3NGFA

Crystal structure of ap endonuclease, family 2 from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADVIARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGELNYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AP endonuclease, family 2 from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Isomerase
molecule keywords AP endonuclease, family 2
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 5.3.1.22: Hydroxypyruvate isomerase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3ngfA00
4ZBCA 4J4KA 1DE5A 3AYVA 2QUNA 4G56A 4YTRA 1TZ9A 2X7WA 5H6HA 5EMLA 2GVEA 3CQKA 1CLKA 1DIDA 1S5MA 4YTSA 1QT1A 1XIBA 1XLMA 3ITYA 4GJIA 4HHMA 4XIMA 1XLCA 4QEEA 1MNZA 4GJJA 1I6NA 4K3ZA 3U0HA 3VNMA 3VNJA 1QTWA 1XISA 1XLFA 3CQIA 3CQHA 3BWWA 1O1HA 2Q02A 1XIGA 3P14A 4XSLA 1A0CA 2XIMA 4ZB2A 1D8WA 1YX1A 1BXBA 4A8RA 1BXCA 5B80A 1XLEA 2ZDSA 1XIJA 3XISA 2XINA 1XIMA 2I57A 5C9ZA 2NQJA 4XIAA 1A0EA 1XYLA 3OBEA 3TC3A 2HK1A 1XLKA 5FA5A 1K77A 4A8LA 3KBMA 1XICA 3CNYA 3KCLA 3TVAA 2QULA 2HK0A 3ITVA 3IUHA 3JU2A 3NGFA 1XLBA 3M0YA 3N4AA 3ITOA 3LMZA 4EAYA 3CQJA 3QXBA 2NQHA 4GLEA 2OU4A 3UA3A 3XINA 3FVMA 4HGXA 3U3HA 3KCOA 4DVOA 2X7VA 1I60A 1A0DA 1XYBA 3BANA 3CWHA 4QDWA 4X60A 5J8LA 4Q7IA 3UXIA 3ITXA 3QC0A 5TNVA 8XIAA 3BZJA 1XLGA 3M0MA 4QE5A 3P6LA 3C0LA 4PGLA 5B7ZA 1XYAA 4HHLA 4X63A 3KWSA 4X61A 4DUOA 3UVAA 3M0XA 1XLIA 3XIMA 1XIHA 1DXIA 1XIFA 2XISA 3IUIA 1GW9A 4QEHA 5H1WA 5EMKA 1XP3A 2ZVRA 4LNCA 4K1GA 1XLAA 3QYSA 4QDPA 6XIAA 3ITLA 1DE6A 4YTUA 3AYTA 3C0SA 3GNXA 3KTCA 3KBWA 3L23A 4QE1A 3C0QA 5EMJA 3UU0A 1S5NA 4US6A 4A8IA 3KCJA 4GQBA 2J6VA 3M0HA 9XIMA 3IUDA 3QZAA 4W4QA 5XINA 1XLJA 4ZB0A 4XKMA 3KBSA 3VNLA 1XYMA 1XIEA 1OADA 4PFHA 1XINA 1XYCA 5XIAA 4OVXA 4XSMA 3M0LA 3DBNA 4XISA 5AVNA 6XIMA 2QUMA 1XLDA 5I7GA 4E3VA 2NQ9A 2I56A 5XIMA 2QW5A 3WQOA 3M0VA 3KBVA 4YTQA 4QE4A 4EACA 9XIAA 1MUWA 2G4JA 5EMMA 8XIMA 3UA4A 2GYIA 3BZGA 3AALA 3KBNA 7XIMA 4A8NA 2G0WA 3BDKA 4YTTA 1XIIA 3AAMA 5AVHA 4ZB5A 3VNKA 3KBJA 5B7YA 3DX5A 1QUMA 2HCVA 1XLHA 3VYLA 3VNIA 4KW2A 1XLLA 1DIEA 3ITTA 4HNOA 2GUBA 2GLKA 1XIDA
chains in the Genus database with same CATH superfamily
4HOZA 4Y9PA 3T81A 1BQCA 2PDNA 1PL9A 2B7QA 4Q3MA 3F2BA 1KXVA 3Q2DA 3TJIA 1X97A 4UCGA 3ITCA 4KFNA 3WY1A 1MNZA 1UB3A 2XFRA 3GU9A 4KWOA 3LHWA 5C54A 3R43A 1EJUC 2QUTA 5E6YA 5FJIA 2QCHA 4B5TA 4DEFA 1AL8A 2ZUSA 4ORMA 3SBFA 1FOBA 3MT1A 1IQ8A 1RCQA 1J0HA 3ITVA 3JS3A 4IIHA 3IGHX 3WQ6A 3HBLA 2XVGA 4EOUA 2EGZA 1XL9A 4PTMA 1HF6A 5SWUA 4IPNB 3V0UA 3O0KA 3AMLA 5J8LA 4BI5A 3O6CA 1XRVA 4C6MA 1LBMA 4RX0A 2PLMA 3QKZA 3GO2A 2XGZA 4FPSA 1HL9A 3DC0A 3RRXA 2Y4SA 4Q4QA 1F4HA 4GVIA 2QCNA 2DH2A 3EOSA 1DJQA 3W07A 3QZAA 3M5YA 4UUIA 2WSYA 1G01A 1GOXA 3PJUA 4C6JA 4PZVA 4U10A 4Q6JA 4EACA 1XRTA 3BOXA 2D0HA 1JPKA 3WDHA 3I4EA 2VENA 4HK5A 4QDMA 1TKKA 3KBJA 1E6XM 9CGTA 1I2NA 2YL5A 1YADA 3DHUA 4GFIA 1AMKA 1CENA 3KHJA 1QPQA 1CLKA 3OGVA 1SR9A 4HD5A 3L2MA 4XAZA 3LXCA 3N2BA 1W3TA 4EPEC 3APTA 5I3IA 2DZAA 2FQIA 3TNOA 2OZ0A 3V0TA 4FB7A 1VP5A 3T0DA 1UUQA 4O50A 2FDSA 3GUGA 4M82A 3AIUA 3PBGA 2ZE0A 4MPKA 3SCUA 2PDGA 3C61A 2A21A 3CZJA 3K4DA 2A6LA 4QLLA 1C92A 2VELA 3PZVA 1W9VA 4MWAB 2GGGA 5E0FA 5KTLA 1TSIA 4DWDA 1KBIA 1PV8A 1OIFA 5LKYA 1N8WA 2NVDA 4UR8A 2YZRA 3GIYA 2TRSA 4PBGA 4WIWA 3NVTA 6TAAA 4HU4A 3STEA 3MCNA 5ABFB 4CCDA 2YR1A 3TLQA 5E09A 1RUSA 3TU9A 3TAKA 4QCFA 1K8CA 5XIAA 1XKYA 5GJNA 5LIKX 2BLEA 3LN3A 4QR6A 4UR7A 4E38A 3NIYA 2ZWZA 3QBUA 4AWSA 1F74A 4GVHA 5D2TA 2PTZA 4IQDA 4L7ZA 5FESA 3CK5A 4LC6A 1PEZA 4NQ1A 4PSPA 2WMGA 1TV3A 2C91A 2DSZA 4QEEA 4IL0A 3B97A 4XTIA 1XBZA 3WNLA 1OK6A 3EMQA 3ARUA 2VJXA 2XIMA 3EMCA 1YBQB 1JDDA 1MI3A 2FPYA 1E72M 1E1FA 1JF5A 3T4CA 2OFJA 4HPGA 3ITOA 2OQLA 3MPGA 4CVWA 3AHYA 2IQTA 2GSHA 3W01A 2CITA 4QSFA 3TSBA 1XD1A 1RR2A 1HKIA 3EWUA 1AA1B 4DYJA 2Q09A 4HQVA 1MQRA 1YXYA 4HHPA 4O1CA 3FJNA 3BSHA 4GX8A 3TN3A 4FR6A 3TKFA 3OLIA 1MFVA 3DG3A 4Q8MA 3KOZA 1FXQA 7REQB 2W67A 3HJEA 2BGQA 2JF6A 1W3JA 1TQXA 3TFXA 3A47A 3QPEA 1VFMA 1V0MA 1TG7A 4RE2A 1L6WA 4S3CA 4I7UA 3U5UA 4CN1A 4W85A 1Q65A 1WQ5A 1BTCA 3HB9A 1GOWA 4AVNA 4DUWA 1TUFA 4IZGA 3EWCA 1ZPTA 4ZSUA 3B9OA 3PR2A 4ZBCA 3K4AA 1W1B1 3M0IA 5BRPA 4I6KA 5I6SA 2D1ZA 4LOCA 1TR9A 4B16A 3OZOA 3O8AA 3KOXA 1TWWA 1WKYA 1J18A 4KEUA 5A8GA 2VEMA 4A8RA 3IJDA 4HN8A 3D0CA 1EGMA 4BF9A 3TQPA 3KCLA 1E0UA 3UF9A 5A6AA 2XIJA 1WOAA 5CSRA 2D2HA 4NSBA 3W28A 1NWSA 4CCCA 3UWWA 4YCPA 3MCOA 2CC0A 1NEYA 3WLQA 3WDPP 2VC7A 1B4KA 3T07A 4NASA 4UTKA 2G3JA 2WVVA 3B4UA 4PR4A 1VCVA 5I06A 3R7MA 4MWAD 1PZ0A 3WJXA 3CHCA 1MDLA 3AIVA 1DE6A 5CPTA 4PTNA 1K9DA 2QEZA 4Y8FA 1SZFA 1FWFC 1EJRC 4DBDA 3G22A 1HP4A 1O7AA 3ZSSA 3CZKA 1GTEA 2G4JA 4DYEA 3WNPA 5J5RA 3G1SA 4JTJA 1XIIA 1PAMA 3PUEA 1V8EA 1IIGA 1SO4A 1ZAJA 2BSLA 1QOQA 2GSEA 3VM5A 3FJ6A 1F3XA 1GHSA 2DW7A 1XBXA 1U1UA 3HU7A 5A6BD 4OE7A 5F1UA 3VOGA 2Y0FA 1UR8A 5MHBA 1O5XA 3VCRA 2OG9A 1JAKA 3UVIA 3WBWA 1SUXA 4XSLA 1Z69A 3NJ3A 3WMCA 2Z24A 2FVMA 3N3MA 1XLEA 5FJJA 5AY7A 4DNHA 3WQ8A 4F2TA 3SQMA 3LY0A 4W89A 1K8XA 3TC6A 3DFSA 2IKHA 5EU9A 4OFCA 1X6LA 1IXNA 3VNYA 5I02A 1J79A 2HTMA 3L4XA 2ESCA 1PZ2A 2AKMA 5IHSA 4TO8A 1CZ1A 4C6KA 2HROA 2EPNA 3AROA 3VOIA 2VTFA 4IGHA 4S39A 1TELA 3VKBA 1TPB1 2VC6A 4QDPA 3GWQA 1EXPA 3TROA 2V5JA 1KCZA 3H4WA 3PNUA 3B03A 4US6A 3O3RA 3C52A 4PODA 3CUZA 3MO4A 1S3TC 2FLIA 1QNQA 1VENA 4NZCA 4J3XA 4XSMA 2D2GA 4ADSA 4MB4A 4LF2A 5AYXA 3ZT7A 2ZZ7A 1ZBVA 2WO5A 4NJGA 3VIJA 2YYTA 3VUPA 4YVVA 4MNJA 4JN8A 3IK2A 3N6JA 3IJ9A 1NOFA 1YYAA 5HMFA 4X9YA 4ZO9A 1O5QA 3W71A 1GW1A 5AHMA 2NXGA 1P6WA 2DIKA 2J4GA 4NZ5A 2XYLA 5AN7A 2E4TA 5EKYA 4JQ1A 2PRHA 2XIIA 5AC7A 3PF3A 1BYAA 2YDQA 2Z00A 2AL2A 2PDXA 1OWQA 4Q4MA 1IEXA 2BOFX 3GG1A 3T2PA 4J3ZA 4O53A 4RZBA 3P8JA 4UIOA 4ENLA 3ITGA 4PMDA 1VFTA 4NNBA 5IXEA 3FDGA 4X60A 2WMKA 3CGTA 3C0LA 4AY8A 1J93A 3UR8A 1FH7A 1FH8A 3EA1A 1TZZA 1GNXA 4RZ4A 4GZJA 4UTHA 1TPWA 3RLVA 5HATA 3GKFA 4H6KA 4WXZA 4ERGA 1BKSA 1WBHA 4PEEA 2VQUA 2ABAA 1BEUA 1OFDA 1W1VA 4GKLA 1GYLA 7TAAA 3PY2A 2WCAA 4W87A 4FZIA 1I0BA 2WNNA 3GDBA 4AMCA 2ZXAA 1DBTA 3GNPA 4IGMA 4R27A 1L2QA 4GZ7A 2CBIA 1IZJA 1UKQA 4ZEPA 2E77A 5D05A 3RG6A 3BLLA 3BO9A 2ZX6A 1M9HA 4V1YA 4J2MA 3B8WA 4IIFA 1US3A 4LUTB 4CNNA 1IXOA 2EEXA 3P14A 4FXFA 3F4DA 2VZVA 1LLOA 2VCCA 4DAFA 4FMVA 3LXAA 3EA2A 3MQTA 4I7WA 4IGNA 2IXUA 2P5NA 3WENA 3QGKC 3GRIA 4V27A 3W29A 2W9MA 1QRQA 4F8XA 1QVBA 3OU8A 2E09A 1R86A 5T26A 2R9RA 2VRKA 3RHGA 3TUUA 1CGXA 3UFYA 3GXFA 2GQAA 1P0KA 1C8QA 1A4MA 3E3HA 4P7RA 4C6PA 2NLYA 3P61A 1RQBA 4BWLC 3C86A 5DT7A 4M3PA 3FAWA 3NEVA 1IEWA 3C6CA 4ATDA 1RPXA 3PB2A 5AHIA 1Q4NX 4QNEA 4PMXA 1J2BA 1VYPX 2VOTA 3KOYA 4KW2A 5CGTA 3RFAA 3TOPA 3VDCA 2HISA 4DO4A 1ADDA 2QUNA 3PB0A 3FDKA 5HUOA 3UR5A 3CL8A 1YMYA 4AZCB 4B5NA 3QH2A 2HSAA 5DX7A 1FKWA 5LNUA 3LCHA 3NQCA 1UZ1A 3W84A 1K77A 4M0XA 2OOFA 1WXJA 1Z8AA 1GVFA 3IUHA 4JPGA 3S1VA 4O15A 1QFEA 3EPOA 4JTGA 3UZJA 4BEQA 4Q6XA 3V0SA 1JCLA 2ZXDA 3WLOA 4NF7A 3GW0A 4KH2A 4C6EA 5TF0A 2VC5A 4AYSA 3AIBA 2CHOA 4A3YA 2NUWA 4XZIA 1TPVA 3N2TA 1QASA 3UYCA 5LNVA 3UWUA 3AJ7A 5CSSA 2X2YA 1S5WA 5LSMA 3GFXA 3D47A 4NZ1A 2DQXA 1R2SA 3WYZA 1P7TB 2Y7DA 4GXPA 3MZNA 1GT8A 4N9BA 2YX0A 2ATSA 5BROA 1B90A 1B31A 2CZFA 2AL1A 2OGYA 5C2GA 3IJ6A 5L9FA 2FZDA 5KITA 1J10A 3WD1A 1A5BA 3RLGA 4EK7A 2VO5A 1DIOA 1W5QA 4E2DA 4Y7EA 4B5XA 2G3MA 2C1GA 3W53A 1QBBA 1WKEA 1DIDA 4X3ZA 3S1WA 1UW9A 4JL1A 4AD5A 3WO8A 3H21A 1SW3A 2ZZ4A 3PPCA 3MMTA 4WXYA 3W37A 3W7IA 2QR6A 4HSNA 4OBRA 1PIFA 3E9AA 1FHLA 4JIRA 3KRUA 3MKCA 4LC8A 5LA1A 5BU9A 4BQ4A 3H2NA 4MTVA 2NWSA 3S9ZA 3R25A 1MW0A 3WF0A 5IFPA 1TFVA 1KKOA 1W5OA 2A3EA 2O7SA 5I24A 1OCNA 3WBYA 1ECEA 3UZYA 3S5SA 3V36A 3SCOA 5IDZA 2I7GA 2W27A 3KAOA 3DYOA 4JTEA 1JZ8A 3EDEA 1HVXA 6REQB 4GQBA 3EPNA 4S38A 3RPMA 4F0MA 4JYEA 4LUSB 1GJWA 1XSIA 1VPYA 2OZ8A 3WD2A 4EWND 3SQLA 1ZGDA 3ANUA 2Z0IA 4E3VA 1E51A 2AOSA 1VBJA 3LU2A 2I1OA 3VKJA 2Z6JA 3ZWTA 2OO0A 3NQAA 2WLYA 3G24A 3GHUA 1IT7A 1L2UA 2UV8G 1X39A 1W0MA 1HJWA 3PJXA 3DXIA 3LENA 4K3ZA 3E38A 3VC5A 1XIGA 4YS1A 3CAKA 5FF4A 5BU6A 5G2HA 3KBMA 4CNUA 4KIEA 3BV4A 2I9EA 2OEKA 3T55A 2OYMA 3BQ5A 3TC7A 1UH2A 4AIEA 3URBA 4Z2IA 2FHFA 1P7TA 3E2VA 5C2CA 4H9TA 3SJNA 1F8MA 4LAOA 4INFA 4R9OA 4LNCA 2J7GA 2HBVA 1KFEA 1CXEA 2GQ8A 2WBKA 2C14A 4KEZA 2Z1SA 1ZHAA 2FTWA 3S4TA 1QHZA 3WQCA 3BE7A 1QWGA 3N2MA 2WANA 2VGBA 1H63A 2G41A 6ALDA 3PZIA 5HWNA 3MI6A 3LSCA 2NVAA 2ICSA 3OPSA 1LF1A 5AOUA 2WLZA 3OTRA 4IMAA 4JNMA 4FNSA 1FWCC 3R8HA 1PO9A 5FSEC 3PVFA 2PEVA 2O0TA 5A2AA 1NM9A 3UZ5A 3F2DA 1OZMA 2Z26A 2HE8A 1QPKA 3MKVA 1PSCA 4HA1A 2JFEX 4ZQNA 3E0IA 2QDDA 1CECA 1THFD 4ROPA 5F2LA 3NNTA 4MG4A 3BJSA 2Y5JA 1HVQA 4D6JA 2ALDA 3WH9A 3GVGA 1LDCA 3APYA 4BJHA 4L6DA 4AIOA 1LWHA 2I5GA 1HGWA 1XYZA 2IXVA 2OKOA 4W7VA 2E40A 1AJ0A 1U1HA 5G4WA 2YB1A 1KFWA 2C7FA 4C6LA 3MB9A 3JUGA 3QC0A 1M3UA 2BV9A 1WXZA 3TQVA 3KXQA 4Y9AA 1KFKA 3B8IA 4IFKA 3RRAA 2VR2A 3NQMA 1E3ZA 5FAGA 3HQPA 3AS0A 3GNRA 2PDFA 1GEQA 3H70A 4QE1A 4JYFA 1W9DM 2OQYA 3QMRA 4U5IA 3STFA 5I09A 4JXCA 3A3WA 2XM2A 3KBSA 3BMWA 3W00A 2WNZA 5HOSA 4MM1A 3U57A 1AG1O 3BSGA 1WNOA 3T8QA 1YBQA 3FCPA 3B0UX 2FGBA 3KRSA 1KFBA 1R8LA 3LQLA 5DELA 1VEPA 2VURA 5AZ0A 3PTQA 4Z1YA 1ZALA 2CIPA 2ONEA 3C8FA 2O9OA 5LNWA 3NQEA 1Y5VA 3VABA 4D1IA 1UC4A 2HE5A 2REQB 1W37A 3PPFA 1NDYA 1BF6A 2W63A 1JVNA 3I7QA 1XFCA 3LZ3A 1ZP4A 1WV2A 4WY0F 3TJLA 4Q8WA 3MSDA 2WAGA 1PZ3A 4OU1A 3GH7A 3WQVA 2FB2A 5M3WA 3SRDA 1LLWA 2WVTA 1TJPA 4OUIA 3N17A 4QITA 4IXHA 4RPPA 3O07A 5F1VA 4TIMA 1LL4A 2ZTJA 5D02A 3OG2A 3AYRA 5C55A 4MFEA 3C4UA 4J9JA 1S2WA 4NG3A 4GIRA 3ITLA 1TTIA 1GQJA 4HOXA 4HA0A 1J12A 3UG4A 1QNSA 5A1AA 4WGHA 3QQ0A 2Y5EA 1GWJA 1TV2A 4O1DA 2OSYA 3ID7A 3UNTA 3LHTA 3EWXA 1OYCA 4MZYA 4HMDA 3W22A 3GG7A 1R3YA 1WB0A 4NY2A 3DU0A 4YXGA 1CDGA 1ECQA 2WHKA 3GNOA 4ZA0A 1QPNA 1RJRA 3PFRA 2IKJA 2I9UA 3ZWSA 2OZTA 4BI6A 4RCXA 3ZR6A 1G4PA 1UWTA 1UH4A 1Q6GA 3CUJA 3MANA 2DT2A 3CHVA 3MP4A 1GJUA 2XIBA 2QDGA 1RD5A 1X1ZA 2PC4A 4O8AA 3EXTA 1K7FA 1TQJA 2XGBA 1TVLA 1PYMA 4RL3A 4C90A 4XVEA 3GXTA 3EBVA 4XQ6A 3W1NA 2DIEA 3WELA 4IG2A 1U22A 3ORWA 3LHYA 3VGHA 3SCRA 1OFQA 2VZTA 4E8CA 3PZNA 3ZT6A 4E2OA 4A6GA 1TIWA 3ZFHA 1JYNA 4FXRA 4GABA 3CNYA 3V16A 4V33A 3OVGA 1WDRA 3KZSA 1UWUA 3WSUA 3LTPA 3CL6A 4LQ1A 1TPEA 1SMAA 2CXGA 3JR2A 1AW1A 1F61A 3Q37A 2GOKA 2VR5A 1FDYA 4E8DA 1JNDA 2E67A 1VBUA 1V7YA 4WLCA 1OD8A 4LU0A 3NCOA 2YA1A 3K8KA 4Q22A 4UTWC 2X30A 1O4UA 2GUUA 2QVNA 3PANA 3ICJA 1IEVA 3GM8A 1HO1A 1E6SM 2ATMA 1H2JA 1ISXA 3M43A 4ZB0A 3MZ2A 1PDYA 4KWVA 4GKTA 3VO0A 1RH9A 4REQA 1O95A 1TTPA 2YL8A 2VDHA 5C9UA 5BZAA 3G6MA 1A5KC 4JIPA 1VPQA 4LB3A 5K4ZA 4QJ1A 4O52A 1DHKA 2NLIA 1NQKA 2XWEA 5DBTA 3QGAC 3MBDA 3W86A 1ZNNA 2PTDA 3BCFA 5FIPA 2YSWA 3EWDA 3ZYZA 3WZ0E 1SFSA 3AYVA 2WM1A 4S3GA 4G2DA 1KR0A 1LUCB 3ZJ7A 4WSHA 3MDUA 3EX4A 1U5JA 4WKAA 4IMGA 1JPIA 1F4AA 1QW7A 3V1PA 2UZ9A 4IHCA 1Z3NA 3SB0A 1LQ0A 5IM51 1NWUA 2Q02A 3ZLFA 1ZCCA 5CPSA 2ISDA 3QV6A 3RJYA 4GYJA 2NX9A 1PX3A 3G77A 2OT0A 4PCPA 1Q6FA 1AJZA 3MWCA 1AVAA 1EBHA 3ABRA 4LVBA 3RM9A 3R4IA 3S5OA 4C5ZA 5M5DA 3N6QA 2XSAA 2CXEA 3UGRA 4AUBA 2AQOA 1KBBA 4JTFA 3BZJA 2BXZA 4W8LA 1EEPA 3BXWA 1EL3A 2E5CA 4U2ZA 1KBKA 1D3GA 5A8NA 4O28A 1CT5A 4NYUA 1MQPA 4GQ0A 1MVYA 4I8YA 5G2IA 2P10A 4V28A 4CNOA 3VPLA 2DY3A 3WCZA 4LEQA 4LUYA 4IQEA 2X40A 2ZUMA 4XBKA 3TK7A 4XISA 2J24A 3GB6A 2DVTA 2EG7A 3E0LA 3CZ8A 2C19A 5G5IA 4JGDA 5K4XA 3H22A 2ZDRA 1Z7AA 1BLIA 2NWRA 2O9RA 5CPOA 3W1XA 2BX7A 1QI0A 3KLLA 1WDPA 3BL3A 1IHIA 1A5SA 1ZQ5A 3TZFA 3OOQA 2TMDA 3MUY1 1X7IA 1GEHA 4HHHA 1HJUA 1OY0A 4AZ6A 4BI7A 3TW9A 3LEPA 5KZEA 3BJTA 3VA8A 4P8XA 1MNSA 5EA9A 3N12A 5C9RA 3IAPA 2WSKA 1GVRA 3A24A 4UOQA 2W66A 1JFHA 4L1XA 4FA3A 1JPHA 3S5ZA 1WDQA 5HJXA 2PSNA 4C6CA 4EIVA 2MNRA 3CPRA 1MYRA 3AHXA 3EX1A 1ZCOA 3CQJA 3S2NA 4GIYA 3S47A 1OFAA 3SCNA 4RUBA 2GZXA 4WKHA 4F66A 3HZ3A 4AX7A 1GVSA 1VJIA 2ON3A 2BS9A 3R8RA 1JDFA 3SFKA 4XUYA 2JIEA 2Z25A 3KFTA 4KETA 2PURA 5FEWA 4HU3A 5K9DA 5EMJA 4YYCA 3NO3A 2BGSA 4AZCA 1KFCA 4URIA 3HPAA 3VGBA 1F6PA 3QM3A 4TVCA 1XYMA 1W9UA 1XYCA 1P0EA 1I9CB 3ISIX 4PH6A 5ABHA 3C2RA 1KNWA 1HKWA 4QHRA 1HX0A 3GH4A 1E0XA 1KM6A 2V82A 3E6EA 1XLHA 3GQYA 3HJZA 4ZL1A 4LNYA 1LBFA 1DE5A 4A22A 4B4FA 3W7PA 2TPSA 3NPVA 3TYEA 1XCFA 4WEVX 3O9NA 2X1UA 1YXDA 3UWVA 1PTAA 1DQUA 1SZGA 1C29A 5G2WA 3SRHA 4QRNA 4GXMA 3XISA 3VZXA 4O1EA 2PDWA 4WF7A 5HK4A 2XN0A 4ML9A 3QLDA 1KXHA 3BK0A 2W61A 2VT0A 5F2MA 1H5VA 3G6LA 3D5HA 4LCRA 4CD8A 1E9YB 3ABSA 5C7VA 3E96A 3H7VA 2BP1A 3H2EA 2PDMA 5H8MA 1VQTA 2NT0A 3CUXA 4EPKA 5D2VA 3EWYA 1XLAA 1P48A 1E5JA 2EG6A 3N11A 3NFUA 1D9EA 3SUVA 3B9AA 4WRHA 4L4OA 1BRLA 4XKMA 1MZRA 3RCNA 1M7PA 3R0UA 4JTAA 3UJSA 4ZZ9A 3H26A 2GJPA 3NM3A 4YVXA 3V18A 4RDWA 1FTXA 4AF0B 4S3KA 4LAKA 3FA3A 4JZ5A 1DWGM 3U48A 3LERA 3P93A 5AVHA 1R0MA 1F76A 3CHFA 3DN5A 2FMOA 3NXFA 1FCVA 3NZQA 3N2CA 2HXUA 2PPGA 2PMQA 2DV0A 4QISA 3BOLA 2INFA 4K36A 4DO5A 1DHPA 2OSXA 4X9SA 3C3UA 3N04A 2XU2A 3FJ4A 1WDDA 3EZ4A 2J7CA 3VXGA 1D8WA 1GGOA 1CB2A 3V1HA 1R46A 4N2YA 2J6XA 1B1YA 1QNOA 1TPUA 1HO4A 1RV8A 1I1WA 1J0ZA 1A49A 5C7HA 1UWQA 3KL3A 2WJFA 4ECLA 3MV11 4H19A 3GKAA 4H9UA 4R3UA 4U5KA 2W6RA 5DY2A 3CPUA 1H1YA 2EJ1A 2J88A 4TOQA 2PZ0A 2PBOA 1EXBA 3RXZA 1WDSA 4MNMA 2HRWA 4OGZA 4LTSA 4M56A 1G4SA 1FWHC 4MJ2A 3H12A 3FKRA 4DX3A 1UPMB 1NARA 3M0VA 1CB7B 2V67A 3EPMA 2G95A 3AALA 1OK4A 1V08A 1VRDA 2GL5A 3T78A 4GIAA 3I6EA 2CPUA 4C1NA 2CZ5A 3OLEA 3TXVA 4WOZA 3HTWA 4Q8QA 3LOTA 1I75A 4YTRA 4Z1CA 4HZ6A 2PTWA 3UPWA 2OELA 3DFHA 3NPUA 4LUTA 5H8PA 1QT1A 3GXPA 2PDCA 2UBPC 1JZ6A 5JUVA 5G1YA 3LMYA 4CNPA 4DZIA 2PWFA 5G1TA 1C90A 5LXXA 3PWIA 3OJGA 4EXAA 3DEQA 4LGXA 6ENLA 1Q8JA 2FKPA 4TX6A 3SURA 3VDBA 1GQIA 1IZCA 3SN0A 4UNLA 5CAKA 1BGAA 4D6EA 4RV3A 1QXLA 1AH3A 3WLLA 2XIOA 5FL0A 3BANA 1QOPA 3W7JA 3PAJA 3AZTA 2ZBTA 1FWWA 4K6AA 1B3VA 4FOUA 3LPPA 4XZWA 1C7TA 1UR4A 1DJYA 3PTDA 3W88A 3L66A 3PBWA 1J0YA 2E5BA 4L9ZA 5C9WA 3VI2A 3CHDA 5A6JA 1Q7MA 2X0HA 5AHFA 1TREA 4CU6A 3R13A 3I7RA 4H8UA 4PTVA 1A5OC 5D30A 4GCAA 3O16A 2ZUVA 4XO6A 4MUPA 1VZWA 3HPXA 4FXJA 2ZX5A 4M80A 4NI8A 4W5ZA 2EPOA 3IJLA 2GJXA 4G7EA 4S3AA 2HS6A 3QR1A 2GWGA 2DZSA 4BWLA 4Z2KA 2GSJA 4LY8A 3LS9A 2CBUA 3W4RA 4B3ZA 1UD6A 3TYCA 1OHLA 4NNCA 1PBGA 1B3YA 4KF1A 4ZFCA 2P1FA 3M7WA 3QMSA 1CX9A 3FGCA 1KV8A 5F2GA 3DENA 1WZMA 2WMIA 4KMQA 4M6VA 5CEWA 1XYFA 2X8RA 4HPHA 4B2DD 4JX4A 1XS2A 4IIDA 3RUBL 1YNQA 4IM4A 5FAJA 2Y2WA 1TV8A 3N9SA 2BXVA 1FWEC 4DB7A 1VEOA 1DXIA 2WOQA 1YDOA 3N19B 4GC4A 3U2EA 5GVJA 3UJRA 3MVTA 3BLFA 4HOWA 2WPGA 1EEXA 1NSJA 2VX6A 4IMEA 4W86A 4LT9A 3NWRA 4MZ1A 3SRFA 1KB3A 4Y8EA 4D8AA 4QQ3A 1EHAA 1VRXA 5I3JA 1GORA 4WHBA 3IRSA 2D3NA 1A3HA 2F2HA 1PIIA 3CV1A 2G3FA 5BXPA 4AD0A 3VGFA 4DXKA 2HV5A 5F7UA 4QE4A 3VZZA 5GPRA 2FTPA 3BAJA 5HAOA 2NV2A 2VEFA 3VGEA 1NWTA 2EBNA 2X1SA 2YA2A 5CG7A 1Q5MA 3K2GA 2ZZ3A 4CLMA 5GJMA 2XM1A 2BB0A 2X7WA 4DZAA 2Q3RA 3WNOA 4HHMA 2REQA 3TTYA 4FLRA 1SW0A 1H1NA 3QJAA 4EPDC 4O4WA 4IJBA 1NDZA 4S3BA 3VNZA 4ZQRA 2JALA 1A0EA 4MKNA 4GG9A 4JTDA 1OGSA 2YFNA 2ZA3A 2F2KA 3WH7A 3REQB 2R1PA 3BLEA 1KRAC 3I6RA 1X1NA 4L6HA 3CZEA 3DFYA 1CGYA 1OX4A 1PE1A 3W7RA 2X42A 5DQPA 4X63A 2XTKA 4LF1A 1UROA 3H23A 3DYMA 3L2IA 1PJ9A 2YXXA 5ABTA 3CPGA 4IIGA 3MMUA 2CKRA 1LLZA 3BICA 3TAOA 6CGTA 1BG9A 3LV6A 3T2QA 2HDJA 2YCLB 1Q3NA 4KGJA 2QCEA 4YTQA 4U3AA 2A7PA 1H62A 1UKOA 4JHOA 3FYOA 2IS7A 5DCEA 4WDWA 1HJSA 2C0HA 4HSHA 1H51A 3T0TA 4HNLA 1WZKA 4MVAA 4DUXA 3HV8A 5FJPA 4NRRA 2NSXA 2DJXA 3S83A 4Z2GA 1UPPA 3CS2A 1C8YA 4H7ZA 3K4WA 3DHPA 1VPXA 4OV4A 1P6BA 2CETA 5FJTA 3MP5A 1DJHA 3M16A 1CTNA 4NI3A 1ZTVA 2O9TA 3WLKX 4OJYA 5F4SA 5CPNA 1Q6CA 2DZPA 4E4UA 3V75A 4UTUA 3OBEA 1RBOB 3WMSA 2CLOA 3T9PA 3B40A 4NHVA 4LPCA 2A4AA 4ES4A 3MHUA 1IR2A 2X0YA 3VDAA 4OOUA 2QPXA 1BG4A 3GBDA 4AISA 5FF3A 1XI3A 1XRFA 5AC5A 3V3WA 3DGBA 5D2YA 5AHNA 1T41A 4B5UA 2GJRA 1M6JA 2WK2A 5LYRA 4C5YA 4ZXOA 3NQ7A 3THAA 3KCJA 3ATZA 4NAEA 5XINA 4US5A 3RAOA 1RSCA 3ZO9A 2FDMA 4WY0B 3K30A 1UOKA 1Q6DA 3TYDA 3WH8A 3KBVA 1KV5A 3UP8A 4QG6A 3EB3A 3LSBA 1CYGA 7XIMA 4PTDA 4C60A 3R0KA 3VNIA 4M7SA 3W82A 2BY1A 4H8HA 2RJHA 2VR4A 1Y5WA 1LZOA 2CLHA 1SZRA 1TPH1 2HXTA 3ALFA 4LS2A 1I6NA 3NOYA 5HPOA 3DHDA 2ZFAA 3EEGA 1S2AA 5C9XA 3IJ8A 1HZYA 1XC6A 4K68A 3TV8A 4UQAA 1P0NA 4FLQA 2WZMA 3L2LA 1M7XA 1TX0A 1V6WA 2R1KA 3HF3A 3PM6A 1ZY9A 1FUYA 4MIMA 1VEMA 3NVDA 4DWSB 2TYSA 1I60A 3BLKA 1GG1A 3R12A 4PMOA 2IPGA 4C6IA 2ZKMX 3MSYA 4N9EA 2YZ5A 3RIKA 1WKFA 5H91A 4UQEA 1B2YA 2YCJA 2PDJA 2E1WA 3H55A 4FK9A 2DH3A 1UR2A 3UD6A 4L65A 5C71A 1OCBA 4LBUA 4H4IA 3OA5A 4BQ2A 2W62A 4CU8A 1FCQA 1L6YA 1ODUA 3EKGA 3DECA 4RNFA 2Y62A 3LDVA 4CQ8A 4KWSA 3AYSA 3M46A 1TTJA 3POHA 4I6VA 2A3LA 2QT3A 2XH2A 3ZJKA 1P0DA 1B57A 1F7BA 1VHCA 3PAOA 2WKLA 2VX7A 4J4KA 1PTDA 3LM7A 3P2VA 4AD3A 1I2RA 2DZBA 3AXHA 3DIPA 1DWAM 4ZOAA 4YTSA 3W85A 3B3DA 1LP6A 1NP0A 2E25A 1UUMA 4HNVA 2QCMA 1H49A 1XSJA 4E0CA 3NQ2A 2JIWA 4W5UA 3S9IA 4MKSA 4RDYA 4E2BA 2A3CA 3SSJA 1KM1A 5TIMA 3T0CA 1LYXA 1JNEA 2WHJA 5I03A 2GJXB 1UJQA 3ZQ9A 4MDPA 4DBUA 3ZOAA 1T7LA 3C8NA 3KS6A 3IGSA 4X0NA 1VH7A 4W7WA 1EC8A 4UBPC 5EFFA 4H6QA 2WCGA 3V5OA 3SN1A 3N4EA 1J0JA 1W3HA 4Z2HA 3WD4A 3W75A 2CZVA 2GPTA 2BOGX 4K7YA 1ICSA 1U5HA 3P84A 4KESA 4XVDA 4YWIA 2H6RA 2J8GA 4GWEA 2VUNA 2WZIA 3M0XA 4ZE4A 4QEHA 4RZ6A 2IPJA 2O92A 1E6NA 3AOFA 3C0JA 3L67A 1JIBA 3L12A 4FNUA 5KEZA 2DDXA 3SI9A 4AEFA 4A8IA 2HQAA 5CGQA 3B8DA 3J7HA 5LIUX 4F9JA 4K8HA 1EF2A 1TA3B 2CNCA 3U7VA 1R7AA 1BSLA 3GH5A 3BG9A 2C8NA 3CIWA 2QF8A 5BXRA 1K8ZA 1R3WA 3WJYA 1JG9A 3CH0A 4XWUA 2Z1XA 1XDMA 5I3DA 2WV8A 4Q8UA 1AFSA 4UTTA 3OW1A 4PBEA 1OFOA 2A0NA 5EMUA 5D9NA 3BV7A 4MY8A 3VE9A 2Z6IA 4R5EA 4IX2A 3PBMA 1BRLB 3MDWA 1PS9A 3VOHA 3S2CA 2J25A 4M6QA 3VCCA 1GKPA 5CG0A 4CU7A 4R88A 3W24A 1V02E 4GC3A 4MJ4A 4BFAA 1DKWA 2VEGA 2W5FA 5EBUA 1CXLA 2Q3OA 3PN8A 2UWFA 4KCTA 4N4PA 4D6GA 2QZRA 5J04A 2E1DA 2X09A 3UZZA 4TMCA 3GK0A 3MO7A 1JDAA 2YJQA 2G3NA 4A2RA 5E9XA 4HK6A 1CGWA 3Q45A 4DF0A 4W9TA 4HPJA 3VOCA 2FFCA 1MMFA 4DF2A 5K2ZA 3LD5A 1KM5A 5D32A 4RXGA 1XLIA 3UYIA 2JGYA 3WDRA 4GCXA 1LL7A 4GYKA 3CUFA 2HPMA 3QYSA 3TNBA 3EDJA 4DRSA 5C2XA 3FYYA 3WJZA 3EB4A 4Y9OA 4NXSA 5DCDA 2Y88A 4LW7A 2BMBA 2JEPA 9XIMA 5LGZA 4X22A 4UTFA 3E74A 3LUTA 2GDUA 1W91A 4OVXA 3ZLHA 2WYSA 4XBJA 1PKNA 1AQMA 2FZNA 2R82A 3CIXA 1Q6EA 4TUFA 1W1PA 5CLWA 5K9XA 3VGDA 3QHNA 4FP1A 5LA2A 3E0WA 3DX5A 3DFOA 3KP0A 4C6OA 2X41A 2V2CA 1DOSA 2GLKA 1KBJA 2EKCA 4DJDA 3MSRA 2D69A 4LXFA 2V63A 1KLYA 1FWTA 1O1ZA 4WZHA 4AWEA 1SO5A 3N3TA 2OTDA 3R11A 3W7NA 4MADA 2H90A 4PL2A 4GUHA 4XIAA 1ONRA 5AYBA 1XLKA 4FIRA 5DXYA 5CZTA 4LAUA 1GKRA 1FWJC 4DLFA 3FVMA 1TPC1 1XD0A 3ARSA 4UOJA 1EF3A 3DHFA 3QZ6A 4TQTA 3G1HA 3GDRA 5TQLA 2V3GA 1W9XA 4QTGA 2ISFA 1H7RA 2P3ZA 3CMFA 5FF2A 1CWYA 1H7WA 2E28A 1TPDA 5DCBA 1H5YA 3T0AA 3LRMA 2OLSA 4HMEA 5FEPA 3DFPA 3B8TA 3RPDA 1VFUA 2QHAA 1O5KA 2ZICA 3CTLA 3HG5A 1YIXA 3W2KA 1SJAA 3WQDA 1VIZA 8CGTA 2P88A 4H01A 3BQ6A 2J79A 4PB5A 5AECA 2I5QA 4S3DA 5HPCA 5HNTA 4J40A 4YPJA 3KP1A 4GNKB 4YTTA 1S46A 1E70M 2V0TA 2PI6A 4MLRA 1Z42A 5M1TA 2ZTKA 4PA8A 3M6DA 1LM1A 1RA0A 3TTOA 2R1NA 3FA5A 1W1ZA 3U2CA 2ZX9A 3BSMA 3VX1A 2HEJA 4NU7A 3FXGA 1QO2A 1ZP3A 3O63A 1V7AA 4V1XA 1NOWA 3LYEA 4LFYA 4BF5A 1HQTA 1RBLA 3O6YX 2R6OA 3VIIA 1LJYA 2FH6A 4PSRA 1ME9A 2D2JA 2RGLA 4O1BA 1S5VA 3TN6A 2OPJA 1G6CA 3EB2A 2ZUNA 1TA3A 2FJKA 4EWJA 3I3EA 1W1IE 2VCAA 4F2BA 5TNVA 3KL5A 3MV01 4NAEB 3P6LA 3UG8A 3ABOA 4BA0A 1Y65A 1EX1A 4IICA 1NFBA 3CUHA 3E1F1 4JTSA 4UMCA 4XZLX 1EX5A 1N8FA 4JIHA 1R9XA 5FSDC 5HNUA 3PJTA 1UR0A 2IPWA 1P1XA 4XX6A 1K4HA 1W8SA 1XCXA 2WWDA 4GRSA 5HQLA 5TD4A 1OT2A 3BLIA 1UHVA 1KXQA 1GOIA 1PPIA 1QHPA 3HFTA 1G67A 4FX7A 3DAQA 2Z27A 3P81A 4UB9A 1F6YA 2E6DA 1CIUA 1XG4A 2XG9A 3GVRA 5A8PA 3G3MA 1E6QM 2ZQ0A 5CH9A 3CAWA 4JKMA 3H54A 5D8WA 2V2HA 5BYWA 1TE1A 4B15A 4DM1A 3UG5A 3QY6A 1UA3A 1UG6A 4JFUA 5E1QA 5HANA 3UXKA 4I3GA 5BOFA 4QS5A 2O56A 2XVLA 3LLFA 4UQCA 4O19A 1RJQA 4PUDA 1YKWA 1ZENA 3PSVA 3URQA 2OLAA 5HNRA 3SADA 3AU6A 4ZTXA 1IXQA 3IIOA 4MWAA 4U33A 5FOOA 5KSWA 4JQAA 2BHZA 2DORA 4UFLA 3FHAA 4W88A 1OYBA 4K37A 4JKKA 4JR5A 3TP4A 2EAWA 4ZODA 2VGGA 3G3DA 5BRQA 1TUXA 2DSWA 5T9CE 1G5AA 3VM7A 4HZ7A 4ZSTA 1JDEA 3RMJA 2OT1A 3TLLA 2PTXA 3HMJG 4JIQA 1X1OA 2Q6ZA 3L68A 2BHYA 4K7VA 4HJFA 1QNPA 2PCEA 2ZZ5A 3IWPA 2DVXA 5EGRA 3UG3A 1AL7A 1ZU8A 1LT7A 5HQEA 2RFGA 4S3FA 7ENLA 1G1YA 3EOEA 3HGOA 2HCVA 4M7TA 3ITTA 3ENLA 5A5WA 3NUKA 5AYZA 1EWDA 1IIHA 3T44A 3HQOA 4JQ2A 1UZDA 4MF4A 4UFKA 2XH4A 1EHNA 2PBGA 1HG3A 4JTQA 5DT5A 1OF8A 3VMPA 1CGVA 2BVTA 4NX5A 2O55A 1F8IA 3ZXWA 5DF0A 4N0RA 2H9AB 3M5VA 3DFTA 4NL1A 1OGGA 2BXYA 1WCGA 2OGJA 1F3WA 3PWGA 4A8LA 4AZHA 1E0VA 2DT3A 3UWEA 3LV5A 3BPWA 2DZUA 4XV0A 3L21A 4YWSA 3G8EA 2FTYA 3A3HA 3WLIA 4DNMA 3CASA 2BVYA 4E4FA 1GOOA 2XVKA 2ZRYA 2ZOXA 3LTYA 1CCWB 2VM8A 4DAIA 1JZ4A 2ZVRA 4PMRA 5DXXA 3SZ8A 3V5FA 2GDQA 3RMEA 1IZKA 4L56A 1J9YA 1GVQA 3GW3A 1JD9A 1QMLA 4ZMGA 5IOBA 4B5VA 3W7KA 5CZKA 1KFLA 1XLDA 1RVGA 1QW8A 4ATWA 1K9EA 1KRBC 4AWUA 3W26A 1SFTA 3BZGA 4A8NA 2BVWA 4HCLA 3AUJA 1XW8A 3VNKA 1IWAA 4KPLA 4IFOA 1O5RA 2PAJA 2A3HA 4UTWA 2OJPA 4UTJA 2BHUA 1EC7A 3BC9A 5H6HA 3GDMA 3G0SA 1AUSL 3OZYA 2R91A 3H7UA 3T05A 3W2LA 4DIAA 2VXNA 4JFTA 1XISA 5PTDA 3KVJA 3ZVHA 4TX9A 4GXWA 3SW6A 4AD1A 1RLCL 1YXCA 1LOLA 4IFKB 4JIEA 4JN6A 1XICA 1RZMA 3OGRA 4DI9A 4EAYA 1W5NA 4GQRA 5D9OA 2UY3A 4MUZA 4F3HA 2VWTA 4FNTA 3CIVA 2ZUUA 4A3HA 4D6FA 1J01A 4E6MA 4J7RA 3VIHA 1OC7A 4R7WA 3WNNA 2D0GA 1U83A 4C65A 3QQWA 3A12A 3EDDA 3CAQA 2IKGA 4L4MA 3KRBA 1E6RA 2UY5A 1OJXA 3PG8A 1UR3M 2ACSA 5CBJA 1L6GA 2G0WA 1GCYA 1D7KA 2H3BA 3MI2A 1RLDA 1QUMA 1BXNA 2VZOA 3MJMA 3VIKA 2FMNA 4OUEA 1HKMA 3AO0A 2J7BA 1YPIA 2PODA 3K1DA 4PUEA 2VKZG 1OD0A 4JFVA 4Q8TA 5K3VA 5CKSA 3N13A 1SPQA 4C6BA 3OP2A 4AD2A 2ZXBA 1KM4A 3OBKA 3CTTA 5A8OA 3K5XA 4HK7A 4AY1A 1F2JA 1GJPA 2DIJA 1R2RA 5A6SA 4LWWA 1ZZMA 2PUZA 2VRQA 3PZMA 2CERA 2J66A 5D38A 1HJQA 3S2LA 2Z4GA 2QAPA 3U8GA 1OFRA 2QIWA 3UY8A 1T0OA 1YQ2A 3RNDA 4NAFB 1I1XA 1W56A 1G94A 3ARPA 2ZA2A 1K70A 2YBUA 1A4LA 2OYKA 1QPRA 4G5DA 2QS8A 3RILA 1TJ0A 3ARZA 3W7EA 3UXDA 4HA4A 3ELFA 8A3HA 5CPLA 3M6YA 4UTMA 2H8XA 3W1TA 3W73A 3V35A 2V5KA 3PNZA 4HT3A 3UPMA 3GXIA 3P74A 1ICQA 4AW7A 3H4GA 2HBXA 4HIBA 1OABA 9XIAA 2V9DA 2D3LA 4A05A 3AMDA 4XAFA 4M6PA 3G1YA 1A5CA 2GQ9A 3GU1A 4TMBA 2D22A 2OEMA 1LRQA 1EUAA 1HJXA 1EZ2A 5E0KA 2OXNA 2ACQA 1X7FA 4RPQA 3RX2A 1I8JA 2C1IA 3TYAA 4QS6A 3LQGA 3C5QA 2BNJA 2Q8ZA 2NUYA 4HNCA 5GNZA 4I5XA 4XZHA 3UXAA 2E6FA 1C8XA 5FEXA 3AI0A 5IRPA 1JYVA 1NFPA 3EWZA 3IAQA 3USZA 1SO6A 3SR7A 4FX8A 1JJKA 2AGTA 2CWNA 4CKQA 3TVAA 3SFWA 1UKTA 2DVUA 4R85A 5CJ5A 3CO8A 1XDJA 4IF2A 2PDHA 4W84A 2ZA1A 2V5CA 1JCYA 4P7OA 4DJEC 2PF8A 3C56A 1XYAA 3W7GA 2NXHA 3RGTA 1WP6A 3RR4A 2NVCA 1QR7A 2AMGA 5HINA 2YIHA 1KA9F 5HJYA 1U1JA 3IUDA 5A94A 3PZQA 1FQ0A 2IQ0A 5HA7A 3LK6A 1ALDA 1OVDA 1OCQA 4B91A 1OINA 4MY1A 1FHUA 4WCJA 2PLKA 5FJOA 3GTNA 4JCLA 1EJSC 4ACYA 1EKOA 2F9RA 3HO8A 3NL6A 2E5DA 3GDTA 2J7HA 3Q94A 4GO8A 2OX1A 1PKYA 3RCYA 4J2PA 3CT2A 2PFHA 3W2MA 3FFSA 2XIQA 2YBTA 4LCSA 1SZNA 2C3ZA 3VMNA 4DUVA 3LBCA 1JZ3A 2WKGA 3ABQA 3VK5A 4UZSA 3MUZ1 4FNPA 3AMCA 1HXJA 3WFAA 1V93A 3KOFA 2O7QA 2E7FA 2RDUA 3GDKA 2DU2A 4GFSA 1A5AA 1BGGA 3QY7A 2A3AA 4A29A 1KC7A 4ZENA 3B9NA 3THQA 3LZ5A 2VCBA 3PTMA 4DWSD 4XG1A 2Z1VA 3TQKA 2YLLA 4A35A 3E0VA 4GGHA 4S2BA 3O0FA 4CD5A 6XIAA 4HBKA 1UBSA 2BY3A 1RXOB 2DT0A 3QMTA 3FA4A 4F0RA 5BRBA 3O06A 3VD9A 3G0UA 3DKLA 3PZGA 1QI5A 3MBFA 3W6YA 5G1MA 4IT1A 1LG1A 3T6CA 3MYPA 3QTGA 1B3OA 4GUFA 4LYKA 1NIUA 3W1RA 3UA4A 1C9WA 1QNVA 2OR2A 2YFOA 5T9BG 4H6EA 4FSAA 3F7JA 4DZHA 1DEDA 1E40A 3GFZA 4AG0A 3HGRA 1EDTA 3B9EA 2PGEA 2JE8A 4IUGA 4DM2A 2QMKA 4PCTA 3CHEA 1VLIA 2FFIA 2W91A 4O0QA 2ZADA 1F07A 1EPXA 3WUFA 3ITYA 4PULA 4JICA 1V3LA 4RNIA 3IJ7A 3FVDA 4L6OA 3L4VA 5CAHA 1K9TA 4WJEA 4YYFA 4UZUA 4NNAA 4AF0A 3ERPA 3UESA 1AW2A 3TXZA 2YGYA 5BOEA 3UBPC 2QF7A 4O8RA 4O1AA 1UBPC 1P1MA 2XZ9A 3FSUA 3SUSA 1VGAA 1QOXA 1XGEA 1OX5A 4B4HA 3LPGA 3IIVA 3BW3A 3B4YA 1GVEA 3C2OA 3PBYA 1X8FA 3Q58A 3R8GA 5KETA 4JTTA 1XIHA 1E71M 1XRSA 3I7SA 2E8YA 1E55A 2EPHA 1LL6A 2ISVA 4Z08A 1M68A 3GBEA 4GI9A 3NA8A 4D8ZA 2Y7GA 3GX9A 3SCSA 2PLCA 4P7QA 4UMAA 3GTIA 3HQNA 1L9WA 4GVGA 5CC7A 1YDNA 3W3OA 3RJXA 2QW5A 4Q8PA 2CHNA 1MUWA 3GXDA 2GYIA 3UCDA 2GOUA 4DJDC 4HVXA 2V6AA 4KEMA 4NXKA 3ARRA 1J2WA 3LM3A 4V15A 3THDA 1UOZA 1L8PA 3LCFA 4DN1A 1J6PA 2G5WA 1MRAA 2PDKA 1EZWA 3WEZA 2DP3A 7TIMA 2Y85A 2VI0A 3GNDA 5LGXA 3EWWA 2PDPA 4ACZA 1E4LA 1WOBA 1WUFA 1XQKA 4OWGA 3GFYA 3WEOA 4ERAA 4LSBA 2VC9A 2AKZA 3L5AA 4JOMA 2AMXA 2XFWA 4I5RA 5CC5A 1HP5A 1JEZA 4UFHA 3UNDA 3SCVA 4D8LA 3I3BA 1UIOA 2V5BA 3F4CA 2WZTA 4OOZA 4XZNX 5CJNA 4WDTA 4S3JA 3P5YA 3DUGA 4YCOA 2XH0A 4GH3A 3VTRA 1FBAA 4PMQA 1PDZA 1V3JA 1MXDA 2PWHA 3WLTA 1JF6A 5DRIA 5CBBA 4JNZA 5LHEA 4JTUA 1E1CA 5CZJA 1GVOA 3TW6A 1FX6A 1JGIA 3CYVA 3F4NA 1POJA 4RE3A 1UD3A 1ITQA 1A5LC 5EMYA 4CNTA 5IHRA 4JQ3A 3EXSA 4QJ3B 4ERIA 3L0KA 2KX9A 4ZVJA 4KRZA 3PZUA 2FH8A 1M1BA 1B3WA 1ADOA 1VB9A 3L0GA 1XJBA 2V81A 2VMFA 3KM8A 1GYMA 3WFZA 1XLLA 2DSUA 3QHMA 2Y89A 3F5JA 3AWOA 5K9CA 1VCFA 1ZJIA 4C7FA 3ARQA 3W23A 3HURA 4Z1BA 4AQLA 1PCWA 4ZE5A 3CC1A 3WDJA 4GJJA 4B92A 1F6KA 3BUVA 5A2CA 4ATLA 3BWWA 1A0CA 4MFDA 4NT0A 2VFIA 3HG3A 3MTWA 5IBXA 4O11A 2RUSA 1PUDA 5FL1A 5BWAA 1ONEA 3UA3A 4KBXA 4H1ZA 3FGCB 1W9PA 2QGHA 2Y1HA 4ONVA 2E3ZA 3FN9A 4UFMA 4O1FA 3N73A 3TSDA 4OV9A 2PTYA 2ZXQA 3WBXA 3NQDA 4D9PA 1JFXA 1VIWA 3KL0A 1DJXA 2VZUA 1VHNA 3GUWA 5H1WA 4E3TA 1B0IA 5HMSA 3W7DA 1OX4B 1RQHA 4RXFA 3C0QA 3WK1A 3EOLA 3W6LA 4IX0A 3L5MA 3H8AA 4J28A 3K46A 3NQ8A 4E4PA 1XIEA 4TR9A 3UGVA 3JVAA 1VC4A 4M51A 5A2BA 5BNKA 3N18A 5EMMA 3CU2A 2PDUA 4V2XA 1GVYA 2ACUA 1KGXA 4J27A 2ALRA 1F9CA 3AS3A 3AICA 4FI4A 3T0BA 3E5BA 3OB8A 3TWBA 4DO7A 1MDRA 2PWUA 2IQDA 2QGYA 3SO7A 2RAGA 3LCGA 3NO5A 1PB0A 1UIPA 2J9ZA 1Q2RA 1ISZA 2WSQA 3PBVA 3CH9A 1FFQA 4ZOEA 3L4YA 3RX3A 3W83A 5I3GA 4HMNA 2J7FA 3BW2A 4AB4A 4C7GA 4YHGA 2Z2AA 4N9CA 3AWNA 3NPXA 1GQNA 2QJGA 3UETA 3W70A 3W74A 4WGXA 1IEIA 1P5BA 3N1AA 3N4AA 3HMCA 2VVSA 3TCEA 1EWEA 4N4QA 2VDGA 3W81A 2OU4A 2NQLA 3OEXA 2VQTA 4CN6A 1I45A 1M04A 2DZTA 2FVLA 3GR8A 8XIAA 3WLHA 2E0PA 2PGWA 3NQGA 1R2TA 3RO6A 1CLVA 1XP3A 3WMBA 1SSGA 3ARVA 1ZFJA 3FW6A 3S1GA 1V6TA 1K1DA 3AIEA 2XDFA 4D6DA 5MKGA 1I4NA 3HPFA 3R1ZA 1Z48A 3VE7A 1H7PA 3KEHA 3QKEA 5MF5A 1BVNP 3L4ZA 3VDHA 4QAWA 2CLLA 3HPZA 3CZGA 4GYPA 1S3HA 3R58A 4OT7A 4CQAA 3GYCA 2WC3A 3CL7A 4R34A 4H83A 4FF7A 3RYSA 3WL1A 1L0PA 4DHGA 1WZLA 3ONBA 4RZ5A 2PWDA 1E43A 3WEMA 1SQ7A 1BYDA 5E93A 5AZ1A 2PCQA 3NTYA 1JCTA 2GK1B 4CCZA 1EP3A 1CXIA 4I90A 1EO5A 1RALA 3A3XA 3T8LA 1C93A 5JU6A 2CW6A 4D6IA 1XC4A 2BDQA 3BGJA 3MHFA 4AC7C 4JDBA 3KDOA 5I5RA 1L6FA 3E49A 3EX2A 2WW5A 4P2VA 1NWRA 3UEQA 3U4AA 4AX6A 3U3HA 1LTDA 3OGSA 3QFWA 1A0DA 4UNIA 3AFBA 4MAZA 7CGTA 4RDZA 2AGKA 3TQ0A 3WLRA 3A9BA 1H7XA 3DCPA 5TAOA 4AXKA 1MO0A 4KRUA 3THCA 4PE8A 5I3FA 1RA5A 5ECUA 5CZ0A 4IGSA 3L23A 1ME7A 2QYGA 4KFOA 5EFDA 2QCDA 2ZX8A 1FWIC 2PU0A 1J5SA 2ZC8A 1JZ5A 3LPFA 2CBJA 1E0WA 5KINA 2QIIA 3HIJA 2FPTA 2JF7A 2WPBA 4J3TA 1BHGA 2GWNA 5TBOA 2UY4A 2OEJA 3WF1A 2QJIA 4PMUA 2OSWA 3NSXA 4QCEA 3O1NA 2POTA 3EDKA 4I9TA 2PP3A 3T09A 4D71A 2Z2BA 4HMCA 4C91A 2EF9A 3KZPA 2CESA 1VLWA 2XFYA 4GUIA 2EQDA 1EO7A 3OVRA 2J75A 4LX4A 3I6TA 4KIRA 4N7QA 3BG5A 3QV9A 4N6EA 2W92A 4YMZA 3BCDA 1PHWA 4CN4A 4HGXA 1E1CB 2HNHA 4CUCA 4DXVA 1QI2A 5GQBA 3RLHA 3B8VA 4EP8C 3DERA 1Q7ZA 1XF0A 3B04A 2JK2A 1HKJA 3KWSA 4QG9A 4C7DA 3AXMA 3LA4A 4OECA 1GW9A 5EMKA 3KW3A 2YXGA 4HNTA 1ESWA 1D7FA 3GTFA 3UXLA 4UQDA 3IRDA 1U5VA 2J8FA 4RNJA 2ZX7A 3BCJA 4R33A 1NTHA 3TEVA 4JX5A 1TV7A 3KVLA 4DBWA 3P67A 4AVFA 4MOZA 4F0SA 3AMGA 1F3TA 3N9RA 4CD7A 2DUAA 1EOMA 3VIGA 2PP1A 3DKJA 1ITCA 3SUTA 1C9DA 2FZ8A 1TVPA 2CLMA 3P5ZA 4IQJA 4WKFA 1ZJBA 3VDGA 3FIGA 3GXNA 4ZQOA 1R3SA 1R85A 4GX9A 1DWHM 1QU4A 2XN2A 4A3UA 1H60A 5LA0A 1XLCA 1OF6A 1A5MC 1IGWA 1JULA 1NF0A 3CQIA 1JZ7A 1NH6A 5D9PA 2XUCA 3KS5A 2C1HA 2G3IA 3FJLA 1H7OA 3BG3A 4IWWA 1CXKA 3B8UA 3OZMA 4RJEA 2YA0A 4QX4A 4NJIA 5AHLA 4QLJA 1KCXA 1LOSA 1H0IA 1Z89A 1H61A 1SU5A 1D2KA 2GQ3A 3H53A 3VAVA 3AIRA 3W7HA 1NVMA 3MUCA 1SVDA 4WD0A 4GE8A 2FYMA 3EGJA 4JX6A 4LY4A 4G8TA 5ABFA 2BTMA 3BAYA 2HS8A 4DJEA 1B30A 3M41A 2C16A 3ABXA 2WMJA 1UH3A 4MYAA 1O12A 2OODA 4JFSA 2VZSA 4LJ3A 3BAIA 1QK2A 4CCEA 2FGZA 3EKZA 3PPGA 2YYUA 2XSBA 5AC8A 7ODCA 4HSOA 1VFSA 3NURA 3M0HA 4GNJA 1SFLA 2QJMA 4I9JA 3LCIA 4L64A 2QPUA 3ZJ8A 2ZUTA 2NZLA 4H04A 2ZC1A 1YE4A 3UQNA 3LGDA 3EA3A 1FXPA 1SJCA 1EYEA 4MAVA 1RK6A 1V5XA 1XIDA 5E70A 3WK0A 2Q01A 3VVGA 3AZRA 2WMHA 1KGWA 2OWWA 2YW4A 1CNVA 3ARYA 2H3DA 1UWRA 3MC5A 2WB5A 2PRMA 1SMDA 3WQPA 2DPEA 1QO5A 1Q66A 3NQVA 3THUA 3W7OA 4PUMA 1X6UA 2J27A 1QDSA 2CU0A 4CQCA 4AXNA 4NZ4A 3FSTA 1DORA 2WM0A 4H9VA 3H2CA 1Q63A 1X98A 5HR6A 1R3TA 2C6QA 4GVFA 4AFYA 1EQCA 3CWHA 2J8TA 4A3QA 2V2DA 3GC2A 2NW0A 4HHLA 2VFEA 4B5WA 3E02A 4H9ZA 4HN4A 4PBFA 4Y6GA 4MJMA 1RPKA 3I3DA 3OA3A 1ZBCA 2OWCA 1TJ1A 4A21A 2D0FA 5JQ9A 3VMOA 2GUYA 3TOYA 1YNYA 1UR1A 3DI0A 4W4QA 2OWXA 1RCOB 2V69A 5T91A 4H9MA 3ARTA 5CBIA 4G1NA 1DTUA 2BVDA 1QPOA 1G9HA 3G18A 4K39A 3GG8A 4WSJA 1H09A 4ILSA 1C91A 1MEWA 1UASA 4QGCA 3S6TA 3V4BA 3O7UA 1O6IA 1RBAA 1IT0A 3LPOA 2JGQA 4IH3A 3RITA 1DJWA 5D37A 5C0QA 5REQB 3H24A 5CPQA 2EPKX 3NQ6A 1G0CA 1S2UA 4G56A 1K7EA 4JL2A 1IF2A 5A6BA 3NG3A 1S5MA 2GGHA 3VD7A 4Q8VA 3MMWA 4M1BA 2VGFA 4RE0A 1XLFA 4MSSA 3WLNA 5BMXA 2OCZA 4X2PA 5HMDA 1ZAHA 3R6IA 3UZXA 1PX8A 2VFDA 2CFFA 4UQ9A 5JVLA 5DMYA 1QNRA 5DO8A 4Z1AA 4LYPA 4QIUA 1UQZA 2QULA 1LQAA 2Q71A 2G8ZA 3WLMA 1TRDA 3B0XA 3POCA 3R89A 2QCDB 1XUZA 5HJLA 1J4EA 4ORIA 3UXIA 2WKJA 1YDYA 5CSYA 2WCSA 3GXMA 3WF4A 2F61A 2GJNA 4JTRA 4CEXC 2CHRA 3WQEA 3KBWA 2HPIA 4BKNA 1DXFA 4GZIA 4NX0A 3EYPA 1UP0A 4DZ5A 1NFGA 5AVNA 4H9YA 2DZWA 3E2QA 2POZA 3D46A 3HM7A 5I07A 3QN3A 3HG2A 4Z0JA 1V03A 4QQUA 5AYIA 4EF9A 2D24A 5EPDA 4IMFA 2JKAA 4O17A 4XAGA 1HL2A 2J47A 3B06A 4LALA 2QQ6A 2ZVIA 1TWIA 3P60A 2PGRA 4PUNA 1SSDA 5AB3A 4AZIA 4HPNA 4AZ7A 3S46A 1BYBA 1PXGA 3WF3A 4IJRA 1AH4A 4GZEA 1IYXA 4JFWA 1ENUA 1PKMA 3ATYA 3OHIA 3A4XA 1G4TA 4IP7A 4IIBA 3UCQA 1C3FA 4XZMX 3E12A 3JU2A 3RO8A 1RAKA 3LMZA 4L4LA 5GNXA 1WX0A 1VYRA 4XTDA 5I78A 1K8YA 5DANA 4UC5A 1JGMA 3BGGA 1OC5A 3IEBA 1M41A 4F48A 1G69A 2YOCA 4DUOA 1SW7A 1ISWA 3IUIA 3TYBA 2TODA 1R47A 2QPSA 2HVOA 1W54A 3C3NA 2Y8VA 4GD0A 3F5LA 3GTXA 1V02A 4GK8A 1M53A 3LXBA 1BF2A 3IJQA 2CWXA 3TN5A 1Y5XA 4CQBA 3SRKA 4C6FA 2I56A 4TU1A 3FEMA 4FS9A 1HN1A 1V3KA 1BWVA 1UP2A 3L4WA 1AK5A 4OBTA 1IT8A 2GVYA 4KRTA 4DO6A 4J1OA 5C9ZA 1XHGA 2DQWA 3N14A 3UWYA 3HGJA 1JDCA 3AIQA 4CQ9A 4JTIA 1KM0A 3NDZA 4LB4A 5I3KA 2FB3A 1ML1A 4MB5A 5C8BB 2F38A 5A8MA 3FHQA 4HYWA 1UKPA 1FWAC 3H7RA 3YPIA 4WQ6A 4ZQPA 2RKXA 4PEKA 3DFNA 1ZBKA 1V6VA 2YW3A 4PTXA 4U2YA 6TIMA 2OYLA 4LV9A 3ZVHB 1VR6A 4ZR8A 1YW1A 1NOUA 4JS3A 3DH7A 4KS0A 4GOAA 4TVDA 3CLMA 3QOKA 2WZHA 4B2DA 3C2EA 2PS2A 1X96A 1AZ2A 4HP5A 4MB1A 2XH7A 3W38A 1E73M 3KDNA 1OX6A 4B9YA 3HG4A 1XH2A 2VX4A 3S1XA 3P80A 3M0LA 4AIUA 1UP3A 2AL2B 1W3KA 3C2FA 3NQBA 3E2RA 3A22A 2WVUA 2Q8XA 2PRLA 3R5EA 1HFBA 2PD5A 4XO7A 4K8GA 3B9DA 3GC5A 1ZAIA 4Q33A 2XFFA 4CVUA 1EYWA 3LI0A 4KEVA 3JZUA 2PDYA 2NXIA 3K13A 5AC6A 2VYOA 1SZEA 5LXEA 2VEKA 1J6OA 1S5TA 2HVNA 3PPHA 4Q8OA 3WH6A 1DIKA 4GGBA 3CWNA 2QCFA 1YPXA 5I3HA 2DEPA 3WLJA 1MW2A 1UD8A 2O4QA 4YN5A 2HNEA 4FLOA 1XYLA 3PZ9A 1F5ZA 2A2IA 7PTDA 3IVSA 4P8UA 1NDVA 4PMVA 1XLBA 3CM4A 4HTYA 3SEPA 3TN4A 5ECVA 4HTBA 5K7JA 3LCLA 3O15A 1XBYA 3BMXA 1KD0A 4AHQA 4HU0A 3GYEA 4LBRA 3P0XA 2B0MA 3AS1A 4H8VA 5D09A 4TTGA 1RD6A 2VDIA 3GHSA 3T08A 4FNRA 4IOTA 3URNA 4R9XA 1H3GA 1ONXA 3GNXA 5IDIA 3F2CA 5HXMA 4L9XA 3LG3A 1Q85A 3GR7A 3M5XA 4MMWA 5I23A 1KTCA 1JL8A 3DBNA 3ANVA 2V68A 4MPQA 1TPFA 4LUJA 4D2JA 1FY6A 2IUZA 7A3HA 1R38A 5DRCA 3G5EA 4LBSA 4WY0A 4YLWA 3WN6A 5A6KA 4Y90A 2O9PA 2QVHA 2TAAA 4O0ZA 3IPWA 1FP8A 2FVKA 1EIBA 3AMKA 4XBSA 2DJLA 4Y96A 3ZZ1A 2NV9A 3AXKA 4AZ5A 3SSZA 4I5UA 3TW7A 4ZXLA 3N2OA 3AUOA 3MP3A 1UUOA 4ZOBA 4O4VA 5I77A 3B0YA 3JRKA 2Z7KA 2PF0A 4FOJA 4NZFA 3WLSA 1ADSA 1GVIA 3QRHA 5HDRA 2P53A 4PFMA 1DP0A 4QDWA 2R94A 3NPWA 3LB0A 2FJUB 4P5UA 1N82A 3NOEA 3TZNA 1GTHA 4JTLA 4QBXA 4XD3A 4ZCWA 1VYSX 3QEZA 1AMYA 3CWOX 2Y6ZA 2V38A 1V6XA 1FHDA 3SCQA 3QF0A 3TWAA 4G6CA 1UMLA 3M0ZA 4NVTA 2QUVA 1BKHA 3INPA 3VIPA 4Z42C 1QI4A 3NZPA 2PWGA 3BAKA 2OQHA 5DEZA 1V3HA 3WQOA 4HZMA 2WMIB 3EXRA 3CMGA 4O16A 4Y9MA 1BYCA 3BDKA 3MVIA 3PZTA 5B7YA 2J7EA 1E4MM 4PCFA 3GAKA 5HBFA 1HKKA 4L1GA 1W8GA 2D73A 3AJXA 3TA6A 5JBEA 5EY5A 1VBHA 3STPA 4Q4RA 1KM3A 2XWDA 2YLAA 3WDIA 1EJXC 3ZIZA 5FI8A 2ZRZA 2A7NA 2W79A 2CLIA 2XN1A 4EVZA 3BTNA 4LVDA 2PGFA 2DUZA 3RR1A 3R0DA 3TA9A 5JIWA 2WC4A 5CC6A 1U33A 1EJ7L 1EA0A 1KGUA 1JYXA 1FKXA 2NQHA 3BMVA 3HN3A 1MUMA 1GQLA 3KCOA 1I2PA 3QSTA 6REQA 1Q6LA 3FK4A 4HNUA 2X7VA 1GHRA 1KTBA 4Q7IA 3ITXA 1P43A 5CSUA 3MS8A 1OIMA 3RF9A 1IWBA 4AEEA 3FY1A 4GJ1A 3ZMRA 1Q8AA 3LHUA 3VCNA 1X8CA 1J11A 1EB3A 3TJ4A 3URAA 3P8IA 4TXEA 4C6QA 1JXJA 5IFTA 2E8ZA 4AHPA 1Z44A 4QROA 3OVPA 1QK0A 1HL8A 1R9ZA 1W5MA 2GJLA 4F40A 4EF8A 1V6UA 2HZGA 3PHAA 1VFHA 3VKCA 3I68A 3MSGA 4KT2A 2XPKA 3VILA 1XQLA 2IPFA 2NSOA 4BZYA 3HPSA 5E0CA 4FNQA 5H2ZA 2CKSA 3T4WA 4LRSA 5FKYA 3GG0A 3KE0A 4ADUA 3BURA 3NL3A 1UR9A 2J62A 4FO4A 3QFEA 3VKDA 1NQ6A 4HU8A 2J7DA 2YCKX 2OVLA 1MWOA 3NR0A 4AZBA 3OIXA 1O94A 1XH0A 2WHLA 1KWKA 4J3WA 1BXCA 2QKFA 4AMAA 4FHAA 4XAYA 4PCNA 5CXPA 1YDVA 5LIYX 3S2MA 1FDJA 5AHEA 3QV8A 2VWSA 4KCWA 1DYSA 4JD4A 2GDVA 4M24A 1ODZA 2Z1KA 4LVAA 1OB0A 3QHOA 2WJZA 3UJEA 1E3XA 4BF7A 4CGTA 1V6YA 3RN6A 5BOOA 1G7VA 3TCSA 2MANA 4MHBA 4X61A 5D2WA 2PWVA 4M6UA 2ZUWA 2KZHA 3HGSA 4IISA 2VX5A 1GOKA 1OG0A 1NAL1 1XM3A 1SYTA 1S5NA 2YXOA 2RDWA 5I2UA 2R14A 4NUWA 1L6SA 1R6WA 4AHOA 2BODX 4RLIA 3L0NA 1UMYA 1V3IA 3MWAA 4G1KA 2OX4A 3PJWA 3TH6A 1Y7VA 2V3DA 3EWBX 2FHCA 3RU8X 2ODOA 4LEFA 2MUCA 3P7YA 4HCDA 4TVUA 3LCXA 4HYVA 2FGLA 5M17A 2VOMA 1E9LA 4JAWA 1E0TA 4RV8A 1CW2A 4GPNA 4B90A 1HGYA 1GZJA 1O68A 1A5NC 1R30A 4AC1X 2VFFA 3VD5A 2UY2A 3RM8A 4WUIA 3WL0A 4WJXA 4NYYA 3A6OA 3I10A 4MYXA 3SCTA 2Y63A 3M4HA 3FLUA 1V51A 4Q7BA 1RQEA 2INEA 3MHGA 1BFNA 4GQGA 3CMJA 3PUDA 2HK1A 1H1ZA 4PUWA 4YIWA 3TR9A 3G1XA 1WPCA 2CZEA 3PSWA 1PHQA 1VFOA 2PA6A 3M44A 1KQYA 4XAPA 3T2OA 3IVTA 4F0LA 4U28A 3W1MA 3M9YA 3DOPA 3TYUA 5JBFA 1AQHA 1R9YA 3TE9A 4PGLA 1T6MA 4H7VA 3MW7A 4NJHA 3PK7A 1OC6A 3PULA 4GYPC 3OQEA 2B7PA 4CNSA 4P8WA 2F84A 5FJRA 4E2VA 1WBJA 1AJ2A 3GSMA 5REQA 4DBEA 3CJPA 2GVGA 2VFHA 3DBPA 4OIFA 3AYTA 1QBAA 1L8NA 3UU0A 1AD4A 4JTCA 3FAXA 3CV7A 4IUOA 2VEPA 1R3QA 4NRSA 1FFRA 4LCQA 4QP0A 3TSMA 4PB4A 2QMJA 3W1UA 1W5PA 1EP1A 2ISWA 2WJEA 3GNNA 4KQNA 3W2NA 1JUBA 1FWNA 1JPMA 4WJ8A 4KFPA 4N42A 4EPBC 1US0A 1QCWA 4PMJA 4QM1A 5E9AA 1MSSA 2W3ZA 1M01A 1WUEA 6PTDA 2NUXA 3QLLA 3W87A 1Q45A 3LBOA 2CLEA 2I17A 4DJFA 4LUSA 2P8BA 2TSYA 1GONA 4GHRA 4BQ5A 1SR0A 3IIXA 1W3LA 3FX4A 2WXDM 3ONCA 3NZGA 2C71A 4CD6A 1QTWA 5FJUA 2Z7GA 2WJDA 1BXBA 2E6YA 2VD8A 2I57A 1UWAA 4WDUA 1EJVC 1TX2A 5KZDA 1M7JA 1OBAA 2JKEA 8TIMA 2HK0A 1ZBWA 3TFCA 1LROA 3ARWA 1FCUA 1HKVA 2ACRA 2CLPA 2RDXA 4U31A 3M0MA 3W02A 4J3VA 4XK2A 4DBSA 5A6TC 3S0CA 2WQPA 1AQ0A 4G7EB 3KUMA 2RHGA 4HPXA 4K1GA 4F0HA 3RLUA 4MGGA 2B7OA 3W6MA 3QPZA 3KTCA 1WDWA 1E6ZA 1J96A 1MXSA 1RY8A 3RX4A 1R5YA 1E6PA 3EAUA 1CBGA 4NZ3A 1VJZA 2QDEA 1E4NA 2ZWYA 4CQDA 5I0DA 4JDYA 4O18A 1N8IA 4IPJA 1ZB5A 3RCMA 1Q2SA 3QPYA 2XGIA 2B81A 3S42A 1ZRQA 1Q7QA 3HOJA 1VAHA 4AEOA 1FRBA 2X1IA 5I00A 1XFBA 2CEQA 1CGUA 5IBXC 3CLWA 2OB3A 1EC9A 2Q8LA 3U0HA 5G4HC 1KCKA 1M5WA 4L61A 1JXKA 2V30A 3OQ8A 1W2PA 3GDLA 5D2XA 1LORA 4MNLA 2QAFA 5A8QA 4JY8A 1T8XA 3SGGA 2CLKA 1U2YA 2XINA 1F05A 2LLEA 4IPPA 3TC3A 3SQSA 4R7JA 4NP7A 1OFBA 4Z2LA 2IW0A 3VU2A 2P50A 1ZLPA 4AD4A 2C79A 3A5VA 3ZM8A 2FHBA 1UYQA 5ABEA 2Z1WA 3BARA 4I9MA 1PX4A 4PYSA 3N9KA 3SIZA 3OBAA 3ANYA 4MB3A 2V5LA 2YL9A 4M29A 3WQGA 3JZEA 3ZT5A 3L7RA 3GY1A 3WBAA 2ZRUA 1FWBC 4O14A 2G37A 3GE7A 1MFUA 3VOJA 3W2JA 3GLCA 2QXWA 3G1FA 1MW3A 1B3XA 3A21A 4EE9A 1OFEA 1TO3A 2FZMA 1S2TA 2J6VA 1NF7A 4DWSA 4PRWA 1KRCC 1BAGA 3GHTA 1B3ZA 5CGMA 5FCZA 4RNHA 4PN2A 4ZQCA 2F6UA 1OM0A 3QOMA 1TMLA 1TR1A 4N6FA 1GPWA 1UQYA 2DW6A 1KLZA 3DC8A 4AY7A 1DV7A 3LI1A 5JXQA 5DY3A 5GJPA 1CEOA 3DYPA 1XCWA 3PWAA 4NJKA 2FZ9A 2Z29A 3WH5A 1DXEA 1W1A1 4GBDA 4XD6A 3S5YA 2XVNA 3GZ3A 1MW1A 1AQFA 3PUOA 4M5PA 2ISSA 1Z9AA 2ZZ6A 4DLMA 3DGRA 5B80A 3NZRA 3QQ1A 1E5NA 1XIMA 3KHDA 1OT1A 3SCPA 1JRCA 3NGFA 4GY7A 4S2CA 3N15A 5ENLA 4Z2JA 3OYXA 2GGEA 2P0OA 1HUVA 3TMQA 4IQLA 2BY2A 4MWAE 3N4FA 4M8UA 4PB3A 1OFPA 2J9XA 1ZUAX 5B7ZA 3TIMA 3BW4A 4F2UA 3AHVA 1U30A 3W7LA 2VNCA 3SY8A 3IGXA 4PMYA 2BWGA 3DZ1A 4MY9A 5JMUA 3IIPA 4H2HA 4HZ8A 1EGZA 3CB3A 4QNWA 3A4JA 1XLJA 1WAWA 2V3EA 4R7OA 2PZNA 5D03A 2C13A 5A95A 4IXXA 2WBGA 3WJSA 3OODA 3VFCA 4UNKA 1FWGC 5DMMA 1UD5A 3U5YA 3F5KA 1TVNA 3AZSA 5DMLA 4TV6A 2X1TA 5FACA 3IVUA 1BVWA 3GAYA 3G1DA 1LCOA 3UPBA 5LHFA 2E9LA 1GKQA 1DVJA 4FXSA 4D6HA 2QNEA 3E0FA 4DJED 4O12A 3UJFA 1KR1A 3VIOA 1GK8A 3L5LA 2Y7FA 4UFJA 3VOFA 2NQJA 2Y24A 4N02A 5FA5A 4YL2A 1QJWA 4GO9A 4TV5A 1DQWA 3VKKA 3WQFA 2ZIDA 2OLHA 3ME3A 4OKDA 4EXQA 2NX1A 2E6AA 3M64A 2XZ7A 4JTKA 3RU6A 1NJJA 1V0NA 1TWDA 4IPIA 2ADAA 3L9CA 2P0IA 3H6OA 1TIMA 1UWSA 4EAMA 2QJNA 2PU1A 3AHTA 4HNNA 2IMRA 1YTKA 1YTEA 2YPIA 4Q32A 1WA3A 2X05A 1R7OA 3N6HA 3ECQA 3T40A 4PFHA 2YDAA 3VIMA 6XIMA 2QLYA 3A13A 4RK8A 4IL2A 1Q6QA 2DFAA 3AHZA 2DSVA 4ZQMA 2YCEA 3R79A 1EPVA 5FF0A 1EH9A 3CUGA 1W31A 3U9IA 5DBUA 2X16A 3P82A 5KMYA 4PMZA 3CQ0A 5BCAA 4M19A 2Y8KA 3QTPA 4P61A 1OSEA 1IE7C 5BW6A 4QJ5B 4JCMA 4L5ZA 1XIBA 5HNNA 4A2SA 3OZPA 2ZRWA 5CQ1A 1VS1A 4AZGA 4Q7NA 5KZMA 1J5TA 1A47A 2QV5A 2ZCGA 2JEQA 3MJYA 1EGVA 4UCFA 1W3NA 3QW3A 3B0PA 2I14A 4O54A 4AVOA 2VEIA 1T40A 1TCMA 4RDVA 4IIEA 4QJ4B 1IWPA 2I5IA 4ICCX 3N34A 3P62A 4ASTA 1SFJA 4R53A 1VCGA 2NT1A 1VKFA 4UTIA 4GY0A 5M03A 2A1YA 3WFLA 1BTMA 3COTA 5AKQA 2BG5A 3OHMB 1TZ7A 2DT1A 2WSPA 2VGIA 4LYRA 1ITXA 2P76A 4BY3A 5A69A 2G4FA 3VNLA 1B4EA 3LRLA 1AODA 3LNPA 3P0WA 2F7FA 2PLJA 5C5YA 4ICMA 3M7SA 1ZS2A 4S1FA 1S1PA 1IV8A 1QW9A 1Q4WA 3G1VA 1EBGA 2JBMA 4M1RA 4Z1DA 4EXBA 4J35A 4Y9NA 3HFYA 3WBEA 4MWAC 2Y70A 4IG2B 3T7VA 2EO7A 4HB7A 3F4WA 2FIQA 1EJWC 1TMHA 1GZGA 4WDXA 4AIBA 3BLOA 4GMEA 2PB1A 4H2CA 2E9BA 4W93A 4DPPA 3B05A 4J3UA 3T42A 1UD2A 5JBDA 1JI1A 2ZDSA 3IANA 1T5AA 2A79A 4DY1A 1AW5A 1GG0A 1G7UA 3ES8A 1VBRA 2BY0A 3U7BA 4KCVA 3UJ2A 1ZJHA 5AFDA 4UTLA 4RW3A 4AH7A 1YTDA 4GI6A 1WXYA 2J78A 4DPQA 1Z41A 1WZAA 1DJZA 1LOQA 4XKYB 3UVAA 2DGAA 1W1YA 3SAZA 1UCWA 2XISA 1VF8A 2X1RA 1PTGA 3AS2A 3E2SA 1XXXA 4O57A 1R3RA 3G0XA 2JQXA 1JQXA 5L6UA 1LWIA 3JW7A 1C8VA 2DSKA 2ASHA 4XZBA 3SUWA 1G4EA 3ZLGA 1OADA 5HR7A 1TMQA 4KKXA 1CXHA 3AXIA 4NJJA 2Y7EA 3IIZA 1K02A 2GGJA 8XIMA 2AAAA 3S6DA 4Q4SA 3UERA 3WK2A 5LNRA 2A7RA 4DJFC 5ABGA 2NX3A 4JY9A 2D2OA 1EUNA 1NELA 3VYLA 3S5NA 2HJPA 3OLDA 2R24A 3LLDA 1KO0A 5FF7A 1K6AA 1BPLB 1EDGA 5D8ZA 5CJMA 2WNQA 3AC0A 1D8CA 3KLKA 1TWZA 1C7SA 1I2OA 3GVQA 3NEHA 1OQFA 3WLPA 1TRIA 3IV3A 3CQHA 1H41A 1JAEA 2WVSA 4ZB2A 3EKLA 5D4YA 3SY1A 2H8ZA 1PWMA 2QV4A 1YX1A 3W1QA 5HQMA 3F4VA 4TTUA 5LIWX 2VP8A 3DFQA 1N7KA 3D3FA 1ME8A 1M65A 1PYFA 4PRRA 4WK9A 3OO2A 2ZRXA 1TJRA 1QHOA 1DL3A 2EHHA 4XUGA 3EOUA 4XD4A 2ANUA 3LNMA 3KVKA 2QCGA 3R2GA 2HWGA 2YBVA 1MXGA 3DESA 1MUCA 4WVXA 4FR1A 2PWEA 2XJ7A 1DQXA 5BXTA 1LRNA 1CPUA 5E6ZA 3W72A 4KGLA 2DZVA 1HTIA 2J74A 4UMBA 3S1UA 3QZEA 3H4XA 1ICPA 4POCA 1JI2A 4C1KA 1FDZA 1NDWA 1TE6A 1LRTA 5M2FX 1QATA 4J5NA 4MZ8A 5I7GA 4AWTA 4P7LA 3VKAA 1E9ZB 4W7UA 2C15A 4YU1A 3W9ZA 1OGBA 2OZ3A 3I65A 2CCRA 3A64A 4H41A 3Q67A 3UWQA 1W17A 2YDRA 3NL2A 3GC4A 1P6CA 3WQ4A 3W1AA 3ABZA 3NAVA 4CEUC 2NV1A 3CAVA 5CZSA 4Z0SA 1SJBA 4BK9A 2WVVB 3A23A 4DF1A 3NGJA 1XV8A 2Y8UA 4JKLA 3CYJA 5LZLA 5CLTA 1DWFM 1H4PA 3L4TA 1V0KA 3SM0A 2AQWA 4Q4PA 4FF5A 4ROQA 4W8BA 3D6NA 1A80A 3S2JA 3ZVIA 2GFTA 4JBRA 3ZJ6A 1FHVA 4IMCA 3OG3A 2QJHA 3WD3A 2B4GA 1XR2A 1FWSA 3GIPA 3N25A 1S2CA 3S3GA 3NSMA 4DVOA 5J5DA 4NKCA 3W76A 1K6WA 1S2VA 1TJ2A 4NIRA 1J8VA 3W2UA 3DG7A 5U4NA 1E4IA 3S8HA 2WWCA 3ES7A 4DELA 2W4XA 4KERA 3G1RA 2O4MA 2G50A 3VINA 1XUUA 2VHLA 3GVWA 3WG6A 1FWRA 2J9YA 3LGEA 4K8EA 1SO3A 2Z28A 4E5TA 4RW5A 1XDLA 2DZXA 3MU7A 3H2FA 3QC3A 1A3XA 1Q6RA 4MDOA 3BVJA 2YB4A 1ONWA 3U2ZA 5U7SA 4QXIA 3FXYA 4XD5A 4QAIA 2HMCA 1KQZA 4OHQA 2KAUC 1T99A 2D20A 1T8QA 5GNYA 4EANA 1GYNA 3MYOA 1MEHA 1DJIA 2F6XA 3FOKA 1QAPA 4U3CA 5C70A 4WOQA 5D04C 3VNMA 1EOKA 3CBWA 4D72A 4GBUA 3SIMA 4O13A 4K2SA 4Z17A 4OQVA 4GIEA 4GISA 3VD4A 4JNYA 3W1LA 3RK8A 2DUXA 5A6LA 1JD7A 2Z1BA 1FWDC 4ACZB 2CYGA 1OG6A 3SGUA 4UQBA 2OOGA 3LHZA 3EX6A 3MY9A 1T96A 4UTTC 3CEUA 4REQB 2BFGA 3GD6A 5RUBA 4LS1A 1HW6A 3H2AA 4C6NA 2EPLX 5E5CA 1MRQA 4JIIX 3QVQA 5HWJA 4C1LA 4LVGA 1JRBA 1E15A 3MCMA 1UZHA 3GR4A 3M5ZA 2PP0A 2BGNE 1VBGA 2GVLA 4FEZA 1P4CA 1S1RA 1YNPA 3W27A 5JH1A 3NYDA 1BWKA 1JUKA 2QUMA 5XIMA 4GQQA 5LIXX 2Y61A 1XGZA 3W7MA 4O0KA 3KWXA 3RDKA 2YCIX 1V4YA 1WAUA 4ZB5A 2R1LA 3M1ZA 1RJPA 1V3MA 2XVPA 4Q4KA 2NQZA 2BASA 4JHMA 5EB8A 3EOOA 3LBMA 3QW4B 1YLVA 4ZO8A 4B3KA 1EFZA 4HA3A 1AZ1A 3D3AA 5DLCA 4P8VA 2EXOA 2QJJA 3GS6A 1A5UA 1RVKA 3TYZA 3I4KA 4LV4A 3VFLA 1DJGA 1OZQA 3L65A 1W9BM 3STGA 1XGDA 4P7NA 3MUXA 4TX8A 2EJAA 1LT8A 1Y8BA 3ARXA 3DDMA 5DFAA 1POKA 4L1WA 3STCA 4BEUA 3Q4DA 4GH1A 4HYRA 3TTEA 4XZ9A 3UR2A 4L4PA 3W7QA 3NYZA 1PVNA 4Y2WA 1D3CA 1JPDX 1MQQA 3WQWA 3TR2A 4C6DA 3N2XA 1XLGA 2HVMA 1XKJA 3MA