3NGFA

Crystal structure of ap endonuclease, family 2 from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADVIARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGELNYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP endonuclease, family 2
publication title Crystal structure of AP endonuclease, family 2 from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Isomerase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 5.3.1.22: Hydroxypyruvate isomerase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3ngfA00
4J4KA 1DXIA 1XIIA 3BANA 1XLBA 2HCVA 3CWHA 3IUDA 3KBWA 3M0MA 3QZAA 2GYIA 3UVAA 4A8RA 3BZGA 1XLDA 1OADA 1DIEA 2I56A 3C0SA 4DVOA 3KTCA 2QULA 3WQOA 5H6HA 4A8NA 3M0YA 4X60A 5XIAA 4Q7IA 4OVXA 3KCOA 3JU2A 5AVNA 9XIMA 4GQBA 2QUMA 3M0LA 3VNJA 3M0VA 5J8LA 3KWSA 4XSLA 3KBVA 1DIDA 2XISA 2GVEA 1XYLA 1K77A 1XINA 4XISA 3CQJA 1GW9A 3CNYA 3TC3A 4ZB2A 4US6A 3BWWA 2GUBA 3IUHA 4G56A 3VNIA 5I7GA 4QEEA 1XLKA 3ITLA 3QYSA 5EMMA 4QE1A 1XLFA 1QTWA 4QDPA 1XIDA 1DE6A 2XIMA 2G4JA 5EMLA 1QUMA 2NQHA 1I6NA 1XP3A 2I57A 3DX5A 3C0LA 4ZB5A 3XINA 3IUIA 1XYBA 4K1GA 1XLCA 4ZB0A 1BXBA 3CQHA 1DE5A 1XIJA 4GJJA 4HHMA 3UXIA 3QC0A 1XIFA 5B80A 2J6VA 1XIEA 3DBNA 1XIMA 3KCLA 3P14A 3N4AA 3NGFA 3M0HA 1D8WA 3FVMA 1XICA 4YTQA 2NQJA 4GJIA 1XISA 4A8IA 1XIHA 3CQIA 4ZBCA 3AAMA 1S5MA 2QW5A 3CQKA 4XIMA 3AYTA 1A0DA 5TNVA 4XIAA 1XLGA 4X63A 5EMKA 1MNZA 1BXCA 1QT1A 1XIBA 1XYAA 4YTRA 3BDKA 4W4QA 1XYMA 1YX1A 2HK1A 3L23A 4LNCA 3XIMA 1XYCA 1CLKA 3VNKA 3M0XA 4YTSA 4QE4A 4QDWA 1XLIA 3KBSA 3ITXA 3LMZA 9XIAA 3VYLA 1XLLA 3KBJA 2Q02A 3VNMA 3KCJA 8XIMA 3OBEA 4XSMA 3UA3A 4EAYA 4YTUA 3AALA 1XLMA 1XLEA 4PGLA 4PFHA 4X61A 3U0HA 2GLKA 3P6LA 5B7YA 2NQ9A 3KBMA 4GLEA 3QXBA 4HNOA 1O1HA 3ITOA 2ZDSA 4HHLA 3UU0A 2X7VA 3ITTA 5XINA 4DUOA 3GNXA 3ITVA 3U3HA 2ZVRA 2G0WA 3TVAA 2HK0A 4XKMA 4EACA 5H1WA 3C0QA 2X7WA 1I60A 4QE5A 4QEHA 5B7ZA 1TZ9A 5AVHA 4KW2A 7XIMA 2QUNA 1S5NA 1MUWA 3BZJA 8XIAA 1XLJA 3XISA 3AYVA 3UA4A 4YTTA 1XLHA 5XIMA 3VNLA 4HGXA 5C9ZA 1XIGA 1XLAA 1A0CA 3KBNA 2XINA 1A0EA 6XIMA 4A8LA 4E3VA 5EMJA 5FA5A 3ITYA 2OU4A 6XIAA 4K3ZA
chains in the Genus database with same CATH superfamily
2VFHA 2INFA 4FA3A 3WUBA 2ZTJA 2A6NA 1O12A 1E9ZB 3UWZA 4P7NA 3S47A 4F3HA 3L4ZA 4N02A 3CAQA 1MXSA 3TAOA 1QK2A 3M0LA 3UXLA 3VNDA 3LX9A 5AC5A 4CQBA 3LYEA 4Q3MA 2DVUA 3WK3A 3BAYA 3VNIA 1UWIA 3LENA 1IT0A 4H2HA 4I90A 2OCZA 4B3KA 4GISA 2NVAA 1UH4A 1QWGA 3SGGA 1O5KA 1TPWA 4EPEC 5HUOA 1K6WA 3EWBX 4R7WA 3FHQA 4JIEA 5KITA 1A0DA 4XIAA 3W72A 3RX3A 4A35A 3OIHA 4RDWA 4A05A 1W9DM 3PPFA 1K6AA 1GQNA 3WLTA 5JH2A 1XDJA 3B8VA 3CT7A 1MW2A 4YTUA 3FEQA 1BTMA 2GLKA 4D72A 4HNOA 4I8DA 3VM7A 4QG8A 2BXVA 3WF1A 2VRJA 3VK5A 3BLFA 3VKAA 4FEZA 4N9CA 5IXEA 4Y9AA 1KTCA 1H4PA 3CAWA 2AL2A 4QX4A 2DQWA 2ZA2A 3HGJA 2HV5A 3BOLA 2X30A 1AL7A 3W1PA 1XSIA 4P7LA 1KLZA 7ENLA 3QHNA 5LNWA 1HJWA 1VBJA 4EXBA 4UXDA 3L65A 1IF2A 3T08A 2GGEA 1IXQA 5FEWA 2XFFA 1PKNA 4D6DA 1AUSL 2ODOA 2CBJA 3NG3A 1R9ZA 1X8FA 2DZBA 3BLKA 4KEZA 2RDWA 4S2CA 5AC8A 1VS1A 1JCNA 2EO7A 5G4EA 4IUOA 4B5UA 3M5VA 2WZHA 4KCTA 3OLGA 1W9VA 4P8UA 2NV9A 1A5KC 3QEZA 4MWAC 4GYJA 4DO7A 3PPGA 1CGUA 1UPPA 1QRQA 3CEUA 3OPSA 4GKLA 3WQDA 4B3ZA 4U2ZA 4NJIA 4UMBA 5D2WA 4IGSA 2GQ3A 2JGQA 4M19A 1OQFA 2OYMA 3VOHA 1BYAA 4AWUA 2JALA 1VCGA 2YCEA 1WP6A 1AQHA 1IT8A 3PBGA 1V3LA 4GZ7A 2E40A 3ATZA 2WMGA 4E4UA 4MB5A 1GZ1A 4D1JA 3W00A 1ZY9A 2VFDA 3JRKA 4KRUA 3W23A 1IE7C 1OK4A 3SCRA 4AW7A 3I4KA 4QP0A 4WY0A 3U8GA 2B7QA 3GG1A 4O18A 2UY4A 5CGQA 2QGYA 3S5SA 5KZEA 1NAL1 1Y65A 3GXTA 2BLEA 3OP2A 1IEQA 3KOYA 3N4EA 4Z1CA 3WNLA 4IFKB 3NZQA 3W73A 3LDVA 1V0KA 1N82A 3MYPA 4UTTA 3MA8A 1DJXA 1DQWA 4E2DA 4LVGA 4AHOA 2X2GA 1W2VA 3KW3A 1LBLA 2GFTA 3MY9A 3PWIA 3MMTA 4W5UA 2BBFA 2QIIA 4INFA 3H2MA 3Q37A 5AYYA 1J01A 3DN5A 3KRBA 4OUEA 3QSRA 4DYEA 1R2TA 3QW4B 2Y7EA 4PCNA 4QLJA 3TX9A 1HJVA 3WDPP 3EOUA 3DOPA 1VPXA 2DGAA 3SI9A 4AZ7A 2VEGA 2FZDA 5EBAA 3GDRA 2FB3A 4AXNA 4YTRA 1E6QM 2A4AA 2ISDA 1UD8A 3MZNA 1TUXA 2VR2A 4RW5A 2QJGA 4WR3A 2Z7GA 3O1NA 3FA4A 3ERPA 1XGEA 3M9YA 3HURA 5CJMA 1HZYA 2J88A 3VE9A 2ZA1A 4C6OA 6CGTA 3ABOA 4JIPA 2WVTA 1LLWA 1P7TA 4TXEA 4HQVA 1PAMA 2Z0IA 2VC7A 4LALA 4MGGA 2XHYA 2VQTA 1VPQA 1KNWA 3P67A 4L5ZA 1TYGA 4IZGA 2WVVB 4NYUA 5I23A 4E2OA 3R2GA 1ZL1A 4JIQA 1W1IE 1GVRA 4GRSA 2GJXB 2IPJA 3CNYA 4ZB2A 3P80A 5I79A 4Z2KA 4AY7A 4QSFA 5CPTA 2CBUA 2QPXA 2PF0A 2ZRVA 3L4VA 5CAKA 2PRLA 2G3FA 2EG6A 2NSXA 3ZWTA 3GNRA 5LGXA 3W28A 4U4MA 3QQWA 1V6VA 3CHCA 3A6OA 3HPSA 3SRKA 1U5HA 2YB1A 3AYTA 3BCJA 1G4EA 1ZENA 3FXGA 3PK7A 1O60A 3SADA 2Y5EA 2H3BA 2H90A 3ARUA 3IJDA 5FJPA 3SUWA 4DJFD 4YTSA 2XH7A 1QI5A 2GK1B 3QZ6A 3STCA 2XU2A 4NF7A 4ZTYA 1J4EA 2CLKA 3VKKA 1OFQA 1F3WA 3UJSA 1V51A 1ITUA 3ITVA 5BCAA 5HNRA 5CPOA 1YLVA 2FIQA 3EBVA 2KZHA 4LAMA 3TJXA 2Y5JA 4NQ1A 1VF8A 1YEYA 3RRAA 3LEPA 5GVJA 3AC0A 4GC4A 1LQ2A 1UKPA 4AIOA 1NU5A 4XAFA 2GYIA 3BOFA 3OLIA 4IPPA 2C71A 2PDNA 4C60A 1C7TA 1EO5A 3FKKA 4P8WA 2OELA 3WF3A 3WMBA 4AZIA 3ARTA 3E02A 2BHZA 3V35A 2CBVA 1MUCA 4HOZA 1E15A 3B9DA 2R82A 1WXZA 2EPHA 4ZQMA 3V75A 5HNTA 5ECUA 4D6FA 4AD3A 5H8MA 1VFTA 2A79A 2OX4A 2Q8LA 4DM2A 3UZXA 1XLCA 4RPPA 1DWJM 1LOSA 1PTDA 1VFSA 2ZYFA 2HE8A 5HANA 3NXFA 1IQ8A 5AHEA 1XYMA 4QNWA 3BARA 2D24A 3VIFA 2AMXA 4B4FA 3BVJA 3F2BA 2O56A 4TMBA 4DI8A 3ZJKA 1GQKA 4QCFA 4URIA 1FHLA 1QW7A 3NJ3A 1XLMA 2YA1A 4FXJA 3C56A 1HQTA 4GUHA 2E1DA 4N9EA 1H5YA 2A7RA 3CIXA 3CYJA 3N12A 3W81A 2O92A 4PEKA 2PU1A 1AH3A 1V02E 4EIVA 1LL7A 4FMVA 3NQ7A 2XINA 4HMNA 5G1TA 5C9XA 1B90A 4JHZA 3VZZA 4H4IA 1TA3A 1NF7A 2ZIDA 2BXZA 4UC5A 1GVFA 2HXTA 1XRFA 1CGYA 2OB3A 4ZZ9A 2C6QA 3WQOA 1B3OA 4JN6A 5DXXA 4MFDA 2EJ1A 4JBRA 2TODA 1B31A 3OZPA 4MNKA 1JD9A 4AAJA 4FNUA 1KD0A 4HNTA 4C7DA 4AX7A 4B15A 2P0OA 4HJFA 2EJAA 1V77A 3C8NA 5EMMA 4BQ2A 1L8PA 3GNNA 1Q2SA 2PGRA 4AY8A 3LGGA 1OEPA 3K1GA 3DFTA 1H7RA 3GNPA 4N9DA 4JYDA 4W89A 1HJQA 1BQGA 4HNLA 1D2KA 3AHVA 4U28A 5T8GA 3TIMA 3QKZA 4ML9A 2XVKA 1UW9A 4CKQA 1DEDA 4TOQA 2OLSA 4N6EA 4LC6A 1HKIA 1OGSA 1Y0EA 3FEMA 4GPNA 5E0KA 3HQOA 4JL2A 1W1TA 4HSHA 3H21A 4LQ1A 4R9OA 1W5NA 3WQVA 1TV2A 4QXIA 3VIIA 1LWHA 1QI3A 4CCEA 1W37A 3NQCA 3SZ8A 2ZZ2A 4NAFB 3ARZA 3KRSA 1Y5XA 1TTPA 3N9RA 4O15A 4H8VA 1Q8AA 3W7CA 5AECA 3EA2A 1M41A 3S1VA 1LORA 3L5LA 4LYQA 4GABA 4W8BA 1VYRA 2FHFA 2PP3A 4XZMX 1GEHA 4GNVA 4NZ5A 2J7FA 3SO7A 2VOMA 1IEXA 3M0JA 3TFXA 3W7OA 4H00A 5DQPA 4C6JA 3T1GA 3WBWA 2GJNA 1MZHA 3QHMA 4KS0A 3ANUA 3P0WA 1VCVA 1UD5A 2DH2A 3T07A 4A3HA 2OKOA 1QUMA 1FXQA 1HKVA 3Q45A 3TYEA 1C91A 1EO7A 4XKYA 3W7GA 4US5D 5LIKX 2B0MA 1VYPX 4RL3A 3W1LA 1BSIA 3BSGA 1S38A 5IOBA 2DUZA 2A2IA 3OZMA 1KFKA 3SCWA 3B8IA 1JYNA 4O4VA 1UASA 2QJJA 4DUXA 2G95A 2AQVA 5I03A 4GQQA 3I7RA 4B16A 2NUWA 3VOIA 4H6KA 3NCOA 4XD3A 3NDOA 4Y8FA 1ADOA 4G1KA 1ADSA 4ECLA 3CZLA 5XINA 1ZAJA 4A6GA 4YLWA 4P2VA 3TNOA 3PUGA 2D2GA 5AOUA 2V5CA 1C8XA 3PFRA 2QUVA 3BLLA 1QNVA 4WSJA 1EZ2A 1NM9A 4IL0A 4GE8A 2J8FA 3N11A 4HGXA 4JY9A 3WLKX 3WQ5A 2PS2A 2ZXBA 3GZ3A 1K9DA 4MSSA 4Q22A 3GLCA 4CQCA 4JTKA 2E9MA 1EX5A 2VZVA 2VRKA 1X6NA 1K9TA 1GOXA 4JTLA 4AD2A 5A6BA 4MJZA 1REQA 3AMGA 2DT3A 1P4CA 4UQ9A 1R3TA 1NVMA 2F2HA 3WLLA 1QI0A 2WVSA 2XSBA 3NL2A 2XN2A 2V0TA 3EWWA 3UWUA 2J9YA 3V0TA 3MC5A 3TMLA 1HKKA 4YXGA 1RY8A 1WDWA 2RKXA 3BE7A 1OX4B 3UYCA 3QY6A 4NJKA 3UXAA 1RP9A 3MV01 1DIKA 2JIWA 1M9HA 1XLLA 1G67A 3TQKA 3NO1A 2YFOA 3MDUA 1XLEA 1RVKA 1EBHA 1UPMB 3S2NA 1TRDA 1GOIA 3LG3A 3WELA 3SECA 4I7VA 1ZBCA 4BQ3A 4KFNA 4UTJA 3NIYA 4WGXA 5M3WA 1G4PA 1Q6EA 2O9RA 4J3WA 2A3AA 1V6UA 3NAVA 3BL3A 3D46A 2CZVA 1BTCA 2O7QA 4CVWA 3PAOA 4MKVA 2ABAA 3STPA 2CZ5A 4F0SA 3GXMA 3VGHA 1VR6A 1XYZA 2W62A 4IPIA 2Y7DA 4JQAA 1JF5A 4UQCA 3I3DA 1OIMA 4JX5A 1J2WA 1QHPA 1MRQA 1XW8A 1K8XA 4Q4KA 5AZ0A 3QYSA 5MKGB 2C1IA 1MFVA 4CQ9A 5D02A 1JR1A 3MPGA 1F07A 1G7UA 3TU9A 4G7EA 1XI3A 1JUBA 4W88A 4YCOA 3POHA 4XUGA 2WV8A 2VVNA 4C1NA 2R1LA 3VKJA 1BHGA 2POTA 2QW5A 5FACA 1W2PA 2GVJA 3CMFA 3MTWA 1US2A 3VO0A 3SCNA 4UTUA 3BMWA 4J28A 2HRWA 1ENUA 3DYMA 4CU7A 2PZ0A 8XIMA 2HISA 1M04A 2XFWA 2I7GA 1O66A 3MVIA 2VYOA 4DLFA 3N15A 4KQNA 1G4TA 1JQVA 4QHRA 4HMCA 3UU0A 2ZRXA 2A5HA 1JJKA 2TSYA 1VRDA 4JEJA 1I60A 2PLCA 2X41A 4R27A 4IQLA 4H01A 1LBMA 1JIBA 3FFSA 3KVJA 1JDDA 1JGMA 1NWRA 3DG3A 2PDIA 3HPXA 1ISWA 3AWNA 1B1YA 3FKRA 2OU4A 1GYNA 4CN6A 2CLMA 4AC7C 2P50A 1YE4A 5F2GA 2BVYA 3MYOA 3WUEA 4UQBA 4DYKA 2OG9A 3H7RA 3UZ5A 1OGGA 2PU0A 3AQUA 1JYVA 1B0IA 1CB2A 1KM2A 3CUGA 1FXPA 3Q4DA 3G0SA 1UWTA 4DJDC 5I7GA 3DG6A 4XTIA 2VELA 3GW0A 4CNUA 2BSLA 3CIVA 3HQ1A 4GQGA 3T81A 2WJZA 5D37A 1V0LA 4WCJA 3OZYA 3M6DA 5GNZA 3CHDA 1XSJA 3MT1A 1V6YA 3I3EA 4QDMA 4DUVA 4N4PA 4Y90A 3THUA 4IGNA 4P7RA 2O9TA 4IP4A 3EEZA 3FGCB 5K4ZA 4AC1X 1EPVA 2ISVA 4K68A 3CPRA 4LUIA 5AKQA 4NU7A 1XRVA 2QCDA 4OZOA 1W9XA 4P7QA 1BF2A 1MUMA 2A3HA 1AMYA 2X42A 4YTTA 3KEHA 3ZVIA 1RY0A 1VLIA 2OQLA 5CZSA 1W1VA 3E96A 3QC3A 5G1YA 3RO6A 4WD0A 4RZBA 2C7FA 3WQCA 2QYGA 3PJXA 3KHDA 1DPMA 1NP0A 1VH7A 4RUBA 4EAMA 2I16A 3ARVA 4GKTA 2WJFA 4YVPA 5EY5A 4E4PA 1FH9A 3G18A 2BY2A 5BZAA 3W6YA 3STEA 1UR9A 3TJLA 4O8RA 3Q2DA 2J4GA 1F2JA 3ELFA 2X2YA 3WQPA 2WMHA 2POZA 4DJDA 1EF3A 3CH0A 3DU0A 3HMJG 1BKHA 2FPVA 3UT0A 4B5WA 2GVYA 5LA0A 3M5YA 3CQKA 1ONWA 1OSEA 1Q2RA 3R8HA 3B97A 1YNYA 2WZIA 1CLKA 1SZNA 4A3UA 3UCQA 3AZTA 5L9FA 5FAJA 1W5MA 1HJXA 2XFYA 4C5ZA 4AYSA 4PFHA 1R3YA 1TR9A 5B7YA 1A5MC 3GKAA 1DWGM 3UWEA 3OBAA 3RR4A 1Q4NX 4YPJA 4KFOA 1H11A 4MWAE 1E6RA 2YA2A 3WEMA 3ARRA 3VKCA 4JN8A 3Q67A 5HPOA 2Z24A 1CX9A 3CL6A 4NIRA 1XCXA 1C3FA 3RRXA 4E3VA 4F9DA 5CPLA 4HHPA 1RQHA 2ZTKA 3COTA 4NT0A 4NHVA 3W7PA 3KTCA 3PZVA 2J7GA 3M0YA 1DBTA 2P76A 4JHMA 4YVVA 5CBBA 4DAFA 1AH4A 3IVSA 5KZ6A 4LX4A 3F5LA 4RJEA 3EWCA 5CPSA 3PANA 4L6OA 4S2BA 4RNJA 2P3EA 4WEVX 1J11A 2NW0A 2ZXAA 2ALRA 1W3LA 3B0VC 2VZSA 4HD5A 3CIWA 2DJLA 5T9BG 4H7CA 1XUZA 6A3HA 1A47A 3KDNA 2A6LA 1NWTA 1XIHA 3P61A 3AAMA 4FXFA 1S5MA 3NZGA 4DZHA 2VZTA 3M7SA 3H22A 5F2IA 2ZUTA 1QVBA 3NPUA 3WH9A 1LG1A 1KM3A 3TOYA 4WXZA 3KBJA 5HMEA 1PTAA 2YYTA 5F7UA 2QEZA 3EA1A 3QMTA 2RUSA 3SDOA 2IXUA 3MB9A 1WYIA 1VEMA 1FKXA 4IJCA 1EB3A 1ZCOA 1TZ9A 4HMEA 5A5WA 1OT1A 3W7NA 1I2OA 3O0KA 4JQ1A 2PDPA 1SO3A 4HT3A 1KRAC 1QO5A 3QGAC 4RNHA 2RDXA 4XZNX 3CPGA 3HB9A 2QHAA 2OZ0A 3PZMA 1M6JA 1EP3A 1WZLA 2F84A 3SQSA 2BODX 5A8MA 4U5IA 3UWQA 3URBA 3RYSA 1B2YA 3BTNA 2FZMA 4J3ZA 5BROA 3U2EA 1ZPTA 1I1WA 3ARXA 5JUVA 4Z17A 3LBCA 5AHIA 2QUMA 4K37A 5FAGA 5HUPA 1J2BA 4NVTA 3GS6A 1ICPA 3W25A 4AEEA 2HVMA 3RPTA 4GUFA 5GJNA 2DZUA 3GIYA 3ABSA 4AWSA 2R24A 5K9DA 5KINA 1PZ1A 1OF6A 3P62A 4EPKA 1PWMA 4XG1A 2IW0A 4X2PA 3NO3A 4JCMA 4H9TA 1XICA 3GDBA 2VKZG 4HU3A 3W29A 2ZZ4A 5I09A 5KSWA 2VX7A 3UCDA 4YWSA 3AZSA 5BXPA 2NX3A 4JIIX 3B4YA 1S3TC 4IGHA 3ZJ8A 4OBTA 1RLDA 4HZ6A 4RE2A 4O13A 2P8CA 3KCJA 4L6HA 3DIPA 4IIBA 4YU1A 4R85A 3PF3A 1EDTA 3LQLA 7CGTA 1Y5WA 3M43A 1VFHA 3RR1A 3TVAA 2XIQA 3N2OA 3MQTA 3OGVA 1KM1A 4CD6A 2I5IA 1C9WA 2RGMA 3HIJA 2X0HA 4NYYA 3W1XA 4IG2A 2F38A 1PEZA 4L80A 6XIAA 4OECA 3CB3A 2ZDRA 3QZAA 4A8IA 4GI9A 2DSWA 2I56A 3SUTA 2XN0A 1A5CA 2ZWYA 3MJMA 2ASHA 2I1OA 1ZFJA 2XDFA 3M0KA 3N4FA 1E0TA 4P5UA 3FS2A 3HGOA 2WMIA 1UUQA 2D73A 4X2RA 1XBYA 1J12A 3RM4A 2CBIA 2NWRA 1J5TA 5AZ1A 5G2HA 2OSWA 5DMLA 1W17A 1ECEA 1K7FA 5CC3A 3MZ2A 1AQ0A 3WLIA 3U9IA 2QUTA 3EXRA 1JRBA 3DYPA 4DNHA 6ALDA 4RXGA 3A4AA 3E2VA 3IAQA 5HMSA 1BVNP 2DIJA 1R5YA 3I65A 1KXQA 2W27A 4A21A 4NJGA 3WQ6A 2FVLA 3DCPA 4PL2A 4WDTA 1X7FA 1BG9A 1EC8A 3TQVA 2XYLA 1J0HA 3FYPA 5D4YA 2NQ9A 3TJIA 4HSNA 1LRNA 1N55A 3DUGA 5DT7A 3U5YA 4I7WA 2PLKA 5I77A 3PSVA 2PDLA 4H9XA 5AHNA 3OGSA 1YDNA 4IIEA 2PTYA 3VGEA 4PYSA 4X0VA 3T78A 4IQJA 1LYXA 4ONVA 4QEHA 4D6JA 1P48A 1B9ZA 1I45A 4DWSC 1ZJBA 3FCPA 4O1FA 1KFLA 2FZBA 3WMCA 1EQPA 4LAKA 1NP2A 1LT7A 2PUZA 2YCLB 4WDUA 1OYCA 3BMXA 1JZ7A 4GNKB 2W61A 3WBEA 5BWFA 5H6HA 1WKYA 4IICA 4X60A 1F5ZA 1E0VA 1TO3A 2ZXQA 3ARWA 2PGFA 4HK7A 3T0CA 1J0YA 1CGXA 3ABXA 4R34A 2J78A 3UR8A 2OZ8A 1SJCA 3W6LA 2FJUB 4WLCA 1E72M 2R9RA 4O28A 3UR5A 5DMNA 4XVEA 5C9RA 1FWAC 1Q6QA 2DZSA 3E5PA 2EPLX 2ACSA 3SY8A 3UY8A 3KCLA 4RE4A 4M7TA 1TPDA 4QQUA 3QVQA 2OMAA 1BXCA 1D3HA 1KRBC 2G3NA 4TU1A 2PSNA 3REQB 2XG9A 2EG7A 3D47A 1XDLA 4FOKA 3S0CA 3A3HA 4LTSA 2PDMA 3PPCA 3CAKA 4MB4A 4IFRA 5E93A 1HL8A 3EWYA 3N2CA 4AIBA 1ADDA 1EP1A 4C6BA 1CDGA 2PBOA 3W1TA 3PFMA 3A12A 4F2BA 2C16A 2MNRA 1PCKA 3OVGA 1GJUA 3II1A 3PPHA 3H2NA 4LW7A 4PMUA 1XRSA 5EMYA 1Y7VA 3EGJA 1DXIA 4U5KA 1JCLA 3VDBA 1FHDA 1Q5MA 4FOUA 2TPSA 1TVLA 4BCEA 4QLKA 3KWSA 1W56A 1Z9AA 4FLQA 5DY2A 2XISA 4DELA 1K77A 1XX1A 1Q6GA 3VIHA 3ZLGA 4XKYB 3VGDA 1NTHA 1XWYA 2VR4A 3R43A 1W1A1 3MKKA 2PLMA 5D2VA 3EWDA 1UR4A 5TD4A 5A6TC 3BK0A 1D8WA 4GZEA 1KWGA 1BVWA 2MUCA 1IEIA 2HK1A 2CFFA 5JXQA 3EKLA 3BLOA 2V63A 4Y96A 2VP8A 3MCNA 3W3OA 4BQ4A 5M1TA 2UZ9A 5IFPA 3U0HA 3AICA 3P2VA 4F79A 3BSMA 4DM1A 3UG8A 5KZDA 3WLMA 4TR9A 5FF4A 1UJPA 1WDSA 3WL0A 4QCEA 2PEVA 3ANYA 4MVAA 3SCPA 3SM0A 4LVFA 4UTKA 1R3QA 2DORA 3VTRA 4FSAA 4BZYA 3RDKA 3TCEA 1SO5A 2ZZ6A 1A4LA 4I9AA 1UD2A 3VXGA 1REQB 1FWHC 1FVPA 1NY1A 1YXYA 4ZVJA 1BLIA 1EF2A 4WKFA 4RW3A 2FGLA 4S3EA 1KC7A 2E9BA 2I14A 2V9DA 2VOTA 2FH6A 2QF8A 3PTMA 2DT0A 4UTLA 2PDBA 4HHHA 1WXYA 1XYBA 2WW5A 2WBKA 1DE5A 4GJJA 3IJ8A 1Z3NA 4AZ6A 1UOKA 3PUEA 5HWNA 1OWQA 3P14A 2QDEA 8A3HA 4J5NA 1XISA 5G4WA 1MNZA 3U2ZA 4YCPA 4M3PA 3L68A 3L23A 1DIOA 2ZICA 2Z1KA 4NZFA 1DXFA 2Q02A 3GZAA 4DJED 5I2UA 3BH4A 4AF0A 4IPNB 2A3CA 3B06A 2UY3A 4IIGA 3AIEA 4ADUA 2PGEA 2R94A 2XIJA 4MPQA 3T0TA 4POCA 3LCIA 5CSYA 1U1JA 4WF7A 3GVGA 1FWNA 3R0KA 2OQHA 5EA9A 4H19A 3EDJA 4QAWA 5LNSA 1MI3A 3L4TA 1RJPA 3E6EA 4UOZA 4PBGA 1VFMA 1AZ2A 1V0MA 3TROA 3W71A 1B3VA 1K7EA 2HCVA 3R4IA 4B9YA 1PTGA 1V3JA 3GBEA 5D04C 1O5QA 4JAWA 4FX8A 4M80A 1SZRA 4LVDA 2PURA 1GORA 3IAPA 2OVLA 5AHFA 3W27A 4HOXA 4LUYA 2QF7A 4WGHA 1QW8A 4G7EB 1LUCA 4W85A 3LCGA 4W84A 4C1NB 1ONXA 4PL1A 4S3FA 3IJLA 3UNDA 1M3UA 4G9PA 1X1OA 4F0KA 4XX6A 4QJ4B 3LQGA 3DXIA 3OYXA 3JUGA 2J47A 4LSBA 3KP1A 5ABEA 2CNCA 2GJRA 4CQDA 3PJUA 1TMQA 5DFAA 3CV1A 1XYAA 2OZ3A 3N29A 1J6PA 1OX5A 3A24A 3T7VA 3SEPA 1X8CA 1YBQB 5DRCA 4MM1A 5K9CA 3VIJA 4GA8A 1QNSA 3NZ1A 5BXSA 1XLIA 2JEQA 3OBEA 4WKAA 5CJNA 3MMUA 3QPYA 4DWSD 4X61A 3RX2A 2HZGA 2YXOA 4J1OA 3RITA 2G8ZA 4DUOA 3N2TA 1AA1B 4ICNA 4XBSA 4OBRA 2AL1A 1U33A 1N8IA 3GDTA 3AXKA 1R3RA 1YYAA 3BZJA 2PTWA 2YDAA 4JKKA 4UR8A 4JX6A 4ZO6A 2YOCA 3M0MA 3TZFA 3WX7A 5CLWA 3PBMA 2ABBA 3VOFA 1G0CA 1KQZA 2V2DA 1J9YA 4GYPC 2ISSA 1VPYA 3VKBA 3PVFA 1FWTA 5IRPA 4I5XA 3Q65A 3DGBA 3W88A 3AS3A 2ISFA 4G7FA 4AEOA 1E5JA 1WXJA 1GONA 1Z6KA 4R9XA 5HJYA 5CPMA 2HJPA 3LN3A 4GMEA 3ZO9A 5FJJA 4RE3A 4IIDA 4XAYA 1LCOA 3IUIA 1KB3A 1GZGA 5JBEA 1KM4A 4RDZA 1XIMA 5D33A 4DYJA 1OFEA 3N2BA 1TPUA 2VEIA 1SJAA 4V15A 5A8OA 2QVHA 4L64A 4HNCA 2FTWA 1V5XA 4HA1A 1Y8BA 1EJWC 4G8TA 1T5AA 3BDKA 3LERA 1TQJA 1OD0A 2WCGA 4UQAA 3ARSA 1J18A 4ZENA 3UA3A 4D8ZA 5BOFA 2DZWA 3AOFA 3FOKA 2QCDB 3VAVA 1F76A 4ASTA 1SYTA 1LJYA 4GI6A 1FUYA 1LDCA 2VX6A 3CHFA 2QDDA 1OT2A 4M81A 4PCSA 4CCCA 1CGTA 1GJWA 2B7OA 4YN5A 4V27A 3OLEA 4UTWC 4AZCA 1PZ0A 1V4YA 4UUIA 3WYZA 1W54A 5M5DA 3ABQA 3R0DA 4U3CA 1MMFA 2GDUA 3LHYA 3ZSTA 2PFHA 4HU8A 1N2VA 1MXGA 5JVLA 1XC6A 4TV6A 4Z1YA 2GUBA 5TAOA 4Z2GA 4YHGA 4UZSA 3ITCA 5ABGA 4XAGA 3VC6A 3W7LA 3C0LA 2NZLA 3CQHA 2XVGA 3NL5A 1A4MA 1GVQA 1F3EA 3LTYA 4AMCA 1GYLA 4DX3A 3PULA 1UA3A 2W9MA 3T8LA 1V6XA 4IUGA 4V1YA 3BGJA 1ODZA 4J3VA 2V69A 2WSYA 1FWWA 4YWIA 1M68A 5FEPA 4HSOA 1VJZA 5A6KA 5HULA 3T6CA 4R3UA 3IK2A 4B90A 3EOLA 3LLDA 3FN9A 1PWLA 2IPFA 5H1WA 2I9UA 4IFKA 3GH5A 4H83A 5ECVA 2KAUC 4E2BA 4ZGYA 3AS1A 1ZJIA 5HR7A 1NDZA 4W86A 1CXKA 4LVAA 2IPGA 1SU5A 4DO5A 5LIUX 1XPGA 3FSTA 6XIMA 3I68A 3GIPA 3BJTA 2A1YA 3QMSA 1US3A 3B03A 2AMGA 3S9IA 4H7VA 3WQ4A 4BHYA 3EZ4A 3GR7A 3H7UA 3K4AA 2J6XA 3UG5A 4L65A 4PMXA 4OVXA 3VD5A 2P1FA 3W83A 4IMEA 3UJRA 4K1WA 1VQTA 1FP8A 1GTHA 3NPWA 4PULA 2CERA 3V0UA 3VX0A 2V38A 1Z89A 3QPZA 5DT5A 1HTIA 2OOFA 3TYBA 5MHBA 3WENA 2X0SA 4H6EA 1L8NA 1I0BA 1S1RA 1CXHA 2JE8A 2Y5SA 3WBAA 1PZ3A 2HNHA 1AG1O 3WCZA 1XIJA 4DUWA 4JICA 2I17A 3SCTA 2WSPA 3W2JA 5LNRA 3PTDA 3EMCA 1CXFA 1AMKA 3VOGA 2I9EA 3D0CA 2PC8A 4Z0JA 1QPQA 3TYDA 5DBTA 3KBSA 3AS0A 3V5CA 4ROQA 4JTEA 1QHZA 3W84A 5IM51 1W1ZA 3S83A 1CLXA 2QLYA 3IK4A 3VZXA 4H2CA 4GIYA 4U31A 4EXQA 3E1F1 1H1NA 1P0BA 1I2RA 4S39A 3LUTA 3NOYA 4JTDA 4WVXA 3ARYA 3P5ZA 5E6YA 3E3HA 4QAIA 1WZAA 1PIIA 1MW0A 3PY2A 1JG9A 2V8ZA 3PZTA 3XISA 3LSCA 4CD5A 3K5XA 1YDOA 1GOWA 2VENA 5JH1A 3NQGA 4DIAA 4MY1A 4H6RA 2EPOA 3B3DA 4HOWA 1PHQA 1V6WA 1TPB1 2G41A 3UJFA 4EP8C 4CGTA 3VOCA 5H8PA 5E70A 3GC2A 3GC5A 5AVNA 1EGZA 3C86A 3HG4A 5H2ZA 1DIDA 3ID7A 5IDIA 3UWVA 5FL1A 2WJDA 1P6BA 1ZLPA 1OC5A 1QHOA 3R10A 2NQHA 3O6AA 3C2VA 3HGSA 4K1GA 2G4FA 5LNVA 4E8CA 1XKYA 3M6YA 3B9EA 3L0GA 4KFPA 2D22A 3EPOA 4YTQA 1OIFA 2CXGA 4BF5A 1TTIA 3ZVHA 4P8XA 5FOOA 1QOQA 3DKLA 1DP0A 3VGGA 4V2XA 1RH9A 3PBWA 3NQMA 3WD0A 3EMZA 1E4IA 1DHPA 3G22A 3R12A 2CHOA 3PWAA 3UBPC 2CZFA 3QMRA 4FXRA 2VL4A 3TC7A 2YGYA 3H2EA 4YL2A 2HVOA 4PRTA 1XC4A 1GTEA 4L4PA 5BU9A 2TYSA 2BG5A 2J7DA 1QWKA 5GPRA 3WQEA 1JNEA 4YJ5A 3B8TA 2YCKX 1XHGA 5C2GA 1OFAA 1DIEA 3TAKA 2CZDA 3T2OA 5CGTA 4HU0A 3BG3A 3RCNA 2C15A 4Q7IA 2WMIB 3EOSA 1Q6OA 1C93A 3R79A 4XZHA 1IGSA 3BQ6A 4Z2HA 4KIEA 4QRNA 3HFYA 3N04A 4QE1A 1Z44A 2X09A 1RK5A 2NX9A 3BV7A 1UQZA 1GOKA 4ZB5A 7ODCA 4ZOCA 3WNNA 4UFKA 4HVXA 4KGJA 1ECQA 1U1UA 1ISVA 1F74A 5F2LA 4N7QA 3H4GA 3P93A 1A5NC 3WF4A 3BAWA 3V4BA 3VCCA 3BAKA 3MJYA 2F7FA 1HP4A 3F4CA 3TYCA 3K4DA 4NRSA 3M0XA 1CW2A 2EAWA 3TTYA 4DZ5A 3A13A 2OX1A 3GUGA 3BICA 2AAMA 4ICMA 1PXGA 3ALGA 5PTDA 3GTIA 5KMYA 1Q45A 2X7WA 3A47A 2PTXA 1S1PA 2I5QA 2W63A 4O52A 4O8AA 1CB7B 2C8NA 1SZGA 1Q4WA 3DFNA 1WB0A 4C6FA 4ZO7A 5D09A 3RFAA 3NQAA 1RD5A 3AUJA 5BOEA 2P3ZA 3MO4A 3ZOAA 2YKKA 4PMNA 2ZZ5A 2YXXA 1DJIA 4GQBA 3DECA 1AW1A 3TN5A 3NQ8A 2VCBA 2H6RA 3QPEA 3LPGA 2G5WA 2QNEA 2AKZA 2A0NA 3PP7A 4GI4A 3MUY1 3UXIA 1G6CA 2FDSA 4E38A 4DHGA 1EDQA 3MKVA 1HVXA 4LUTB 3KM8A 2FTYA 1JDEA 4Z08A 4FR1A 1OB0A 3V5OA 4FS9A 1E6SM 4QBXA 4HPGA 3V7PA 3WF0A 4IQDA 1OZMA 3PUDA 4TUFA 4QDWA 3P82A 5CG7A 3SQLA 1ZTVA 1ITQA 2WWCA 5DRIA 1PPIA 4FR6A 4NAFA 1XS2A 3S1WA 5EB8A 4XZWA 4Q4SA 1VAHA 4YVXA 1HT6A 3CL8A 3O2LA 1TV5A 1UR2A 3S46A 1JI2A 3HPAA 3PZUA 2CLOA 5B7ZA 4MAVA 3GU2A 2VDHA 4JEQA 1EL3A 2QCGA 2E28A 5F1VA 1E1CB 1EJRC 1UWUA 1HUVA 2QJMA 1XLHA 1FWCC 1K4HA 2HMCA 2NLYA 3G6LA 1BWKA 3FK4A 3GM8A 5LHEA 4JDBA 3S2LA 1GVYA 2VUNA 5XIAA 4QITA 1J93A 4HA0A 5J8LA 3OO2A 1KGWA 3JR2A 1GT8A 1GVSA 1S5VA 4XQ6A 4QEEA 3DFPA 3TLQA 3RGTA 1VB9A 4OTKA 3G0UA 4GY0A 3W9ZA 4HN4A 1PSCA 4GH3A 5JBFA 1NDYA 4IPJA 4TX9A 2OKTA 4JXCA 4P61A 3M41A 5FJIA 4LYKA 1W5PA 4UBPC 4DJEA 5G2WA 4GUGA 3JZEA 1SJBA 3QW3A 2Z27A 4H9ZA 4Q7BA 3VNKA 2Y7GA 3F03K 3LMZA 4R7JA 3O8AA 3DENA 2PWGA 1XGZA 2BGSA 4JR5A 4NX5A 2X1IA 4ZO9A 2HPMA 7TIMA 1EYEA 4M82A 3E0LA 3QR1A 5ABFB 1KBIA 5EYWA 2RH9A 2H8ZA 1YE6A 3GVVA 4DEFA 3DZ1A 3QQ0A 4GXMA 1EUNA 1XLJA 4UOQA 1OG0A 3EDEA 4GY7A 2ZUNA 1XIGA 3GDLA 2YLLA 4CU6A 1YMYA 3LLFA 4HJWA 5DMYA 3BANA 3DI0A 4BEQA 3PBYA 3IV8A 3DI1A 4GH1A 4X9SA 3H53A 3W38A 1WAWA 3UY7A 4Y8EA 1VIWA 1UR8A 3WNMA 3H23A 3KS6A 5DXYA 1UBSA 1OC6A 2A3LA 3G1SA 2AQWA 4GX9A 1LRTA 3MBFA 3MMWA 1OX4A 1UUMA 2QCMA 3LU2A 1BWVA 3M0IA 4ZA0A 5FKYA 3A4WA 3WJWA 4JTIA 2EQDA 3KOZA 4GI8A 4AD0A 3OQ8A 2WSKA 3PG9A 8RUCA 1HW6A 5LYRA 3NURA 3M44A 4MJ4A 1VBHA 1ISYA 3WG6A 4JKMA 3VFCA 3AMDA 1NJJA 3QTGA 1E0XA 2ZX6A 4N6FA 3S42A 4HBKA 2FKPA 3URNA 3R6IA 3LA4A 5RUBA 2EGZA 3SQMA 3W7MA 3ITTA 4UQDA 2OSYA 2XIBA 2ZVRA 4RXFA 3VDGA 3EKZA 2E6YA 1UIOA 3B0UX 3FA3A 4CD8A 1E4LA 1O94A 3TLLA 4C6CA 1DJGA 2W3ZA 3H4WA 1H63A 3Q58A 4UOJA 4GVGA 1TWWA 2J24A 3SIMA 3SUSA 2OO0A 4DF1A 1WDPA 5A2CA 2PWEA 1UR0A 3W74A 1C8YA 3LXBA 5HXMA 3UGRA 4LBSA 3DEQA 4KESA 2CKRA 3IJ9A 4JTRA 4XK2A 1EJ7L 1OYAA 2OXNA 2J7CA 2WNQA 3CZEA 2HWGA 3L4XA 3CZGA 2ZRZA 2WSQA 3IUHA 3NVDA 2Y62A 1UD4A 4Y2WA 3LY0A 2WNNA 1ZRQA 3S6OA 5LHFA 1KLYA 1ZCCA 4HYWA 4C6DA 2JKEA 2WNZA 1NARA 1DL3A 4QNEA 1ALDA 1CBGA 2O4MA 4GBDA 3IACA 5D2YA 4LNCA 4QJ1A 4DN1A 2WMJA 9XIAA 4JN7A 1QI4A 4ZE5A 2IQDA 3IIZA 4TTUA 1IWPA 5BNKA 1M5WA 1XL9A 1I75A 2FMOA 4N2YA 1BYDA 1GVIA 3MHUA 2X05A 1Q6LA 1HNYA 4LS0A 4KWWA 3TYZA 1QU4A 4AISA 5LIWX 1FKWA 3PZNA 3AO0A 1QI2A 4EKJA 3AHXA 3MWAA 1EHNA 3SCSA 2NVDA 4WRHA 3T44A 4RNFA 3JW7A 9RUBA 2Z25A 3AMLA 1H7PA 1THFD 5C9UA 4U10A 1DKWA 1YXDA 2XWDA 1KFWA 3N17A 4M24A 2FFIA 2V2CA 5IBXC 4L61A 2DSUA 4RX0A 1ONEA 1OFPA 1RA5A 3UNTA 3TUUA 2WANA 1M1BA 2Z2AA 3ZWSA 3SSZA 5L6UA 1XINA 1B3WA 4CNNA 1Q7ZA 3U4AA 3JZUA 1FDYA 1W3JA 1PDZA 4S38A 4GZJA 3IVTA 4LOCA 1OX6A 2HXUA 1NWSA 1I6NA 4GFSA 1CT5A 4JCLA 3EDKA 4QSHA 2GWGA 1M7OA 2HSAA 4EE9A 1LL4A 4JTHA 3FGCA 2VJXA 3O06A 4C6MA 2VNCA 5TNVA 1VHCA 3SIZA 2FQIA 1ONRA 3WIJA 4IFOA 3LI1A 2ZX5A 2GGGA 3KLLA 5GJMA 4UTTC 5CKSA 3O6YX 1EIXA 1MVYA 5D2TA 1F7BA 2FPYA 3FAWA 3GKFA 3SRHA 3ITGA 5FIPA 1UCWA 4BR1A 2R6OA 1JCMP 1R86A 3G0XA 2BTMA 3E12A 4IMDA 2DPEA 4AZCB 3KOWA 4BF9A 3USBA 3QQ1A 4ZCWA 5CSSA 1EWDA 2F8QA 4GWEA 3MVTA 3IVUA 3K30A 5CZKA 1A0EA 2FZNA 4ADSA 2CESA 1O95A 5A6AA 5H8UA 4JTQA 2WQDA 3IUDA 3MSGA 4LAOA 4O1EA 1Q63A 1A80A 4IT1A 3SUVA 1XCFA 1SVDA 3WFZA 4BFAA 2NSOA 1R6WA 1BEUA 2Z6IA 4JQ4A 1XCWA 2ATSA 3ZYZA 3WJXA 2WQPA 3J7HA 5I5RA 3WKZA 2JEPA 1OC7A 4XV0A 3WQFA 5IBXA 3H2OA 1LM1A 2WHLA 3LK6A 4PE8A 2BWGA 1B3XA 3P81A 4YYFA 4ML4A 1SFTA 3FVDA 3DBNA 1QFEA 2XFRA 1U5JA 4RE0A 2ICSA 2CCRA 1XLGA 1RVGA 3TTOA 5LXXA 1GG0A 3AISA 3QFWA 1TWSA 3MV11 4FOJA 2BGNE 5A1AA 1TPFA 5CJ5A 1JXKA 3CXOA 1QMLA 3P84A 3GYCA 4MYAA 4C6PA 2E67A 3G77A 2PI6A 1SZEA 3N2XA 5AHLA 4MZ8A 1PBGA 1I8JA 3KLKA 4AH7A 1BFNA 4D8LA 2ESCA 1QNRA 3AJ7A 3VNLA 1WBJA 1ODUA 1EXBA 1WCGA 2D2OA 2BXYA 1UZ4A 4ROPA 2BV9A 2OJPA 3W6MA 4CN4A 4HYRA 1H51A 3UP8A 3LTSA 4X0NA 1JULA 4W9TA 3AU6A 3A4XA 4FLOA 5LA2A 1TMLA 2GDQA 5DF0A 1EPXA 4PSPA 3BSHA 4N9BA 4RZ4A 2GL5A 3BOXA 1F05A 1S2AA 4Q8UA 5AYIA 4DO4A 5CH9A 3THAA 1BRLA 1E6PA 3LCXA 1UBPC 4ZFCA 3RCMA 1M01A 3W1MA 3FVMA 4M6VA 5CCZA 4ACYA 3D6NA 1V93A 4KKXA 2YBTA 1SSDA 1RCXB 4XAPA 1P0NA 1D7FA 1SFSA 1SW3A 4M56A 3HG5A 1EFZA 3MW7A 2P8BA 3THDA 3KZPA 3WDHA 3ZIZA 5J5DA 3VNMA 1CENA 1XJBA 4GVIA 1OF8A 3UD6A 1MW3A 3PTQA 3PB2A 4XZBA 2OT0A 5IHRA 4BF7A 1ZNNA 4GYKA 4MJ2A 4AEFA 5A2BA 5A69A 1A53A 3I4EA 2EF9A 1CTNA 1DQXA 1TQXA 4GACA 4HPXA 5D30A 3LS9A 5I3IA 1TPEA 3NO5A 4IF2A 2CITA 2A3BA 2VGFA 4PH6A 3O3RA 3CGTA 3CPUA 3OOQA 1BXNA 2V5KA 3IIPA 2OGYA 4GIAA 4GX8A 1RLCL 4ENLA 3EX4A 3CK5A 1J79A 4JTUA 3GRIA 1PB0A 4YYCA 3N1AA 2GSJA 3KCOA 3TN3A 1YDVA 2OYKA 1UP0A 2BVTA 1M7XA 1Z32X 1P6CA 2PD9A 1N7KA 3U5UA 3E38A 1R0MA 3M1ZA 3GR8A 2E5CA 3LGEA 1YPIA 3OA5A 2QGHA 4BY3A 3LCFA 3EWUA 4QDPA 1QBAA 1RD6A 2IKGA 4C6EA 3L7RA 2PDCA 3U2CA 5LXEA 1G4SA 4UFHA 3N4AA 4EK7A 3NOEA 3ZVHB 3UPWA 3UPMA 4AX6A 2NXHA 3N13A 4RNIA 2PA6A 1FFRA 3BUVA 2O9OA 4PB3A 5FSEC 2VR5A 3TEVA 3GO2A 1TZ7A 1XUUA 1FCBA 2VC9A 2BHUA 1K02A 2PWFA 1TJRA 4AIUA 2NUYA 4PMJA 5FF3A 2PDHA 1MYRA 4DPPA 3VDCA 1RPXA 5HDRA 5HQLA 3C2YA 1RA0A 4UFMA 3EDDA 4W8AA 2ACRA 1VLWA 1DVJA 2YZRA 4JL1A 4LUSA 2QUNA 2WHMA 2W5FA 5D05A 1LQ0A 3LCHA 5A3HA 5J5RA 4R5EA 3VMNA 2OYLA 1O5XA 3WD2A 3TN4A 3DFYA 4DXKA 3HPFA 1C92A 4UCFA 3DDMA 4KEUA 3TDFA 2D1ZA 1Z41A 3BG9A 1QJWA 3CUHA 4K8GA 2MANA 3WNOA 2CLIA 3JU2A 3LHUA 1U22A 2EHHA 4MZYA 1IIGA 1TJ2A 1B30A 4DXVA 1E6XM 2BY0A 4XISA 3PHAA 3B0XA 1XH2A 2J77A 1VBRA 1R2RA 1TWDA 3MU7A 4KH2A 4LFYA 3T2PA 1TVNA 3RN6A 1DWIM 1W9UA 2FVKA 3N25A 2XPKA 6REQB 5EKYA 2NQJA 2C14A 5D2XA 3W1QA 5LGZA 4O1DA 1P6WA 1K8CA 5A2AA 1DWFM 1VC4A 2V30A 4MKNA 2DVXA 2YCJA 3QV8A 3TV8A 1I0DA 4DAIA 1HO1A 2DZPA 4EAYA 4QS5A 1AZ1A 4LB4A 2BMBA 3ITOA 4NNBA 4IX2A 3RJYA 3VFLA 1E3XA 2B7PA 4OU1A 4WDWA 5LSMA 1OM0A 5AVHA 2YCLA 2PRHA 1H49A 4MWAD 5T91A 3VVGA 1E71M 5DX7A 1NH6A 4OT7A 1HN1A 1ZP3A 2WNWA 4IMCA 2YYUA 3EX2A 5CPQA 1H41A 1OCNA 3UZYA 2PB1A 2DV0A 1AVAA 1K4GA 3VD9A 4W87A 3WF2A 3EB2A 2Y8KA 4IGMA 7A3HA 2PWUA 3TWBA 3NYZA 1UJQA 1FWFC 1ME7A 1W3IA 1UG6A 5D8ZA 3WK2A 4A3QA 2C13A 1E55A 4DZIA 1A49A 3RX4A 3NQVA 4AMAA 2WM0A 1XD0A 3ZS4A 4GUIA 3NGJA 1F3TA 3W1NA 4HMDA 2DZXA 3BAJA 3REQA 4Q4QA 1C8VA 1SW7A 4AY1A 5M2FX 2BASA 3R7MA 4E6MA 3UEQA 1RBAA 4AD4A 2R1PA 2XIIA 3EX1A 3BQ5A 4AG0A 4BA0A 4PTXA 3OG2A 1F8IA 3GD6A 4LY4A 3ZT5A 5JIPA 3GNXA 4XKMA 1IXPA 4RLIA 1TE6A 4NAEA 3WFAA 4EOUA 2WC4A 1FBAA 3PS7A 1UR3M 1VZWA 8XIAA 4ZO8A 3W2NA 3LV6A 1KBBA 4IX0A 5ENLA 4R88A 4AUBA 1R3SA 3VABA 3RNDA 1XLBA 4NXSA 4REQA 2NQLA 1H61A 2WO5A 3H4XA 2OT1A 4A8NA 5LIXX 4MYXA 3B8DA 5I3HA 1TCMA 3NPVA 1RHCA 1DJZA 1TJ1A 1GQIA 1WUFA 4K2SA 3G1XA 4G56A 1YTKA 4G5DA 1H7WA 1HP5A 4RKAA 3N6HA 5GNYA 4LBUA 3DKJA 3UESA 4KGLA 1A3XA 3IJ6A 3PNZA 3VINA 3OVPA 1W5OA 1QK0A 3GYEA 2G50A 3NGFA 4WKHA 1HKJA 3QRHA 3O6CA 2QAPA 2REQA 2YZ5A 4EF8A 2R14A 3KOFA 3QFEA 5TF0A 3PBUA 4LV9A 1JPIA 1X39A 3M0ZA 2H9AB 1TMHA 1ZJHA 3THCA 3FJ6A 1ICSA 3POCA 3O05A 1Q6DA 1YDYA 5REQB 3SY1A 4HZ8A 3NVTA 3C0QA 4L1XA 5FSDC 4Y9OA 1F3XA 1KM5A 3ECQA 2G37A 4K8EA 5HMFA 3SR7A 1A5SA 3QR0A 3R13A 1PUDA 4JPGA 1DWAM 2XH2A 3BW4A 4ZQPA 3LCWA 2AAAA 1M53A 1IXNA 5D38A 3TSBA 2C91A 1YHTA 3GK0A 2PWVA 2Q8XA 4DVOA 4GNJA 3KL0A 4M5PA 3UWYA 3TSDA 3E2SA 2CYGA 2ZFAA 4TMCA 3G8EA 3GHSA 1MRAA 4UWMA 4GOAA 1GYMA 1MWOA 4US6A 3QKEA 4CNPA 3VMOA 1UMLA 1W9PA 3DC0A 3LHWA 2CWXA 1UOZA 1Q13A 2XSXA 3PZGA 4PBFA 1SR0A 1CYGA 3FXYA 1TELA 4QG6A 4XZ9A 3ZT7A 1D7KA 3GQYA 2O4QA 3L5MA 5HMDA 4HK6A 3G1VA 3CS2A 2X40A 2O0TA 3RXZA 2PTZA 3W75A 1TJPA 1W8SA 3TW6A 4YNGA 3VYLA 2QT3A 1RP8A 2DW6A 3TMQA 4O12A 3W1RA 1BAGA 2OPJA 1KCZA 1NIUA 1JFHA 1RQEA 1W1B1 4HHLA 5D9MA 4DBSA 1HKMA 2JQXA 4UNLA 1TSIA 4C5YA 2J7BA 4JFTA 1LOLA 1F4AA 1TIMA 3VKDA 2P5NA 1QNPA 4WOQA 1WZKA 1RBOB 3H2FA 1J0JA 3AYVA 3RILA 4DWDA 3FW6A 1ZBKA 2E8ZA 3WDJA 3DFQA 1Q3NA 3W70A 5BXRA 3TKFA 1GVEA 3ITYA 4FXSA 3UG3A 3N18A 4A8RA 4B92A 3UETA 2OEJA 1JCTA 3K8MA 3ISIX 3MUXA 3R11A 1TX2A 4UB9A 2FMNA 4DRSA 2QS8A 3EYPA 3DESA 3S1XA 1KKOA 2WKJA 3WJZA 4GUJA 4LGXA 4F66A 1NFBA 1O5RA 1U2YA 2KX9A 3G5EA 4TIMA 2HROA 3LV5A 2INEA 3L2LA 2DIEA 3GBDA 1R87A 2NXGA 5CZJA 5FF7A 4LU0A 1R7OA 2NQZA 5G2IA 1KXTA 3BJSA 1H50A 1YBQA 5C70A 1VENA 2INZA 4NZCA 1WOBA 1KA9F 1R9XA 1XIBA 3UGVA 4F48A 4W5ZA 3XIMA 1EJTC 3TFCA 1XR2A 3S4TA 3RLVA 3FY1A 4MG4A 4ZTXA 3TQPA 4ERIA 4GXWA 2JGYA 1XSKA 4GLEA 3IS4A 4MMWA 5FJTA 3IIVA 4MPKA 1XFCA 1OFRA 4ACZA 2AOSA 1C90A 2HK0A 2YXGA 2C3ZA 3M07A 1YNPA 3ONCA 2Q3RA 3LHTA 1EC7A 4NRRA 3DFHA 3SW6A 1UR1A 3VIKA 2G3MA 1DJNA 3USZA 5BWAA 2QMJA 2HE5A 3CWHA 1UZ1A 3TA6A 4QQ3A 2VI0A 3S5ZA 2PDQA 3WLRA 1YKWA 2VD9A 1PIFA 1NF0A 4HNVA 3UYIA 1IGWA 9XIMA 3RHGA 3M0VA 1VHNA 5HNNA 1CGVA 3IV3A 3EA3A 4O50A 1NDVA 5K3VA 6PTDA 4GHRA 1IZCA 4Y9NA 3AMCA 3F7JA 4KWVA 1W91A 4EANA 2VUYA 4OQVA 3EOOA 2DZAA 3QV6A 4ZB0A 1E1EA 1GCYA 2VFGA 3S1GA 4MNJA 4MJMA 4PTDA 2J6VA 1AJ0A 2V81A 5CBJA 4PEEA 1WV2A 4B9ZA 4KWUA 2NLIA 1A5BA 4XIMA 4CCDA 5A6BD 3VNYA 5I3FA 3SJNA 4I5UA 3FV9A 4BS0A 3MCMA 4XD6A 4D6CA 4PMDA 1C8QA 3E74A 4OFCA 1MEWA 3L67A 1IZJA 4QISA 2UY5A 3S2CA 2J7EA 3HMCA 1UHVA 2DP3A 1VBUA 4PZVA 2GSEA 3QBUA 1I2PA 3BV4A 2E8YA 1CGWA 1JCJA 3A21A 4NZ1A 4F8XA 3QLLA 1S5NA 2UV8G 3UZWA 4IM4A 2XGBA 4DO6A 1I2NA 1LZOA 5CGMA 4O0QA 4JX4A 1JCXA 1ICQA 2ZBTA 4ZOBA 3BURA 3D5HA 3JVAA 4ZXLA 2WAGA 4AZGA 3S5NA 5EL1A 4Q8PA 4DJFC 1OCBA 2P0IA 4ZMGA 2CPUA 1ZHAA 3EX3A 1TCDA 2V5JA 2Z1BA 4ZFMA 3BGAA 1FA2A 2BDQA 4TQTA 2ZA3A 3LZ3A 4S3KA 3WNPA 3ENLA 3S2MA 4FB7A 2VZOA 4R53A 3RO8A 1UA7A 3T0DA 1ZS2A 3KHJA 8TIMA 3VX1A 4GCAA 3WLJA 1S2UA 4DBEA 1HXJA 1KFBA 1DTNA 3WMLA 2J66A 4MUPA 2F61A 2ZUVA 3OVRA 3GTFA 1D8CA 1PL9A 4W4QA 4ERAA 2DUAA 3UCCA 4RDVA 2FB2A 3LBMA 3VIPA 1CCWB 1TKKA 3ZFHA 2TAAA 4CQ8A 2CLHA 1EA9C 1VRXA 2ZVIA 4UTHA 3U3HA 1HFBA 4CEUC 2XM2A 3ORWA 2R8WA 4V33A 4J27A 4ZEPA 2ZZ7A 2BOGX 1SR9A 4ES4A 2WC7A 4GY1A 3WJYA 4PMQA 2D0HA 1A5OC 3ONBA 4WK9A 4X9YA 3MCOA 4Y9MA 1BKSA 1OZQA 3W1UA 2A3EA 3BLPX 3WD4A 4FALA 3U4FA 4C65A 4MB3A 3H7VA 4L7ZA 4GGBA 1OCQA 3CV6A 2WMFA 3A64A 3QN3A 3U7BA 4UR9A 4WXYA 1DJHA 1E4MM 2CC0A 4DJFA 3CQJA 2OO6A 1P0KA 1K1DA 1BRLB 5EFDA 1TV7A 2VXNA 1XQKA 2ZX9A 1A3WA 1H1ZA 5E6ZA 2G96A 1H3GA 3NM1A 1B5TA 1JYWA 1RCQA 1PX4A 3CAVA 3FYYA 3M0HA 5DEZA 3TSMA 1UC4A 4ZOAA 3W53A 3S3GA 1EEXA 3ZZ1A 1U5VA 1OG6A 4QGCA 2GSHA 3TC6A 1KCXA 4XBKA 5TIMA 7REQB 1OINA 1VD6A 2V82A 3BLEA 3TR2A 3HPZA 1M65A 4BI6A 2X7VA 3PR2A 4J3TA 1KXHA 5HK4A 4GC3A 5IHSA 4H6QA 4JOMA 1GG1A 3GWQA 4LS1A 3HN3A 3CO8A 1JVNA 2CLFA 1D9EA 3TP4A 3F4NA 1T6MA 3IGUA 4LCRA 3ZM8A 1V7AA 3G2GA 3IPWA 2NV1A 2HDJA 4K3ZA 3SN1A 5AFDA 5D32A 1EXPA 3W0KA 5C71A 2PDGA 4OV9A 2PAJA 1G01A 4KEMA 4CD4A 3TCSA 3LD5A 1JZ3A 5BMXA 4DZAA 3GVQA 2ZQ0A 4F4RA 1QNOA 1W8GA 4HNNA 4TVCA 1E5NA 3QR3A 3AXIA 3F4DA 3TNBA 2GZXA 4JD4A 4IIFA 1KFJA 2WM1A 2QPUA 2C1HA 2DZVA 2C18A 5CAHA 5ABTA 5BW6A 2Y2WA 3KS5A 4Y9PA 5CQ1A 1BXBA 4DBDA 1Q7MA 3QGVA 1L6YA 1TPC1 3KE0A 3W7IA 3WLHA 3WLNA 3OHIA 4A22A 2Q09A 2PDWA 3V36A 2PTDA 2NV2A 2BY1A 3EX6A 4WIWA 5MF5A 4MLRA 4NNCA 3I10A 1GW1A 1W1PA 4PODA 1QT1A 1B57A 4IP5A 4UTFA 4XD4A 3LSBA 5F1UA 2Q8ZA 5D8WA 4IL2A 4JKLA 1LBFA 5A6SA 5K7JA 3L4WA 3UQNA 3NR0A 4HTBA 2ZC1A 1AK5A 1OYBA 3WD3A 3A23A 4LUSB 1I1XA 4H9YA 4MWAA 1JZ5A 4DJDD 4XVDA 3KAOA 3W7EA 4UZUA 1Z7AA 3PZIA 3W87A 5E1QA 4CLMA 1JUKA 2X1SA 4H41A 3C3UA 4JTJA 1Q6RA 2DSVA 4O14A 5HATA 3VUSA 4O53A 1PE1A 4A8LA 5FF0A 2WCSA 3UJEA 3E5BA 4M7SA 4PRWA 1WBHA 3TXZA 2PRMA 3IGXA 3BZGA 1TV4A 5CPNA 4GIRA 4KCUA 2ZRYA 2PDUA 3L5AA 5CC5A 4LF2A 2VHLA 4DB7A 4PR4A 4JY8A 3WLSA 4F9JA 3BGGA 3BO9A 1UD6A 5E9AA 1HG3A 1JPKA 4Y6GA 4NKCA 3WL1A 1FWSA 1K8ZA 4ZSUA 4AHPA 3RLUA 5AB3A 3NZPA 1E9YB 4C6QA 3BJFA 1MSSA 1XIFA 2BHYA 2WWDA 4X3ZA 2OLHA 3RU8X 3MANA 4AVOA 3ZSSA 3WH7A 4GJIA 3GR4A 1GZJA 3DGRA 4RDYA 4JTSA 4HB7A 2DDXA 4PUUA 1HL2A 1JRCA 3W7QA 2PGWA 2D0FA 1Q65A 3HOJA 4NUWA 3C52A 2QZRA 3CJPA 3CEPA 2CWNA 3G3DA 1LTDA 1X97A 3EB4A 4KETA 5C7VA 3FDGA 2XH0A 3LMYA 3UG4A 1XV8A 5I3JA 2BY3A 3WZ0E 5FESA 3CO4A 3T0BA 2WBGA 5DN1A 3VI2A 1AW2A 1A0CA 4KERA 3W2LA 3WY1A 4Q8NA 3E2QA 4PMOA 3OHMB 2IMRA 1ZJAA 4US5A 4BWLC 1NFGA 1D3CA 1TWZA 2CIPA 4V28A 3URQA 1HJSA 1C7SA 1QASA 5DCEA 2NXIA 2NT0A 3NQFA 1T7LA 1U1HA 4J3SA 3T2QA 1PCWA 3CM4A 3GG7A 3SBFA 4CUCA 4LUTA 1GPFA 1TPH1 3VM5A 1DJQA 3GY1A 4I6KA 2ZXDA 1EC9A 4G2DA 2PWDA 2R1KA 1XBXA 3QC0A 3ZXWA 1NOWA 2Z00A 4Y7EA 1V7YA 4Q33A 1DWHM 1ISZA 2E6DA 3CWNA 2DU2A 3ZMRA 3DC8A 3OTRA 1X7IA 2DJXA 4RR4A 2X8RA 1GEQA 2LLEA 3C8FA 5K4XA 1NQ6A 3T42A 1FOBA 1LF1A 5HWMA 3OW1A 4HPHA 3W7DA 4YS1A 4GGHA 2CW6A 1IWBA 1R85A 4LCQA 1ZALA 4PGLA 1NWUA 3P6LA 3C3NA 1E1CA 1X98A 4NAEB 1C29A 3KRUA 4CCZA 4LUJA 1W32A 3GFZA 2C19A 3QF0A 4HA3A 4PB5A 1HKWA 5CG0A 3CUZA 3GXFA 3O9NA 1RCOB 4XAZA 1RXOB 4MZ1A 3VD3A 2XSAA 4REQB 1Z42A 3FHAA 1HIZA 4EVZA 4YIWA 1JCYA 1SW0A 3BPWA 3UXDA 1XKJA 4J4KA 3ES7A 4YHEA 1BYCA 1RZMA 2R1MA 1QO2A 2BOEX 3RJXA 1RR2A 2ZRWA 3L9CA 5C0QA 3LXAA 1W31A 5M03A 4BWLA 3ABZA 3MWCA 3PB0A 2RDTA 2YJQA 3BLDA 4QG9A 4C1LA 2Z6JA 3LTPA 3GH7A 2W79A 4B5XA 3MKCA 1EWEA 1EOKA 1TR1A 2PP0A 2PZNA 1DV7A 2REQB 1WKEA 3LRLA 4BJHA 5LKYA 2ATMA 4CN1A 1FP9A 4JNYA 1GGOA 4S3BA 2V5DA 8CGTA 3CQIA 3F5KA 1GQLA 2QXWA 4PTNA 3LRKA 4MNLA 4EWND 1IHIA 2JFEX 2PODA 3A5FA 1WZMA 2XM1A 5AY7A 4UNKA 4C7FA 3P60A 3AMKA 3T4CA 5ABFA 3N9SA 5DMMA 1UROA 1ZBVA 4JTGA 2VGGA 5E5CA 5U4NA 4XZLX 1E43A 3H2CA 4W7WA 3LNMA 4NZJA 1YPFA 1RSCA 3UZJA 3AXHA 5GQBA 1EOMA 2J62A 1IEVA 1B4EA 3ZLHA 1QPNA 2W66A 2J27A 2WVUA 1JGIA 3SGUA 3AUOA 1F8MA 1Z48A 3SCQA 3ZJ6A 3CASA 1IT7A 2PCEA 1DHKA 3VIMA 1IR1A 1GOQA 2JIEA 3L12A 4PTWA 4CEXC 2J79A 3NQEA 1W3NA 4Q8QA 3WEZA 4OV4A 5CBIA 1XH1A 4WHBA 5GNXA 4UIOA 4C6IA 4GFIA 3CB8A 3IGHX 3KP0A 4LWWA 2VGIA 3HFTA 1GVOA 3FNDA 3GXDA 4Q32A 1JI1A 1GKRA 2JKPA 5G5IA 3CMJA 5HR6A 1T8XA 3UR2A 2OLAA 2QQ6A 1JL8A 2Q3OA 2WKLA 4L9YA 2PPGA 1UMYA 4JNZA 1DYSA 5I0DA 1T96A 2BFGA 1L2UA 3N73A 2E1WA 1FDJA 1HL9A 4AXKA 3VUPA 1K3UA 2QJHA 4FNRA 1GNXA 3RPDA 3IIXA 2VMFA 1CLVA 3W2UA 1MNSA 4GXPA 4C91A 3LB0A 4NZ4A 2B4GA 2YFNA 3F4VA 2Z26A 4HPNA 2XVNA 2ZCGA 4HCLA 1FDZA 2QDHA 2ZX7A 4FF5A 4A29A 4E2VA 1E4NA 4QFUA 4GQRA 3IJ7A 3UA4A 4HZMA 4AWEA 5HOSA 2Q6ZA 3GAKA 3R8RA 3M5XA 4KRZA 4WOZA 3T8QA 2QCHA 2IKJA 3M16A 3NNTA 3V1PA 3GW3A 1T8QA 2CLEA 5HAOA 1Q85A 4D6GA 1XLDA 1FCUA 3BCDA 3K2GA 4L56A 1SZFA 3TN6A 1UKQA 2Y85A 2PBGA 1T99A 1AL8A 1IWAA 2V5LA 3F2CA 2PDFA 1R8LA 2X1RA 2VTFA 1CPUA 2IPWA 3WJSA 3CTTA 4H1ZA 3GXPA 2FGZA 3V0SA 1US0A 4ZR8A 3XINA 4FK9A 2UBPC 2Y89A 4L9XA 4E3TA 4FNQA 3BXWA 2YBUA 2GOKA 3B8WA 2DIKA 1CXIA 1BQCA 1Q7QA 4B5VA 5BRBA 1SM9A 3E9AA 5AC4A 1UZDA 1JUEA 1AD1A 1L2QA 2XN1A 1CI1A 3L66A 5DY3A 1EGVA 3W76A 3OEXA 1OFDA 1HVQA 1RK6A 3VCNA 5HNUA 1P1XA 1KM6A 3KVMA 3QJAA 3RM9A 1K03A 4I3GA 4ACZB 4UFIA 4ADTA 3AYSA 1EEPA 5JU6A 3S1UA 3G24A 3W82A 1P5BA 3TK7A 1AODA 1FWEC 5CC6A 3ZR5A 3W7HA 3APYA 3WBYA 3KXQA 4QE5A 3GG8A 3WUGA 3ZJ7A 2G3JA 2NX1A 1JAEA 4FX6M 2D23A 2H3DA 2OQYA 3CZ8A 1WA3A 3KOXA 2HNEA 3PZQA 3WH5A 3B9OA 3DG7A 4QROA 4IMAA 3MSRA 3BW2A 1QOPA 1ZBWA 4D8AA 3VIGA 4EXAA 2OOGA 4DBWA 1YRRA 4FNSA 3CHEA 2O9PA 1V3KA 5C7HA 4TV5A 2CEQA 3VNJA 2JKAA 2VWSA 3RG6A 1V79A 4UTIA 5CXPA 5JBDA 1BYBA 4MLJA 5A6JA 1KV8A 2OEMA 1DE6A 5FCZA 2WHJA 2XUCA 1LOQA 1ESWA 3P7YA 1Q6CA 5LNUA 1GOMA 1YNQA 3PZ9A 1QXLA 3NQ2A 4Z0SA 3SAZA 3AI0A 3IWPA 3GH4A 4OUIA 1H0GA 4A2RA 2EG8A 4H8HA 3EOEA 4LPCA 1KBJA 4I9MA 1WDQA 1YXCA 3KX6A 1UWRA 3LHVA 4GO9A 1DJYA 4PC8A 2GDVA 3TZNA 1IIHA 1SQ7A 3N2MA 1SMAA 2RFGA 2OODA 4C6NA 1KXVA 1TRIA 1BWLA 1V3HA 1X96A 4XUYA 3AU2A 1V03A 2R91A 2VQUA 3C2FA 4JGDA 3CMGA 2FPTA 1X38A 3OLDA 3WUFA 1PZ2A 4ORMA 4LYRA 3CV2A 4PCPA 3O07A 4D1IA 3OBKA 4H9UA 1HGYA 1L9WA 4UQEA 1SGJA 2ZZ3A 2XJ7A 3H6OA 2NT1A 1RV8A 2X16A 3D3AA 1AQFA 2WLZA 1MEIA 4K6AA 1LLOA 5JMUA 1S5WA 5C54A 3ABRA 1JPHA 2VX5A 3HZ3A 3MI6A 3WDIA 3G6MA 1H7XA 1E9IA 1JAKA 2PMQA 2OFJA 3C61A 2XWEA 3TJ4A 1CECA 1O4UA 1G7VA 3BAXA 1G69A 1W3TA 2WZMA 2GVEA 3N9KA 1R3VA 4NJHA 1FCQA 3BWWA 2DH3A 4GJ1A 4AHQA 4J9JA 1VFFA 4IPLA 3INPA 2QV4A 4HIBA 2W92A 5IDZA 1W1YA 2E77A 3OGRA 2VCAA 1FWDC 2FJKA 2WKGA 1MQPA 3GTHA 3LNPA 4IP7A 5E0FA 2QV5A 3L0NA 3E0FA 4JS3A 1KGUA 1IEWA 4UFJA 3THQA 3TXVA 1QBBA 4F40A 4CU8A 1EJVC 3AXXA 4XSMA 1J6OA 4ZQRA 2B31A 1DJWA 3A9BA 4PUEA 5FJRA 3NDZA 3MDWA 4O4WA 3BAIA 1KRMA 1T40A 5LA1A 4MOZA 1E73M 1XG3A 4K7YA 1EYWA 4QM1A 3UF9A 7XIMA 3MO7A 2B81A 1KCLA 1EH9A 1AQMA 5I02A 3KBNA 2BP1A 4P8VA 3NEVA 5CZ0A 3G1HA 3R25A 3SN4A 1GUVA 5I06A 4EX4A 3IJIA 3KL3A 2RJHA 4J3UA 4O54A 1KTBA 4Z2LA 1CZ1A 4MDOA 1DOSA 3NWRA 1FFQA 3YPIA 2AL2B 4MAZA 5HJLA 1LL6A 2Y63A 3OQEA 3PJWA 1PX8A 1UWQA 3E2RA 5DCBA 5D9OA 2ISWA 1XYLA 4RK8A 4M8UA 5A6LA 2XZ9A 4Q7NA 1G1YA 1KW1A 2RGLA 2DUXA 5F2MA 2AKMA 2AGKA 3OJGA 4U2YA 1Y5VA 3DYOA 3WQWA 2D69A 3PTKA 4XD5A 3GTNA 1TTQA 4NY2A 4H9VA 3I6EA 2Z29A 1QOXA 2IQ0A 4RCXA 2Y70A 3RMJA 3AYRA 3EB3A 1J5SA 3RMEA 5I3GA 2XIOA 3GNOA 3EDFA 4G6CA 3V1HA 1F73A 5HA7A 3ICJA 1AH0A 2QUUA 2D2JA 4IH3A 5T9CE 1QW9A 2OWCA 3ITXA 4UTMA 3S9YA 4MADA 4X22A 1FCVA 1H2JA 2CETA 4IIHA 2YW4A 2V5BA 2ZDSA 2QPSA 3SY5A 4UMCA 5EGRA 3VD4A 2ZE3A 1EHAA 4O17A 2Q01A 4S3AA 3AHYA 1MUWA 4QTGA 3GXIA 3SSJA 3W4RA 2ANUA 3B4UA 2WCAA 5DBUA 3DERA 4JNMA 4WY0B 2RDUA 3H70A 1FTXA 2YR1A 3HQPA 1SSGA 3W07A 3TQ0A 3MP5A 3T40A 2BX7A 1J10A 2V6AA 4W7VA 4HCDA 4FO4A 3CV7A 2VRQA 3PG8A 3KL5A 2BGQA 4D2JA 1R46A 4D9PA 2ALDA 4I7UA 4W7UA 1VEPA 2YL8A 2W6RA 1HF6A 2VEPA 4LY8A 1IR2A 5M17A 1OCJA 3DX5A 3K8LA 4KCWA 2QCFA 1UP2A 3H55A 1KQYA 3L21A 1L6SA 4CNTA 1DTUA 1TV8A 4M51A 2ZX8A 4TTGA 3WNKA 3B05A 5BRQA 3NTYA 4B2DD 1G94A 3SCVA 4D6IA 2VD8A 1UQYA 2V2HA 5FEZA 1XYCA 2YSWA 2R1NA 5F4XA 3NM3A 4MWAB 1UP3A 3CH9A 1H0IA 3CZKA 1O1HA 3NEHA 3UXKA 3EKGA 3OIXA 3QSTA 5E09A 4O1BA 5I24A 3RAOA 3F1QA 1UUOA 4PTMA 3ZLFA 3PAJA 3MUZ1 4F0HA 4FHAA 4YMZA 1QPKA 4LCSA 3NDYA 3G3MA 4JTAA 4QJ3B 4Z2IA 2OWWA 4C7GA 1P7TB 4AIEA 1HGWA 3WLOA 3LPPA 1VKFA 2AGTA 3VPLA 1ZAIA 4JYFA 3A3XA 1XFBA 4HZ7A 4J35A 2PDXA 1YADA 1EA0A 4RZ5A 2GVLA 1ME9A 3NUKA 3QZEA 1XLKA 2RAGA 6REQA 4GK8A 3GIQA 3UWWA 3NSMA 3OB8A 1UC5A 5C2CA 1KFEA 1RJRA 3CT2A 1VFOA 3PSWA 3APTA 3N19B 1GWJA 2FVMA 1CNVA 4QLLA 9CGTA 4GIEA 4HK5A 1P0DA 3W1AA 3VDAA 3TTSA 3L2MA 2HEJA 3TOPA 3HM7A 1H7NA 2WHKA 3GFXA 4HTYA 3S9ZA 1A3HA 4WSHA 2Q71A 2VC6A 5T26A 4S1FA 1XQLA 4LV4A 4EPDC 3RM8A 1NQKA 1PJ9A 3TYAA 3WMSA 2BOFX 2OWXA 2Y0FA 1UZHA 1A5AA 4AYGA 1PKMA 3MSDA 2DT2A 3MUIA 4KW2A 2ON3A 1H1YA 4H9MA 4LT9A 2VURA 1FWBC 1TFVA 4DI9A 3QH2A 2D0GA 2XVPA 1UH2A 1AD4A 2V68A 1TV3A 3SFKA 1SUXA 4N4QA 3WD1A 3KFTA 4DJEC 1GKQA 3U57A 2PDJA 4LBRA 1E9LA 2E4TA 4S3CA 1KKRA 4PUNA 2GUUA 3FDKA 3CYVA 1S3HA 2FH8A 3PN8A 4NI8A 1XLFA 3GC4A 3HG2A 3A5VA 4Z1AA 1A5LC 3LBOA 3MI3A 3WH8A 2FHBA 3NPXA 4HHMA 3SGZA 4ZQOA 6TAAA 1S5TA 5A95A 4O11A 3LPFA 3SURA 3KTXA 4H3DA 3BMVA 4MKSA 5D9PA 4LC8A 3S5YA 1F6KA 2Y8UA 1EGMA 1U30A 3I7QA 4O19A 3FA5A 1YTDA 4IXHA 1YX1A 4CD7A 1UKOA 4Q6XA 3CC1A 3B8UA 4MFEA 2ZUWA 3GUWA 2B7NA 1S46A 4M1RA 4PUJA 1QR7A 1YQ2A 3EXTA 4LH8A 3O15A 1R47A 3ANVA 3GE7A 1X6LA 3AIVA 3V3WA 1P1MA 3RIKA 3HJEA 5HJXA 2A7NA 2E09A 2YA0A 1ITCA 4PRRA 4Z2JA 2QCEA 3IANA 3TW9A 1XD1A 4GVHA 4OKDA 1FHVA 5EFFA 1GQJA 2DT1A 2QAFA 1YTEA 2W4XA 5AC6A 2IUZA 5FA5A 4HCHA 3AXMA 3W24A 3DHDA 5I00A 2Z1VA 4PA8A 4AZBA 2TRSA 1FHUA 4PMYA 1F61A 1H5VA 3LI0A 3S8HA 3PNUA 2VFFA 3NYDA 5BU6A 4TVUA 1TJ0A 2PLJA 1G5AA 1TA3B 5FF2A 4M6PA 1RPKA 1H09A 4FI4A 2GWNA 1EDGA 4E5TA 2F6UA 1E51A 4OGZA 3Q94A 2YL5A 1UWSA 4FPSA 3V5FA 3TR9A 2Z7KA 1XBZA 2Y4SA 4U3AA 4IXXA 1FWRA 1R9YA 2OR2A 4DQWA 1T41A 4LF1A 5A6MA 3C0JA 4IMFA 3RU6A 4K7VA 1HO4A 2P10A 3O16A 4FNTA 1NOUA 1OD8A 1JZ6A 2SFPA 2H9AA 4NILA 1QNQA 2PC4A 2HS8A 1GHRA 1O7AA 3M64A 3MP3A 1HJUA 1RJQA 5J04A 3IARA 2BZNA 4Q4RA 4LRTA 2HVNA 5REQA 3N6QA 2D20A 4LRSA 3T9PA 2WOQA 3BLIA 2FGBA 2VDGA 3C2OA 3G1YA 2NUXA 4C6LA 6TIMA 1VYSX 3PM6A 3CUIA 1YPXA 4J7RA 1I9CB 3HGRA 4WZHA 3VE7A 3P3BA 1ZZMA 4XO7A 2WPGA 1F6YA 2EXOA 4U33A 4MIMA 1VCFA 3T55A 3F2DA 3VGFA 1VJIA 3KUMA 3L2IA 2PD5A 1WX0A 1KO0A 3L4YA 4WSKA 3GFYA 1J0IA 4PUWA 4HA4A 1EQCA 4C1KA 2E5DA 3W02A 2PDYA 3QOMA 4KRTA 1JF6A 4H04A 1MZRA 1R38A 5D9NA 3ITLA 3WH6A 3TYUA 3CBWA 4DWSA 1E0UA 2G4JA 1AW5A 2E9LA 1XIEA 2WK2A 4ZQNA 5BMWA 2G97A 2Y88A 2CXEA 3TE9A 1TB3A 2E5BA 4A2SA 5D03A 4GINA 4AB4A 3L4UA 1PX3A 3IRDA 4ZOEA 3E0IA 4L4MA 2Y6ZA 5DLCA 1ZAHA 4KEVA 3U7VA 1NEYA 1VFUA 3FYOA 4H8UA 1YIXA 2VX4A 3N3TA 1OFBA 1OGBA 2F6XA 1ZQ5A 4JTCA 3OODA 1JEZA 2AQOA 2F6KA 4L1GA 2VWTA 4V1XA 2OGJA 4IJRA 5H91A 1XDMA 3F5JA 1LWIA 3UVIA 4PCTA 4JZ5A 5CSRA 3GU1A 3N34A 3HO8A 4FX7A 1XPYA 2HTMA 5DO8A 1XGDA 3JS3A 3VIOA 4EF9A 1F6PA 3LXCA 5CLTA 1SFJA 4NG3A 1WDRA 4PMVA 4XSLA 3M7WA 2Z2UA 3W86A 4F0LA 3LHZA 2Z4GA 1GW9A 1RBLA 1E6ZA 2VFIA 3LZ5A 3GHRA 2ZC8A 2A85A 3B9AA 1GPWA 3QV9A 3KDOA 2J74A 5C9WA 1EX1A 2IS7A 3EWXA 1PKLA 2YDRA 4F2TA 4FLRA 4FP1A 4J2PA 4DF0A 4MY8A 3C2RA 3O6DA 5I3DA 1E6NA 4X63A 1NFPA 4DF2A 2ZZ1A 1JNDA 3EWZA 4UFLA 5BXTA 1OABA 4I6VA 1C9DA 3KTSA 4E8GA 4QJ5B 4GYFA 4PCFA 1SO6A 3NSNA 1XRTA 4OOZA 4ATLA 1WUEA 3M4HA 3NQBA 4RPQA 4M6QA 2X1TA 2E0PA 2VFEA 1LWJA 4M29A 3I6RA 2JF7A 2D3NA 3GVWA 4JIHA 2J8GA 1MW1A 3MI2A 4BKNA 4CVUA 3GHTA 2GGIA 5CC7A 5FJUA 2G3IA 3SJ3A 1S2VA 1BG4A 1KR0A 1QDSA 4LAZA 5KTLA 1CEOA 3UPBA 3LOTA 3QYQA 1W0MA 1OJXA 4AD1A 2Y1HA 4KWOA 4LEQA 1SMDA 4LEFA 3TA9A 5K9XA 4DNMA 3MUCA 2ZRUA 3R8GA 1AFSA 4CNSA 2EPNA 3PBVA 3H8AA 5EMUA 3LRMA 1SFLA 4B3LA 3AIRA 3VGBA 1ELSA 4PN2A 1KTNA 1DORA 3A3WA 4XWUA 4K36A 3SN0A 3R89A 3W7KA 1J8VA 4LANA 3G1AA 2DVTA 4JIRA 3STFA 3W7RA 2YDSA 4N42A 3CUFA 2O55A 1H7OA 4Q8OA 2OTDA 2ZKMX 5I3KA 3SRDA 2YL9A 1XBVA 5KETA 2WPBA 4R7OA 3KBMA 1PIGA 2GOUA 3BW3A 1TE1A 2FTPA 1KGXA 2Y24A 3LM7A 2FZ8A 3H54A 4F0RA 4O0KA 2YBVA 1GHSA 1TVPA 3FLUA 4GG9A 1EBGA 4ALDA 2XZ7A 4MTVA 1XLAA 3T0AA 1CXEA 1OBAA 3UFYA 3GVRA 4XTDA 3T09A 4MF4A 1A5UA 2J75A 1XIIA 1HX0A 5AYXA 3PJTA 3KBWA 4M6UA 4W93A 3HF3A 1B3YA 3I3BA 4NASA 2L5HA 3DHUA 3UW6A 1B9BA 2V3FA 4S23A 3ALFA 2ACUA 1K9EA 4FIQA 7PTDA 4CNOA 4KF1A 1POJA 3AROA 3C2EA 3CU2A 5CEWA 4AWTA 3K13A 2CKSA 1X6UA 3CQ0A 2DSZA 1CIUA 1BSLA 2EEXA 3SB0A 3TH6A 1WAUA 4KIRA 1AJZA 1H62A 3DHFA 4WX2A 1J0KA 4L9ZA 4M0XA 3T05A 4IJBA 4GD0A 1EJSC 4Z1BA 4E0CA 2WSRA 1JZ2A 4FAMA 1S2TA 2CZEA 3R0UA 3QTPA 1OHLA 2OEKA 3WFLA 4BI7A 3QXBA 3O7UA 3I7SA 1NDWA 3L0KA 2J9ZA 1LP6A 1QPOA 1BF6A 3KZSA 5DCDA 2WMKA 3MHFA 2VC5A 2GJPA 1XG4A 1SO4A 4OBSA 1QPRA 2TMDA 1TREA 5FJOA 1W5QA 2BS9A 1Q66A 2UWFA 2VCCA 4XBJA 1BGGA 3HU7A 1V6TA 2QIWA 4OE7A 3EEGA 4MY9A 2J25A 3DBPA 1L6GA 1UB3A 4ZE4A 3FJNA 1TTJA 2ZUSA 3KVKA 4MHBA 5FEXA 1OY0A 3EPNA 3WLPA 1K9FA 4G1NA 1EJUC 1PYFA 5FD0A 1LG2A 1CWYA 2VM8A 3ATYA 3WK1A 4AD5A 3G8RA 3W85A 4Q8VA 4ILSA 1WNOA 3P5YA 3TC3A 4XB3A 3W22A 1FH7A 3NSXA 3QM3A 1B4KA 5ABHA 3AJXA 2FDMA 1N8WA 4IISA 1JZ4A 1XP3A 2I57A 1D3GA 3WLQA 3UZZA 3H24A 1XH0A 1WDDA 4RZ6A 4B2DA 2Z28A 3GHUA 4OOUA 2DZTA 1WE5A 7REQA 3W2KA 4M1BA 2XGZA 3NQ6A 5C6MA 3FJLA 3R5EA 1KV5A 4FF7A 1UH3A 1QATA 3S5OA 3GDKA 4IWWA 4PUMA 3TTQA 2W67A 2BVDA 3B8SA 4GYPA 2V3DA 2GQ8A 5K2ZA 4Q4PA 4QE4A 4PMZA 2GQ9A 4O57A 5E9XA 1MQQA 1NOFA 4LJ3A 4JTTA 3MS8A 3B0YA 3W7JA 4XZIA 3CUJA 2C0AA 2D3LA 5JIWA 4NZ3A 5AC7A 3RUBL 1W3KA 3WQGA 4B5NA 2CLPA 3T4WA 3HV8A 4FIRA 4XO6A 4JFSA 3FSUA 4JQ3A 5HQMA 3ME3A 3NXLA 3QGKC 2QULA 4NJJA 2IKIA 4IOTA 4AQLA 3CUXA 3RCYA 2ZE0A 3GB6A 4LB3A 1VGAA 1M03A 4C90A 6ENLA 2EKCA 3U48A 5BRPA 1FWIC 4FZIA 1JD7A 2XH4A 2IXVA 5F4SA 2NWSA 2BVWA 3ZT6A 4GZIA 1EIBA 3KRZA 1F9CA 2F9RA 1J96A 5EMLA 4A4AA 1RAKA 2VT0A 1JQXA 4UTWA 1V3MA 1FY6A 1S2WA 3ZR6A 3W26A 3OZOA 3GTXA 5A8PA 5AN7A 2DSKA 3UR7A 1JDCA 5HQEA 1EUAA 4GO8A 3TONA 3DAQA 3MUAA 2VDIA 4Q6JA