 4W92B 4PWDB 1RT7B 4I6AA 2LEAA 5IQQA 1H98A 3AH6A 3K5PA 3TUIC 3HJFA 1R8AA 3S1TA 1UVKA 3NMRA 5IT4A 3EZUA 1AXQA 1OSCA 1VQKS 4DN0A 3CDWA 3CCMS 1T05A 2C2RA 2NPFA 1S1UB 3GB0A 1V9OA 1PGZA 1HWLA 1N5QA 1GX6A 1JXLA 1L3VA 1LKZA 1V3ZA 2FHKA 3HPOA 4DG1B 1HW9A 2GHWA 3I6PA 2POKA 4YQWA 5B0BA 1Q4RA 3M32B 2BA9A 5LXYA 1ZPWX 2PIIA 4PCQA 4YDXA 1KR4A 3DRSB 2HNYA 3PEJA 1EETA 2PE8A 3MM8A 4J9KA 4PQUB 4UQTA 2HHUA 3BQ1A 4WJBA 2VBYA 2AV5A 3VALA 2ZZNA 3H20A 2IJNA 4ZOSA 2W9BA 5KG3A 1IKXA 5I4MA 1X4CA 4TU8A 3M8PA 4C11A 5C42A 1ZAXA 3G8QA 3CJKB 1FDAA 2BQUA 4Y0FA 4MKAA 4DBQA 1RTJB 3C46A 2UVWA 1X0PA 2QA4S 1VIOA 2E5GA 1FJGF 2DGVA 2XY5A 3MMBB 4I64A 5DDQC 2FHJA 2YWEA 1PSDA 5DG8A 3WDOA 2ZHBA 3KK1A 2IBKA 2JHEA 4AUKA 1B0PA 2ZJPQ 4M94A 1GXUA 2DNPA 1S1VB 1VS3A 3BGLA 4X62F 2IFXA 2KG1A 3E51A 2DK2A 5F3ZA 5KT5A 2DRAA 2NSBA 3DRPB 2XMVA 5HO4A 3M8QB 3M30A 1VIXA 2YKMA 1KHWA 4C8KA 3DLEA 3DGPA 4EO8A 2D74B 3MMCB 2CFXA 1F9FA 4LQ9A 2VKRA 2N4DA 2P9GA 4MKBA 1IM4A 2OPSA 4J9OA 3FZ2A 1HBMB 2W7PA 1DBDA 2VL1A 1L3TA 4C3LA 2LVWA 5EDWA 1MU2B 4DR5F 3TOQA 3NL0A 2K2PA 3D2WA 1LWCB 1VQ6S 1WHVA 4B9UA 2DNKA 4AL7A 4NLTA 2FJBB 3DDNA 1HWUA 1JLEB 4QPXA 2N7YA 2BV3A 2CJKA 1P9QC 1R8CA 2FLOA 3UW1A 3KK2B 3SDEB 2DJWA 2HPUA 4OI0A 1HQUB 5KT4A 2Y1IA 4PG4A 1X5OA 4MIBA 3UR0A 3MFIA 3OXLA 2JL9A 1VQYA 3TNVA 3Q23A 3BQ2A 1GNKA 3OL9A 3NP5A 2RU9A 1BQNB 5A8WA 1DRZA 4KC5A 3Q8SB 4FNIA 5EWEA 1S1TB 1UW4A 3MD3A 3EXYA 4FF3A 2ZDPA 5DQGA 1N5TA 3HHLD 1U49A 5A8KB 2HS4A 1P1LA 3NNAA 4G1PA 5JJBA 3IN5A 5HROA 2ZOMA 1S10A 4Q0BB 1Y5NB 2XMTA 6FDRA 2DNNA 1VQSA 3UQSA 3TYTA 3N79A 2DT9A 4YUDA 3IR5B 3K8VA 4ZVFA 3CTRA 4QWCA 3KYLA 1QE1B 1ZOTA 1RT4B 2MKHA 3CJ5A 3N01A 1JLGA 2CPZA 3CB4A 2ASJA 2E1CA 1S1XB 4TNOA 2BYCA 4Z2XA 5IM0A 2LQJA 1U2FA 4B3RF 3CVKA 1HHSA 2DH7A 2J7WA 2RDJA 2DPIA 1QLNA 4NOHA 4KV8B 2R7WA 1K1QA 1LFPA 3GSDA 4URQU 5L38A 3H2LA 3RRKA 3T19A 2HQIA 1TZ0A 4K4TA 1ZYQA 2VBZA 4PPZA 3I9ZA 3PRBA 3RR8A 3ICLA 1KFDA 2ACYA 1YG0A 1WF0A 2M4MA 4R0EA 1VQMS 1HNVB 5HP1A 1TV6A 5B7WA 2CPYA 2CDQA 4LUBA 2FY1A 2JC1A 3MEEA 1X7VA 2D1CA 1VLYA 4KIAA 4ETZA 4V19X 5U47A 2C2DA 3O6QA 4NLWA 2ASLA 3FCHA 1JLQA 3W2WB 4ILRA 3G86A 1HD1A 2OTLS 1E6YA 3BF4A 1N6QB 4DR6F 3AQOA 4OV1A 3M2RA 3RR7A 4F8RA 2NREA 3OVBA 1VFJA 2RNEA 3LANA 4OIXA 4TXSA 1SC6A 5J2NA 4UUXA 1BQMA 2B6AA 2L41A 4DV3F 3UPFA 2Z2MA 1FRMA 1JLFA 4K5SA 4RW8A 2M2BA 4WCEQ 4B3OB 4OFZA 2IVMA 1O51A 3O1LA 5EUHA 2ZKTA 5KT7A 4IQMA 2O67A 5DLFA 2EG2A 5L1IA 1S6QB 2OMOA 4Q45A 3TUJC 1GAOA 1Z2LA 4RLEA 3J81Y 3JSBA 1AROP 1TL1A 4IH7A 4EUVA 2D9OA 4ED5A 4ID5B 4QIEA 4USHA 1PC5A 3OHAA 1PO6A 4UW2A 1RT6A 1YITS 1XERA 1X5TA 1HR0F 2BR0A 4C8LA 1Y9OA 1WEZA 5L1LA 3DHWC 2D3UA 3OFHA 2Z4PA 3M1VA 1HWKA 3GMGA 2XSJA 3ISNC 4OQJA 3AAWB 3MFHA 3ZZZA 3HVTB 2LXIA 4O3PA 2J7KA 4DSLA 4ECUA 3POTA 2QEXS 2B4OA 2VBXA 1GXTA 1VOMA 5DJBA 1A9NB 1CC8A 3GYNA 1M5KC 1K0VA 2M88A 2YWKA 1Q1KA 2CPXA 3P5TL 5K8PA 1OQ6A 3V5RA 3CXCR 3B78A 2XULA 4LMZA 2O3DA 1HI0P 3C2PA 4MK7A 2VA2A 1H7WA 3DXBA 1LV5A 1S48A 2XEXA 1REVB 5GAGU 4NA1A 3ZZUA 2EWHA 4A8FA 5K9FA 2V0NA 1RP5A 4MIAA 4JI2F 3MWBA 3M2VB 3DRRA 3OVSA 3IWXA 4IG0A 3MEGB 4HT5A 5EX3A 4OZ5A 2DHXA 3G8SA 1HBOB 4I56A 1RDRA 4HKQA 3V6KA 1QSYA 1FDDA 1NNDA 1VRTB 2YNGA 1D9AA 1M5SA 2ZDOA 4B3SF 3QZ8A 1TQLA 2DNOA 2B9XA 2KM8C 3H8YA 2NR0A 3KHRA 4G1QA 5C25A 1WACA 1RT5B 3E01B 3LWLA 3S01A 2VG7A 4B9VA 1QVFR 3I5AA 2KZMA 4ID8A 4NL5A 2CIMA 2JZ5A 1X9WA 4DSFA 3G9CA 3F41A 3FSXA 3I0SA 3K0JA 3HM9A 5G0RA 2IYGA 1X0FA 3DRYA 5HI7A 3VAFA 1HHTP 1TL5A 2WBMA 3AJ1A 3PJWA 2A1BA 1UAWA 3HHEA 2UV8G 5E33A 3NKYA 4OHZA 1MMLA 1WG5A 2D41A 2RKIA 5GAHU 4AXIA 1KVJA 2J0XA 5HLFB 4MYUA 1Q82T 1T3OA 2GFFA 3OR1B 4R25A 1X4DA 5F8JA 2BANB 2B5JA 1RT3A 3C6TB 3LP0B 1RKIA 2O1PA 3HDSA 2PMZD 2GGPA 3SFGA 4ECXA 4P6QA 2ZFHA 4A8OA 1H3DA 1VC0A 3OPKA 2BACA 4B3TF 1BGXT 4ERDA 1C4CA 4R0JA 4JV5F 3K5LA 4RW7A 5HBMA 5KFCA 2RT3A 1FE4A 1YQHA 1URNA 2RDIA 2MQLA 1G7CB 3FQLA 1KVIA 1S6OA 3OTOF 2XWYA 2ZH3A 2QSFA 4ZKAA 3MF5A 3OL6A 3R5DA 4CO1A 3HKZD 1WWHA 4LSNB 5KFGA 2HNZA 3HI9A 1IQTA 1XMQF 4QU6A