3NGFA

Crystal structure of ap endonuclease, family 2 from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADVIARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGELNYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AP endonuclease, family 2 from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Isomerase
molecule keywords AP endonuclease, family 2
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 5.3.1.22: Hydroxypyruvate isomerase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3ngfA00
2I57A 4K1GA 1D8WA 3M0VA 4K3ZA 5J8LA 3UVAA 3VNKA 4W4QA 4EAYA 5AVHA 8XIAA 1GW9A 3BZJA 4QDWA 3KWSA 3BDKA 3BANA 1XICA 3UA4A 1S5NA 4A8NA 3QXBA 1DE5A 2J6VA 4A8LA 3IUDA 1XLFA 3AALA 3KBWA 5B7ZA 3M0MA 3CNYA 3U0HA 2XIMA 3KCOA 1XLMA 4HHLA 1K77A 1CLKA 3VNLA 3C0LA 4HNOA 1A0CA 3OBEA 4X60A 3P6LA 3ITVA 4XKMA 2I56A 2QULA 1XIFA 3CQIA 2QW5A 3QYSA 3C0QA 2XINA 5B7YA 4GQBA 3UA3A 4YTTA 1XINA 3ITXA 3KBVA 3L23A 3M0XA 1XISA 1XLKA 3VNIA 3ITOA 1YX1A 1XIHA 4DUOA 1I6NA 3VNJA 3BWWA 3M0YA 1XIMA 4GJIA 2Q02A 4GLEA 2QUNA 6XIMA 3CQHA 1XLGA 4YTQA 4ZB2A 1XLLA 2G4JA 3P14A 1MNZA 2ZVRA 3M0HA 1XLJA 3XISA 1XYBA 1XLIA 4YTRA 1A0DA 1XLHA 3ITLA 5XIMA 1XIGA 1O1HA 3KBNA 1QUMA 4J4KA 3ITTA 3JU2A 4QEEA 3AYTA 5H6HA 4XSMA 3KBJA 1BXBA 3QZAA 2GYIA 4HGXA 4QE4A 2G0WA 1DIDA 3C0SA 4QEHA 3KCJA 4X63A 1XLCA 3IUHA 1XIDA 4E3VA 4QE1A 4DVOA 1XYAA 1XYLA 2XISA 3N4AA 3DBNA 2X7WA 1XP3A 4XISA 3UXIA 4A8IA 1QT1A 2X7VA 4XIAA 1XIEA 2HCVA 5EMLA 3CQJA 3LMZA 4XSLA 1OADA 3TVAA 3UU0A 5XINA 2GLKA 2QUMA 2NQ9A 5B80A 4G56A 2OU4A 3XINA 4HHMA 1XLEA 1I60A 2HK1A 5FA5A 4EACA 1A0EA 5AVNA 7XIMA 4PGLA 5EMKA 4Q7IA 5I7GA 3ITYA 1DE6A 2GVEA 4PFHA 5EMMA 3WQOA 3VNMA 4A8RA 6XIAA 3XIMA 4ZB0A 5C9ZA 3KBMA 4YTUA 1XIIA 1DIEA 3NGFA 3CQKA 3KCLA 1TZ9A 4GJJA 2ZDSA 3DX5A 4KW2A 3AAMA 3CWHA 1XYMA 4LNCA 5XIAA 1XLBA 9XIAA 1DXIA 3GNXA 3TC3A 4ZB5A 1S5MA 1QTWA 1XIJA 3QC0A 3FVMA 3IUIA 2NQJA 4X61A 3BZGA 3KTCA 1XLAA 1XIBA 4US6A 3AYVA 5TNVA 9XIMA 4QDPA 1BXCA 1MUWA 4XIMA 5EMJA 4YTSA 1XLDA 2GUBA 3VYLA 1XYCA 4QE5A 5H1WA 3KBSA 2HK0A 2NQHA 4OVXA 3U3HA 3M0LA 8XIMA 4ZBCA
chains in the Genus database with same CATH superfamily
1GOQA 3IK4A 4NXKA 4PMNA 5AC5A 4HCDA 5CPMA 1VLIA 3LZ5A 1S5NA 3VIJA 3AHYA 1BHGA 4MJMA 4OBTA 3LQGA 2ZCGA 4OJYA 1NF7A 4BQ3A 2EGZA 3ZT5A 4D6HA 3QRHA 1X1OA 2VEKA 3WLHA 4KEVA 4WY0A 5DRIA 2J7DA 1JYNA 2IKJA 4PE8A 2IQTA 1H1ZA 2FHCA 1R8LA 4XG1A 5TAOA 3FIGA 5GNZA 4D8ZA 2OKTA 2V5DA 1N8WA 3GZAA 2QLYA 2PRLA 3LHTA 1O7AA 4ILSA 3Q2DA 3STPA 2EPHA 3N2XA 4KBXA 3EDEA 3PNZA 3TTOA 3BAWA 5K4XA 1CNVA 3APGA 3MCOA 4IMFA 1EJSC 4XZLX 3RPMA 3OIXA 3LTPA 2OZ3A 2E6AA 1OCNA 4CQDA 3C0JA 4AMCA 3V36A 1OYBA 3WEMA 1B9BA 3CBWA 1VBHA 3I3EA 1JJKA 4KWVA 1JFHA 3UZYA 1VIWA 4B91A 5BOOA 5DY3A 2AQVA 3MYPA 3O06A 4M0XA 4AB4A 1DJWA 1FKWA 2J75A 2ADAA 4QDWA 5IXEA 4MAZA 3RLGA 3GRIA 1K8ZA 4A8LA 2PDJA 1AL7A 1A5LC 3ARTA 4G6CA 1OYCA 4NJJA 5EFDA 1JGIA 2Y1HA 4MWAD 3W84A 3PZMA 4MY1A 4WZHA 2GK1B 3QHOA 3SB0A 2XINA 2V2DA 4AYSA 4G7EA 2CFFA 1Z42A 3P8IA 4LUYA 1CTNA 1SYTA 1OCBA 2Z1VA 3CUZA 1JD9A 1N82A 4Z17A 3FXGA 2Z28A 4AD2A 2B31A 4ONVA 2VFIA 4PL1A 5LIKX 3BLPX 2DVXA 4HNLA 1AQHA 4OT7A 4KCVA 2QEZA 4GA8A 1WDDA 1DJIA 1BXBA 2FB2A 4IFRA 2XM2A 3A5VA 1IXOA 4JICA 3W53A 4WJ8A 1SGJA 2RDUA 1VJSA 3LMZA 2GGHA 3UU0A 3HBLA 5BU6A 3OZYA 4BF5A 1MEWA 4LEFA 1SZEA 3I4KA 5HWMA 2YCLB 3EX1A 1IGSA 2ISFA 3D6NA 2AL2B 1WUEA 2YKKA 1FY6A 1I0BA 3NQEA 1NDVA 1DP0A 1KM4A 3GVGA 3S5YA 3ZR4A 3IRDA 1ME7A 1XLAA 2JGYA 5F2GA 3RPTA 5CCZA 3NPVA 4JIHA 4BJHA 2YGYA 1XFBA 1MFUA 1OC6A 3M44A 4E2BA 2YBUA 2CC0A 1WZLA 4DZ5A 1E1CA 3P82A 4JTRA 2E5BA 4PC8A 4PA8A 1AFSA 1E43A 4B5SA 4X60A 1QPQA 1POJA 2G5WA 5BRPA 1KCKA 2G3MA 2ZX6A 2VCAA 5T91A 3DFNA 1TELA 3M16A 2CXEA 3S1WA 3BO9A 4JTFA 2XH7A 1Z8AA 3N04A 4IPNB 3TJIA 3IANA 2O7QA 5HNTA 1XLHA 5ABFB 3F5JA 3N6QA 4QDMA 1M01A 4O1AA 4M6QA 3AIEA 2YXXA 3GC2A 3WY1A 1UBSA 2W66A 5I2UA 4LANA 4WRHA 1EP3A 2D0HA 4A22A 5CPTA 5H8PA 3HQPA 3NR0A 5IDIA 4S23A 3TYZA 1YQ2A 1VEPA 4CCCA 1FRBA 4JQAA 4RDZA 3W1UA 3LI0A 4H6QA 2QDEA 2IQ0A 2RHGA 1XBXA 2QJJA 2ZC8A 1HUVA 2DT0A 1ZRQA 3B0UX 4ZQOA 3BGGA 3UWQA 2CLPA 1VR6A 5EL1A 4DO6A 1HP5A 1US3A 1QI3A 5HPCA 4G7EB 1OGSA 2CWNA 4M3PA 4PTXA 1NWUA 2GK1A 5G4WA 5ABHA 5I0DA 1Q7ZA 3HGSA 4LS2A 3SZ8A 1PUDA 3BDKA 4X9SA 1TPDA 3ME3A 1PJ9A 1GWJA 4MLJA 3CV7A 3FHQA 5I3HA 1WKFA 5IBXC 3CQIA 1R3TA 4IMAA 4UZSA 2XN1A 3HN3A 1UR3M 2A4AA 1ECQA 1RQEA 3WQWA 1ZP4A 3GNRA 2ZUVA 1XG4A 3ZQ9A 3GS6A 3VOHA 4JYFA 4BI7A 4MB3A 4V2XA 3KFTA 4DBEA 3V75A 3GVVA 3GG1A 4RE3A 3VNYA 5I24A 2Y63A 2J13A 4AXNA 5EB8A 4QQUA 2Y70A 3M41A 1V3HA 4BR1A 2BASA 3B8DA 1MRAA 4JNZA 3ZJ6A 2J7BA 3B0XA 4LUTB 3U57A 2XJ7A 1RPXA 2Z26A 3XINA 1DJQA 4HPHA 3KDNA 4O0KA 1KBLA 3KL3A 4K8HA 2QUUA 1ZTVA 5ABGA 1W1ZA 4RKAA 3ELFA 1E71M 1IWBA 4J3ZA 1T41A 2NW0A 2Z1SA 3R2GA 3M9YA 1DIKA 1V51A 4Z1BA 1Q66A 1TREA 2NQ9A 2QR6A 3CHFA 3WLRA 3NCOA 3PB0A 4WCJA 2UY3A 1AW5A 3AS1A 4ASTA 3V5OA 2P0OA 1BQGA 3UP8A 2I57A 2CERA 3EEGA 5CGTA 1A3XA 2PDMA 3FV9A 5DF0A 3AALA 4AF0B 3GG8A 3U0HA 2ZFAA 4LYQA 1A0CA 3GSMA 1MQQA 3REQA 2POZA 2FTPA 4IT1A 1Q8AA 3WF0A 3WLMA 3BLDA 4GJIA 3THQA 4MKVA 3VX1A 1OGGA 1C9DA 2J9ZA 2WYSA 5G2IA 3DKJA 1ITQA 1MEIA 5MHBA 3TMQA 1Y8BA 4IWWA 4I5XA 4LVDA 2XWDA 4J27A 1N8IA 1YNQA 4Q8QA 4E38A 1XLCA 5EU9A 1R46A 2AQWA 3A22A 3GTNA 3R8GA 4PBFA 1GGOA 2ZWZA 3DBNA 3MSYA 5JBFA 1FOBA 1BG9A 2ZUNA 3TW9A 4GCAA 1IWAA 2W4XA 2G3IA 2OO6A 4DY1A 1XQLA 1DE6A 3PB2A 3S9YA 2FZ9A 1HG3A 2POTA 4KWUA 1KWGA 3CZGA 2VDIA 3ES7A 2Y8VA 1R30A 5L9FA 4LAOA 4W8AA 1OIFA 2ZA1A 2YSWA 7REQB 1EDQA 2XGBA 4FR1A 2D1ZA 1TR9A 2GQ8A 2Z1BA 4JZ5A 4O0ZA 3ARSA 3WK0A 4K3ZA 4MNLA 1UWQA 4J5NA 3DFOA 8RUCA 3L4YA 2P5NA 2HSAA 5AFDA 1DWGM 3UERA 2IS7A 3EX4A 5AECA 1Q7MA 1CLKA 1JDFA 1IQ8A 2FPVA 1BXNA 5AYBA 3S9ZA 4IJBA 5M2FX 1P6CA 2G96A 5GJPA 1PZ0A 3ITOA 1PZ1A 4GI6A 4JNYA 2YIHA 6XIMA 1R6WA 2ZRWA 3C8NA 3C86A 3URAA 1ZALA 2CLIA 2Z27A 1V93A 2ZXBA 1SUXA 1SZGA 3LENA 1TE1A 3I7SA 2XZ7A 1O1HA 1I2PA 5CSUA 4AZHA 4R53A 4QJ5B 3N2OA 1NDWA 1SFLA 4XD4A 5XINA 2GYIA 5DMLA 3WSUA 4IG2B 5LA0A 4ZA0A 2I16A 2ZA3A 3CEUA 2WNZA 4NX5A 1FQ0A 4AD3A 4A8IA 1QJWA 4IUGA 3W7PA 1V08A 4AVNA 1SFJA 3P3BA 1IGWA 4GQRA 5AC6A 2ZBTA 3L2IA 3G18A 3FJ6A 1YYAA 2R1KA 1CXHA 1XSJA 1YHTA 4QLJA 1UZ4A 5I3GA 5DCEA 3T6CA 3WKZA 4IGHA 1LTDA 1H5VA 4F79A 5E09A 4KCTA 2ZE0A 5D02A 3TP4A 3QYQA 2PU0A 2WW5A 3WLNA 1E0TA 3TWBA 3CUIA 2Z7GA 2AKZA 3U48A 3P67A 2OXNA 3N3MA 1LJYA 2DQXA 4GX9A 1Q6QA 1MXSA 2G97A 1DJYA 2GWGA 3SCSA 4EOUA 4GYPA 5DANA 5E5CA 4Q8PA 5ABEA 3VC6A 3VNLA 2PA6A 1AJZA 3T0CA 4EWJA 4LT9A 2BNJA 3ITVA 4LPCA 4JD4A 1CB7B 3VOGA 1WKDA 4Q4KA 3UWUA 3TTQA 4ZE5A 3CEPA 3SW6A 1XR2A 3Q94A 4AIUA 2FJKA 5A69A 4O8RA 3LGGA 4PCSA 1O5QA 3TWAA 4DPQA 3MDUA 3F2DA 3GU9A 3VIPA 2WC7A 2OGYA 1CECA 3VO0A 3FSUA 2GGGA 5LKYA 2WM1A 1E1CB 2QF7A 2HBXA 3RLUA 3VCCA 3N4FA 3DIPA 3IUHA 3OGSA 3UPMA 4HA0A 3WMCA 1OF6A 4Q3MA 1R0MA 1CI1A 5DO8A 3NO1A 2PBOA 4AG0A 1WX0A 4P2VA 3SUSA 1AJ2A 4EACA 1WZKA 2WSYA 4PMUA 4K7VA 1VF8A 5DMYA 2CZFA 3PUGA 1HKKA 2AKMA 3WQOA 2C14A 3A4JA 4L1GA 2R91A 2VGIA 3UCCA 5A6MA 3O63A 1J0IA 3KOXA 2A0NA 1Q45A 1E6QM 1V0NA 1ZCOA 2Y62A 4GY7A 3KS5A 3FXYA 4MFDA 1X6UA 3IIXA 5AHMA 1KW1A 1AQFA 2Z6JA 4EPEC 4AMAA 4GGBA 3GH7A 4Y6GA 3UJEA 1HNYA 3NSXA 4C1KA 1YNYA 4L5ZA 3WF3A 3UG8A 3GNNA 1NP2A 1JCJA 3WD1A 3ZSSA 3CHEA 4B3ZA 2FQIA 4HZMA 4B4FA 4GOAA 2PWVA 1H60A 3PZUA 4K2SA 4JYDA 4WX2A 3TDFA 1CDGA 1BGGA 3TTYA 1JULA 3E12A 2Z1KA 1FHLA 4MIMA 4ES4A 1F73A 1S2WA 4V27A 4E8CA 3A64A 1REQA 1WBJA 1GOKA 2PSNA 3GDKA 3SECA 1O1ZA 2REQA 3HPXA 8CGTA 3HPFA 1ZCCA 4U3AA 3CMFA 2VZOA 3THCA 4C6EA 2B0MA 4O8AA 8A3HA 3DG6A 2BY2A 2PDPA 2DVUA 4HZ6A 4ZXOA 3ABSA 4OUIA 1H1YA 4O1BA 1EEXA 2WZEA 3ZWTA 1XIIA 4FP1A 3W1MA 2CEQA 4IIEA 3RG6A 4R9OA 2A5HA 5J5DA 3LTYA 3TU9A 1XV8A 1V3MA 2W6RA 3LPGA 2CLHA 3T9PA 3T4WA 4DWSB 5CZ0A 3WQ5A 3R89A 1W56A 3MSGA 1OZQA 2O7SA 3LXCA 1OIMA 4R34A 3IGUA 3E96A 2IPWA 4S1FA 3OLDA 4RE4A 3VA8A 1KWKA 3ZVHA 4GVIA 3KBWA 3UZ5A 1IXNA 3VZXA 4IPJA 4ACYA 3VOFA 1AD1A 1TWDA 2DUXA 1H61A 1I2NA 3WDIA 3W1LA 4FB7A 3CMJA 4J2MA 3NO5A 4H3DA 3PG8A 1SPQA 3QBUA 1Z48A 4S2BA 2OX4A 1VENA 5TQLA 4AD4A 2D20A 1QR7A 4QIUA 3AXXA 1CYGA 3S42A 5I3DA 3LD5A 1BYBA 1IEVA 2VM8A 3A4XA 3RXZA 3PJWA 4H00A 3BGJA 1TCDA 2NX9A 2VVNA 3K46A 4DEFA 3HJZA 1FTXA 1ZFJA 1ADOA 1GVSA 1I60A 1J0KA 3M1ZA 1UH3A 1ZB5A 4XX6A 2V3DA 1WBHA 3GHUA 1J2WA 4G2DA 4QISA 4LUJA 1H62A 1BWVA 1YPIA 4IFKA 1GVIA 4BWLA 4PSPA 3W7GA 3AI0A 4HYWA 4YHGA 2YFNA 6TAAA 2ZDSA 3CH0A 1R87A 1BF6A 1RALA 1QBAA 1LOLA 1LBFA 1FWCC 2GJPA 4AVFA 2INEA 3VXGA 2PI6A 2IPJA 5E93A 2XVNA 1XBYA 4GI8A 4RL3A 2TODA 4C1LA 1WAWA 4I8YA 3MPGA 2OR2A 3H2NA 1ISVA 2G3FA 1B30A 6TIMA 3SSJA 3NZQA 1JRBA 1ZPTA 1JI2A 1Z9AA 3WO8A 4TX6A 3JVAA 3WQ8A 2ACUA 4S3BA 3ZT6A 2HMCA 3CS2A 5I09A 1LLWA 1FP8A 1OGBA 4ZQNA 4ZTXA 3BSGA 4PTMA 3GDLA 4E2OA 1UR8A 3PZOA 3WN6A 4QCEA 2ZXDA 3PBVA 4F0RA 1AQMA 4REQB 1GPWA 2YZRA 3HG4A 3M7WA 1Y5WA 3VDCA 4JDYA 7CGTA 3EGJA 3GAYA 1OK4A 1GEHA 3ARYA 4CNSA 1NARA 1WZAA 4L61A 4H8NA 3RU8X 4CEUC 3ZVIA 1HT6A 4LOCA 2HK1A 4DXKA 5FJPA 1UWIA 1HL8A 4M5PA 3AHXA 4FR6A 4IQEA 3ABZA 4OE7A 2WKGA 4FHAA 4GYJA 4UMCA 3HURA 1EUAA 2NLYA 1KLZA 4GZEA 5EMJA 1J01A 1IWPA 4GUHA 2OFJA 2JE8A 2WBGA 3VNKA 2ZRXA 2DW7A 1XXXA 3GDTA 3KVJA 1KQYA 3GR8A 5C0QA 1LROA 4GGHA 1NAL1 3RMJA 4K6AA 2BGQA 1E15A 3O7UA 1JPIA 1KR1A 4J1OA 3QF0A 1J96A 1NQKA 2GOUA 3L4VA 3R12A 3KP0A 2J8GA 4C6JA 5AC7A 3CQHA 4GNVA 4H83A 4XD6A 4LRTA 1K9TA 1EJTC 3NQFA 1Q2SA 3E74A 3QZEA 2UBPC 2J62A 2ZA2A 1TJ2A 3W7IA 3HV8A 3GXMA 3LXAA 1S2AA 4NJKA 5E0CA 4QP0A 4FK9A 5CGMA 3TQKA 1P0DA 3R94A 4PYSA 3IIPA 3VGBA 4PGLA 4HNVA 1X39A 3R4IA 1KR0A 4PFHA 3L12A 1RJQA 2QGHA 3BMVA 2WCSA 2YLLA 3N13A 1J0YA 4MZ8A 1HXJA 1NY1A 3CO8A 1TPUA 4N6EA 1IV8A 2VDGA 2ZIDA 3CZEA 1REQB 2NQJA 5REQA 5HQMA 3SFWA 4IQJA 3RRAA 4GX8A 4AHQA 2HTMA 4ZEPA 1OF8A 2ZVIA 4KIRA 2PEVA 4WKFA 3W88A 3WLPA 1Q2RA 1GW9A 4GD0A 3G1SA 3B05A 1PTDA 4AW7A 1E0UA 4MUPA 1F8IA 1VYRA 3TA9A 1A80A 5LIXX 3DENA 1EF2A 4ATDA 1YTKA 1WOAA 4OUEA 2QULA 3LB0A 1AQ0A 2QW5A 3W1RA 2V30A 4LVFA 1J6PA 4H8VA 4CD6A 3EXRA 3QLLA 4I6VA 2CBVA 4C6OA 1OT1A 4HA1A 3SUTA 1FWEC 3VGFA 5JH2A 2P8BA 3SCTA 2ZC1A 5D9PA 4C7DA 3P60A 2VXNA 1XGDA 3ECQA 3I6EA 1KXTA 4OV9A 3GE7A 1L6GA 1SU5A 1B57A 1KFJA 4UUIA 1KBIA 3LN3A 1DJHA 1H7OA 4F4RA 3LM7A 1DEDA 1UD8A 3ARVA 4LGXA 4AZBA 3AHVA 5A6JA 4PUMA 4UTMA 1JFXA 3WEZA 3SRDA 2A21A 4Q4RA 2C8NA 4V15A 1UROA 2ZTJA 1V77A 4AISA 1TVNA 3DFHA 2KX9A 2NZLA 4JQ1A 1JDAA 1H09A 3GH5A 3FVMA 1H0IA 1E51A 1Q6DA 5RUBA 4MF4A 4H04A 3KBSA 3TNOA 3B0YA 4DUOA 3TJXA 5GJNA 3PBMA 3PP7A 1LQ0A 4PSRA 4WIWA 4MB4A 1F6KA 3EB4A 2YJQA 4GWEA 2RUSA 3LSCA 4Z1AA 3EWWA 2A1YA 5A2CA 2PLJA 1ZGDA 1XHGA 1FWIC 1GPFA 2C79A 4OZOA 1W31A 1KCXA 2QCMA 3AU2A 3IJ7A 3RGTA 1PS9A 1GZJA 4HNTA 4N9BA 5E9XA 4S3DA 2YDRA 5DBUA 4DBUA 3EWXA 1R9XA 1VYSX 1QDSA 1PPIA 1K6AA 3TLQA 4H1ZA 2BHZA 4Q4SA 2JIWA 3QEZA 1HL2A 1SO3A 4PRWA 4HGXA 3VK5A 1IZKA 1V79A 5LGXA 1NQ6A 2NXIA 3UCQA 1V3JA 1NDYA 2VR4A 1PIIA 2XIBA 4PUEA 1RXOB 4S3AA 1I75A 4GY1A 1HQTA 3CV2A 1TRDA 4K39A 3JZEA 3AOFA 4JOMA 2C1HA 3R0KA 3PBUA 1ICSA 1VH7A 3W76A 1TPWA 3LX9A 2P76A 1KRCC 1TTJA 1US0A 2EXOA 1J2BA 3NQBA 3U5YA 5JUVA 2PLCA 3QKEA 4MSSA 4F9JA 3VDHA 4CNOA 1GOWA 3B8WA 1W1A1 2XN0A 3G1RA 4FZIA 1QW7A 2OQHA 4GACA 2E6FA 1VKFA 3LPFA 4Y9OA 2BVYA 1TCMA 4FXFA 1H49A 4IMDA 3I68A 2DT3A 2A3AA 2BBFA 2HVOA 1PCWA 1UR2A 3W7NA 5G2HA 3KBVA 3Q37A 3MW7A 2RFGA 3MVTA 2YB4A 3EMZA 3B97A 1E6SM 2PDHA 6CGTA 4HSOA 4P8UA 5D9OA 2P53A 5HINA 4O52A 1OCQA 1RZMA 3USBA 5ENLA 2RGMA 1SR0A 3KM8A 4AWSA 3POCA 1FWGC 5J04A 2HNHA 1UD6A 4N02A 3VX0A 1F3WA 3WENA 1XPGA 1VCGA 1EB3A 4JIIX 4MJ2A 3W70A 2BZNA 3TAKA 1JRCA 3K8KA 1U2YA 3S2NA 3A47A 2V2CA 1V0MA 4DHGA 3S6OA 3I6TA 2OB3A 4PBGA 3KDOA 3KBMA 4NU7A 3C2FA 3G2GA 3PZQA 2QCEA 2VR5A 3LCIA 1WB0A 3IWPA 4KQNA 5XIAA 1XIJA 4L65A 3QV9A 3IVUA 3NQMA 4RXFA 4O1FA 1A4LA 4H7CA 3VINA 4JR5A 3S8HA 4NX0A 3LSBA 4UQEA 4AY8A 1YE6A 2YYUA 3CAKA 2BVTA 4LBSA 5BYWA 3E3HA 2P50A 1L8NA 3W37A 4K37A 4K8GA 2YXOA 4MYXA 4B5XA 2V6AA 4RR4A 2W91A 4US5A 2XHYA 3VD3A 2FB3A 5D30A 3B8TA 2EPLX 2D23A 3MV11 5REQB 4FNRA 3VABA 3RN6A 2OOFA 3UJFA 1XX1A 2CLFA 1E56A 1FWSA 4UNKA 3L4ZA 3UR2A 2WMKA 1YXYA 4HJFA 9RUBA 3LV6A 3N2MA 3VZYA 1E6XM 3AWNA 2J74A 3JRKA 1YE4A 5A95A 5IRPA 2GDVA 4JTHA 1YMYA 2PODA 3WH6A 1GVRA 1EJWC 2GVLA 4HSHA 2HCVA 4CN4A 2Q3RA 4E8DA 5DT5A 3WX7A 2VHLA 3BAIA 4PEKA 1NH6A 1EHNA 1W9BM 3MWAA 1BKHA 3LEPA 2AL2A 3BJSA 4UWMA 1BRLA 5K3VA 5LSMA 5GQBA 5D03A 1R3YA 1T99A 4X61A 3NPUA 3FX4A 4NZ1A 2A7PA 2W62A 4L6HA 4OQVA 3E2QA 3OJGA 3BOLA 3B9OA 2C19A 4GRSA 3NEVA 4JDBA 3OVGA 2Y85A 2ZWYA 4L1XA 2JF7A 2CHOA 3IVTA 4W86A 2V3FA 2V8ZA 2FGLA 3GY1A 3UR8A 1WDPA 2QQ6A 3BOXA 4U3CA 5F7UA 4UFHA 4HNOA 5MKGB 2OSWA 3MUY1 3B8SA 3OGVA 1UD2A 4FPSA 5U7SA 3IJ6A 3KRSA 3SN0A 3AU6A 3AHTA 3BLKA 2YCJA 3PF3A 1GKPA 4IFOA 3W2KA 1TWZA 5KZEA 3PSVA 1R7OA 4QAWA 1ZAHA 2V5KA 3JU2A 1G4SA 2EO7A 3G0UA 3IIZA 5HNNA 4JX5A 4KRZA 2B7OA 4ZQMA 4AIBA 3VIGA 2OG9A 5AHFA 1KRAC 3A24A 4MWAE 2AMGA 2OQYA 5DCDA 1QNPA 2Y88A 4GYKA 2Z2AA 1HVXA 3FDKA 1W3IA 2C71A 3QHNA 1R3QA 4UFKA 4S3JA 3LCHA 1C90A 4A8RA 4JKMA 2HE8A 3FAXA 1QWKA 3VD9A 1P0BA 4WXYA 2VZTA 4WJXA 4V33A 5A1AA 3W00A 5CG7A 1DVJA 1NIUA 3TC3A 2ZRVA 2YCKX 3TW6A 3W7MA 4BEQA 1Z89A 3NJ3A 3TR2A 1B54A 2FMOA 1ZQ5A 3FY1A 3KWXA 5LZLA 1FWHC 1YEYA 2DZXA 1J4EA 3QXBA 4I9JA 3RM4A 3S5OA 7TAAA 1V6XA 3SIZA 4PUKA 1DJZA 4G8TA 1WNOA 2GDUA 3BAKA 2GUYA 3NDOA 2Y5JA 1BVWA 4UTTA 1X38A 1ZAJA 1MUCA 3SGGA 2V3EA 3N6HA 1VHNA 2YA1A 5I3FA 1XS2A 1P48A 4IQDA 1X1ZA 1A3HA 2WZMA 3WFAA 1XBVA 3TKFA 3FS2A 1VCFA 3U2CA 4WKAA 3BLFA 4MB1A 3L66A 1JYXA 1YDNA 2Q8XA 4FOJA 5KINA 4HSNA 1XYAA 2QVHA 4Z2IA 1GVEA 3O6YX 3MYOA 4UR9A 3VNZA 4BHYA 1O5XA 2FVKA 2WMFA 2OOGA 1X6NA 2DH3A 3OB8A 2OO0A 2ISVA 3POHA 3RITA 3EKGA 4J3TA 4R9XA 1LUCA 5BXSA 3DYPA 1S3TC 3SUVA 1QFEA 1XPYA 5AYIA 3DYMA 4RLIA 1GVQA 3B9AA 3WJZA 1QK0A 4AX7A 5D9NA 3Q45A 3D46A 3ARPA 2PZNA 4REQA 3AIWA 4C91A 4JXCA 3DHPA 1RA5A 3VKCA 3AMDA 1WO2A 3ZFHA 3LA4A 2CZDA 2NT0A 4NJHA 3AXKA 2JBMA 3NWRA 1V7YA 3T8QA 3WD3A 4S2CA 1PX4A 1BD0A 3OO2A 5B7ZA 3HPAA 3RMEA 5CJNA 2C91A 2BDQA 3P6LA 4OV4A 1TZZA 5L6UA 4JTGA 3NZ1A 1M9HA 2QCNA 4ZTYA 1EHAA 2YDSA 4XTDA 1EJRC 2EG6A 4ICMA 5KSWA 2NUWA 3A9IA 3B8UA 3F4NA 4NZ5A 3PTDA 5M17A 2Z29A 1A0DA 4NZ3A 3BAXA 4HKPA 4KEZA 4ZOCA 3T81A 3LG3A 2A2IA 3KBJA 1C3FA 4RE2A 1EQPA 2PFHA 3UWYA 3G22A 3SCPA 3TYUA 2I5QA 4R7OA 4TMCA 1VBGA 5CXPA 1U33A 3K4AA 4HU4A 3HQNA 3BAJA 3OTRA 3DOPA 4NY2A 1U83A 3W6LA 1F4AA 4DO5A 4AVOA 5CPQA 3RCMA 4N9CA 4IM4A 1AK5A 3BZGA 1YRRA 4WEVX 5FJOA 4BFAA 2I17A 3EBVA 5DQPA 2DUAA 4CD4A 2XH0A 1W3TA 3N19B 3T42A 1SFSA 3AMLA 2YZ5A 4WDTA 2Y5EA 1IF2A 1CIUA 3UVAA 4Z1YA 1ZNNA 1Q6CA 4BI5A 4FMVA 2NQLA 2VC7A 3U7BA 2A3EA 3T40A 2RDTA 3FSTA 3SR7A 4EX4A 3C2YA 3SN4A 2QPUA 3ABXA 1BYDA 3KTXA 3H7UA 3TYEA 1M7PA 3PUDA 2EHHA 1YX1A 1S2UA 1ZZMA 1KKOA 4AWUA 1JQVA 1J0ZA 2BB0A 1PL9A 3VC5A 3WJXA 4LYPA 4DBWA 4TVCA 2VFFA 3WLQA 1Y5VA 3T0DA 4FXJA 1G69A 2UV8G 1OJXA 2PGFA 4XAGA 5FOOA 1QPNA 3IAQA 3JZUA 3PBWA 5G4EA 3TNBA 2DIKA 1VIZA 4PB4A 3QC3A 3L2LA 2FGZA 1DV7A 2BODX 3FEQA 4DJED 2ABAA 3R79A 1I0DA 1K4HA 5LYRA 3FOKA 1JDCA 1Y65A 4NZJA 2JGQA 2NV9A 1V8EA 3SY5A 3WH7A 4NNAA 3W1TA 2OX1A 1F76A 4EAMA 2ISWA 4IP5A 2VZUA 3ZLGA 4YWIA 1W9UA 1GT8A 2E9BA 3BSMA 2IPFA 4US5D 1SVDA 3BICA 4N4QA 2ABBA 2O92A 4YTSA 3URNA 4R85A 4M1RA 4Z1CA 2ZX9A 3NQ6A 4I5RA 4LAMA 3M0LA 2VDHA 4HHHA 5KETA 2FHBA 3DI0A 4UR8A 2E3ZA 3IAPA 5D05A 1Q63A 2ISSA 2OVLA 3CASA 3WH5A 1TPC1 2WO5A 3UETA 4MZYA 4MWAA 4ML4A 1E1EA 2J7HA 3C0QA 1FFQA 3FYOA 4I9MA 4L1WA 4LVBA 5CC6A 3TSBA 1OINA 1G4TA 2BY1A 4E4UA 3QOKA 4IIDA 4YTRA 2V81A 1C8XA 5FCZA 4QS5A 4ZR8A 4DM2A 5FESA 3WQVA 3DFPA 3TYDA 3U8GA 3CZKA 3HTWA 1SR9A 2O55A 4IIHA 2QCLA 4N7QA 1GG1A 1LRTA 4LV4A 2ZUTA 3W29A 1NM9A 2ON3A 1XLEA 2RJGA 5FA5A 4WLCA 3KUMA 5HJXA 3DG3A 4KGLA 5HNRA 3AXIA 1ZBCA 3ZIZA 1O95A 4LW7A 4IX2A 4GZ7A 2EKGA 2XM1A 3W6YA 4HJWA 1ZJIA 3B03A 1GTEA 2V5JA 4O10A 1W3NA 3WD4A 3UZWA 5LXXA 2Z00A 2NSXA 1UD5A 3T05A 5HMFA 4GE8A 5AVHA 4IPPA 3P84A 2H3DA 4FLQA 3SFKA 3GVRA 4I9AA 1UR9A 4A2RA 4E3TA 1OY0A 1X7FA 4AY1A 3OBEA 1CPUA 1UP0A 4C6CA 3CYVA 3QR1A 4I5UA 4AWEA 3LHVA 3P0WA 2R1LA 2MNRA 4L9ZA 4CQBA 3F4VA 1FH9A 1PEZA 5CGQA 3R11A 4C6IA 5CBJA 1RD6A 3NZGA 3F5LA 4HA3A 1XLJA 3GXFA 1UP2A 2DORA 3H22A 3AZSA 1XD0A 2WMJA 1KGWA 3UG4A 1RV8A 1UC5A 1OFAA 2CCRA 4Q8TA 4YXGA 2P3EA 3G0SA 3O1NA 4PMDA 4XWUA 5JIWA 2Y8UA 1AODA 3GIQA 4C65A 2O56A 3RF9A 1A5BA 4J3UA 2WXDM 1RCOB 3MC5A 3KL0A 1A49A 2FPTA 1H50A 1WDWA 2R1NA 3IJQA 5MKGA 3WQDA 2JF6A 3APYA 4FX6M 1NVMA 3F4WA 3C52A 3PWAA 3OEXA 3OODA 3W25A 3P74A 3MI3A 1BEUA 1XQKA 3HG3A 4MHBA 3DECA 3UYCA 3VKJA 2WBKA 4XBSA 4R33A 3BE7A 3ABRA 1VYPX 1G4PA 4R5EA 1D3HA 4XV0A 4JTLA 1TPVA 2VMFA 3VNIA 3A9BA 2W3ZA 1I6NA 3MUIA 4CGTA 1BTCA 4TOQA 3WYZA 3ERPA 1RLCL 1HIZA 5JMUA 1SO6A 2PDYA 3O15A 4CUCA 2VT0A 3M5ZA 3M0JA 2B7NA 2OSXA 4O4VA 3VUPA 2ZZ2A 1NP0A 4QJ4B 1XH0A 1UC4A 3UGRA 3QPZA 1XIDA 2OEMA 2O9OA 1FA2A 2J24A 2WSKA 4A2SA 2NSOA 1KNWA 5A6AA 3MO7A 2QCDA 2ZRZA 1F3TA 1LBMA 3W1QA 3WQPA 4H01A 4XSLA 1B4EA 1LOQA 4FNPA 2F6XA 1P0EA 3H8AA 2GSEA 4JCMA 3ARRA 3PY2A 2ZQ0A 3CZJA 4C5YA 3OG3A 4TX8A 6REQB 3MT1A 4AX6A 5T8GA 3MBDA 3BC9A 5K2ZA 2YBVA 2OZ8A 3DX5A 2Y0FA 5IDZA 1KM1A 4KPLA 1JUKA 5G5IA 3IJIA 3NXFA 4ZB5A 1LCOA 5EA9A 3W83A 4BF9A 1FCVA 1GZGA 3AYVA 1JG9A 4PMOA 1JPMA 1HJUA 1C8YA 4RXGA 4UTHA 1SZRA 3T2OA 4DJDC 4JY8A 1EA0A 2A7NA 1IEWA 3OLIA 3IGXA 3L68A 4F3HA 5D2WA 1GYLA 4GABA 3EWYA 3RU6A 2XIMA 2IKIA 3ITCA 3HA1A 1BWKA 4BS0A 5A3HA 3QGKC 1EEPA 1XGEA 2QCCA 3ZWSA 4YTTA 1E5JA 3VI2A 3IK2A 2R82A 5CSYA 2NX1A 3HGJA 4EIVA 1IT7A 2A6LA 1CGXA 4QR6A 1F74A 3HU7A 4U2ZA 4B92A 1G1YA 3NQ7A 3PPGA 4UZUA 1MQPA 3A5FA 1C93A 1C91A 4FNUA 3GHRA 1R85A 4H6RA 2VGGA 1VD6A 4QE1A 1WYIA 3F5KA 5LHEA 2FYMA 1EOKA 2C13A 4Q8WA 1GK8A 2GLKA 4GUFA 1YXCA 2PP1A 3UZJA 3KX6A 5M3WA 3HMCA 2X8RA 1MXDA 1O5KA 1UW9A 3GW0A 2E0PA 1FWFC 3SBFA 4D8LA 1DBTA 5FI8A 4ZOAA 1SZFA 3I65A 1TIWA 4ROPA 2VNCA 4TUFA 2VEFA 2J9YA 1QW9A 1XIBA 1H3GA 1P6WA 4L6OA 1XRVA 4X2PA 1JEZA 2ZUUA 3MQTA 8XIMA 2O4MA 1AMYA 4S3EA 4K1GA 5J8LA 3KXQA 4W84A 1TMLA 2DUZA 3D47A 1GOOA 4IICA 1KRBC 1BLIA 3GG0A 4HU0A 1FWAC 1KFBA 3MS8A 4DN1A 5DRCA 3OBKA 4GI4A 2IUZA 4UTFA 4DAIA 3TFCA 2OELA 3HGRA 3TTSA 4MNJA 3QM3A 4ZXLA 5F4WA 3KVMA 2BVWA 5CSRA 3CIVA 4NAEB 4RZ5A 3CXOA 2VGFA 4HNCA 3G1AA 4LB4A 3C3NA 5A94A 4INFA 2Y2WA 5I00A 2D22A 4BQ5A 3QV7A 2VRQA 4AC1X 3H53A 1GVYA 3KRZA 1RQHA 1IXQA 2Z4GA 1V5XA 2P1FA 3LCXA 4G56A 4QS6A 5I3JA 3PULA 4F48A 3WNNA 4F0MA 5U4NA 2OT0A 5HMSA 3UW6A 1RH9A 3AROA 2CU0A 1Z41A 1IIGA 1JCMP 4WK9A 5E70A 4AUBA 5C5YA 3VTRA 3IARA 2BOEX 4FXRA 1VCVA 3H21A 3E0FA 5LNVA 2XVPA 4L80A 3A21A 3W81A 3H4GA 2OYMA 4E4PA 2WPBA 3UESA 4IP7A 3GXDA 1DOSA 5JBDA 3OPSA 3STGA 3E49A 4MYAA 1CLVA 1ITXA 3P81A 3KWSA 1JUBA 2NUYA 4QFUA 1ZSXA 1H41A 1J5SA 2DSWA 3BMWA 4NNBA 5C9RA 1V6WA 2Z2BA 4D6IA 3IIVA 3L4TA 3R58A 2O9PA 4AZCA 1TJPA 2ZXAA 2X41A 2XYLA 3RM9A 1QCWA 3NQAA 3BWWA 2TYSA 4L9YA 3JUGA 2WZIA 1E6ZA 1B3YA 1GOIA 2HJPA 3FKRA 1EC8A 1KV8A 3L0NA 4W88A 4A3HA 5IOBA 1U1HA 1PB0A 3W7CA 1WA3A 1R9ZA 2HEJA 3C4UA 3MSRA 3K8LA 3WFLA 2NXHA 3APTA 3WBXA 2FHFA 1WP6A 4LUTA 4AEEA 5HMDA 2F38A 1LLZA 2A85A 3OVRA 1PCKA 2W63A 3IGSA 6ENLA 4NASA 1VBJA 4H8UA 4GXPA 4HYRA 3TXZA 3FN9A 1F61A 3AAMA 1YDVA 1KM3A 1EH9A 4KFPA 1OWQA 2Y7DA 2DIJA 5HJYA 3WUBA 3CUGA 2C0HA 1X97A 2DZBA 1P0NA 1PHWA 2E25A 4QNEA 3UA4A 3N2BA 1K9FA 3W7DA 2CLKA 4MMWA 2FH8A 2VD8A 3WQ4A 3QV6A 4XTIA 3TXVA 1ZL1A 2PDFA 1R47A 2OWXA 4UC5A 2V68A 3LOTA 2ZICA 3M43A 1V02E 4MLRA 1I2RA 4RNIA 2V3GA 2UWFA 2Q02A 1ME8A 1R9YA 1XFCA 4DJEA 2PAJA 3AXMA 4BZYA 5CQ1A 1EBHA 2WVTA 3MDWA 4PCPA 1G7UA 4TR9A 3VM7A 4QE4A 4Q6JA 2ZRYA 4W89A 1TWWA 5LGZA 5F1UA 1SO5A 1FWRA 1V3IA 1Q7QA 3G1FA 4UNIA 3RUBL 5I07A 3CUHA 4JIEA 1HZYA 4CNNA 2XWEA 4DF0A 5AZ1A 3GNDA 1CGWA 3I3BA 5IM51 3IPWA 1NF0A 4NYUA 4RZBA 3RFAA 4DJDA 3W22A 3LLDA 1M7OA 3HGOA 3E2SA 1Q6EA 1BVZA 1UKSA 1TQJA 3O16A 1ISWA 1Y7VA 2WMGA 1RA0A 1EWEA 1VS1A 4HN8A 1XD1A 5A6TC 4PBEA 4X3ZA 3TAOA 1D8CA 4J9JA 3FVDA 3QGVA 4V1YA 3ARXA 3GIPA 1XW8A 4KMQA 4B5WA 1EOMA 5CPSA 2DZAA 2ODOA 1WAUA 4Z2HA 2GDQA 4DWDA 1CXFA 1UMYA 4GIRA 4I6KA 3P5YA 4URIA 3B9DA 2Y4SA 3MMDA 3V4BA 1UWRA 1W5QA 2G4FA 3ALGA 2FVMA 4H9UA 4DYEA 4CQ9A 4ACZA 1EJ7L 3QN3A 4UXDA 1LP6A 4G5DA 3W3OA 1KXQA 2ZUSA 3CV1A 2VEGA 3BGAA 2BFGA 4O11A 4C6FA 3VM5A 4NZFA 1TKKA 3P61A 3CQJA 3KAOA 1YTDA 3RX2A 4PUDA 1SQ7A 4WY0B 5BCAA 4XZ9A 2E40A 1KCLA 2BHYA 3HPSA 3G24A 2QDHA 3KCLA 4PTVA 4U4MA 1TG7A 4QSHA 2RGLA 1E4MM 3EOSA 3L5MA 1JZ4A 3RYSA 5HBFA 5DELA 3EOUA 2QJNA 4MUZA 4ATLA 3TC6A 3GNPA 3WLIA 1JPKA 1ISXA 2AAMA 5D2XA 2IQDA 3S0CA 1KBJA 2H90A 3R43A 1P7TB 1DE5A 3CAWA 1SSGA 3F4CA 3S2JA 4S38A 2Y24A 4B16A 2CBUA 4Z2LA 5C2GA 5F4SA 3HO8A 2BXYA 3VIIA 1PAMA 2QJHA 5C55A 3DH7A 2GPTA 3L5AA 3W7EA 4WDWA 4LC8A 3G8RA 3BCJA 1Q5MA 3AZTA 3C2VA 4XAPA 1XLIA 5FEZA 4IFKB 4IIBA 3TH6A 5CLTA 5E0FA 2EG8A 4PR4A 3ITTA 1L0PA 2NQ5A 1SW3A 3C0SA 5D2TA 3OA5A 3WQCA 4E2VA 3HZ3A 4FF5A 2GFTA 4EF9A 1NEYA 2W9MA 1E55A 3N9KA 5FACA 2QUMA 1OX4A 4J3VA 1KGUA 3Q4DA 5CZKA 1W5PA 4PH6A 3M7SA 1JVNA 1EO7A 4QBXA 1R5YA 1JF6A 5K4ZA 3AICA 1K1DA 2I14A 4PCTA 1U5JA 3AIVA 1JGMA 2DPEA 4ZSTA 4UFLA 1UUOA 4IP4A 4FEZA 4XZBA 2P0IA 1J6OA 2RKXA 3WFZA 5T9CE 1VBUA 3QKZA 3W71A 4BK9A 1VFTA 3VOCA 1QK2A 5ECVA 1OFPA 2IPGA 4XD5A 5EY5A 1WXZA 1P6BA 1PE1A 1I1WA 2WMHA 2OSYA 1UG6A 3R10A 4CN6A 1W1B1 4FX7A 1QW8A 9CGTA 1UWSA 2WMIA 3LRKA 2E4TA 1Z7AA 2JIEA 1PTAA 4ORMA 2QUTA 1NWRA 3I10A 5E6ZA 2FFIA 4Z2KA 1GJWA 4N6FA 4RCXA 1K7EA 3CUXA 1J0HA 5I78A 5MF5A 1ENUA 3URQA 4PMJA 5HK4A 2Z1XA 4Z42C 1EDTA 1U5VA 1TV8A 2O4QA 1EP2A 1WDRA 3TE9A 3T09A 1E4LA 4MNKA 4OIFA 2XGZA 2YLAA 2OU4A 2PGWA 4I7UA 3H2EA 1H7XA 2JKEA 1LRNA 4YMZA 1OT2A 3WMLA 3N11A 2GGEA 4QITA 3AHZA 4B9YA 1H63A 2VO5A 1B3ZA 1Y5XA 3PK7A 4LF1A 1SFTA 3M64A 1JDEA 3OQ8A 4N2YA 1HN1A 1EX1A 2YCIX 3N9SA 9XIAA 1VHCA 1BYCA 1J18A 1I8JA 1LWIA 1YPXA 1V6TA 5A8QA 3LLXA 3BV4A 2D69A 3K2GA 1N7KA 3DFSA 1JL8A 4Q8MA 4GC3A 2BHUA 3HFTA 2TSYA 2J6XA 3WDJA 4LVAA 1LWJA 4DO7A 1B5TA 4R3UA 2W61A 1TUFA 2VQUA 1KFKA 5C70A 1HKVA 1Q4NX 3B0PA 1KFEA 1I2QA 1OZMA 5IHRA 3OLEA 3KP1A 1BG4A 4LU0A 1DPMA 1PZ2A 1PO9A 3NOYA 4XUGA 2J7CA 1UQYA 2R24A 2G4JA 3DN5A 2O9RA 4QNWA 4ZSUA 3U5UA 4G7FA 3PFRA 1B9ZA 1O6IA 3HG5A 2RAGA 4UOQA 3WQGA 2YL6A 3LHWA 5BZAA 1VLWA 3UJSA 2ALDA 5HQEA 1P1XA 4DZAA 3S1XA 5HUPA 5A6LA 3UNTA 2W5FA 3D3AA 3NA8A 3AUJA 3NTYA 1BGAA 1UIPA 1EBGA 2QT3A 5FF3A 3LBMA 2J88A 5FF2A 3N6JA 4MADA 3MI6A 1H5YA 1DJNA 2OT1A 2YW4A 3NGFA 4GJJA 1S1RA 2D24A 2Q8ZA 3UZXA 3MJYA 2PGEA 3OG2A 3BPWA 1VEOA 3AISA 5BMWA 1VC4A 1L6FA 4D6CA 3ZJ7A 5FEWA 4NF7A 3PANA 5CPOA 4O54A 1BAGA 5HWNA 4LWWA 2R1MA 4TTUA 2JEQA 4EAYA 1T5AA 3BZJA 1TPEA 3LDVA 4LJ3A 2FZBA 3NO3A 4HTBA 3H12A 2ZUWA 4S3KA 4WGHA 3G1HA 4MOZA 4MFEA 2VRKA 5GVJA 4KRUA 3LS9A 4Y9PA 3BLIA 4BWLC 1K8YA 2VZVA 2YA0A 2Q01A 3K1GA 4YTQA 3RLVA 3WBWA 4ZFMA 1U22A 2H3BA 4PCFA 4DNMA 4KT2A 2VURA 3VDBA 3M47A 1TFVA 1AUSL 3WNPA 3CHCA 1E72M 2GOKA 3EA1A 3LCWA 3S3GA 3OYZA 3WF2A 1BWLA 1V3KA 5D8WA 4IIGA 2VRJA 4HIBA 4E2DA 1AD4A 1CXKA 1Z44A 1CWYA 7XIMA 3EDDA 3BJTA 1OFBA 3G1YA 1MVYA 3L5LA 2PC4A 1W1IE 5M5DA 3NPWA 4UFIA 4AXKA 2PWFA 2IXUA 1TJRA 3MP3A 5F2IA 3H23A 3PM6A 3TQ0A 4LUSA 4GFIA 4Y96A 3LYEA 1UB3A 1W0MA 1XYZA 2EJ1A 3S6TA 2IXVA 1XLDA 4S3GA 3SGUA 1ECEA 3TV8A 1R86A 3CB8A 2DSZA 3GBEA 3S46A 1YKWA 3SSZA 1RCXB 3B06A 3ICJA 4HU8A 1MW0A 3INPA 1OFDA 4C1NB 2CLMA 1GOXA 3MMUA 3C3UA 4C90A 5KZMA 1KXVA 3BOFA 4DJFC 3UPWA 1DQWA 3V0TA 3CV6A 4AQLA 3TJLA 2GJXA 3O0KA 4PB5A 5JBEA 2WCGA 4YCPA 4NG3A 5CC3A 2EEXA 1QI0A 4FF7A 3BV7A 4Z1DA 3P14A 4HTYA 4B3LA 2XTKA 4MKNA 4H9MA 3HPZA 2CIPA 4HN4A 1XG3A 1EGVA 3M6YA 4P7OA 5CKSA 3TCSA 1H4PA 1HVQA 3H2OA 3M46A 4JIPA 5CZJA 4BCEA 4NXSA 4HOWA 3FDGA 3SCNA 4HQVA 3AIBA 2QXWA 4YJ5A 1XP3A 3ORWA 4AZIA 5FSEC 4GH1A 4LAUA 4DWSC 1M5WA 1OSEA 1D7FA 1L8PA 3LRMA 2ZTKA 5T26A 1Q3NA 2QNEA 2R14A 1XDMA 3VMOA 4R27A 2Y7GA 1E6NA 3QSTA 3XIMA 1EGMA 3W2UA 3SQSA 3WNMA 4UBPC 4YYCA 1MI3A 3LTSA 4OWGA 1XLBA 5C7HA 2PTWA 4LUSB 2J7FA 3W26A 5BRQA 2X1RA 4RX0A 4M7TA 2KZHA 3V1PA 4OTKA 1RVGA 2OODA 1BYAA 3SCUA 1U30A 2D0FA 2HV5A 4J3WA 2NQZA 1TJ0A 3G5EA 2P10A 7A3HA 1K8CA 1RD5A 2BP1A 1LF1A 1S5TA 1KFLA 1TVLA 3E02A 3DU0A 4HBKA 3QR3A 3UFYA 2PDWA 4O18A 3W2NA 4ALDA 3BURA 3EPOA 5DCBA 2YDAA 3N2TA 4H9ZA 3PC0A 1WXYA 2CITA 1MDRA 1UPMB 1UWUA 1DL3A 2WVUA 1VPQA 2A79A 5A2AA 2Q8LA 3T1GA 3FCPA 4C6KA 3ZLFA 2ZADA 1UJQA 2ZX8A 5TF0A 1HJSA 5D33A 2CXGA 2VX4A 4ACZB 4A6GA 3UXIA 5EMLA 1M7JA 2DSKA 4L4PA 3N12A 1K9DA 4IJCA 4F2UA 2C15A 3OHMB 2TAAA 3E6EA 4LH8A 3I4EA 5H8MA 3CAQA 2CNCA 4P8XA 3BG9A 1Z32X 4CVWA 3WZ0E 3S2LA 1H7RA 1UZ1A 1XRSA 4N42A 4QQ3A 5A8GA 3N73A 2Q6ZA 2X0SA 3U3HA 1GORA 2CHRA 1WKYA 2Y89A 4ZQRA 3DFQA 1QO2A 3H2MA 4XUYA 4W4QA 5C54A 4KWWA 3GW3A 1HGYA 2XIQA 4RPQA 1XDJA 4PMXA 4GXWA 3H2AA 3SCWA 1NJJA 5F1VA 1XLFA 1DWJM 3S2MA 3RCYA 3NFUA 1RUSA 3CNYA 1HJWA 4DELA 5FJJA 1ZBVA 1LBLA 1EIXA 2IW0A 4M82A 3LCGA 5FL1A 3KHJA 1NSJA 1WV2A 4H9YA 2VUYA 3H7VA 3PG9A 1ELSA 2WOQA 4UOZA 2SFPA 5A8NA 3GWQA 5H91A 1JQXA 4CU7A 5HUOA 3H70A 1W2PA 4NQ1A 4KKXA 4UFJA 3Q58A 1VPYA 2VENA 5AZ0A 1FFRA 1R38A 3C56A 1UOKA 2I9EA 5I79A 1SMAA 5LIWX 3RX3A 1YADA 3PAJA 1QU4A 4GXMA 1UKPA 1UWTA 1XGZA 1EC9A 4WOQA 3VIFA 4P7QA 3TROA 1XRTA 4KWOA 3GTHA 3SIMA 5JVLA 1NU5A 2E5DA 4S3CA 1E3ZA 4QRNA 3RNDA 2X1SA 2ACRA 5AHIA 2Y61A 2TMDA 1RHCA 1ONRA 1TQXA 3GXPA 4UTUA 1JI1A 7REQA 2HE5A 1NWSA 2D3LA 4GZIA 2YL8A 1E9LA 2VZSA 3QC0A 4IISA 3KRBA 3WQEA 3W38A 1W9PA 3P7YA 2WHJA 3MP5A 3L4UA 4CCDA 2B7QA 4PCNA 2GWNA 3I7QA 3VYLA 1PWMA 2J25A 1OFEA 1K03A 1CLXA 3H2FA 1PBGA 4NI8A 3W82A 3ZS4A 3KZPA 2GQAA 4CU8A 1MUMA 3C2EA 1A5MC 1POKA 8TIMA 4PFMA 4GIEA 3THAA 1JZ5A 3ANYA 4FOUA 4PTDA 4TQTA 3WELA 1E9ZB 4L64A 4Q4MA 4JL1A 2PLMA 3UQNA 3D0CA 5B7YA 2QYGA 3W7RA 1MDLA 2QDDA 2J7GA 5K9XA 4CQAA 3ZT7A 4GLEA 1LT8A 4JGDA 5FJTA 1I1XA 2GUUA 2CPUA 3EPNA 1W1TA 2ZOXA 3ITLA 4FO4A 5KTLA 3AIUA 1PYMA 2PLKA 2Q71A 1W32A 2PDQA 4JY9A 4P7NA 4M51A 1DTNA 3VKDA 4PUUA 1JUEA 1JNEA 1R2SA 2JKPA 4Q32A 4D6JA 3W6MA 2C1IA 1OX6A 5I7GA 4OECA 5BRBA 1XCFA 1VP5A 3EX6A 1GONA 3UXDA 4GISA 4DNHA 2VEPA 1IT8A 4A4AA 4JN7A 1TV4A 4LALA 2VP8A 3CIWA 2V5CA 4HCLA 5F2MA 2E6DA 4C60A 3S2CA 2JFEX 3EWZA 2NXGA 4I7WA 7PTDA 3WH9A 5T9BG 1AZ2A 2X40A 4DUXA 3MKCA 2Y7FA 4O19A 1UZDA 4IG2A 1WZMA 4B5VA 4O16A 2VOTA 2YCLA 3GD6A 4UTLA 4F0LA 3ZSTA 1TWIA 2H9AB 4XZNX 1ZBWA 2PWUA 4IL0A 1EO5A 1GEQA 3IJ8A 2I56A 1TV2A 3CMGA 2DGAA 1F6YA 1EKOA 2GJNA 4B90A 5C7VA 4TXEA 3WK1A 3SRFA 1S2VA 5JU6A 4M6UA 4WJEA 4HCHA 3P62A 3GKAA 4H2CA 3PBYA 4R7WA 5AHEA 4QG8A 4ADUA 3AS0A 4A05A 2VFGA 4W87A 1DQUA 3RILA 1QNOA 3R8HA 2PTXA 2PDUA 3SY8A 4CQ8A 2UY4A 3NURA 4XIAA 5A8OA 3LNPA 3BXWA 3MMTA 2B81A 2VQTA 4PMRA 2JEPA 4JYEA 1HKMA 4HPGA 3GDRA 4CN1A 1A53A 3NVTA 3TN3A 2HXTA 4JTTA 2OLAA 2CZEA 1XYMA 2WPGA 3URBA 3GR4A 3O2LA 3IUIA 3NG3A 4UTIA 4HMNA 3GIYA 3N17A 2CETA 4M1BA 4K36A 4KEUA 3QJAA 3UXKA 1GVFA 3VD5A 4QX4A 4RDVA 1C9WA 1XWYA 3SCVA 5I3IA 4F0SA 4CD5A 5BXRA 3C5QA 5D2VA 3M4HA 3ISIX 3VKAA 2PGRA 4Y9MA 4DXVA 1E4IA 2Z2UA 4TIMA 3LPPA 1VBRA 2WVVA 2PC8A 3UXLA 3TX9A 2QCGA 3FNDA 3R8RA 2B4GA 4FX8A 5G4HC 5D4YA 3G6LA 1TX0A 2R8WA 2AGKA 2WVVB 3HQOA 1Q6FA 1ADSA 1KB3A 3FGCB 1GUVA 2BXVA 1R3SA 1UHVA 3NUKA 5FAJA 2VKZG 3PUEA 3VMPA 2CBIA 3GVQA 4NNCA 3O6DA 2WC3A 1P5BA 3DESA 3CJPA 1LQAA 1EF3A 1JPHA 4Z08A 2J9XA 2V0TA 5D37A 2CZVA 4XISA 4JTAA 1OYAA 2YOCA 3U2EA 3DUGA 4A3UA 4X2RA 4AIEA 1V6YA 2C6QA 1Z3NA 4XZWA 4YVXA 4HMCA 4LCSA 2F2HA 2J66A 4I9TA 3WNKA 3W2LA 1SJDA 5C9ZA 2R94A 4GG9A 3N9RA 1F3XA 3QH2A 2YDQA 4IQLA 5GJMA 3QPYA 3TN6A 3S6DA 3WLLA 4CNTA 3CL8A 1DXIA 5LHFA 3UWVA 4D9PA 1MUWA 4XIMA 2XIJA 2I9UA 4QE5A 3OHIA 1UJPA 4Y9NA 1KM5A 5FJIA 1TMQA 2DVTA 4F8XA 5JXQA 2FTYA 1DHKA 4F0KA 2YCEA 3P2VA 1OD8A 1TTPA 1WDSA 2Q09A 3LZ3A 1GQLA 5LNWA 4I90A 1K3UA 4NAFB 5I77A 1TA3B 3PJTA 4G1NA 5JH1A 3ARQA 3LRLA 2V38A 4GIAA 5M03A 4O14A 4JBRA 3BMXA 3T2QA 2DZVA 4C6NA 4LUIA 3L67A 3QQ1A 3AO0A 2D2GA 3CAVA 1S1PA 2PWHA 4E4FA 1EPVA 1MWOA 4M6VA 3MB9A 4U10A 1ME9A 3GNOA 1FDJA 3GXTA 2IKGA 4RDYA 2BLEA 1XF0A 3E38A 4DYJA 1EC7A 1W3JA 4HZ8A 1VJIA 2W0UA 3I3DA 4LYKA 1A5KC 3MVIA 3EB3A 1HKWA 4RNHA 1PIGA 3D3FA 4YTUA 1R3RA 2CKSA 3WQ6A 2PDBA 2DZPA 1YW1A 4IXHA 4C6QA 3B3DA 3CTTA 4N9EA 2QHAA 3HFYA 3FYYA 5TNVA 4F2BA 3IIOA 5BNKA 4KFNA 3KVLA 4W5UA 1U1UA 3ZLHA 3RRXA 1JXKA 4MB5A 4MWAB 1HTIA 5EGRA 4GMEA 1IXPA 2PWEA 4L6DA 3WJYA 1JCXA 4UCFA 3M5VA 4HMDA 2VEIA 2JALA 5A6BA 4XZIA 3C0LA 4XKMA 1A47A 4RE0A 4W7WA 4AD0A 4NILA 5D32A 2Y7EA 4MVAA 4W5ZA 1Q8JA 3N4EA 3QTGA 1RJPA 1XISA 5HQLA 1J8VA 4ZZ9A 1SW0A 3WBYA 3F2BA 3WK3A 4HPJA 4P8WA 1E6RA 3U2ZA 5PTDA 5E1QA 4ATWA 1ESWA 2O0TA 5CC7A 3PBGA 1R2TA 3MMWA 1ZU8A 3WLSA 4QJ3B 4QEHA 3VCRA 1S2TA 1FWTA 3E2VA 4NIRA 4ZCWA 1Q4WA 4ZO8A 5AHLA 3GO2A 1XH1A 3LBCA 2G3JA 5FEXA 1AZ1A 1C7SA 4Q4PA 3G6MA 3KLKA 3V5FA 2WMIB 4V1XA 4CNPA 3PPCA 1G0CA 3QY8A 1QAPA 3M6DA 1EYWA 2F2KA 3R6IA 4ZENA 3GNXA 1QTWA 2DZSA 1G6CA 3GFXA 2QMKA 3E0VA 3MHGA 4HVXA 1QI4A 1CGYA 2W79A 4AH7A 5HMEA 4ERAA 3PPHA 3IEBA 1AW1A 1HP4A 3QQ0A 1XKYA 2F9RA 1EA9C 4AEOA 2ASHA 4WQ6A 4WVXA 5DLCA 1DQXA 2E68A 1EFZA 4B5UA 1ZLPA 3UY8A 5FSDC 3CHDA 2FJUB 1MNSA 1DORA 4H8HA 2O9TA 1PKYA 2HRWA 1K7XA 1H7NA 3S9IA 3TOPA 2BOFX 2VCCA 1MQRA 1QUMA 2PS2A 5H6HA 3OQEA 3G77A 1W3HA 4ZOBA 2QVNA 3K8MA 3LHUA 3W1PA 1MW3A 1A5OC 4OBRA 4WSJA 3T44A 4KGJA 4DB7A 2INFA 4AHPA 1OX5A 2F8QA 4PEEA 4FOKA 1DIOA 1D3GA 4CQCA 2DH2A 5HPOA 3QY7A 3ZJKA 3NQDA 3B0VC 3FJ4A 4MDPA 1R3VA 1E5NA 4J35A 3LM3A 1FXPA 3AUOA 1BRLB 5LIUX 4NZ4A 4KCWA 4DM1A 3T7VA 4YIWA 1B0IA 2YL9A 3SGZA 3UWWA 2P8CA 1E6PA 1OK6A 3EOEA 5BXTA 1RK6A 1SJBA 4A35A 1QI2A 2YL5A 4MDOA 1EDGA 1IIHA 4C5ZA 2BMBA 5HATA 4AWTA 2J8FA 2ZZ6A 3BVJA 3PJXA 3EA3A 4UMBA 1L9WA 2VR2A 2DEPA 4XAZA 1PDYA 1XSKA 1ISYA 1U1JA 1B31A 1EGZA 1TTQA 3QW3A 2A3CA 4YS1A 4DF2A 2GJRA 1RLDA 3WJWA 5I06A 4N4PA 4JL2A 3FLUA 1FCQA 5I3KA 1O4UA 2VX7A 2FPYA 4UQCA 1D7KA 3ENLA 2QV4A 3UZZA 4IMCA 3E0IA 5D09A 1TV7A 4EKJA 3T2PA 1VFLA 3W1NA 3VIKA 4J3SA 2FKPA 4LFYA 4GQ0A 1G7VA 3NYDA 3AWOA 1MMFA 1RR2A 3IACA 3GZ3A 3MO4A 3NYZA 3V0SA 1JAEA 5GNYA 3VKBA 3WDRA 3IRSA 4Q7IA 3P93A 2E9LA 3ITYA 5E0KA 2BV9A 3B04A 3ZR5A 1I9CB 1DIEA 4H6KA 3GC5A 1X6LA 4CCZA 3BQ6A 4OOZA 1W9XA 1OEPA 5AB3A 3IJLA 3BW3A 4JFWA 2BY0A 3HB9A 2DZWA 2HK0A 3NZRA 4QLKA 1LG1A 3O6CA 4JQ2A 4Y9AA 4EP8C 3WBAA 3M5XA 2PRMA 3H4WA 3O3RA 3LUTA 4JTKA 1QXLA 4NUWA 1P7TA 2QUVA 3DC0A 5F2LA 3W72A 2FIQA 2NWRA 1W5OA 3GB6A 7ENLA 1K77A 1AG1O 3OGRA 3TCEA 3WEOA 4CEXC 6A3HA 1OC5A 2WJDA 3A3HA 1TUXA 4JFTA 3L4WA 3ITXA 3CHVA 1WE5A 2D2HA 5CPNA 4DLFA 1XIHA 1X8FA 4M7SA 2DQWA 2XG9A 1FWBC 2CESA 1QRQA 5HANA 1XLLA 3WMSA 3OVQA 4RNJA 4JTJA 1O5RA 4GUJA 3T0AA 3LNMA 1PXGA 3ITGA 5A5WA 4C1NA 2Y5SA 3EDJA 2ZKMX 2GVJA 2X09A 1FX6A 3MTWA 4AC7C 3ZZ1A 2XSXA 3F7JA 3LU2A 1W6TA 3IVSA 3O07A 3SCOA 1QT1A 1RAKA 3PZNA 3ZO9A 3VMNA 1OQFA 4HHMA 3OIHA 4LBRA 1VFFA 4DO4A 1DXEA 2I1OA 3NAVA 5ECUA 3W4RA 4JX4A 3U6WA 3OZPA 3KRUA 3K5XA 1SW7A 2X1UA 4FLSA 3NOEA 1BFNA 1CW2A 1T40A 3KOWA 2YX0A 5K9DA 1CBGA 4GQQA 1CZ1A 3DHFA 1WPCA 4QDPA 4BEUA 1WDQA 3S4TA 4XB3A 4R7JA 3PUOA 3KS6A 5EFFA 2ISDA 2VD9A 4IXXA 5A6SA 4HD5A 4KERA 1WUFA 3OZOA 1MYRA 2KAUC 5EBUA 3KZSA 3DGBA 3EDKA 3UCDA 3PAOA 4Q6XA 2ZZ4A 3FJNA 1EZ2A 5CH9A 5AY7A 5SWUA 4GINA 1RPKA 4TO8A 4UCGA 3TK7A 3MUAA 2DSUA 5LXEA 1R3WA 1XKJA 4G9PA 3VNDA 2EPMX 2WNNA 4J28A 1M3UA 1KLYA 4H2HA 3UJRA 4JTCA 3LK6A 2A3HA 3HG2A 1W9VA 1THFD 2F84A 2WM0A 3KBNA 3T07A 2PWDA 3SURA 4D6DA 4F2TA 5C9XA 2Q3OA 3GFZA 1WOBA 3PWGA 3ZOAA 1Z6KA 4JN8A 6PTDA 3EKLA 1QATA 4AY7A 1TB3A 4POCA 2Z0IA 3VVGA 2GGIA 1H1NA 2PP3A 5DMMA 1KA9F 4HP5A 1XUZA 4AZ6A 2XFWA 4FAMA 3L21A 1TZ7A 4H19A 4LY8A 2HROA 3ATYA 4B2DD 4XD3A 2CLOA 4O53A 3HM7A 4ZVJA 3CQKA 4UFMA 3NSNA 4DRSA 2H6RA 3FFSA 1IEIA 4MM1A 3UG5A 1BXCA 2GUBA 4GC4A 4MAVA 2QS8A 1DWFM 1GQJA 4YHEA 3O0FA 2Z6IA 1I2OA 2P88A 4QHRA 1VFOA 4RK8A 3BCDA 5GPRA 3N14A 2QGYA 3MU7A 4KRTA 5EKYA 4DZHA 2Z25A 4H7ZA 3RO6A 1MXGA 5CPLA 3VDAA 2PPGA 1AA1B 3EYPA 4HA4A 1YXDA 1ZBKA 1EYEA 3PZVA 3DBPA 3E2RA 5HAOA 4DPPA 2GSJA 3SUWA 1OD0A 3G1XA 4IL2A 1C8QA 3T0BA 4OFCA 3FYPA 4O1EA 1US2A 1ITUA 4O12A 2ACSA 3A3WA 2UZ9A 3W2JA 1E0VA 3V1HA 3UJ2A 3WDQA 1H0GA 3PZTA 4E3VA 1RQBA 3QZ6A 4H7VA 3NM1A 3BLOA 2X2YA 3HIJA 4PMVA 3BSHA 1L6YA 1MRQA 1ML1A 4WXZA 1YIXA 2C16A 5K9CA 3VCNA 3USZA 3W73A 1W8GA 3MUXA 5D9MA 2IMRA 5DMNA 4C6PA 1XC4A 3LV5A 4Q4QA 3L9CA 5AYZA 3VDGA 3TZFA 3GFYA 3PZGA 3VFCA 2V5BA 1P1MA 4HPNA 5H2ZA 2V82A 1EWDA 4Q7NA 3C2RA 4ZBCA 2OZ0A 2ZX7A 4NJIA 1E1FA 1Q6LA 4M81A 3SO7A 3M0VA 3RO8A 2NUXA 5G1YA 5IBXA 3E0LA 3VIHA 3KOYA 5IHSA 2X1TA 3U4AA 4U28A 4AYGA 3QV8A 5A8MA 3AS3A 5CJ5A 1QVBA 2GSHA 1UKOA 3VGHA 1ODZA 3QQWA 1YBQA 4JTSA 5ABTA 1DTUA 5I23A 2BS9A 4QG6A 1M68A 4JEQA 2AAAA 3GAKA 3ARWA 5TD4A 4Z2JA 1SJCA 3P5ZA 3AS2A 3CYJA 4OOUA 2QKFA 5KMYA 3NL6A 5DX7A 3S1VA 4Z2GA 1D3CA 2G0WA 5A8PA 4H9XA 1S39A 5FF0A 1QWGA 2XPKA 1UASA 2ZUMA 2E67A 1TIMA 2E09A 1YNPA 2RH9A 4Q4OA 3S5NA 4HK7A 2XUCA 2VC9A 4JFUA 1M41A 1HGWA 3QFEA 1TYGA 3ID7A 5CZSA 3K4WA 2G41A 3TLLA 3VGDA 4K38A 1TO3A 2ZYFA 1RBLA 2CLEA 2C7FA 4J2PA 1QHOA 1YBQB 3MKVA 2VGBA 3EOOA 1IEXA 4RV3A 3I7RA 4GYPC 1W1PA 3WD2A 4Q8NA 3WCZA 2YA2A 1W91A 8XIAA 1UUQA 1UR4A 1K7FA 2YPIA 4NYYA 3AFBA 4UTJA 2HDJA 1Q65A 3MSDA 3EOLA 3MA8A 3LI1A 3RR1A 4XKYB 3MZNA 2E1DA 3TZNA 1F07A 4RZ4A 3BJFA 3N18A 1XLKA 1TV3A 3UXAA 3T8LA 3WLTA 5I5RA 5FJRA 3K30A 1H7WA 2PTZA 1MNZA 4LB3A 2VI0A 4M19A 5XIMA 3AJXA 3V18A 1GOMA 1VRDA 1XIGA 4RZ6A 5E9AA 4DYKA 4GO9A 3AXHA 1NFBA 4ROQA 3QZAA 4S3FA 1XDLA 5AKQA 4Q8UA 4DVOA 4OHQA 1H7PA 1OFQA 3KVKA 4NT0A 4ZE4A 1V6UA 1J11A 4H9TA 4Y7EA 1RBOB 4XVDA 4RJEA 3L0KA 2GJXB 1OABA 1NOUA 1HF6A 2MUCA 1LL4A 4PTNA 5BW6A 3EWCA 2DZTA 3WMBA 2GVEA 4NVTA 3EB2A 1QNRA 2D0GA 3ZR6A 5FD0A 1XL9A 3VZZA 1K8XA 1PV8A 2VFHA 3J7HA 2ZXQA 2OLHA 2C1GA 3D5HA 4HT3A 1TX2A 5FJUA 3W23A 5I03A 5I6SA 4H41A 5BROA 2WVSA 1VFUA 2J8TA 3EXSA 3GC4A 2EG7A 1S5WA 1A5SA 1B4KA 3ONBA 5A6KA 3ES8A 2PTYA 1ONXA 3CGTA 2ESCA 3TUUA 4C6MA 5A6BD 4I3GA 5GNXA 1VGAA 4KFOA 1M6JA 4PN2A 4ML9A 1E73M 4WSKA 3L7RA 1TE6A 1VAHA 2A6NA 3S5ZA 2EQDA 2CKRA 1UA3A 3JS3A 2GQ3A 1FH7A 1ZJHA 3NXLA 2VX6A 1KCZA 1MO0A 6REQA 1V0KA 3NZPA 1QPOA 4NI3A 3EX2A 2DU2A 2VFDA 4AZCB 4W9TA 5DEZA 4N0RA 3N2CA 1QO5A 1OG6A 2GGJA 4CVUA 2YFOA 3K13A 1HJQA 2R9RA 2QCHA 1GKQA 1ZP3A 1MW2A 1CXEA 2I5IA 1E0WA 1EUNA 3PN8A 5G1MA 4DWSA 1A50A 1DJXA 1TMHA 4W7UA 3DI1A 5C8BB 2OJPA 5ABFA 4M56A 1AVAA 1JCLA 2WHMA 3ABOA 4C6LA 4D6EA 3B8VA 2GZXA 4GNJA 1BQCA 4AFYA 1QPRA 4ADTA 1XYCA 1V7AA 2VFEA 3CLMA 3AJ7A 4O13A 1DXFA 3A23A 1FXQA 2QV5A 1QBBA 1QNQA 4XAFA 3FKKA 4JNMA 3A4WA 1XLMA 4D1IA 4YWSA 3DEQA 3AYSA 1JXJA 2WKLA 4F40A 3W7QA 4DJDD 4GUIA 3ONCA 4U5KA 1KRMA 3CWNA 3TIMA 3CLWA 4NAEA 4U33A 3H54A 3COTA 1PSCA 4X22A 2DV0A 4PZVA 3VD4A 4O4WA 1ICPA 5BWFA 4XSMA 4L9XA 5EPDA 2DJXA 4X63A 2D3NA 1UD3A 3QTPA 1LDCA 4LC6A 3E5PA 3TSMA 4UQ9A 3H24A 4GYFA 3CWOX 2X7WA 3W7OA 3DFYA 4AZGA 3GHSA 3QLDA 4D8AA 1NELA 1W1VA 4ZMGA 4BF7A 4DUWA 2VC5A 2QMJA 4W8BA 1IYXA 1Q6GA 2WSQA 4EPBC 5BMXA 1JIBA 4PRRA 1TZ9A 1VJZA 1TPFA 3CU2A 4NJGA 2AQOA 4PRTA 4JIQA 4LYRA 3QVQA 4Z0JA 4CNUA 3N15A 1SO4A 1FCBA 1FBAA 3UBPC 3NDZA 1S2CA 2RDWA 3GLCA 1UYQA 4L4OA 1HKJA 5C2CA 1FWNA 2ZX5A 3GKFA 4A8NA 2XGIA 1XH2A 1T0OA 3BW4A 1GYNA 3S5SA 1J93A 2NT1A 3STCA 4HHPA 2EPKX 4OGZA 2EPNA 3ARUA 2PU1A 4O57A 3MWCA 4MJZA 1XIFA 3W27A 4MPKA 3WD0A 3HOJA 2VX5A 3C8FA 3GTXA 2NVAA 2WWDA 4MPQA 2I7GA 1DHPA 2NWSA 4UIOA 1KKRA 4RUBA 3A12A 3EDFA 2EPOA 1LWHA 3M0HA 1B1YA 3SY1A 4EE9A 4IZGA 4RDWA 4YVPA 3KCJA 2FTWA 3WQFA 1MW1A 3T78A 3WLKX 1TPB1 3GG7A 3WUFA 2XIIA 2J7EA 3SJ3A 4QTGA 4LNYA 1QNVA 4D6FA 4U31A 3AMCA 2PB1A 1VZWA 1LG2A 4H4IA 4QSFA 1ZENA 3VIOA 1AW2A 4S39A 3WK2A 4KW2A 4CD8A 3LGEA 1AH3A 3ARZA 2X2GA 2VOMA 4CKQA 3II1A 4IOTA 3VUSA 4JFSA 3PJUA 3UGVA 2DW6A 4AZ5A 5CJMA 3WL0A 2CBJA 2INZA 4K7YA 5C2XA 2J78A 2OEJA 4KH2A 1UIOA 2TPSA 2ZZ1A 4Z0SA 3TOYA 4B15A 2QAPA 2HWGA 2QAFA 3EEZA 1W1YA 1K9EA 1RY0A 1QOQA 1VB9A 3N3TA 3DCPA 3BLLA 2ANUA 3B8IA 4CU6A 4GQBA 2PURA 4JAWA 1KC7A 3B4YA 1UD4A 4RW3A 2QZRA 1XLGA 1D9EA 4N9DA 4ZO9A 4FALA 1GHSA 2EJAA 2PMQA 3H55A 5CLWA 4F9DA 2J47A 2G95A 3LMYA 2WSPA 1PVNA 1E40A 2R1PA 3B40A 3A6OA 2ONEA 1TWSA 3CPGA 3FAWA 3STFA 4LS0A 4DF1A 2RJHA 3OBAA 1GTHA 1KFWA 2PF8A 4W8LA 3CT2A 1TSIA 4IPIA 1JPDX 4ZOEA 1HO4A 4PODA 3UT0A 4IMEA 2WHKA 1UA7A 4Q7BA 3N25A 2PDGA 1F7BA 4FLOA 3TR9A 3MHUA 4B4HA 1OFRA 1UUMA 2GVGA 4GPNA 1X1NA 1G94A 4Y2WA 4BA0A 4TVDA 2X05A 2WHLA 3NM3A 3LPOA 4LRSA 2D73A 1E3XA 3GDMA 3KTCA 1BSLA 4NKCA 3GVWA 4UMAA 5K7JA 3QMSA 4C7FA 3QY6A 3H26A 1D8WA 5KITA 4LCRA 1R2RA 1OM0A 3EXTA 3LHYA 1O68A 3V16A 1H51A 2D2JA 3T08A 3GYEA 3CH9A 1XUUA 1JNDA 3LGDA 3W28A 4G1KA 4O0QA 3QMTA 4JTQA 3RDKA 4PMQA 2Y8KA 4JQ4A 1CCWB 4RV8A 3PS7A 3ZMRA 3SADA 4MGGA 1HL9A 3VAVA 1XCXA 1P43A 2I5GA 3B9NA 4ZQCA 4GY0A 4IIFA 3P8JA 2PUZA 1EP1A 3M0KA 2CZ5A 4JFVA 5DXXA 3V35A 3WLJA 1ONEA 3WLOA 4MWAC 3U7VA 4TMBA 3MANA 3G1DA 2ZVRA 1UKTA 2AGTA 4XZHA 1DJGA 2ALRA 3UR5A 4DUVA 2VWTA 3RAOA 5DN1A 3NQ8A 3QMRA 2D2OA 1UH2A 2IKHA 2PDNA 5FKYA 1R7AA 3WUGA 4O50A 1QPKA 1ZHAA 3SQLA 4Y8FA 1FCUA 4D1JA 3SJNA 1IZJA 4Q8VA 2VUNA 3NVDA 4HNUA 1S3HA 4ENLA 1C8VA 3GTFA 3W24A 1CGVA 3VNMA 3W74A 4CLMA 4U2YA 1FWWA 4YL2A 4MG4A 3HV9A 4GBDA 2REQB 3NEHA 4GNKB 3WH8A 3PWIA 2HXUA 1ZJBA 2OWWA 3EWBX 2QF8A 1GJUA 2NVCA 4UTWC 3R25A 3FA3A 4OBSA 2Y6ZA 2FGBA 1S5VA 3W01A 4QAIA 5D38A 4IGNA 5M1TA 4KESA 3TW7A 4C6BA 3NQVA 2A7RA 1JCNA 2HPIA 5HNUA 4ZFCA 3UWEA 2UY2A 4K8EA 1MEHA 4L56A 1HFBA 3BAYA 2E7FA 4HB7A 1KO0A 4WGXA 3CB3A 2PD5A 4BI6A 3L0GA 1K6WA 3UF9A 3CZLA 3HF3A 3E0WA 3W07A 3OZMA 1GYMA 5HJLA 4RW5A 3Q67A 1JZ3A 1QHZA 4ICCX 4YLWA 4NRSA 4YVVA 2DDXA 1FWJC 2HBVA 1X98A 4V28A 4NHVA 1V3LA 4GUGA 4P8VA 2DY3A 1SZNA 2VTFA 3BG3A 3I6RA 2XISA 3WDPP 2XH4A 4B5NA 3PHAA 5G1TA 1TPH1 3STEA 4DX3A 2HS6A 1ALDA 1OADA 1PWLA 1E0XA 3AZRA 2PDCA 3NQ2A 1JZ7A 1SJAA 2NX3A 3O6AA 2WSRA 1QI5A 5HOSA 4A3YA 2QCFA 1GZ1A 4LBUA 3IJDA 3M5YA 2A3BA 1DWAM 1UQZA 1RSCA 2BWGA 3EKZA 5IFTA 2J79A 1Q6OA 3KOZA 1G67A 2V63A 1ZAIA 4JTUA 9XIMA 2YXGA 1XI3A 1PKLA 3TQVA 4OVXA 2ATSA 4PL2A 4X0VA 3EAUA 3QSRA 1HJVA 4P5UA 4UNLA 2X1IA 4GH3A 3W1AA 1OHLA 4MNMA 3BW2A 4JHZA 4MTVA 4UTKA 1EJVC 3GM8A 4P7LA 2L5HA 4WDXA 2VEMA 4GJ1A 4FNTA 1AL8A 1TR1A 3KCOA 1M7XA 2QIWA 2PTDA 1Q6RA 3UD6A 2WQPA 2BGSA 2R6OA 2OCZA 3QYSA 3NDYA 1Z69A 3T55A 5DBTA 3HMJG 1U5HA 5H8UA 2QUNA 1TJ1A 3H2CA 3RHGA 4ZB2A 3MY9A 2PDLA 3W0KA 2WLZA 4EWND 4GVFA 4Y8EA 4ERGA 4RPPA 3FHAA 1ITCA 3E9AA 3DDMA 3AYRA 3DKLA 1PZ3A 1QOPA 1JD7A 4LTSA 1J0JA 2NLIA 1RBAA 1OC7A 4CD7A 4EXBA 7TIMA 2OWCA 3GXIA 1G01A 4M80A 3S1GA 3BH4A 2E77A 3RLHA 3H7RA 2FLIA 1TV5A 1JAKA 3AC0A 3NIYA 3PTKA 5CEWA 1OCJA 3M07A 2FZMA 1EJXC 1OX4B 1L6WA 2NVDA 4DJEC 1DYSA 3W7HA 2J4GA 5AC8A 4MJ4A 1YPFA 4FNSA 1ZJAA 1B3VA 3S47A 2PDXA 3WG6A 4HU3A 3IV8A 4L7ZA 1BVNP 4DI8A 2C0AA 4RNFA 1KXHA 4A3RA 5HWJA 3NSMA 1T96A 4HK6A 2G3NA 4JEJA 3F03K 4ADSA 4LCQA 4E0CA 3KTSA 1PDZA 3M0XA 4ICNA 4M6PA 1YDYA 1CGTA 4UOJA 2FMNA 3DXIA 3EMCA 2HZGA 3E5BA 1E4NA 1L2UA 4GBUA 2E5CA 4P7RA 5DY2A 2E8YA 4EANA 3BARA 3A3XA 3IV3A 1ZS2A 3K1DA 1P4CA 2B7PA 2VYOA 1X96A 5D8ZA 1K70A 4TV5A 1ADDA 1I4NA 1IZCA 1UCWA 4HK5A 4KEMA 3PR2A 4EPKA 3A4AA 3DC8A 1TRIA 5HR7A 3UEQA 4ZB0A 2F6KA 3VKKA 1LM1A 3HQ1A 1OB0A 3RX4A 3TN5A 4LAZA 2ZZ5A 2OYLA 4QXIA 1S5MA 3PZ9A 2WNWA 1EIBA 1FH8A 4FA3A 3CL7A 3OVPA 4H9VA 4IUOA 4X9YA 4EXQA 3VE7A 2DFAA 4I7VA 4M29A 1EX5A 5EBAA 2MANA 2H9AA 3AQUA 5KZ6A 2WANA 3PZIA 2OPJA 4MY8A 3HJEA 4IJRA 2OEKA 5C9WA 3MZ2A 4Q33A 3R13A 5LIYX 1IE7C 1IT0A 3CPUA 4J40A 4QCFA 4Q22A 2BX7A 1S38A 4DZIA 2E28A 3VOJA 5CBBA 4AF0A 2FVLA 2E6YA 5BWAA 4B2DA 2XSAA 1PX8A 3V3WA 5AHNA 4ZO7A 4AIOA 4W85A 3MV01 2BY3A 4PUJA 1DWIM 1L6SA 3UR7A 3FA5A 2EAWA 4IF2A 4JX6A 3PTMA 4KETA 5DT7A 5BU9A 2PE4A 4LQ1A 1FHVA 4YYFA 4O17A 2EKCA 4TX9A 1UOZA 3C6CA 5AVNA 3H4XA 1XRFA 1XC6A 2V5LA 3F1QA 3CO4A 4UQDA 1XYFA 3VFLA 1W5NA 1T8QA 2G8ZA 1UMLA 4ECLA 3DYOA 3DAQA 4XBKA 4XO6A 1JZ8A 3CT7A 4IGMA 1G9HA 3N34A 3V7PA 5HR6A 1LQ2A 4NAFA 4AZ7A 2V9DA 1V6VA 2V69A 4LXFA 3R1ZA 4XKYA 4YCOA 2BOGX 4GFSA 4ERIA 1NWTA 1LZOA 5AN7A 3EWUA 4UTWA 4YNGA 5KZDA 3WF4A 4F0HA 1X7IA 1JYWA 2HPMA 1A3WA 2EBNA 1EXBA 2YB1A 4MZ1A 1A5NC 2WC4A 4JIRA 2WKJA 1V0LA 5AYXA 4JHOA 1O12A 4JKLA 4EXAA 1K02A 1O60A 2WJFA 2XSBA 3FJLA 5TBOA 1B3OA 4KWSA 3WBEA 4ZO6A 2BVDA 1FHUA 3ZJ8A 4NP7A 1NOWA 3TFXA 2FZDA 5FAGA 3PPFA 2PZ0A 5LA1A 1KBKA 4D71A 4K68A 2CYGA 4LV9A 1QMLA 4WUIA 1XBZA 3OU8A 5HXMA 3SAZA 1UP3A 4XBJA 3LLFA 3RCNA 2PP0A 4B5TA 1KM6A 1GHRA 3CUFA 3W75A 1VEMA 2PDKA 2PCQA 1UH4A 2F61A 3WIJA 3NL3A 1LUCB 4IMGA 3W86A 3FGCA 3AMKA 2XH2A 3LCFA 2PWGA 4L4MA 3SRHA 3CQ0A 2QIIA 3R5EA 3QFWA 2XIOA 2NQHA 1Y0EA 3TQPA 1P0KA 3U4FA 1LT7A 4QGCA 2UY5A 1J5TA 3G0XA 3GYCA 2H8ZA 1T7LA 3W2MA 1LYXA 3JW7A 2GVYA 1I45A 4FS9A 3QW4B 3RPDA 2WJZA 2WCAA 5LNUA 5FIPA 1W3KA 4H6EA 1TTIA 2PBGA 2YBTA 1XINA 1KTCA 4GVHA 3KEHA 3W02A 3GBDA 1A5UA 3M0YA 2QJGA 3GQYA 4A21A 1IR2A 1EQCA 4JTEA 1N55A 1UZHA 1KD0A 2DP3A 4UB9A 3THDA 3N1AA 2ZDRA 5HDRA 4W93A 4AD1A 1CXIA 4EK7A 2OKOA 3W85A 2WK2A 3LERA 4QLLA 4FIQA 2FFCA 1XIEA 1KGXA 3TVAA 3KLLA 2H8XA 2OGJA 3R7MA 1GQIA 1UPPA 3GR7A 3F4DA 4GO8A 4DLMA 3RJYA 3THUA 4XQ6A 3DERA 3WNOA 1BTMA 1XM3A 4WKHA 2WQDA 2WAGA 1GQKA 1FUYA 4NRRA 3RIKA 4AHOA 3EZ4A 1W2VA 3EWDA 3L65A 5JQ9A 4BY3A 2PDIA 1KQZA 3TEVA 1PHQA 5J5RA 1RCQA 4IPLA 2WLYA 4XK2A 2HS8A 2QCDB 3BANA 2G50A 1W8SA 1MZRA 3IUDA 1PIFA 1HJ