3NGFA

Crystal structure of ap endonuclease, family 2 from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADVIARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGELNYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP endonuclease, family 2
publication title Crystal structure of AP endonuclease, family 2 from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Isomerase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 5.3.1.22: Hydroxypyruvate isomerase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3ngfA00
1XP3A 3TC3A 3M0HA 1I6NA 3GNXA 4XKMA 5XINA 4G56A 4X63A 1XLAA 1XIJA 4LNCA 3OBEA 3BDKA 1XLIA 4PFHA 1XLHA 1XLFA 2NQHA 4A8IA 4GLEA 1DIEA 1XIDA 1K77A 3BANA 4A8RA 2X7VA 3KBSA 1XIEA 4QDPA 4QEEA 3ITOA 4DVOA 7XIMA 1XIIA 3BWWA 1TZ9A 5EMKA 1A0DA 3C0SA 2G4JA 5TNVA 4XIMA 1QT1A 5H1WA 3AAMA 3VYLA 4US6A 3VNKA 4YTQA 3C0LA 5FA5A 5EMMA 4KW2A 4XSLA 3KBJA 3QXBA 4E3VA 4EACA 5EMLA 1MUWA 3UU0A 3VNLA 9XIMA 1CLKA 1DE6A 3CQHA 3TVAA 1XYBA 3ITLA 8XIMA 4XISA 5I7GA 2XIMA 2HCVA 3C0QA 4QDWA 3KCOA 3DX5A 3FVMA 4X61A 4ZB0A 3LMZA 3M0LA 4ZBCA 3KTCA 4X60A 3KBMA 3DBNA 4PGLA 3ITVA 3UVAA 3L23A 5EMJA 5J8LA 3AYTA 3VNIA 6XIAA 3UA3A 4A8LA 4K3ZA 3ITXA 4Q7IA 2OU4A 4J4KA 4HHMA 3IUDA 1XIHA 2I57A 2HK0A 1XIGA 3KBWA 4YTTA 1XLGA 9XIAA 1XIBA 4QEHA 4XSMA 3QZAA 3P6LA 4GQBA 3UXIA 2XINA 2Q02A 5XIAA 1O1HA 5H6HA 4ZB5A 4QE1A 4A8NA 2J6VA 3ITYA 4K1GA 2XISA 5AVHA 6XIMA 1XISA 1XLJA 3QC0A 5B7ZA 3M0YA 1XYCA 1XIFA 2GYIA 3VNJA 8XIAA 3KWSA 1GW9A 1D8WA 3CQKA 1XLDA 3KBNA 4YTSA 3AYVA 3U0HA 4QE5A 4YTUA 1MNZA 4OVXA 3CNYA 1XLEA 2QULA 3M0MA 2NQJA 4HGXA 1XINA 2QUNA 2GLKA 3XINA 4W4QA 3UA4A 3M0VA 2NQ9A 1DXIA 3M0XA 4XIAA 3P14A 2GVEA 3BZGA 1A0EA 3KBVA 5B80A 1S5NA 3XISA 1XYAA 3IUHA 2HK1A 3ITTA 3N4AA 1BXBA 4GJJA 1XICA 3CWHA 1XLKA 2GUBA 3KCLA 1XYLA 4HNOA 1XLLA 3CQIA 4GJIA 3AALA 2QW5A 5XIMA 3VNMA 3XIMA 4ZB2A 5AVNA 4YTRA 1OADA 1YX1A 4DUOA 1XIMA 3KCJA 1I60A 1BXCA 1XLMA 3IUIA 1DE5A 1QUMA 2G0WA 3BZJA 3QYSA 3NGFA 1DIDA 1A0CA 3WQOA 2ZDSA 2QUMA 4QE4A 5B7YA 2I56A 4HHLA 1S5MA 1XLBA 5C9ZA 1XYMA 4EAYA 2X7WA 3CQJA 3JU2A 3U3HA 1XLCA 2ZVRA 1QTWA
chains in the Genus database with same CATH superfamily
4NHVA 4A3RA 4A3HA 3W1QA 1DIKA 4BKNA 3RG6A 3BAYA 4JD4A 1W1TA 5J5RA 2Z1BA 4FF7A 4D1IA 4EIVA 5E9XA 4FX8A 1BYCA 1RCQA 4H9XA 1UBSA 3UPMA 1GWJA 3W1PA 1JDAA 3VA8A 3L0GA 4IP5A 4C6OA 4F48A 4WOQA 2G41A 3O7UA 3PBYA 4MZYA 1HJSA 3CLMA 4KEMA 3WLRA 2YR1A 1I2OA 4RDZA 3SCQA 4HHHA 4UQ9A 1EX1A 1L6SA 1B3YA 3GC5A 1CPUA 1P0NA 1XLGA 1ZSXA 2V3EA 3V3WA 2J7EA 5IBXC 2OJPA 3IJ7A 1ZENA 2VO5A 1Q6QA 3P93A 4L4PA 5D33A 2EG7A 3AS1A 3EB3A 1P6BA 1WDWA 1GW9A 4B5WA 3A4AA 3NO1A 1RALA 5A8GA 4AWSA 2GK1B 2QDGA 4QE5A 4K8GA 5ABFA 1J8VA 4JFTA 1VPQA 5EBUA 4Q32A 4UQAA 4UBPC 5HNRA 1SW0A 2ZUSA 4LBSA 1A0EA 4O18A 1JXKA 1K9FA 3V7PA 1XFBA 1FWFC 1GTEA 5HUPA 1LOSA 2PP3A 1AW2A 3NQ7A 5ABTA 2CZEA 4G8TA 5DRIA 2EPNA 2JGYA 3THQA 3WK3A 3WJSA 2BHZA 2IPJA 1VPYA 1GHSA 4QE4A 4OBSA 3NM1A 4FMVA 2BB0A 3FKKA 2ISDA 4IFKA 3E2VA 3IK4A 3AIUA 5GPRA 1RJPA 3E12A 1BSIA 4AG0A 3CYJA 5CGQA 4QM1A 2D0GA 5DRCA 4JTKA 4YTQA 5AC4A 4UTKA 2CC0A 3VPLA 5HNTA 1PYFA 2Y88A 1EIBA 5HQEA 3SSZA 4NRRA 2GSHA 2V82A 3WLQA 2VZSA 4DIAA 3GDTA 4O8AA 5M3WA 4UQDA 3TA6A 3MP4A 2E8YA 4N4PA 4PRWA 2FFCA 3AMCA 1T99A 3BLLA 3L23A 3VNIA 4QSHA 3A64A 1PKLA 5D9PA 5BOEA 4GFSA 2WWCA 5A94A 2E9MA 3AMDA 5DXXA 3ITYA 3VOCA 4H6EA 2QCNA 4GUFA 4E4UA 5D9MA 5FOOA 4FNUA 3IAPA 4HMCA 3T44A 5DT5A 2V5BA 1O60A 4BK9A 1RPKA 3WN6A 4UTTC 1MEHA 2X1TA 1FH7A 5D2VA 1UKSA 3KOYA 1TE6A 4RLIA 3GU2A 1KLZA 3MTWA 5E09A 1T96A 2CLMA 2WQPA 4B5SA 4MLJA 2BVTA 2RH9A 1U2YA 3R0DA 2XVNA 3IEBA 3LNPA 4Q8VA 1JUKA 4XK2A 1SFJA 3TW6A 1P4CA 3RJXA 2DDXA 5BMXA 3GDLA 1VS1A 5LXXA 1AMYA 2GL5A 2UY2A 3GRIA 1MO0A 2VR4A 5K7JA 3L2IA 1LRTA 3CM4A 4HIBA 3GNDA 4UB9A 2FZDA 5LIWX 4GVHA 1XSJA 3L66A 1YXCA 4HU8A 5I23A 3N2BA 4B91A 5EYWA 2FMNA 4H6QA 4I9TA 4EKJA 4GZIA 4HZ6A 3RX3A 1JF5A 3STFA 4Q7IA 3H7UA 4IIGA 1V0LA 2I9EA 3TROA 2P8BA 1VHCA 1L9WA 4LUTB 3WJXA 5KETA 1D9EA 3VX0A 2WPGA 2AQWA 4O17A 4GY1A 3W7EA 4ZO9A 2WMKA 2DSVA 3KLLA 1EF2A 2CU0A 3VOGA 5BCAA 1QI5A 2XGZA 1GVYA 1C29A 5C9RA 2TRSA 3CB3A 3E0LA 1TE1A 1V6VA 3VILA 1DYSA 1I75A 3ARTA 3T0CA 1AJZA 4ZOAA 2D2JA 4PMXA 1E72M 4A2SA 5FI8A 5G5IA 3WQCA 1IT0A 4NAFA 2GJXA 1KTNA 3WQ6A 1TTIA 1GG0A 1B3XA 1K3UA 3Q37A 1SJDA 1PZ3A 1XLBA 4F66A 3OHMB 4Y9AA 1B4KA 3O0KA 5D8ZA 2R24A 1LLOA 2G50A 1TPB1 3ZOAA 4AZCA 3E2QA 1VEOA 5F1UA 2FVKA 3BPWA 4CQCA 3OVQA 3HPSA 2HVOA 5JBEA 2EJAA 3K8LA 4LALA 2V5KA 1WUEA 3N6QA 2EG8A 3S5OA 1MI3A 3BG9A 2NXHA 3WD2A 3KBWA 2BSLA 2VEGA 4QQUA 1QW7A 2Y6ZA 2ZVIA 2FTWA 1ZAIA 4XZLX 2DQXA 3P74A 3SURA 3G8RA 3LYEA 3OEXA 3L5AA 2Y63A 2INZA 1KXHA 3QRHA 4ZOEA 3SGUA 3M1ZA 3B9EA 4WGHA 4PBEA 2A3HA 4CU7A 3WLOA 4KEZA 1XH1A 1MFVA 1R3YA 3CYVA 5JUVA 4BY3A 2ZUMA 4UQEA 3IK2A 3M0KA 4DUWA 4WSJA 5LA1A 3M5VA 3MPGA 4R33A 1I0BA 3QJAA 2TMDA 1FWCC 5GQBA 4OHQA 1H60A 1IXOA 4IT1A 1P6WA 4IPIA 3SCTA 2Q01A 3MYOA 3SCNA 3MC5A 4UTLA 1D8CA 3GK0A 2FGLA 4FI4A 4UC5A 2PURA 3G1VA 4ZO7A 2FTYA 5LNRA 4O52A 4OBRA 4YWIA 4JFVA 1G4EA 4GG9A 2WB5A 2OMAA 3RO8A 3N2OA 1DKWA 1G7UA 1MFUA 4ZOBA 1TKKA 1SJBA 1IXQA 3LCXA 1FDYA 5H1WA 1W2VA 5AKQA 1L2QA 1RUSA 3W7KA 1RSCA 1H50A 4PA8A 3B06A 3TEVA 2NSOA 3SBFA 4PUMA 2A1YA 1EHNA 4W7VA 3ZR4A 4V27A 4F0RA 3L5MA 3W27A 2I1OA 4LUYA 1H1ZA 1ZFJA 3WIJA 2Y85A 1SZGA 4F40A 3W1LA 1JQXA 3A22A 3IJIA 3LCHA 2Z0IA 4F0SA 1KM5A 1CYGA 3IRDA 4PTNA 3P5ZA 4K1GA 4Y8EA 3RITA 2J9YA 5I3KA 5A2BA 3OQEA 3KWSA 1WDDA 4OOZA 4FA3A 2DGAA 5A8PA 1ZBKA 4X3ZA 1J0YA 3EMCA 3PWAA 1Q7ZA 3UXDA 1B57A 1UD6A 2RFGA 1R6WA 3OZOA 4XAZA 1UJQA 2QJJA 4RPQA 2PU1A 2PSNA 3WLIA 3KE0A 1Q6RA 3S47A 4I7UA 4UFIA 1QATA 4DJDD 3K2GA 4IMGA 1EJWC 3R0UA 1WAWA 2WKJA 4AYGA 2FHBA 5ABFB 3IIPA 3NPXA 1JEZA 1X98A 4RXGA 2NVAA 2ZRVA 3PFMA 3G0XA 4GRSA 4J3VA 4Q4KA 1JXJA 1R3VA 1GKQA 4A8RA 2DSUA 5JBFA 3L4XA 5C9UA 1KCLA 4CCCA 1J6OA 1LCOA 2J78A 3TE9A 4QRNA 7TAAA 4J3SA 3WNMA 2EF9A 4LX4A 3N6HA 2V3FA 3W76A 3LSBA 1X6UA 1EJVC 3A3XA 3LHYA 4MGGA 4CQAA 2VR5A 1R38A 3T4CA 4MIMA 5D2YA 2IMRA 1VFMA 3PUEA 3CMGA 1IEXA 2JIWA 2FDMA 2OU4A 3CL6A 2P53A 3KW3A 3S1GA 1GG1A 1IZCA 2V2HA 5M2FX 5HJYA 1X1NA 4AZGA 1UH4A 1ADSA 4IFRA 1H11A 8A3HA 3FHAA 1E6ZA 4QJ3B 1HG3A 1W3HA 3K46A 1BGGA 1TJ2A 1KBIA 3LXBA 4MFDA 3NYDA 2JF7A 3ATZA 1FHLA 2TSYA 1LQ0A 1MEWA 2DZTA 2XH0A 1E4LA 4L6HA 4U2ZA 2XWDA 1WP6A 3IIXA 4UTFA 5CZTA 4A3UA 1P0KA 3B9OA 1W3KA 4YL2A 3I3BA 2H8ZA 4ATWA 4Q22A 1SW7A 3FS2A 1DE5A 2G0WA 3S1XA 1HKIA 1WZKA 4LJ3A 1HT6A 3MO4A 1PIFA 4MYAA 1HL8A 1FQ0A 1AZ1A 2VEIA 2FLIA 4CKQA 2WLYA 6ENLA 4IHCA 3TSBA 2WZTA 4GWEA 1ONXA 3THCA 3KVKA 1F8MA 3W84A 4CN1A 1FWAC 3TJ4A 5CSYA 3U2CA 3R25A 3JZUA 3EYPA 3SCUA 4AWEA 3LHUA 3MKCA 2GJNA 2WNWA 4GC3A 3VNLA 1UKQA 4PCSA 3NQAA 4HSOA 1H0GA 4O1DA 4X2RA 4TV6A 3CGTA 3T0BA 2FJUB 4LPCA 2CLIA 1QNRA 3HQNA 2V0TA 3LUTA 1JYWA 3URAA 2VDHA 2ZKMX 3ZJKA 4LRSA 3P8IA 4JTCA 2VFGA 3ZR6A 1UHVA 2QDEA 1N8FA 1F76A 2Z26A 4AD0A 1IEWA 4BF7A 3WLLA 3MY9A 5H91A 4YYCA 4MPKA 1XSKA 3UEQA 1N82A 3UA4A 1PWMA 4AXNA 2NZLA 1V3LA 3CWOX 1OD8A 1VYPX 3TAKA 4ATLA 2Q8XA 1MUMA 3OODA 3MMWA 3BGJA 4QNEA 4ZB2A 2OWCA 4M29A 2CZFA 1VBGA 1AQHA 3R2GA 3S1WA 2G95A 2F8QA 3F5JA 4W86A 4PL2A 2PAJA 4BCEA 3PTDA 3U3HA 4JQ4A 2X09A 5EA9A 1W9BM 5CSSA 1LL7A 2W67A 1MQPA 4I8YA 1XIIA 3VOHA 2ZUVA 2VX6A 2GJXB 4LAMA 4FNPA 1ZJBA 1GVEA 2X1IA 3QXBA 1BVZA 1QFEA 1YPFA 4UTTA 1V93A 2J7GA 1KTCA 1GPWA 1LP6A 4NJKA 2OWXA 3N12A 3PM6A 3AFBA 1BVWA 4JR5A 5CJMA 1C8XA 3UVAA 4HNNA 4MUZA 5IDZA 4WXZA 2OEMA 1GKRA 1EOMA 3PJXA 4QJ5B 4AZCB 3TQKA 1Q85A 5BWFA 4IWWA 4HCLA 1DQXA 3TMLA 1IEVA 3RR4A 4PEKA 2YIHA 3UR8A 3EB4A 4Q8PA 3W0KA 3F03K 3EKZA 4DHGA 1FH8A 4R88A 4X9SA 4LC8A 5JIWA 4LANA 1MQQA 3CAKA 1GEQA 4DUXA 1EC7A 4IGSA 4RCXA 1QI3A 3RO6A 4QJ4B 1KCZA 3C6CA 3CWHA 3SN1A 2WM0A 2WANA 3AWOA 4D6JA 4Q6JA 4L1XA 3WLPA 3UVIA 3UZ5A 3GYEA 2FIQA 4B5XA 4PTXA 4UFHA 1ZNNA 1QNOA 5E70A 3QGKC 3TZFA 3UZJA 3VIPA 2CBUA 4ZQPA 3VKBA 3RR1A 3IIOA 1EGMA 3JRKA 4GLEA 2FPVA 4MNKA 5A1AA 4OOUA 3CV6A 3GG1A 3AHZA 2YZRA 4IUOA 2Z6IA 1RAKA 2WHKA 2XIMA 1DWIM 3PPGA 3LOTA 4AF0A 1W3TA 1TTPA 3EOLA 1ZHAA 3OGVA 2VHLA 3EEZA 5DBTA 1VYSX 3BG5A 4W93A 2IS7A 2WMIA 1REQA 2G4FA 3EX4A 1KRAC 4RW5A 3HPAA 3PZQA 3D3AA 2V5DA 4UCGA 3M46A 1EXPA 2OSXA 2PTDA 1S1RA 3IJLA 5HQLA 3GY1A 1TQJA 3P14A 3KBVA 3EDKA 2XM1A 1J2WA 2BWGA 5JIPA 5DN1A 5KSWA 5CPMA 3T8LA 2JFEX 3S8HA 3FXYA 5CJ5A 4OU1A 3WLMA 1IZJA 3CXOA 1VFHA 1XXXA 4UR8A 2Y5SA 3WMBA 4JDYA 3DIPA 3RHGA 3M0ZA 3MI2A 7CGTA 2HJPA 4H7CA 2FVMA 3EWDA 4PCPA 5K9XA 1GQKA 4PMRA 1BD0A 1PSCA 5HMDA 2NQHA 5I3FA 1TPFA 4C6IA 1Q6EA 1W54A 3Q45A 1YMYA 2WKLA 3O8AA 2WCAA 1M03A 3HGJA 1Q6LA 1KM0A 2D3LA 5LNSA 3D0CA 5I7GA 2CZDA 3O6YX 1RQHA 1UP2A 3UZZA 3BXWA 1IWBA 1WZAA 1XRTA 4HHMA 4Z2IA 3W86A 1UD3A 3AHTA 5LIKX 1JDCA 1H7XA 4V2XA 4A3YA 4MJ4A 4DWSD 1MW1A 1U30A 2C15A 3M0YA 4DAIA 1H7PA 2YXXA 3BCJA 1VCGA 4IXHA 2QCCA 3T09A 5AFDA 3W7JA 1BKHA 2HDJA 3GHTA 3QPZA 3TWBA 2W27A 1AK5A 1XICA 2PCQA 4XWUA 1VFTA 4C6JA 2Y5JA 4ZGYA 2VKZG 1XIMA 3KCJA 4GBUA 3P60A 3FYOA 3QKEA 5AY7A 2YL6A 1QUMA 1E6SM 5BRPA 4X0NA 4GCXA 1F5ZA 1MQRA 3VI2A 1LJYA 3TYBA 3LNMA 1F61A 4DBDA 3ARYA 4GVIA 3B8VA 4E3TA 3S9ZA 3OVRA 3GDRA 2FFIA 1RQEA 3NO3A 1QNVA 4GFIA 1DJQA 2Y4SA 4D6CA 2A7NA 5I03A 3GD6A 3DC8A 4XAGA 5BOOA 3F2CA 1WKDA 2VC6A 2Z1KA 4I5UA 5AYYA 6ALDA 3QR0A 3KRUA 2I7GA 3HJEA 4C7FA 4HU3A 3E0VA 1MEIA 2PDBA 1C90A 1QAPA 1BXNA 2XG9A 4WD0A 4IPLA 4LOCA 2INFA 3T0DA 5AC7A 4XD5A 1RZMA 1SQ7A 5HWNA 3TOYA 4LBUA 4BJHA 5I06A 4CCEA 3SIMA 3OPSA 3VNJA 7ODCA 1I8JA 3E96A 3WUGA 1R46A 3N73A 1UZ4A 3IVTA 1GT8A 1ZB5A 2XIJA 3R6IA 3E49A 1S5NA 3IGSA 5GNYA 2GGEA 3TP4A 2OO0A 2PBOA 4HSHA 4N2YA 4QS6A 1ITXA 1E5NA 2CBVA 4TXEA 2E09A 2Z2BA 3CPGA 4K36A 1TVLA 1A5CA 2HEJA 1KM2A 4UCFA 4JICA 3V0SA 5CC7A 3WQDA 3VZZA 3EWZA 1DIDA 3UCCA 1JD7A 3W37A 5I6SA 3ZSTA 1XGZA 3W1RA 2ALRA 4PN2A 4XBKA 1NIUA 3W25A 4B4HA 1J93A 2I16A 4HYVA 3CUFA 1GOQA 1PBGA 4RUBA 5CGMA 1GJWA 3CTTA 3NXLA 4MJ2A 1W8SA 5FJRA 3RILA 3STPA 3BSHA 2PD5A 3GZ3A 4W7WA 3DX5A 3WBXA 4CD7A 4AMAA 1W1B1 3H2OA 4AISA 3VNYA 2CPUA 1W2PA 4XVEA 3LTSA 2P3EA 4HPNA 4L4MA 1UZ1A 2ZWYA 2BTMA 1JULA 1ME9A 3UY7A 3H6OA 4S3KA 4KQNA 1HXJA 2DVTA 3T2OA 2ZRUA 3AXMA 1W5MA 4IUGA 4QE1A 4ACYA 1XBXA 2E6YA 3F7JA 4C1NB 3VFLA 1PX8A 1ESWA 1ZCCA 2V3GA 1DJGA 4KRZA 5CSRA 1FRBA 3LHVA 3PJUA 4W4QA 3PAOA 3VKCA 2YA2A 2G96A 3PZUA 4GVGA 2WNQA 4KRTA 5B80A 2EKGA 1JYVA 2QCEA 1B2YA 3IUHA 1WXYA 3ITTA 3LPGA 1BGAA 2HMCA 3DKLA 2QJNA 3DFNA 4XO6A 4WDTA 4HN4A 1J12A 1C7SA 2GJLA 3ES7A 3NURA 3RRXA 4KETA 1OX4A 5C7HA 4PBFA 2POTA 2D2GA 2KZHA 3UFYA 3DFTA 2AAMA 4PB4A 4JFSA 1JFHA 1KFWA 3Q4DA 3FXGA 1MYRA 4N9DA 2OGJA 3T2QA 2D0HA 4F4RA 1J2BA 3ZYZA 3FA4A 2QF8A 1XDLA 2Y0FA 1O95A 5FD0A 2P50A 1HO1A 2QLYA 4IPJA 1JQVA 2YCKX 2HWGA 4PMJA 1CLKA 3B8WA 3VIHA 4YCOA 2C7FA 4UFJA 3VCCA 1ITUA 4HJWA 3M5ZA 3WZ0E 3TSDA 2EO7A 5HR6A 4K3ZA 1AZ2A 1ZLPA 1AFSA 1OC6A 5F4XA 2CLPA 2G3FA 1RLDA 2YA0A 4KFOA 1TVPA 3SB0A 2OZ3A 1GW1A 3RLVA 4O11A 5D8WA 1Q6FA 3KX6A 4AF0B 1E0UA 4B9YA 4BZYA 3WBYA 4AD4A 4YYFA 4L5ZA 1BWLA 3M0XA 3F5LA 3EKLA 4S3CA 3LD5A 5HMEA 4C60A 1UOZA 2WMIB 3R5EA 1RPXA 3ELFA 1DVJA 2ZRWA 3TNBA 1EP1A 1XLKA 3BLKA 2PLCA 1TV7A 4GJ1A 2F6UA 3PTMA 5LYRA 2YOCA 1ZJIA 3P0WA 1TTJA 2V30A 1NM9A 1KTBA 3A23A 3EX2A 5LZLA 3GFZA 1XQLA 2CESA 3CEPA 2WMHA 4O28A 1DWAM 4D8ZA 4EPBC 4GNJA 4L65A 2YFOA 1ISVA 1ME8A 4A35A 3U4FA 2E6FA 4IOTA 3EWWA 4Q8WA 3HZ3A 3N11A 1BWKA 3TU9A 3CHVA 3QW3A 1W9DM 5F2LA 4GYFA 1VRXA 2Z7KA 4FXFA 3NPWA 3LRKA 2XYLA 1PTDA 1TJPA 1GUVA 3QN3A 1OJXA 3TXVA 1MMFA 3W7IA 1BF6A 3MDUA 1PUDA 2ICSA 3IJQA 3RUBL 4UNIA 3C2YA 2XVKA 1N2VA 2QNEA 5EGRA 3ZJ7A 1POKA 4JTDA 4NI8A 1NFBA 4GYJA 1ICPA 1G69A 5AHLA 3MCMA 2CXEA 4Q8MA 4YTSA 4ZXLA 5LGZA 1HN1A 4PULA 5KINA 1QPOA 4HNVA 5DELA 1P1XA 1XINA 3LGGA 1RVKA 3QLDA 3VGBA 1UIPA 3UETA 3FEMA 4GMEA 1PZ2A 1LBLA 1KLYA 1TMHA 5FJIA 4YVXA 5HAOA 2ZE0A 1XYLA 1KKOA 1XD0A 1EYWA 2V5CA 4ZQMA 4UQCA 1MWOA 4D8LA 5IHRA 1G4PA 3WH6A 1WZMA 1BLIA 1HO4A 1SUXA 3VCRA 3RGTA 4HK5A 1TPWA 3OVPA 2B7QA 1ZU8A 4GIYA 1QI2A 4K6AA 4X2PA 1XIJA 3I3DA 3VE9A 4AD5A 4RKAA 2A3AA 1KW1A 2J27A 3NM3A 4JHMA 4L7ZA 2PDNA 2AQVA 5CZKA 1C7TA 3P5YA 1GPFA 1A3HA 2IQTA 2DJLA 3SY5A 1JUBA 3DHFA 3H4WA 1SPQA 3LSCA 3VGEA 3GTIA 3I10A 1EPVA 2OELA 2ABBA 3MUIA 3AU6A 3QZAA 3S1UA 3TTOA 3S9YA 4XZ9A 1X1OA 4AZ7A 4AEFA 5AB3A 5K2ZA 4MUPA 3OA5A 3WMCA 1KO0A 1EHAA 3WENA 5B7ZA 3W7DA 4RW3A 3LZ5A 3AYVA 1EP2A 4IPPA 1H5VA 1X8FA 4HHPA 4PFMA 3H24A 2E9LA 3LHWA 3WFZA 1S1PA 5A6TC 3MZ2A 2QF7A 1XYZA 3CUIA 3PVFA 1M53A 4Q8OA 4K37A 4MWAE 3E74A 4LVDA 3E0IA 3PSWA 5IDIA 1ZP3A 3L65A 2YL9A 3B03A 3AS0A 2NV2A 1JCXA 1FWHC 1DQUA 4P8XA 3WDHA 2VD9A 4NG3A 1CZ1A 1QWKA 2J6XA 3FAWA 3I6TA 4AAJA 4PUNA 3ABRA 3E6EA 8TIMA 2W0UA 2EKCA 4H8NA 1US2A 1Q63A 1XLHA 3ZLHA 2PGEA 3GU1A 3RXZA 3IGHX 3U7BA 1FFQA 5TNVA 3A5VA 4ZCWA 2WC7A 5EU9A 2V69A 3LLDA 3P2VA 1H41A 3QYQA 3AZRA 2ZFAA 1XYBA 2BP1A 1YLVA 4DM2A 4FOJA 1TV4A 1WAUA 2D0FA 4GI4A 2PF8A 2AAAA 1UUMA 2B7OA 1FOBA 2DZWA 2QAFA 4EE9A 4JIQA 3QMRA 2ZZ3A 5BU9A 3K5XA 1EO5A 1EJSC 2PEVA 4CD8A 3WF2A 2V81A 2CLEA 4PE8A 4J28A 5HBFA 5FACA 4M82A 4C5YA 2R1PA 3QC0A 4ERGA 4NUWA 5FJPA 1EZWA 1XLDA 3CK5A 2PI6A 2WV8A 2PF0A 1ZGDA 4AEOA 4O0QA 4PTVA 4FR1A 1U1UA 1IXNA 2F38A 1DJXA 3MUZ1 1M6JA 1W5OA 1F74A 4EP8C 4NX5A 3IANA 2UWFA 1NWUA 3VKKA 3EOSA 2YGYA 2W5FA 1E55A 5L9FA 1QPQA 2GOUA 1US0A 3ZWTA 2H6RA 3WDRA 3NGFA 4HJFA 3TN5A 5KTLA 3MHFA 1TREA 1P5BA 2CW6A 1UC4A 3FSTA 3BAKA 5FEXA 3URNA 5KZEA 4WIWA 1ZL1A 3PULA 3PNUA 4JEQA 4NSBA 2YPIA 2GVJA 3WF3A 1TJ1A 1T6MA 3G1XA 4NF7A 4AZIA 4BEQA 4IQEA 1K8YA 1AG1O 1H4PA 2AGKA 3NWRA 2ZX8A 4XO7A 1OK6A 2ZC1A 2P88A 1F3XA 3SUTA 3GTFA 3LPPA 3ORWA 1A50A 1U1JA 3FEQA 3C2VA 3I68A 1B3VA 3EAUA 2WKGA 1I1WA 2OQYA 3B4UA 3WFLA 1GVRA 4DBWA 3FN9A 5FAJA 3GVWA 4YPJA 5EY5A 5LNVA 3UXIA 1O1HA 1F6KA 4G2DA 3W70A 1I2RA 1UMLA 2W6RA 3QQ0A 3WX7A 3N2TA 4MB4A 1K4HA 3MHGA 1XCXA 5REQB 3YPIA 3H8AA 3UJRA 4J2PA 4Z1AA 1EP3A 2F84A 4JIHA 2VWSA 2ZDRA 2ZXBA 3VD3A 3UYIA 3DFHA 4GNVA 4G5DA 1HP5A 2UY3A 3VGDA 5I02A 4JBRA 1E3XA 4L6OA 5I78A 1Z89A 1W31A 2VUYA 4DPPA 5CG7A 2VQUA 3L4WA 2XFFA 4PMYA 3W6MA 1T40A 4DPQA 1A5AA 3SUUA 1HNYA 3OIHA 4MWAB 3M0HA 2H9AA 3EA2A 1A3WA 4NNBA 3BDKA 2DORA 4AHPA 2CLHA 2ZX7A 1PS9A 4E8CA 1CT5A 2A7RA 2V63A 1G4SA 5JU6A 4RL3A 2VQTA 3ZWSA 3FSUA 3HGRA 3WUEA 4ZO6A 3HG2A 4W5UA 1K9TA 3IRSA 3KP1A 2OTDA 1UH3A 1GNXA 2PDKA 3MUAA 5C2XA 1JYXA 3ARUA 2VTFA 3P0XA 3W7QA 4BS0A 4HOXA 4R7JA 3V36A 3EXRA 4J9JA 3BLPX 4B9ZA 1H0IA 4UOJA 3LI1A 4XBJA 2ANUA 2PWEA 3M47A 3W24A 1F7BA 5C7VA 2E28A 4W5ZA 4YU1A 2C6QA 4O16A 4XVDA 1TPC1 3RN6A 2F6KA 2XVGA 5EL1A 1E1FA 4F2UA 4IIEA 1DXEA 3W1AA 3G1DA 3HJZA 3S2LA 1HUVA 1VKFA 1Q7MA 3CQIA 1IWPA 3MKKA 3IWPA 2DEPA 1P6CA 3KEHA 3TTEA 1BYDA 1E0VA 2BBFA 1KFEA 3GNRA 4WXYA 1V03A 2XM2A 2I5IA 1PDZA 3G6LA 3WQOA 3WDPP 3BW3A 1GOOA 2X30A 1UIOA 2MUCA 2WYSA 2GPTA 2YL8A 3VAVA 1X39A 5ECUA 2Z1SA 4MNLA 4EK7A 3BOFA 1VPXA 3L5LA 1JL8A 5C8BB 3DYOA 2AGTA 1TX2A 2PLJA 2WSRA 3W2JA 2BLEA 3H2CA 4QCFA 4QLKA 2YZ5A 1SGJA 2IKHA 1RD5A 1NELA 1QW9A 4V1XA 2ZUUA 3UA3A 3SCOA 3PJTA 4WY0F 5ABGA 4JYEA 2W3ZA 2DT3A 2XIIA 3GAYA 4B3KA 1S2WA 3CL8A 2OYKA 4AX7A 3UG5A 3DYPA 3P6LA 3OYXA 2ONEA 1UR1A 1K6WA 3QV7A 3OU8A 3WG6A 4XV0A 2D2OA 4PSPA 1JRBA 4C6LA 4AD1A 3A21A 3H55A 2YCEA 3W82A 3GR7A 1UD8A 4RJEA 2AMXA 5HULA 2L5HA 4W84A 2WJFA 4P7LA 4I6VA 3DG6A 4PMOA 3UESA 4NZ3A 1Y5XA 2XVPA 4CCZA 3TZNA 3P81A 2ZXAA 1M65A 1N55A 2QW5A 1OX6A 1EJRC 2F6XA 3AJXA 4N4QA 4M8UA 5LKYA 4NZ1A 5IXEA 5D32A 2NLIA 3OP2A 3AHVA 3SUWA 2WJEA 3DFSA 3ANVA 1B5TA 1K02A 4RK8A 5K4ZA 3AWNA 4IICA 5D30A 4A05A 1TG7A 3VM7A 4Q8QA 1V6TA 1JPMA 1UPPA 3PZMA 3B97A 3NQEA 4D6FA 1A5UA 2R9RA 4GVFA 5BMWA 4O1AA 2Z25A 4UZUA 3W88A 2QHAA 1MSSA 2QS8A 4FHAA 1CXLA 3KVMA 4CD5A 1AVAA 1R86A 1PAMA 1OZQA 3P67A 1NWSA 2XINA 1ZQ5A 5I3JA 1LQ2A 1KNWA 1IE7C 4CNPA 3I7RA 2BOFX 1X7FA 5CPTA 4DLFA 4X22A 1NEYA 1PYMA 1OINA 1W9PA 1E0TA 3H12A 1E0XA 1JCYA 2QUNA 1RJRA 2OX1A 3PANA 4O53A 4MY9A 3HV8A 3TDFA 4GJJA 3UJEA 4WKHA 2Z2UA 3DESA 2PD9A 4JZ5A 5A6SA 4GGBA 3K13A 4PBGA 4IP7A 3TMQA 4FNQA 3F2BA 2OB3A 3MP3A 3UERA 1DWFM 3T2PA 4RR4A 2BG5A 1CGUA 1J5SA 2W4XA 3WQEA 2REQB 1K9EA 1VBUA 3CPUA 4CNOA 3B0XA 2QJGA 4QDPA 3S4TA 5U4NA 1TZ9A 1LDCA 3GTNA 4LWWA 2PWHA 4XAYA 5FA5A 3UQNA 1F6PA 3HG3A 3LHZA 3O9NA 3TYEA 5F4SA 3LXCA 1P1MA 4FPSA 3I6RA 3POHA 1DXFA 2OZ0A 4DAFA 1XCFA 4GC4A 3T05A 4LF1A 4TMBA 4KCWA 1BG9A 3LTYA 2E9BA 4L1WA 3Q94A 1XKYA 3VC6A 1F4AA 2WHJA 1EYEA 3SAZA 1JZ2A 1FP8A 4XX6A 1L2UA 3S83A 3UWQA 1ZBCA 2QCGA 2NQJA 3XINA 4YS1A 3KHDA 3PBGA 2QGYA 1I9CB 4UTIA 3UGVA 2DH3A 3O3RA 1CEOA 3WK0A 1GJUA 2G8ZA 4E6MA 2E25A 2WMJA 4KMQA 5RUBA 1KWKA 1RBOB 3PWIA 3VMOA 4ZSTA 1A0CA 4KEUA 3LGEA 3DFQA 2VRQA 2CZVA 5LGXA 5E0CA 3SFWA 3PUDA 1E56A 2PDYA 4E2BA 1WKFA 4JN6A 2X7VA 1HP4A 3EMQA 2OLSA 3OGRA 3B8SA 3U2OA 4WR3A 1QOPA 2XHYA 3KZPA 3UU0A 4HP5A 3N18A 3S6DA 4UTUA 3TW7A 4DO5A 3THAA 3CB8A 3CUHA 3D5HA 5CC5A 3DBNA 2H9AB 1Q5MA 3USZA 3LQLA 2ZRZA 3EDDA 2PMQA 4YWSA 1NF7A 1R2SA 1RP9A 4ORIA 1LLZA 1M7XA 2GSJA 3V1HA 3B8TA 1NDZA 3C61A 4ZVJA 2IPWA 3ENLA 3S5NA 3FA3A 5E6YA 4BQ2A 1DV7A 4MNMA 3RIKA 3BL3A 3EEGA 3RFAA 3REQB 2RDXA 2VOMA 2GVEA 3KP0A 1JDFA 1PL9A 3WNLA 3W71A 5CKSA 5BU6A 3PUGA 1UYQA 3CQ0A 2C1IA 1CWYA 1ME7A 1W37A 1S2CA 2VEMA 2WQDA 4WY0B 4AZBA 1FDJA 4FXJA 4DZAA 1J10A 3D46A 3EA3A 4EAYA 1GCYA 4V1YA 2IW0A 2ZUNA 1E15A 2R94A 3WD1A 2WVVA 4LYQA 2FB2A 3QMTA 1H7NA 3OG3A 4Q3MA 1VJSA 2QPXA 5DF0A 3CQHA 1FWBC 1VD6A 3M7SA 4PUJA 4PMQA 3F4CA 1PE1A 4W87A 3VIJA 2ISWA 3ANYA 3B0UX 5AC5A 3MHUA 4ZQCA 2BFGA 1M7OA 3WSUA 4NKCA 4PUEA 4H00A 1S5VA 1VLWA 4QG8A 3SRDA 4ZL1A 2WC3A 5C6MA 3NCOA 1MXGA 1LRNA 2NSXA 4YHGA 2ZX9A 4AHQA 3AROA 5I07A 1XS2A 2OSYA 3VGHA 1OGGA 5TBOA 2X1SA 5EB8A 1Q6GA 2FHCA 3TCEA 4MOZA 1HKMA 4AWUA 2DY3A 5KZ6A 1S38A 2JIEA 3DYMA 4H9YA 1H3GA 1UP3A 2C14A 1BXBA 2OEKA 4L80A 4J27A 4MG4A 3FY1A 3MBFA 4LXFA 3G5EA 2Q3RA 2WJZA 1KGUA 3TC6A 2IPFA 4GYKA 5CGTA 2WXDM 4JXCA 4RZ5A 2PS2A 3GUWA 4UWMA 3TYUA 3CC1A 4W8LA 2BGSA 1C9DA 1S5MA 3BSMA 2PDIA 3A9BA 4Z0JA 4HVXA 5TD4A 1UD5A 3PBUA 1Q7QA 2CXGA 3AISA 2GK1A 4O1EA 4FIRA 4S2BA 5KEZA 2HS8A 4GOAA 4R27A 4XZWA 1TSIA 1XIEA 2PBGA 4JTQA 4AQLA 7REQA 4PMZA 3P62A 2WBKA 1BG4A 3WNNA 4HTYA 1QPKA 1EB3A 1GVQA 3QTGA 3R58A 1DWGM 2V38A 4CNTA 1FBAA 1YNQA 2H90A 1DHKA 1EJXC 3LLFA 2NW0A 4MKVA 3IV8A 4A2RA 1SM9A 4LQ1A 1F3EA 2I57A 4A22A 1KGWA 2OYLA 2P8CA 1UJPA 3WO8A 3EWYA 5BXPA 2W63A 2BY2A 2XFWA 1ONRA 1GZ1A 3N6JA 1PVNA 5C2CA 2VD8A 2EPOA 3S0CA 2C1HA 1UWIA 4W8AA 5DBUA 1UC5A 2ZZ2A 2WO5A 2NQ9A 4LEQA 3TYZA 2ATSA 4EWND 4D1JA 3WNOA 3VD5A 3KCLA 1XLLA 3G1YA 1JUEA 3W81A 3ZT7A 3CTLA 1OADA 3FAXA 4YCPA 2ZXQA 5LNUA 3BG3A 3MQTA 3WQPA 5HJXA 4RE2A 2ESCA 5DFAA 1EQPA 3O6CA 4B5NA 2J7CA 2VR2A 4B2DA 4DYJA 4HZ8A 3NSXA 4LUIA 5H2ZA 4H19A 4X63A 3TAOA 2QV4A 1VF8A 3B3DA 4GISA 2J7HA 3ZIZA 2WSQA 1JFXA 3V0TA 1QT1A 3AAMA 3VYLA 3R7MA 1P0BA 2V2CA 3U2EA 5FEPA 1JPDX 1RH9A 2AKMA 3V4BA 2DQWA 4MY8A 1GVOA 1E70M 2KX9A 2HISA 1S2TA 4IGHA 4QSFA 3FW6A 4F2TA 3NQGA 4ORMA 3B8DA 1BVNP 1KXQA 3UCDA 3MBDA 3MZNA 5CCZA 2VEPA 3G3DA 4HMDA 3E2RA 4DN1A 1FWGC 2J4GA 4W89A 1RY0A 5FSDC 3WFAA 3M5XA 4DXKA 4HGXA 4MLRA 3R12A 3MJYA 4DXXA 3QOMA 4ZQNA 1Q6CA 3N3MA 3W23A 1ZAHA 5BXRA 1FCUA 4IIDA 2D22A 3HO8A 2O0TA 2DIEA 1V3IA 4Z2GA 4L6DA 4BFAA 1FX6A 1V02E 4FLOA 4LUTA 3NZPA 4ERAA 2QUMA 1GORA 3LCLA 3DUGA 3A4WA 1UWRA 2E68A 4U4MA 1EDQA 1XJBA 1BYAA 2J24A 3ARSA 1LL4A 1OFDA 3CHDA 2G3JA 1CB2A 3ARVA 3GBDA 2QUVA 4JTHA 2RAGA 3DXIA 5GNXA 3AHYA 3N1AA 3S3GA 4LCRA 1JDEA 4KFPA 1V6YA 4RZ6A 1CXHA 4JX6A 3SFKA 4OJYA 2PRLA 5FF7A 3UWWA 3TLLA 5DO8A 2R91A 3QW4B 2Z1XA 4GNKB 4C1KA 1OG6A 3CIXA 1DJZA 4X0VA 5BNKA 8XIAA 4KPLA 1TVNA 4GACA 4AZ6A 3GG0A 4I5XA 1QK2A 5HMSA 4RDVA 2ZBTA 4JYFA 1OG0A 3WH9A 4CEXC 3VMNA 1S5WA 4WQ6A 1OIMA 3ARWA 3VK5A 1SFTA 5M03A 2EBNA 2OOFA 3G0SA 1IR1A 3VCNA 4XTDA 3WQVA 5GVJA 1T0OA 4LVGA 1IT8A 3KM8A 3PZ9A 1UKPA 3W87A 4H9TA 4J2MA 1A53A 3MKVA 1VFSA 4LY8A 2VENA 4WDUA 4FLRA 4HOWA 1Z41A 4W8BA 3TR2A 3VM5A 3ZT6A 2B7NA 1RCOB 4BI7A 1NSJA 1G0CA 1K03A 4E4FA 2FZ9A 3KBSA 2BV9A 1MXDA 2DW6A 2OGYA 3WQ4A 3EPOA 4L64A 1UROA 4UFKA 4MB5A 2ZA3A 5CXPA 2J79A 1JYNA 1ISZA 4LS2A 4CQDA 2V6AA 4HNTA 4PSRA 2VM8A 1Y5VA 1F73A 3EB2A 3H53A 2WW5A 4TUFA 2A5HA 1E0WA 3QC3A 1FDZA 1QNSA 3N2CA 4GUHA 4JN8A 1FCQA 2DSZA 1DJIA 1A49A 3FIGA 1C8QA 5JH1A 4N6EA 5FJUA 4PZVA 1R7OA 2VYOA 1C93A 3SM0A 2HTMA 1VENA 3DECA 3ALFA 4UMBA 2X16A 4ZTXA 2OVLA 1R3SA 2IXVA 5HANA 1R2RA 4ZO8A 3KXQA 1UR0A 1YHTA 4DYEA 1SZFA 3TOPA 4LT9A 5FCZA 5KMYA 4AFYA 2PZNA 1KM3A 3N9RA 3APGA 3W83A 1PIGA 2GGJA 5CPSA 4GX9A 3R94A 2I56A 2J8GA 2BASA 1EF3A 1FWWA 1TPEA 2NX3A 1TUXA 3TC3A 2HPIA 3KDOA 3K4WA 2ZTKA 1JDDA 3EPNA 3DHPA 4MADA 3WNKA 7XIMA 3VDHA 1GOMA 3B4YA 4IP4A 4E5TA 2NXIA 5A69A 1HJUA 1OFRA 2OT1A 4LAZA 2ZZ4A 3AICA 4ZQOA 4IMDA 1EGZA 4KIRA 2H3DA 4X61A 2FVLA 4O4WA 4AIEA 4H7ZA 1TV8A 3PZVA 3QFWA 4GZ7A 1Z42A 4P8WA 5J04A 7REQB 2Y62A 1XX1A 3NSMA 1FXPA 3GXMA 4Y7EA 1H1NA 3DH7A 1M41A 3OLDA 1VIWA 4BWLC 3OGSA 2CFFA 3O2LA 1U33A 1HKWA 3W2LA 1KM4A 3LRMA 2GWGA 1RVGA 4NASA 1EBHA 3W01A 2GUYA 1WV2A 1SFLA 3PC0A 3IJ9A 4HT3A 1YKWA 1ZAJA 4Y9OA 4L9ZA 2ZUWA 8CGTA 3QSRA 4YTRA 1J96A 2NQ5A 4IM4A 4B15A 1XLMA 2A3LA 3TONA 4DNHA 1K6AA 1EWDA 3LY0A 1YRRA 1ECQA 2PDXA 3B0YA 1E1CB 2P1FA 4D6GA 4PMVA 3IARA 1DWJM 3Q67A 1YE6A 4JY8A 3U5YA 4S3JA 1VR6A 3Q65A 3S2MA 1W3IA 4H9ZA 3CH9A 4GX8A 3GXNA 4DJFA 4P7OA 3CU2A 3FKRA 4JQ3A 4JNYA 4QR6A 3MMTA 5G2WA 3RPDA 2W62A 1IEQA 1AH3A 2VFEA 3VO0A 4XZBA 1DIOA 1VLIA 2AOSA 5DMMA 3O1NA 3UJ2A 4JTIA 1TX0A 4DLMA 1VBJA 4LRTA 2QXWA 1M1BA 4MKNA 3NZ1A 3QPEA 1POJA 1XKJA 1E73M 2DUXA 2ZE3A 3RU8X 2WHLA 5E1QA 3HFYA 1A3XA 1UPMB 4IL2A 1PTAA 4ONVA 5E6ZA 2VFHA 2YX0A 5C5YA 2X1UA 4LS0A 3O16A 4POCA 1JRCA 1OB0A 2FJKA 2PWGA 1HJQA 5AZ1A 3H2FA 1G7VA 4LVFA 4XKYA 1ZPTA 1FCBA 4JGDA 1S46A 1A47A 1W5PA 1J11A 2YCJA 1CTNA 4FXSA 4LV4A 2XH4A 2VZVA 6CGTA 4ZZ9A 1YXDA 4OWGA 4DJEC 4CNSA 3BW4A 2FTPA 3BSGA 5CSUA 1Q8JA 1FTXA 3KOZA 2P0OA 1IV8A 2DUAA 3BUVA 3NAVA 3ZZ1A 3T1GA 3M5YA 4WX2A 1O4UA 2VEKA 5EMYA 2JF6A 1US3A 4OIFA 5DY3A 4CCDA 4GQGA 1FFRA 3BAXA 2PTYA 2YYUA 2A6LA 3WK1A 2E6DA 3I65A 3R8RA 1R0MA 1WYIA 1YE4A 2QUUA 3PTQA 3OBKA 4P8UA 5J5DA 3H2AA 2VMFA 3PG8A 3KOWA 3QHOA 4ECLA 1RR2A 3ITLA 2C0AA 1TMQA 3PF3A 1EQCA 3COTA 4O8RA 1X96A 5GJNA 4NQ1A 3W53A 1KXVA 4QHRA 3UP8A 4Q7NA 4TX9A 3ITXA 1N7KA 3VE7A 4HB7A 5M1TA 3H2EA 4QEHA 1THFD 4DRSA 1XWYA 2CBJA 4GQQA 5T9CE 3PHAA 1MVYA 2QZRA 1ONEA 2BY3A 2Y7FA 2QMJA 4FLQA 1EJTC 1EO7A 3GVGA 3FJ6A 4QJ1A 2DZSA 2CCRA 1LZOA 2G5WA 2PLMA 3QPYA 3BK0A 3G8EA 4A29A 1OABA 1T41A 3QGVA 4CNNA 2FMOA 5CLTA 1RY8A 4E2VA 3TQVA 1E6PA 1V0MA 5AVNA 3VC5A 4U33A 1SO5A 3MVTA 3FK4A 1FWEC 1KFCA 4H8VA 5FL1A 4JCMA 1ICSA 1UUQA 5D9NA 1OYBA 1XYMA 3WQ5A 1QNPA 1PX4A 1O5RA 3CL7A 4R34A 1CIUA 4DWSC 1BQCA 1XGEA 4FAMA 2DZUA 4MHBA 1I6NA 1TIMA 3DFOA 4OV9A 4F9DA 4LH8A 4Q8UA 3T0AA 2EJ1A 3BWWA 1W9VA 2FH6A 4IZGA 5E0KA 4ZTYA 4MDOA 3TUUA 4E8GA 2HRWA 3W73A 3MCNA 4XUYA 4B3LA 3RLHA 3ABQA 2A6NA 1WNOA 3KBMA 3V16A 1HL2A 1AW5A 2A3CA 2FPTA 3N29A 1XIBA 3E0FA 1PKNA 3G1AA 2BVDA 3R13A 1EXBA 5TF0A 2HNHA 5C9WA 3LI0A 3RM9A 3MUXA 3VIMA 1ZJAA 2QMKA 2VDIA 3GH5A 4NNAA 2E7FA 3HG4A 2NWRA 1OGSA 5IOBA 2WVUA 3HM7A 5F7UA 5DMNA 2J7BA 2VC7A 2CETA 3EWCA 2PGFA 1E9LA 3IACA 1VIZA 2WVSA 3IVUA 4KF1A 1PPIA 1R5YA 1WBJA 1H62A 3N4FA 3L0NA 1CCWB 2V67A 4KFNA 5AHIA 3IV3A 4H1ZA 1WE5A 1YDNA 4L9XA 5FAGA 4HNCA 1RA5A 1TV3A 3O05A 1SO6A 2VZTA 3VINA 2XJ7A 9CGTA 2VCCA 1I2QA 4HQVA 1ZJHA 2ZRYA 3R8HA 3WDJA 1I0DA 2ZZ5A 3KL5A 4XAFA 1KQYA 4AY1A 1AA1B 3PB2A 4Y96A 1VB9A 3ZFHA 3SDOA 4AD2A 2O9TA 3V1PA 1PEZA 3EMZA 3S5YA 1GKPA 3GS6A 2HZGA 1QBBA 3BJFA 4BI6A 3MDWA 4D9PA 2IXUA 4W88A 3QY6A 3CMFA 2O9RA 4N6FA 1O7AA 3PPHA 4MNJA 4IPNB 2J8FA 1D3HA 3GG8A 1GVFA 2PP0A 2Z2AA 1MNZA 3CNYA 1XLEA 2QULA 4J1OA 3G18A 2GGIA 3W7RA 1B4EA 1JPKA 1SU5A 3BE7A 6PTDA 4IISA 3S6TA 2TAAA 3SCRA 1QHPA 5AZ0A 3RLGA 1DPMA 3AMKA 3AO0A 3VDAA 3QKZA 1J9YA 1NQ6A 1B3WA 1XBYA 1JIBA 1KGXA 3U7VA 4JTGA 2DFAA 2GQAA 2Y8UA 4G9PA 3W4RA 5IRPA 3S46A 2NUXA 4XKMA 3ARQA 1I2NA 3TNOA 3GHSA 3ITGA 3RX4A 1E9IA 3RMEA 4DQWA 1JCTA 3M64A 3MA8A 2VCAA 1CGTA 3KL0A 4PR4A 1L0PA 1A5OC 4HPJA 2YCLB 3S2NA 2HCVA 3CT7A 3PTKA 3VDBA 4JN7A 1ZS2A 1LOQA 1G6CA 4XZHA 4A8LA 5ABEA 2PWUA 1VHNA 1T5AA 1T7LA 4MJMA 4UTWC 5G1TA 3LHTA 1DORA 2UY5A 4Z2LA 1JCNA 1L6YA 1WPCA 3O0FA 1UZHA 3E0WA 4WUIA 3NR0A 1W8GA 1D8WA 3GFXA 1UH2A 3U0HA 3KFTA 3PBWA 1GJPA 5A6LA 4PUUA 1RP8A 3N04A 4GQRA 4DBEA 1UWUA 4JX4A 3WLJA 1TYGA 3T6CA 1Z8AA 2NT0A 1U5JA 4NYUA 1P7TB 5IBXA 4RE3A 2Z1VA 3N13A 5AHNA 1GYNA 4JOMA 3W2KA 3O63A 3E3HA 1QOXA 4HTBA 1YX1A 4K2SA 4R7WA 3WD3A 5IFTA 4XKYB 1W17A 2CYGA 1UR4A 4CD6A 2Z1WA 1HQTA 4QS5A 5FJOA 2VC5A 1U1HA 4O15A 1WUFA 4GXPA 2YFNA 4Y90A 3UWZA 3CUXA 2D24A 3SI9A 1M3UA 3BAIA 2E40A 2EXOA 4WJXA 1XLFA 3RCYA 4BWLA 2VX7A 3BLEA 4HZMA 2ASHA 4MY1A 1FHUA 4PUWA 1J01A 1QK0A 1GOXA 4I3GA 4MSSA 3SY1A 4LY4A 3HB9A 5MKGA 4HKPA 2PDCA 4J35A 1PXGA 1SR0A 5J8LA 6XIAA 2FYMA 1J0KA 4IXXA 1YW1A 1JG9A 3H4GA 4ZA0A 2HK0A 4LAKA 5AOUA 1W1IE 4Q4OA 4NAEB 2DV0A 1S2AA 2G97A 1TPUA 2DZVA 5DMLA 5EMUA 1YDYA 1EBGA 3ATYA 1C8YA 1TWZA 5CG0A 1NJJA 3PN8A 1E1EA 2ZUTA 3WH5A 4GPNA 1MW2A 4UMAA 3RLUA 2YW4A 1V3JA 1X6NA 4OGZA 1EWEA 3VZXA 5A8OA 4UMCA 4ROPA 1DJYA 1GVSA 2FGZA 2VJXA 2NT1A 1BXCA 3IUIA 2WZHA 4MWAC 1EDGA 3RCMA 1TR1A 2VT0A 3QYSA 1DL3A 3ICJA 2YDSA 3ZMRA 1EKOA 3QEZA 3AI0A 3GSMA 3PBMA 3WEZA 1CLXA 3KAOA 4C1NA 1B90A 5G1YA 1UD2A 3VIFA 1Z44A 1DWHM 5A8MA 3G1HA 1D2KA 2PDPA 5K4XA 4UQBA 5BWAA 2X0SA 3Q2DA 3ZJ8A 2Q6ZA 1E4IA 4REQB 4F0MA 3NQDA 1DP0A 3WF0A 2GVYA 4DJEA 5I3HA 1V5XA 2DSKA 1LT7A 2OQLA 4WKFA 2HXUA 2EPLX 1OGBA 3NFUA 1XBVA 3WH8A 3BAWA 3STCA 4ICMA 1NOFA 3CV2A 4OFCA 2O4QA 2PDQA 2F2HA 3L12A 1CLVA 1G01A 4HCHA 5AC6A 3QFEA 1NF0A 2P5NA 3CQKA 2YB1A 5JQ9A 1MXSA 1R3RA 4JY9A 4GUIA 2QCDA 1YQ2A 3C86A 2VGBA 2JK2A 4Z1YA 2PLKA 2CLOA 1QI0A 2PWFA 1ZCOA 5D09A 1NDYA 2PDLA 3RNDA 1Y8BA 3LCWA 3G3MA 4TO8A 2QGHA 4TX8A 1MDLA 3GIYA 3TJXA 4DXVA 1S3TC 4TV5A 3ZQ9A 4IL0A 5D37A 4W9TA 4Q8TA 6A3HA 5CC3A 2GOKA 1UWQA 3FGCB 4O1BA 3J7HA 4PFHA 1F05A 4DVOA 3CZLA 3BQ6A 3CAWA 4LUJA 2OO6A 4I9AA 1UP0A 4B2DD 2ISSA 2OR2A 4CQ8A 1DJNA 4M1RA 3NG3A 4IX2A 2DUZA 2R1MA 2WHMA 3TN4A 4DI8A 4XISA 3W22A 3CAQA 2XGIA 3QHMA 3NO5A 1F6YA 1UR3M 3N3TA 2WZEA 2PDUA 1G1YA 1OYAA 3WD0A 3OYZA 4AB4A 3DC0A 1MRAA 2GDQA 4AH7A 3DBPA 3UR2A 2BY0A 4GIRA 4NX0A 4DWSA 4DB7A 2VWTA 4KBXA 1KCKA 3R10A 3AYSA 4NI3A 2Y8VA 4XQ6A 1LWHA 1GEHA 1DXIA 4KT2A 4JQ1A 4KKXA 5HOSA 4B16A 1XYAA 1HKJA 3TK7A 3LN3A 3M0IA 3ME3A 2Y70A 2WC4A 1FKWA 1AODA 3NOYA 3G1FA 3DG7A 1TWDA 2XWEA 5T91A 1KBKA 4K38A 4NP7A 5I3IA 1FWNA 4NZ4A 4E2DA 3WDQA 1DHPA 1DOSA 5HINA 1ZBVA 3U5UA 5E0FA 1ISXA 1H51A 3PJWA 3VABA 2FGBA 3BLFA 4IJBA 4AUBA 1E6RA 4G56A 3W1UA 2QV5A 5C55A 3LBMA 4U5IA 3G24A 1XIDA 1K77A 3BANA 3LM3A 2JQXA 1NDVA 2A85A 2E77A 4K68A 1Q4WA 4M6UA 1UKTA 5I24A 1UKOA 3FYPA 3R79A 3C0LA 1LWJA 4H9MA 3MI6A 2J13A 3CIWA 4DBUA 4FEZA 2PRHA 4AY7A 3TVAA 5C70A 4FX6M 1JJKA 1QXLA 5G2IA 3S2CA 1YEYA 3U9IA 4WK9A 3HPFA 2Q71A 3QBUA 1AH0A 5HPCA 3S42A 3A9IA 5HK4A 4S1FA 2XFRA 3WLNA 3GDKA 1R9YA 3K1GA 3L4YA 1EDTA 4FOKA 2QUTA 3QTPA 4FLSA 2Z00A 3F1QA 1BSLA 3N9KA 3VNDA 3HFTA 3NL5A 3QGAC 4YMZA 3WLHA 4HMEA 2EG6A 4ZE5A 3GR4A 2YBTA 5F1VA 2I14A 3HGSA 3RF9A 4LBRA 1XPYA 3W2NA 4TX6A 5AYXA 2E5DA 3URBA 4C6FA 1OCBA 3G22A 3ANUA 1CXEA 3WEMA 3L67A 1KCXA 5SWUA 3KTSA 5EFFA 3AZSA 4JTUA 3T78A 3SEPA 3SRKA 1EEXA 1PIIA 4JX5A 1LUCB 2J25A 2QCFA 1O5QA 4G7EB 4S3EA 2C0HA 2I5QA 5DCDA 1A5NC 1VJIA 4XB3A 3W1NA 5JMUA 4K8EA 4UTJA 2ZZ6A 1JGIA 3VKJA 4H8UA 3N9SA 4GH1A 3W9ZA 1BRLB 2VP8A 1CXKA 2O4MA 4DO4A 1U83A 1OFOA 3BW2A 1TWSA 1TR9A 4G1NA 1RD6A 3PBVA 5PTDA 3LERA 4ICNA 1XC4A 2CEQA 4HNLA 1VFOA 4IX0A 2WSKA 3CPRA 2BS9A 4YHEA 1Q45A 4G7FA 5MKGB 4OECA 4BF9A 3JVAA 5DLCA 3PR2A 4N42A 3T42A 3NYZA 4UOZA 1QPNA 1L6WA 3STEA 4PL1A 1MNSA 1UWTA 3GXDA 2ZOXA 3M4HA 2XGBA 3BMXA 2E67A 4FX7A 4M0XA 3GHRA 5A6KA 4ROQA 1X7IA 1RBLA 1NOWA 2EHHA 1HX0A 1WDQA 3V5CA 3WL1A 3UZYA 4OZOA 2X7WA 4UTWA 1IT7A 4Q6XA 4F0KA 5JH2A 3TX9A 4ADTA 4I9MA 1G94A 1J5TA 1XHGA 2RGLA 5A6BA 1WKEA 3WMSA 4XIMA 3VXGA 3H7VA 1KD0A 2G37A 4MJZA 2ACQA 9XIMA 5K3VA 3JS3A 3QM3A 5AC8A 2F2KA 1JCJA 4CEUC 1WBHA 1JAKA 4S23A 2BVYA 3H7RA 1ZTVA 4CU6A 4C7GA 4INFA 3SQMA 4JQAA 1GVIA 3OZYA 4XBSA 5ECVA 5JVLA 1K8ZA 1I45A 4HZ7A 1HF6A 3EDFA 4FK9A 5BOFA 4ZB5A 2QT3A 3AIRA 5CC6A 1G4TA 3GTXA 1CENA 1U5VA 3FFSA 5F2MA 3QSTA 2G3MA 4GUGA 4LU0A 3P7YA 4OUIA 3S6OA 2VZUA 3VIIA 4JTAA 1IWAA 2ZWZA 3UBPC 4RNIA 5K9CA 2GDUA 1IZKA 3ABSA 1BQGA 3C8FA 4Z42C 1LF1A 4PMDA 1OWQA 3NQ6A 3GKAA 5EFDA 1B9ZA 3IIZA 3BURA 3O6DA 3GR8A 1L8PA 4I90A 3NQVA 5T9BG 4P5UA 1M01A 3E9AA 4Z1CA 3TQPA 2YL5A 1GONA 2QCDB 2DSWA 5B7YA 5G4WA 3MO7A 1Z69A 2ZVRA 3LRLA 4N9EA 3OBAA 3U6WA 1VEPA 4H8HA 2PGWA 1AL8A 2I17A 1FY6A 3ARPA 5REQA 3RX2A 1Z48A 5T8GA 2I9UA 3R11A 5I00A 3NQBA 3EPMA 3CUJA 1ICQA 4R5EA 3VD9A 3HG5A 3OLIA 2Q8LA 3A24A 1B9BA 1F8IA 2GVGA 1C3FA 1FWJC 2PODA 3UNDA 3LG3A 4AXKA 5E93A 4M6VA 3C0QA 2HE5A 4DJFD 3STGA 3WD4A 3T07A 5DY2A 1JZ4A 5DQPA 1W91A 5ENLA 1HL9A 1G5AA 1SZEA 1OFAA 3CBWA 2C3ZA 4FNRA 4YTTA 2YLLA 1QNQA 2D20A 4RV8A 4GIAA 4H6KA 3I3EA 4MWAA 2VDGA 4LUSA 1X8CA 3AU2A 3PG9A 5D9OA 1FWSA 4EVZA 1UMYA 3W02A 4FO4A 1LOLA 1J18A 1J0ZA 4K8HA 4NVTA 4QAIA 2PWDA 5CBIA 4F79A 1TA3A 3FDKA 1UBPC 4FNSA 1VBRA 2C8NA 1S2VA 3L0KA 2YB4A 5FJJA 1HKKA 2BXVA 3TSMA 3IS4A 3WLKX 1NFGA 4CU8A 4NZCA 3HBLA 4DWSB 1TWWA 3KHJA 3QOKA 4B5UA 5BW6A 1V79A 4KRUA 1SO3A 4C6EA 2X2GA 1Q3NA 1WA3A 1QRQA 3EXSA 7ENLA 2XFYA 4H01A 2WCSA 1W5QA 3MYPA 3UWUA 1KV5A 4JTEA 4NJHA 2V2DA 1TQXA 1MZRA 2NQZA 2WZIA 5DCEA 2B7PA 4UR9A 4EACA 2EPMX 7TIMA 4B92A 5CPNA 3MB9A 2ACSA 1ZY9A 4KCTA 3KTCA 2RKXA 1Q2SA 1M9HA 2XPKA 1MZHA 4NJJA 4MZ1A 4DI9A 3K4AA 1OT1A 2QQ6A 3E2SA 4Y9NA 1H5YA 2FB3A 1O6IA 4MVAA 3ISIX 3HGOA 1ECEA 1OEPA 3SGGA 1EJUC 3GW0A 5LHFA 3GE7A 1AD4A 2V9DA 1RXOB 4GY7A 2Y7GA 5CZ0A 3VU2A 2AQOA 2DVUA 3TJIA 2Q8ZA 2ZX5A 4NXKA 1NH6A 3ES8A 1R3QA 2ZTJA 4O54A 3CHFA 3QQWA 1V0KA 4HU0A 1JVNA 2ZICA 3SUVA 1EUAA 1FXQA 4GIEA 4ML4A 3LBCA 1C91A 1ADDA 4GJIA 4FALA 3DN5A 3N4EA 2TYSA 3TWAA 1C92A 3AQUA 3TFCA 1XP3A 4D6HA 1SW3A 2ZQ0A 5D2XA 4LNCA 2PDMA 4PUDA 2J9ZA 3C56A 5L6UA 4C91A 4L4LA 1GQJA 1V08A 3B9AA 3ZVHA 1JZ7A 1UR9A 5EMMA 4NU7A 3IJ6A 4K39A 5CZSA 2F61A 2BGQA 3INPA 4ACZA 2C91A 4JTTA 4Q33A 5K9DA 2VGIA 3SW6A 2Y8KA 2BZNA 3CUZA 3LU2A 2BHUA 3T8QA 5H8PA 3UZWA 4UZSA 4KWOA 3RAOA 4KESA 1LBFA 2Y89A 4CN6A 4BR1A 5FSEC 3DG3A 5C54A 2ZCGA 1FWDC 1HIZA 1B0IA 1Z9AA 1X1ZA 3EXTA 3MVIA 1XIFA 3UXKA 1FH9A 2FPYA 2YBUA 4AX6A 4Q4QA 1Z7AA 3M0VA 3GDBA 3WF4A 2ZXDA 2QEZA 1FVPA 1UOKA 3VMPA 2GUBA 1XPGA 3MT1A 1O66A 2J9XA 5GJMA 4JNMA 2OZ8A 4GABA 4DUOA 4JFUA 4U3AA 3CS2A 1NP0A 3S2JA 3SRHA 3TN6A 1KRCC 2KAUC 4O1FA 2VX5A 2P10A 1F07A 3DERA 4EXBA 1R9XA 1EL3A 2ZA2A 1DJWA 3BICA 2OT0A 1EGVA 2UY4A 4FP1A 1UWAA 3CO8A 4PCTA 1I2PA 1AD1A 3V5OA 3CMJA 4PB5A 2NX1A 5FEWA 4D2JA 2ZIDA 3GNPA 1WZLA 3DFYA 3MMUA 1LQAA 2OKOA 3GH4A 4ILSA 1QVBA 4LB3A 3M7WA 4JCLA 3LMYA 3A5FA 2OSWA 5CPLA 1H7RA 4NL1A 3W1XA 1AJ0A 4KCVA 1OVDA 4O57A 3MS8A 3KOXA 2GFTA 3S1VA 5XIAA 3EWBX 4JTLA 1OHLA 3NZQA 4S3GA 2REQA 3TN3A 3NIYA 3PPCA 4U31A 1YPXA 4IFKB 3GKFA 3WBEA 4TMCA 4NZJA 1RA0A 3ERPA 1R87A 3M0MA 1OT2A 4MAZA 1AQ0A 3OTRA 4H4IA 4WCJA 3N17A 4NJIA 1GQIA 4OE7A 2DZAA 1SYTA 2VRJA 3U4AA 4Z2JA 3HOJA 4XZMX 3KRZA 3BO9A 1BYBA 9RUBA 1BEUA 4CLMA 5CLWA 3T4WA 1KFLA 2PZ0A 4B4FA 4PRRA 4UOQA 1R2TA 3W7CA 3BZJA 1KC7A 2EGZA 1LG2A 1PTGA 1OQFA 5LNWA 3TH6A 3BOXA 3W74A 4QBXA 3ZO9A 3QZEA 2JBMA 4JKKA 1Q66A 3OBEA 7A3HA 3UGRA 1S2UA 4A8IA 2FHFA 4EANA 1PZ1A 4JDBA 2V3DA 4EX4A 3DEQA 2JEQA 2FZ8A 1V3HA 1DTNA 1XH2A 3JZEA 2DT1A 3GYCA 1FHDA 4HBKA 2E3ZA 5D2WA 4QLJA 4LYRA 4DM1A 1JCLA 1L6FA 5BYWA 3AS2A 1ZBWA 3NXFA 4HU4A 5A5WA 4YXGA 3A47A 3W38A 3L4VA 3CV1A 2WZMA 4C6BA 4MKSA 2HNEA 2NVCA 5HNUA 4ADUA 1V7YA 1Q13A 1Q6OA 1U5HA 4KH2A 4Q4RA 2Y1HA 2AL2A 1A5MC 3AOFA 2X2YA 3CEUA 1TPDA 4Q4SA 4AW7A 4CNUA 1N8IA 2JEPA 4P8VA 3MI3A 4YLWA 3VGGA 2C18A 1SZRA 3GXFA 2X1RA 1GHRA 4U28A 3V5FA 4LUSB 3R8GA 1KM1A 1VZWA 4O0KA 1NTHA 4L9YA 4OTKA 4J40A 3LV5A 2YJQA 1HJWA 4GKLA 4DF1A 5IHSA 4B5VA 2BOGX 4KCUA 1OCQA 1TA3B 4ES4A 3WQFA 3JU2A 1ML1A 3W6LA 1W3LA 4AC7C 4ZFMA 1RLCL 4GUJA 4DX3A 1ZALA 3A3WA 3FDGA 3UZXA 5D38A 4QEEA 1E6QM 4LNYA 4AVFA 3REQA 5EMKA 2NWSA 3VIKA 4US6A 3NQ2A 1V6UA 3WDIA 3C3NA 1KV8A 4DBSA 3VDCA 1V0NA 3M0LA 1VYRA 3IGUA 3SSJA 1SMAA 1R8LA 4WY0A 3HQOA 1TIWA 1ITQA 3UW6A 2PDWA 1KM6A 3C3UA 4CN4A 4FB7A 4JTJA 4GH3A 3F4VA 4NAFB 4JKLA 1TV2A 1YYAA 3SZ8A 2NVDA 3LXAA 4AVOA 3U2ZA 4MYXA 5G1MA 2J7FA 3KLKA 2PUZA 2YDQA 5FF4A 3MSYA 2WOQA 1EPXA 1EC8A 4ERIA 4L1GA 3OHIA 1CXIA 4JL2A 2RJHA 3WH7A 1XFCA 2D69A 1HZYA 1NDWA 3DGBA 5HMFA 3LV6A 1ZZMA 1O94A 1WDRA 1TO3A 3AXKA 3RDKA 1YDVA 4KGJA 1V7AA 4XD6A 3VIGA 1O12A 1K7XA 4US5A 3DI0A 4M19A 3N14A 1UA7A 1V8EA 2Y5EA 4QG9A 4Z2KA 4GZEA 1VFLA 4RX0A 4E4PA 4Z0SA 3KVJA 1XLCA 1EZ2A 3AIQA 4L56A 5D03A 1QMLA 3OA3A 1LBMA 3KZSA 2CLLA 1G9HA 5XINA 2R8WA 3HQ1A 4E2OA 3WMLA 5I0DA 4D6EA 3LLXA 4S2CA 1NAL1 2TPSA 1ALDA 3IAQA 3IIVA 3KS5A 2D73A 4JPGA 2RGMA 3C2OA 1K4GA 3KBJA 3H26A 5A6MA 3NZRA 4HK7A 3G1RA 4RE4A 3ONBA 5KZDA 2IKJA 3FJNA 1VAHA 4AIUA 1Y65A 3ONCA 1MW0A 2CERA 3G1SA 5HR7A 1H2JA 1V6WA 1ITCA 4U3CA 1QJWA 3ZVHB 3ZSSA 4DJED 2CITA 4PB3A 4A6GA 4ACZB 1W1PA 1AW1A 2A79A 2CBIA 3MSDA 4C7DA 4HOZA 4ML9A 4M51A 3N19B 3TCSA 3WBWA 1YDOA 1YTDA 3W07A 4JHOA 5IM51 4CGTA 1BWVA 2QCMA 4AZHA 4GCAA 3S5SA 2WNZA 5CAKA 3U57A 1O68A 2EPHA 4Z17A 3GH7A 2ZC8A 3AALA 3VNMA 3LCGA 2J88A 4BQ5A 4QCEA 4DY1A 2XN0A 4H9VA 5HA7A 2Z29A 1R9ZA 3LDVA 4XUGA 5TAOA 4I6KA 3W29A 3UWYA 4QG6A 1LLWA 4IMCA 4LVBA 3M16A 2W61A 2X0HA 4GGHA 3H21A 1YPIA 2EQDA 5LSMA 1P0DA 4D6DA 2WMFA 3DOPA 3TFXA 1HGWA 3OQ8A 3BMVA 4JIEA 4TQTA 3WELA 1P48A 1RV8A 3DI1A 2ZX6A 3P80A 1V3KA 3T9PA 4E3VA 4AU0A 2GGGA 1TPVA 4QROA 5AYZA 4RNJA 2VURA 1WOBA 4KEVA 1EIXA 4AHOA 3O6AA 3PK7A 3LX9A 3QVQA 1OSEA 3VOIA 2PC8A 4YVPA 3UD6A 1PX3A 4HN8A 2QCHA 1PKMA 4LVAA 2XZ7A 5JBDA 2D3NA 5HPOA 1J6PA 4JIPA 4BI5A 4GQBA 3V0UA 3DGRA 3VGFA 5I2UA 4GO9A 2A3EA 2QVNA 4RNHA 1OC5A 1W3NA 3NGJA 3BCDA 1NY1A 2DIKA 3SCVA 1LL6A 3PZNA 4J5NA 4Y6GA 2J7DA 2CIPA 1BKSA 2ZYFA 4EAMA 3M6YA 3CHCA 3H2NA 3PWGA 4PH6A 4GKTA 4U5KA 3R1ZA 4TTUA 4GI6A 5FKYA 2A0NA 1WX0A 4OKDA 3NOEA 3VOFA 3LZ3A 4I7WA 3K1DA 2BDQA 1CGVA 1XRVA 3BQ5A 4LAOA 3VZYA 1ELSA 3W7HA 4DWDA 3W26A 1W56A 3CLWA 3LCFA 2C79A 2OCZA 1EX5A 2GQ9A 2Z28A 4OT7A 2SFPA 2OOGA 4F9JA 4KIEA 3RPMA 4N9BA 3NPUA 2EPKX 3IVSA 3GB6A 5HATA 2BHYA 1XYFA 4F0HA 4MPQA 2ALDA 4TU1A 4RNFA 1I1XA 5CH9A 5HUOA 3RK8A 5F4WA 2IUZA 2Q09A 3H4XA 3GO2A 3EGJA 1DE6A 8XIMA 2XH2A 1OFEA 2GGHA 4LGXA 4QP0A 2DP3A 2OG9A 3A4XA 3RMJA 4TR9A 5EMJA 3B0PA 3BGAA 4A3QA 4Z08A 2ON3A 3GX9A 4FZIA 3GIQA 4JTSA 4JYDA 2X05A 1OFQA 3W7PA 2Q02A 4IJCA 4R53A 1R3WA 3N15A 3AUOA 2PP1A 3W7MA 1KXTA 2XN2A 2B81A 3OVGA 1D7KA 3RM4A 4HCDA 1OX5A 3NQFA 5FJTA 1XC6A 3WK2A 3GW3A 2GLKA 1B54A 2GUUA 3TJLA 2X0YA 4D72A 2HBXA 5AYIA 3QLLA 1QCWA 4QIUA 3BLIA 2NQLA 2VOTA 4O4VA 3ZLGA 3SECA 4AYSA 2PB1A 2QPUA 2INEA 3NEHA 4A4AA 1KRMA 3O06A 2O55A 1RCXB 3VNZA 2AL2B 3URQA 5A95A 4R3UA 4U2YA 3V18A 3UT0A 1OCNA 2VCBA 3CQJA 3KUMA 3M07A 3E1F1 4JAWA 4XZIA 1TZ7A 4HA3A 1QR7A 3ALGA 3GAKA 1EFZA 3WNPA 3B9NA 4QFUA 2J62A 4PMUA 2XTKA 1GZJA 1TUFA 1NOUA 4M24A 4M7SA 1KA9F 1NFPA 4QGCA 3WUBA 3V75A 3WYZA 2QDDA 4DNMA 1OFPA 1PWLA 4S3FA 5M17A 1JPIA 1B3OA 2R82A 3L68A 2WM1A 2AL1A 1WB0A 3HPXA 1W1YA 1EUNA 3GZAA 2XZ9A 2J47A 4Z2HA 3VTRA 3GNNA 4M3PA 5A2AA 4IGNA 4CUCA 3SRFA 6TIMA 1J0IA 1AL7A 1KR0A 5CBBA 4E38A 2ZRXA 1MUCA 3SN0A 2W66A 3WJWA 2B31A 2XSBA 3NPVA 1UZDA 2IKGA 4L61A 2ZADA 2QKFA 2GQ8A 1E9YB 2XN1A 3ABZA 1F2JA 3M9YA 5KITA 3VX1A 3PY2A 3HMCA 2HK1A 1KB3A 1KWGA 4BF5A 4GY0A 4NXSA 4EWJA 4BHYA 2WAGA 2E0PA 4PMNA 3EX3A 3QY8A 4IMFA 3EZ4A 1ODUA 4WJ8A 1Q6DA 4WOZA 3C4UA 3OZMA 2BXZA 3AS3A 4JTRA 1XR2A 1IGWA 3B8UA 3VUPA 2XIBA 4FXRA 3JUGA 3C2RA 1YBQA 1IHIA 3CWNA 3T7VA 3AIEA 1CGWA 4JIIX 4S38A 1XLAA 1YNPA 3QR3A 1WXZA 3HURA 3CIVA 1W5NA 4UTHA 1H09A 4AEEA 4WRHA 3NVTA 5DCBA 4H41A 1SZNA 4WDXA 2DZBA 3WY1A 3M6DA 3FJ4A 4MZ8A 2C71A 4F8XA 3D47A 2YDAA 4TTGA 1XW8A 2IQ0A 1N8WA 2BNJA 5A6BD 3TW9A 3NQMA 4O0ZA 4EPEC 3F2DA 4P61A 1MRQA 2R1NA 4DUVA 1XDJA 5A8QA 1E9ZB 1K8CA 2YCIX 3VD4A 3H23A 1Z6KA 3GXPA 5HNNA 3NQCA 1V02A 2E4TA 1NP2A 1AQMA 2Y2WA 2X42A 3S5ZA 3W00A 1XUZA 2HQAA 2RJGA 4PCNA 3A13A 4XZNX 1M04A 2DIJA 3L9CA 2DPEA 2JKAA 2O56A 2X8RA 4EF9A 1JZ3A 3C8NA 2WMGA 3CAVA 1TJRA 4KWUA 1I4NA 4HNOA 3LPOA 2RDUA 1Q8AA 2HSAA 3L2MA 1H61A 3MV11 1GOWA 1B3ZA 5F2IA 4UFMA 5U7SA 3PZOA 3TTYA 3APTA 3BJSA 3DFPA 1TCDA 4ENLA 1REQB 3LTPA 3W85A 3UG8A 3UCQA 3W75A 1QPRA 1T8QA 3EWUA 4IQJA 2HVNA 2G4JA 3UR5A 3GTHA 4EF8A 4WF7A 4C6MA 5CQ1A 3UXAA 4X9YA 4PYSA 2W79A 2XDFA 3IJ8A 3CZGA 1OYCA 1E43A 3GC4A 1E1CA 5I77A 4XSMA 4UUIA 3WCZA 4M5PA 1TB3A 2VI0A 4EPDC 4C6DA 3USBA 3I7SA 4M7TA 1B31A 4S3BA 5DXYA 4WLCA 5A6JA 1IYXA 1PJ9A 3QY7A 3SADA 1BHGA 4MWAD 1QHOA 1C8VA 1S3HA 4MM1A 2E8ZA 5BXTA 4PODA 5CBJA 3QV9A 4WSKA 4OQVA 4DZIA 4YJ5A 4LF2A 3B04A 1XI3A 1JD9A 5C0QA 3POCA 3DENA 2W91A 3B9DA 3N25A 5HWMA 4QISA 4MMWA 4IF2A 4C6PA 5A8NA 2ZDSA 1LTDA 4H83A 1XSIA 1E4MM 4NNCA 1WKYA 5AHMA 3GNOA 4B5TA 4V15A 3FJLA 5HQMA 2QJHA 1DBTA 3MJMA 3WQGA 4H9UA 1AQFA 2VX4A 1P43A 3AIWA 3BLOA 1MDRA 1FWIC 3AIBA 3E38A 3MV01 1HJVA 3CV7A 4KGLA 4XTIA 1JF6A 3FVDA 3OJGA 2V68A 3KRBA 1E6XM 3FLUA 3W7NA 1IQ8A 1IIGA 2R6OA 1L8NA 1UG6A 3ABXA 3UPWA 4ZSUA 1XIHA 4PEEA 1TRIA 1XIGA 3MWCA 3L4ZA 2ADAA 2W92A 2VEFA 5H6HA 3WF1A 2IPGA 5GJPA 2R1LA 1XLJA 2ZZ1A 3ZJ6A 3ZT5A 3EKGA 5A2CA 1VP5A 2WCGA 4Y8FA 3PB0A 1AMKA 1O5KA 4JHZA 3N2MA 3U48A 3EDEA 4AD3A 4O14A 1IR2A 5MHBA 1TJ0A 2FKPA 3KWXA 4FNTA 2WPBA 1GZGA 4W7UA 4N02A 2FZNA 1VEMA 1NVMA 1LT8A 3K8KA 1QU4A 5KZMA 3B05A 1RBAA 3C5QA 4KWVA 4NZ5A 1H1YA 4I7VA 2E1DA 1A5KC 5CAHA 5CPOA 1B30A 1W6TA 2HV5A 4HHLA 3QR1A 4ATDA 3KTXA 3NDYA 1ADOA 1OFBA 1Y7VA 1XG4A 3SJNA 2PTWA 2BMBA 4O50A 4MB1A 1PDYA 4DJDC 3UJSA 2P3ZA 4GYPC 3BTNA 2ACRA 3NEVA 3O15A 4KW2A 2RUSA 5G4EA 1TWIA 4YVVA 3SCPA 2CHRA 2WSYA 2DZXA 1GGOA 2CZ5A 3FVMA 1RK6A 3MANA 1NQKA 3SQSA 5BZAA 3PSVA 3VOJA 1UASA 2J75A 5HJLA 1WO2A 3GWQA 1A5LC 3PZGA 4J4KA 4S3DA 2GZXA 1BTMA 1S5TA 3GVRA 4IH3A 3GM8A 1XQKA 4C6KA 1X6LA 1Q4NX 1YXYA 2VELA 1Z32X 2VNCA 2QPSA 4J3WA 3GBEA 2QIWA 4O19A 4HPHA 1AJ2A 2B0MA 3VVGA 3TTSA 4GA8A 5ABHA 2DJXA 3SCWA 4FIQA 2YXGA 1W3JA 1OF6A 2Z27A 1B1YA 2GQ3A 2Z6JA 3FHQA 2QAPA 1K8XA 1TFVA 4QAWA 3B0VC 3F4WA 3WJZA 3OG2A 2PTZA 1CGYA 4AIOA 4LTSA 1TELA 4DZHA 2V5LA 3ID7A 2QYGA 4ZE4A 1LM1A 1XLIA 5AECA 1OBAA 2NV1A 3PAJA 4IIFA 4GI9A 3SUSA 3LB0A 1R85A 2FDSA 3GXIA 2NUYA 2OXNA 2J66A 1NWTA 1YBQB 4NZFA 2J77A 3TIMA 1K70A 1SMDA 4PRTA 1GOKA 2XIQA 3UY8A 1D7FA 3UPBA 4WKAA 1OX4B 3NDZA 3B8IA 9XIAA 3UF9A 1QHZA 2YXOA 4XAPA 2POZA 4RPPA 3GIPA 5H8UA 4RDWA 1UB3A 2XISA 4G6CA 2H8XA 4IMAA 4MB3A 4C5ZA 2WWDA 3TQ0A 1UQYA 3FCPA 5GNZA 4I9JA 1F4HA 4OVXA 5DT7A 1V77A 3OW1A 3PPFA 1E4NA 1UUOA 4NILA 4IQDA 3ZLFA 4LAUA 4G1KA 2OFJA 1EJ7L 4XIAA 4D6IA 3WEOA 3FYYA 1VFUA 2DZPA 4YIWA 1E51A 3ECQA 3A4JA 2VZOA 5XIMA 3UWEA 2VGGA 4IG2A 2HROA 2ZZ7A 1OC7A 3GVQA 3CASA 1TV5A 1GQNA 1WDSA 4B3ZA 4MAVA 1W9UA 4EXQA 3VKDA 1QASA 2DT2A 1QTWA 2CHNA 3HV9A 5FL0A 1FCVA 1YNYA 3KS6A 1QWGA 2PCEA 4GO8A 1WQ5A 1W1ZA 4RE0A 1PHQA 1J0HA 1NARA 5MF5A 3KRSA 2YDRA 4CVWA 2OEJA 1MW3A 5CJNA 1Y5WA 4HA0A 4R85A 3WUFA 3P8JA 3RU6A 1V3MA 3PUOA 4LCSA 4QDWA 4QX4A 1A4MA 3IJDA 3KCOA 3KOFA 3LMZA 2VRKA 5EBAA 4E8DA 4PGLA 3QHNA 4XD4A 2OPJA 2OLAA 1XRSA 2PA6A 3LGDA 3AIVA 4I8DA 3BV4A 3TXZA 1HW6A 3TYAA 2P0IA 1IGSA 4QDMA 3T81A 2VC9A 3NSNA 1PV8A 3LCIA 1XYCA 4M1BA 1H7OA 2IQDA 3SJ3A 3EWXA 1H63A 1TZZA 1SR9A 2OWWA 1CDGA 3EX6A 4O1CA 1XCWA 3T55A 3UYCA 3W7OA 1M7JA 1QW8A 2QR6A 3BLDA 3HIJA 2YCLA 3IPWA 3NTYA 5FF3A 3W28A 4PTWA 2CHOA 4OBTA 3BCFA 2FQIA 6TAAA 4U10A 4BQ4A 1JZ8A 2XH7A 3CHEA 2UV8G 1EC9A 1E6NA 3TA9A 4LW7A 4UFLA 4Y9PA 5TIMA 3L4UA 3OZPA 4LSBA 3RM8A 4CQBA 4AVNA 3HA1A 3W72A 4D71A 3RYSA 5DX7A 2VXNA 2Z4GA 1CBGA 3VUSA 5CZJA 2LLEA 1M7PA 2Y61A 2YBVA 4M6QA 3FNDA 1X38A 1DIEA 4P2VA 1CI1A 3ZXWA 3P84A 3BARA 2OYMA 3TTQA 2QCLA 3R89A 3DDMA 3VNKA 1P7TA 1LROA 4XSLA 1MUWA 3EOUA 3IGXA 1FHVA 1NU5A 3HTWA 1A5BA 4GD0A 2YYTA 1R7AA 3MSRA 3S9IA 1DQWA 1OCJA 1UCWA 1W1VA 3MU7A 2C13A 1E40A 3ITVA 1L6GA 2D2HA 3BOLA 3UNTA 1J4EA 1OF8A 1Q2RA 4QTGA 4ZMGA 2CWXA 1GYMA 4FF5A 3ARZA 3RRAA 1BPLB 1KFKA 1V4YA 5M5DA 4H6RA 1SFSA 4V28A 1NWRA 3WBAA 5FIPA 3VDGA 3G0UA 4A21A 4UNLA 4WHBA 1D3GA 4YTUA 2WK2A 3SGZA 4NY2A 1QBAA 1SJAA 2DT0A 1WXJA 3TKFA 3BGGA 3GQYA 3C2EA 4OUEA 4QNWA 2QVHA 2Q3OA 5LA0A 3RCNA 5G2HA 2R1KA 3ZVIA 5DEZA 2ATMA 3F4DA 5DANA 5D4YA 3NA8A 3E5PA 3H54A 2A7PA 1XM3A 1H49A 4NAEA 3I4KA 4B90A 2RDTA 1A4LA 2NX9A 4WJEA 4IGMA 4Z1BA 3DZ1A 3F4NA 1TRDA 5LIUX 1YTEA 2MANA 4J3UA 5D02A 1GQLA 4US5D 4ZFCA 3UXLA 1TMLA 1UA3A 3GG7A 3SCSA 3WJYA 3E5BA 1A0DA 3C0SA 3DAQA 1AH4A 4RZ4A 5HDRA 3FX4A 4N7QA 5LIXX 4EOUA 3A3HA 4ZBCA 1Q65A 1PHWA 3M44A 3AYTA 5AHEA 4E0CA 1ODZA 1EOKA 2PPGA 3UWVA 2OQHA 3K4DA 3I7QA 4AC1X 4Y2WA 2X40A 3CT2A 1K1DA 4GHRA 1CGXA 3OOQA 4WGXA 4NYYA 1JCMP 3HMJG 5T26A 1XISA 4TOQA 2GYIA 1ISWA 5FF0A 3GLCA 1UW9A 4DF2A 3FA5A 4O10A 4QLLA 4LCQA 2DW7A 4Q7BA 1YTKA 1UR8A 1P0EA 1HVXA 4GI8A 3NDOA 4REQA 3LBOA 1JNEA 4MFEA 2CLKA 1T8XA 3F5KA 4LB4A 1HGYA 1WDPA 3MCOA 4I5RA 3CJPA 4GBDA 4ALDA 4S3AA 3AMLA 1JZ6A 4GZJA 3H70A 1OIFA 1XBZA 4LEFA 3UG4A 4JQ2A 1CECA 3C0JA 1XH0A 3C52A 2EEXA 4R9XA 5C9ZA 3R4IA 3SIZA