3NGPA

High resolution structure of alpha-spectrin sh3 domain mutant with a redesigned core
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPRELTVKKGDILTLLNSTNKDWWKIEVNGRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of an alpha-spectrin SH3-domain mutant with a redesigned hydrophobic core.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ngpA00
3JV3A 2H8HA 2K3BA 4AG1C 5IXFA 4D8DA 3IQLA 2DA9A 1SPKA 3EHQA 2K2MA 3UA7A 1HSQA 2J7IA 2K6DA 4DEXA 3I5SA 1K76A 2GBQA 2BZYA 2KXCA 1W6XA 2E5KA 1T0JA 2DRMA 2F2XA 4RTYA 2HDAA 1M27C 2JXBA 1UTIA 1TG0A 2CSQA 2QDLA 1N5ZA 2O9VA 1K0XA 4JJDA 2ED0A 1K0SA 2C0IA 5L23A 2JMCA 1WA7A 1HD3A 1QCFA 2V1QA 2LJ0A 1BB9A 1GBQA 3UA6A 3QWYA 2KR3A 2AKLA 2KRMA 2RQRA 1GFDA 1H3HA 2AZSA 2O2OA 2FO0A 1AWXA 4HVVA 2DL8A 2LMJA 1G2BA 1X27A 1UHCA 2ESWA 2FEIA 2EPDA 3VS6A 4JZ3A 2BTTA 2DILA 5GJVB 2SRCA 2FPFA 5FW9A 2EYWA 2FPEA 1QKWA 1B07A 4RUGA 3ULRB 4JPBW 1E7OA 3TVTA 1EFNA 2EGEA 2EBPA 3M0RA 1X43A 1GRIA 2A28A 1MV3A 3VS2A 1SRLA 2O31A 1X6BA 1FYNA 2V1RA 1WYXA 2LQWA 1NEGA 2AKKA 2L3QA 3U23A 4CC3A 1UDLA 3QWXX 2O9SA 1PWTA 2EKHA 1WI7A 3SHWA 2CT3A 1SEMA 1X2QA 4OMPA 2KT8A 1YWOA 4D8KA 2K7AA 2YUQA 4OMNA 1M3AA 4J9GA 4CC7A 3KFVA 2LX7A 1PRLC 3PE0A 1M3BA 1M3CA 2CSIA 1I0CA 3LH5A 4JJBA 2KYBA 2J05A 3PVLA 4ESRA 1W1FA 1J3TA 2ROTA 1T3SA 1YN8A 1JXOA 2KRSA 1YNZA 2J06A 4F16A 2JS2A 1WIEA 4J9DA 1MV0B 2DBKA 1UUEA 2XMFA 2F2VA 1JO8A 1UHFA 2JTEA 1ZBJA 2DMOA 5FWBA 2HSPA 1OEBA 1G83A 2EQIA 2PZ1A 1JQQA 4Z8AA 2L3SA 1YCSB 2DRKA 4AFSC 3VS3A 2YUPA 5I22A 2DLPA 2J6OA 1M8MA 4HVWA 1NEBA 1OV3A 1X69A 2C0TA 1GBRA 2RF0A 1ABOA 2ABLA 2DBMA 2B86A 2HBWA 1WDXA 1A0NB 1ZUUA 2K79A 2CDTA 2GGRA 3I35A 1ZX6A 3SEMA 1E6GA 1UGVA 2DF6A 1K9AA 2VVKA 2RPNA 3UF4A 2HEQA 2CH4A 3PVQA 4QT7A 1H92A 1UG1A 1XOVA 2DJQA 1UE9A 1AWOA 4J9HA 2ED1A 1QLYA 2YUNA 1NLPC 2EVRA 2KNBB 1UFFA 1AEYA 4J9FA 1PKSA 3A98A 4GBQA 1HJDA 1RLPC 1WXTA 2NUZA 3REAB 2A08A 1UECA 2RQTA 2ENMA 2LJ3A 1PHTA 3REBB 2D0NA 4IIMA 1VA7A 4M4ZA 2F2WA 2IIMA 3H0HA 2YDLA 1KJWA 1Z9ZA 2KBTA 1AWWA 2DYBA 3I5RA 4WCIA 4OMQA 1PNJA 2VKNA 3VS7A 2KEAA 2DM1A 2CUDA 2MCNA 1CKAA 2OJ2A 1KIKA 2HCKA 2JM9A 2YSQA 4EIKA 1Y57A 1CSKA 4AFUC 2MOXA 1MUZA 2PNIA 4OMLA 1H8KA 1S1NA 4HXJA 2SEMA 3EG1A 1VYVA 1ZSGA 2RQVA 1U06A 2L0AA 1WFWA 4R0KA 5EC7A 2RMOA 1GCQC 2FG0A 1YWPA 4RTTA 4Z88A 2W0ZA 3NGPA 1KFZA 2BZ8A 1TUDA 2FPDA 2KROA 4J9EA 1BK2A 1Y0MA 1OPKA 4FSSA 4LNPA 1LCKA 2RQWA 1ZLMA 2JS0A 2J6KA 3M0TA 2LNHB 2KT1A 2CH4W 1JEGA 3VRZA 1JU5C 3EGUA 2D8JA 1AOJA 2JW4A 3O5ZA 5HCKA 2RN8A 2JM8A 4K11A 1I07A 3TSWA 1VYUA 1BU1A 4JZ4A 2GQIA 2DX1A 1JXMA 4DEYA 3H41A 2DE0X 2W10A 5IHKA 1I1JA 4IIOA 2JMAA 2EYXA 4AFQC 1T0HA 2CREA 2C0OA 1VYTA 2CUBA 2A37A 1RI9A 2A36A 1AD5A 5IHIA 1RUWA 4ORZA 2BZXA 3NPFA 1X2KA 2GTJA 2RNAA 1X6GA 1PRMC 1M30A 3VS1A 4CC4B 2EYZA 4RTXA 2DNUA 4F17A 2GTOA 2I0NA 1E6HA 2VWFA 4RTWA 1SHGA 1GL5A 3EG3A 3NHNA 1NM7A 2M0YA 3M0PA 3VS5A 2AZVA 1KSWA 1K4US 1U3OA 2LCSA 3EHRA 3R6NA 1Z9QA 4X1VA 2L2PA 3M0SA 1QWEA 2O88A 1NYFA 2LP5A 2ROLA 4GLMA 1WXUA 5IXBA 1SHFA 2JT4A 3M0UA 1ZUYA 1AWJA 4AFZC 2X3WD 3C0CA 1OOTA 4LE9A 2EYYA 2K9GA 3VS0A 2YT6A 2LJ1A 4CC2A 3RNJA 1W70A 3UATA 1NLOC 4HVUA 1AVZC 2MIOA 1GCPA 2KGTA 4RTUA 3GBQA 5GJWB 3VRYA 2NWMA 1QKXA 4OMMA 4OMOA 1FMKA 3THKA 2OAWA 2AK5A 3ZL7C 1IO6A 2ECZA 1AZGB 1U5SA 1WXBA 2PTKA 1RLQC 4RTVA 3I9QA 4ZNXA 5ECAA 1BBZA 2FRWA 2P4RA 2EGCA 3RBBB 1TUCA 1T3LA 3H0FA 3EG0A 4KRTA 2DVJA 4LN2A 2LQNA 2X3XD 2DL4A 3H0IA 4J9BA 1CKBA 1PKTA 1SSHA 2KRNA 5FWCA 2KE9A 1ARKA 2DL3A 4E6RA 1K1ZA 2EGAA 2G6FX 1UJ0A 1AZEA 3EG2A 3FJ5A 3M0QA 1OPLA 2D8HA 4F14A 3VS4A 1ZUKA 2RQUA 1B3QA 5IHNA 2KXDA 1GCQA 2M51A 1NG2A 2OI3A 3TSZA 2FRYA 1ABQA 3CQTA 4JJCA 5I11A 2D1XA 4Z89A 1UJYA 1NYGA 2CT4A 2LZ6B 1WX6A 4LUDA 2YUOA 1SRMA 4HCKA 1WLPB 1V1CA 4LUEA 2J6FA 2GNCA 5IH2A 2DL5A 4AG2C 4RTZA 2DL7A 1QWFA 4J9CA 2EW3A 4A63B 4J9IA 3NMZC 4Y92A 1YP5A 2L3PA 2KYMA 1GFCA
chains in the Genus database with same CATH superfamily
2K3BA 1SPKA 3PTAA 1VQNQ 3UA7A 3CCET 2K6DA 3M4YA 3FC3A 1K76A 3BY7A 4M77C 1KD1R 3JCMc 1W6XA 5HK0A 1QVPA 5KYUA 1T0JA 4M75G 1M27C 2K3XA 4EMKC 3JCMW 2JXBA 1TG0A 3CC2A 5IT9E 2JVVA 2ED0A 4IUUA 1WA7A 3A5ZB 1QCFA 3QYGB 5GMKj 4BB7A 3RMQA 2R57A 2LJ0A 2QA4Q 3M55A 1BB9A 2KR3A 2KRMA 1GFDA 3M57A 2COZA 4HVVA 2QASA 3HPWA 4DBQA 3L2UA 1YJ9T 4FYVB 4DOWA 4JZ3A 2DILA 1JJ2P 2FPFA 5FW9A 3G71A 3CXCP 3SDZA 3G71T 1FMVA 4XU3A 1VQ7Q 3TVTA 4XTZA 1M4ZA 1D0YA 2P0KA 4C0ZA 3M0RA 2A28A 1W2BA 1BIBA 1SRLA 2Y4YA 1VQLT 3M54A 2LQWA 1NEGA 3P8DA 4XTUA 3QWXX 2CZ1B 4M75C 2O9SA 4MMLA 1WI7A 2JNGA 2QYZA 4OMPA 1X2QA 5AT1B 3V8KA 3D7SB 4E7ZA 3CBMA 3RKXA 4L59A 3MO8A 2E6NA 2K5FA 1YI2T 3JCMg 1I0CA 2KYBA 4ESRA 1W1FA 4DOVA 3OYIA 2QEXT 1YNZA 2J06A 3QDRB 3CCMT 1I5OB 1WIEA 2DBKA 3L1AA 1R77A 2L89A 1JO8A 2JTEA 2M16A 2DMOA 2H3EB 2MF2A 2QK0A 4F7UF 2HSPA 1BI1A 1OEBA 1G83A 2RH2A 3VYGA 3GOXA 1KC8R 1VQ7A 3PNWC 4PJOB 2L3SA 2DRKA 4AFSC 2DTHA 2QEXA 2HQHA 5CVIA 2QTXA 4HVWA 5FU6C 1GBRA 1K8AC 5KYWB 1ABOA 1QP3A 2B86A 1YIJT 4ZGJB 2HBWA 5CIUA 2DPPB 2GCXA 1D0ZA 3M53A 1E6GA 1VQ4A 1WPYA 2VVKA 1S72Q 1TU0B 2L8DA 1UG1A 1XOVA 5GAMe 2DJQA 3PIOA 4FYWB 1IXDA 2QQBA 4DA4A 1NJIU 1D09B 4L6V5 2ED1A 2KMTA 2ZPIB 1NLPC 5CK9A 2RJEA 3M56A 4OB1B 5CQYA 2NUZA 5CAIA 4C92D 3REBB 1LNXA 1WHJA 2KDSA 4YTLA 1AWWA 2DFUA 4JRKA 4WCIA 4OMQA 4II1A 2VKNA 3VS7A 2KEAA 4JRPA 4ZTJA 2NUTB 1LJOA 1KQ1A 3JCMJ 2X4WA 4BI3A 2HCKA 5LL6S 1KK7A 1CSKA 2KK4A 4MDWA 2BKDN 3C4SA 5LJ5f 4OMLA 1H8KA 3TREA 4OF1A 1VQ5Q 3EG1A 4ZGDB 3CMEQ 3CCRA 5D6YA 2RQVA 4OB3B 4EDUA 3CPWP 5EC7A 1OU9A 1Y07A 2RMOA 4RTTA 2W0ZA 2BZ8A 2MMPA 4NL3A 4M78F 3VYHB 3EGDB 3SWNB 2FPDA 4J9EA 3JCMd 3JB9F 3OB9A 1ZA1B 1OPKA 1LOJA 2R5MA 1Q7YU 2C06A 1VQ5A 3VRZA 2OTLQ 3EGUA 1PD0A 3O5ZA 2LDMA 2RN8A 3JCMX 4OMFB 4K11A 2OX7A 3FIFA 1BKBA 1VYUA 1VQLQ 2M1HA 4A4EA 3GPLA 2HAXA 2KSSA 1XQHA 5IHKA 4JRQA 4RG2A 1G3SA 3L42A 1XNIA 3JCMV 2RI3A 2DD4A 4QVZA 4LD9K 3UT1A 3NPFA 1MMNA 3FRNA 4BE1A 2GTJA 2VASA 2FYKA 1NJIR 1X6GA 1PRMC 3ME9A 3JCMe 1RABB 1IREB 3SFMA 4F17A 2GTOA 2I0NA 3AT1B 4O5VA 4XK8E 2VWFA 1IRXA 5LJ3g 4Y91A 1ZHIA 2F69A 2O01E 1PSEA 2PVGB 3NHNA 4LXCA 1YHQQ 3MEAA 2XIDA 1K8AR 2RJDA 2RI2A 1SG5A 3M0PA 4Y28E 2YXYA 4M7DC 2AZVA 1WJQA 4X1VA 4QVDA 1VQLA 2L2PA 3CCVA 2RK2A 4C5IA 5LJ5g 3KUFA 5IXBA 2JT4A 3CCQA 4EMGA 1ZUYA 1WJSA 1VUBA 3CD6Q 2E3HA 3J7AF 1O75A 4R55A 3OYFA 2EQJA 1HYOA 3L2VA 4E7LA 3VS0A 1X75C 4X34A 2NYSA 4XU0A 2WSEE 1W70A 5GAOp 3WVEB 2LVMA 3DB4A 4J7IA 1AVZC 1MMAA 1VQPA 2DTIA 2MIOA 2KGTA 3VRYA 4M7AC 1FMKA 4A54A 3J80E 5GANf 1YIJQ 2AK5A 3ZL7C 1IO6A 4M7DA 1IGUA 3BE3A 3I55A 3EFRA 3JB9H 4RTVA 4DBFA 2EQUA 1BBZA 1T3LA 4KRTA 3EG0A 4F7UE 1KQSA 3H8ZA 2V26A 3G4SA 5GANd 2LQNA 5CR2A 2DL4A 1CKBA 1PKTA 5FWCA 2KE9A 4IUPA 1K1ZA 2EAYA 1FMWA 4JDSA 1G3WA 3PMTA 3MJXA 2NUTA 2OTJQ 4QW2A 1PSFA 3MCAB 3M0QA 4ZN1A 3E19A 4PJLA 3QBYA 1M5Q1 1ZUKA 2KXDA 1KHCA 5GAN3 3LWHA 2YLBA 5LJ5e 2M51A 1V29B 1ABQA 4PFOA 4VUBA 5I11A 2D1XA 2HQEA 1UJYA 4XU1A 2LZ6B 2YUOA 2V8KA 1WLPB 5GMKe 1V1CA 3X26B 2J6FA 2GNCA 2CP2A 5CCAA 3VV0A 2QQSA 4C0DC 3HSBA 1D3BB 2F1LA 4EPCA 4RTZA 5GAOr 2DL7A 5GANe 2EW3A 4A63B 4C92F 2VGNA 3V7RA 1YJWT 3CCEA 3QZ9B 4ELYC 2WSCE 1HSQA 4L5GA 3I56A 4KGVB 3UPUA 5GANj 1I5LA 1I81A 2VC8A 3V7CA 4XTVA 1VQNA 2K5LA 5D6XA 3LWIA 2DRMA 2JTMA 4FW2A 2A3LA 2HDAA 1M1KC 1UTIA 2D6FA 2LT1A 3SWNC 2QDLA 3CMAQ 3CXCA 2E70A 4JJDA 2DAQA 5L23A 1S72A 4KUIA 3AHUA 1UGRB 1D0XA 1NPRA 3UA6A 3RR6A 2ZPFB 2RQRA 5A0GA 4XAXB 5KYXB 2DL8A 2LMJA 1G3TA 1KQSS 1G2BA 4M7DE 2ESWA 2FEIA 4XTYA 4PFPA 3RUXA 3RESA 4FSXA 5C0MA 1QKWA 2DXTA 4RUGA 4JPBW 3JCMh 1E7OA 4FW1A 3M9QA 1Q86R 2EBPA 2L3RA 4E7HA 1TXQA 1GRIA 3VS2A 2O31A 2OTJA 2BUDA 2IPOB 1WYXA 2OTJT 4C92E 4OVAA 1Y96A 4CC3A 3CCRQ 5AYFA 2HMAA 2PVDB 3OS1A 1N8RC 4P5NA 4XTWA 2HQXA 4C8QE 2MK5A 3GLXA 3SHWA 5CKDA 1VQ4T 2XDBA 1KD1U 2KT8A 3ZEHA 1YWOA 4D8KA 1WHGA 2M9UA 2K7AA 3H9NA 2XKOC 4J9GA 3I55Q 1TH7A 1BI0A 2IVWA 3H6ZA 1M1GA 3LH5A 4JJBA 3E9GA 4GY5A 1WHLA 3ASKA 1T3SA 4QQGA 3HRUA 1WGSA 1RI0A 3HRTA 4J9DA 1MV0B 2X4XA 2F2VA 2DYIA 5J26A 4E7IA 2PZ1A 4Z8AA 2QI2A 5I22A 7AT1B 2J6OA 4R56A 3A1PA 3EGXB 1VQPT 1X69A 2XD0A 2CGHA 1EZZB 3L2WA 3GNGA 3OYCA 2ABLA 4MDXA 3EG9A 2GF7A 3OMGA 5LJ3j 3QJYA 1A0NB 2CDTA 4M75A 3BFMA 4C5GA 2DXCA 3SEMA 4M75E 2JZ2A 2Z0WA 4M7DD 5FU7C 1PCXA 3UF4A 4FYYB 2CS7A 2KVQG 1K9MC 3S3MA 4J9HA 5HKCA 2RJCA 3SWNA 5KYWA 3QJ6A 1UFFA 1VQ9Q 5GAN2 4J9FA 1RLPC 2JUFA 1WXTA 5GAN7 2RQTA 1M9SA 2LJ3A 3QHSA 2M0OA 1Q82R 2DK3A 2F2WA 3GF5A 3F70A 3H0HA 5LJ5d 1FXXA 1KJWA 1N9SA 1Z9ZA 2KQWA 3OBYA 1VQOQ 4M78A 1PNJA 2DM1A 3LX7A 2ZPGB 3VU3C 1KIKA 4J8OA 4M77F 4EIKA 1YJ9A 1KC8C 2VGMA 4HT9A 1UGPB 4OP0A 1RAFB 3OYNA 4HXJA 3OYJA 4M7DB 1VQ8A 5KH6A 2HBPA 1KQSP 3PIPA 2E6ZA 4M77A 4PNOA 1WFWA 4R0KA 1LVKA 2X4YA 2FG0A 3EAEA 2RHIA 3CPFA 2V8IA 3NGPA 2JJ9A 2ZCFB 1QP2A 4ELZC 3VUZA 3I56T 1TUDA 2K2VA 3T9NA 3E9FA 3MEUA 3UDCA 1NPPA 3G1JA 5KYXA 4RMOA 1KQ2A 3M5AA 4XQ3A 1LCKA 1BCOA 1TSFA 5IAYA 2J6KA 3M0TA 3G71Q 2KT1A 1MNDA 1RL2A 2D8JA 5FLXE 2P84A 3G4SQ 2QA4T 1I07A 1JXMA 4C92C 4DEYA 3H41A 2W10A 4C0DB 4IIOA 4AFQC 2DZCA 2AHJB 3MEVA 2JTFA 2QAZA 2CUBA 2A37A 2DVEA 2E12A 4RCCA 1OULA 4M7AA 1RUWA 3G7ZA 2BZXA 5GAOq 1Q81U 4LDXA 1QCOA 2CP5A 3X28B 4E2FB 2RNAA 2XICA 4BY6C 1KG1A 1G8XA 1QVFP 3QSUA 3VS1A 3QXEB 2E4HA 4RTXA 1WJRA 2DNUA 3OSSC 3OW2P 2XDPA 3EG9B 1E6HA 4RTWA 2YHTA 4KBMB 4BE2A 2ZPEB 1SHGA 1GL5A 2DIGA 3OW2A 3CPWA 3ZFJA 2ZGWA 1KSWA 2B8AA 1U3OA 2RB6A 1C0MA 3C95A 1WQWA 3RKYA 1WZOA 3CCVQ 1YI2Q 2ROLA 3JSCA 4A4GA 5GAOm 3LGLA 1D3BA 3CBOA 3C0CA 5DLQE 1AHJB 5HY6A 2ZPHB 1OOTA 5FRMA 2EYYA 3FJPA 2GFUA 3RNJA 4M75B 1QW1A 1OX9A 4M75F 1PD1A 2LQKA 5KCOA 2DEUA 4HVUA 2BIVA 1M90U 1QQJA 1AT1B 4HA8A 1VQMA 2EQMA 1GCPA 2QGFB 3GBQA 5GJWB 1JRIA 1VQ8Q 1YJWA 2HSEB 3DB3A 2NWMA 1QKXA 4OMMA 5GAMf 3HKSA 2ECZA 1AZGB 1U5SA 2QTVA 1YITQ 3OYKA 3OYEA 1RLQC 1YJ9Q 2PUOB 3I9QA 4J83A 4ZNXA 5GAN5 1SF9A 2P4RA 2EJFA 2CZ6B 2L5QA 3H0FA 3X24B 1XTDA 4X9CA 1PC0A 3G4ST 1JB0E 4PK4A 5GAMd 2EKOA 1N8RU 1OI1A 1BIAA 3CC2T 1ARKA 4DBHA 1VIFA 5GANh 5FU6B 2GFAA 4IUVA 1UJ0A 5GAN4 1AZEA 3EG2A 1H3ZA 5D6WA 2RHUA 1WHKA 4HCZA 4J6XA 4FT2A 3CC4Q 2HNIA 3E1SA 3A8OB 4PJOC 1N9RA 3CCSQ 2DTOA 3M59A 3C12A 2PU9B 5LJ3f 1NG2A 2OI3A 3CXCS 2FRYA 4Z89A 4KH0B 1I8FA 4LUDA 4DQ2A 3G6EA 3G6EQ 4HCKA 3CCLA 1D1BA 1OX8A 5IH2A 1K73U 2OAUA 2K4YA 5HK3A 4KUDK 4J9CA 1Y71A 2DD5A 3QZ5B 4J9IA 4IUTA 3NMZC 1VQ8T 3JB9I 1UB4A 1M1KU 5KE2A 1GFCA 3JV3A 2H8HA 4M7AE 4V2SA 4D8DA 1YBYA 3EHQA 4PLLA 2F5KA 2M02A 2J7IA 3META 4IKFA 3I5SA 2GBQA 1QMCA 4OGEA 2KXCA 2E5KA 4E47A 4IUQA 3S3NA 1ZSZA 2F2XA 4RTYA 4M7DG 2K3YA 1M90C 2RD1A 2CSQA 1N5ZA 2O9VA 1K0XA 1YJNQ 4N4IA 1K0SA 2OTLT 2JMCA 3MEWA 1S72T 4FL6A 1GBQA 3QWYA 1YCYA 1GXIE 4M78E 1H3HA 2RHZA 3A8HB 1I4K1 3RDVA 1AWXA 2OTLA 4QKUA 3OS0A 1Q86C 2EPDA 5KYNA 2BTTA 4BY6B 2VUBA 2SRCA 2EYWA 3CCSA 3OYMA 1N6AA 4C8QA 1K73C 3JCMP 4CRIA 1EFNA 2EGEA 3EGXA 1MV3A 4M7AG 4M77B 2E10A 1IB8A 3QO3A 2QQ9A 3OYYA 1FYNA 3OYGA 1EX4A 3WVDB 1WHMA 2L3QA 2EJ9A 1UDLA 3OW2S 2D9TA 4O6JA 4LDUA 5GAOn 2BE9B 3JCMQ 1Q86U 3GNFB 3V7SA 3GP8A 2QQAA 2X9HA 2CT3A 4IURA 4BD3A 1TOVA 3HL8A 1DJ7B 3CCMA 3L2ZA 4CC7A 3CCJT 3PT9A 2GQVA 3HHTB 2ZZDA 3PE0A 5FRNA 1M3BA 2HKQB 2CSIA 1VIEA 4LD6A 3PVLA 3RIRA 5GAMj 1J3TA 2ROTA 2JS2A 4HCCA 1UUEA 2XMFA 1N27A 3VJPA 3QDFA 5FWBA 2P0QA 2EQIA 1JQQA 4FCYA 3VS3A 1SSFA 1BYMA 1NEBA 2QDYB 2C0TA 1ZQ1A 3OYLA 6AT1B 1G5VA 2Y90A 1K9MU 2DBMA 1Y7XA 2VXEA 5C6SA 3CD6T 1WDXA 1ZUUA 2K79A 2YWWA 3I35A 1ZX6A 1UGVA 2YLCA 2HEQA 3PVQA 2EWNA 1RACB 1RAIB 1H92A 2DEQA 1UE9A 1AWOA 2MAMA 1QLYA 2YUNA 4M7AB 4EMKA 4M75D 1PKSA 3A98A 4HT8A 1ZSZC 3NFCA 2DERA 2A08A 2G3RA 4PJOE 2EQKA 4A4KA 2XHCA 4M4ZA 2IIMA 3CCEQ 2XG8D 2LNVA 1MMDA 3FEOA 4PFZA 2DYBA 3I5RA 3QUIA 4QQDA 1Q82U 4KT0E 2RJFA 1C6VX 3TQ7P 2CUDA 1TS9A 2MCNA 1CKAA 2JM9A 3A8LB 1Y57A 2R5AA 4AFUC 2MOXA 3JB9D 3RMSA 1KD1C 1S1NA 2SEMA 4M78D 1ZSGA 2DETA 1VQPQ 1YJWQ 2ATCB 1YHQT 1RADB 3ZBDA 3OY9A 1YWPA 1JJ2S 4Z88A 9ATCB 5I2SA 3MKDA 3CCUQ 3OS2A 1KFZA 1IGQA 2XK0A 2KROA 1UEBA 1OZ3A 1BK2A 1Y0MA 1M2OA 2HZYA 2HD0A 2CZ0B 4C8QG 4J7FA 1ZLMA 2LNHB 3NTHA 1JEGA 1YJNT 5KE3A 4FU6A 1M2VB 4DBRA 3CPWS 1EIFA 2JW4A 1ZSZB 4KGZB 4B6MA 3R6OA 2RHXA 2JM8A 1YI2A 4JZ4A 4NOYA 1U1TA 3QG1A 1V76A 2DE0X 4ATOA 2K5IA 4QVCA 1QCNA 4BDZA 3P8BB 4HCBA 2JMAA 8AT1B 5GMKh 3X25B 3CMAA 4JS4A 1Y96B 2C0OA 1AD5A 2IG0A 5IHIA 3CC4T 1X2KA 4C8QF 2HL5C 1R0CB 2MWOA 4MZTA 4BI8B 5GMKm 2LCLA 3S3OA 3S6WA 3V8LA 3CMAT 2CKKA 2EYZA 2LTOA 1B7TA 4ZN3A 1NJIC 3MHXA 3EG3A 3CD6A 1NM7A 1D1AA 3CCQT 1K9MR 4ZGEB 3MP1A 4WF2A 1SKUB 3PGGA 3EHRA 3R6NA 2DXUA 3M0SA 2MYSA 5DLOA 1QWEA 1RAEB 2O88A 1NYFA 1R0BG 1MHNA 2LP5A 5GAMh 4GLMA 1WXUA 1VQNT 1SHFA 3M0UA 1AWJA 4AFZC 2I2LA 4PJNA 3RERA 4FT4A 2QEXQ 4PJOG 3TEEA 1KHIA 3HRSA 3OMCA 4B9WA 3INZA 2PUKB 2FZKB 2JOYA 4EMKB 2LJ1A 3HFNA 5I2MA 4CC2A 1OQKA 2P0PA 2FB7A 1ACMB 5DM7R 4KULA 1UGSB 2E64A 3LGFA 3OYBA 1X6OA 1VQ6T 2VB6A 4RTUA 1HXDA 4OMOA 1NZ9A 3THKA 2OAWA 2A7YA 3MPUB 1M8VA 4OB2B 1OU8A 1WXBA 1YITA 3QYHB 5ECAA 4RKUE 4M78G 1B34B 4X9DA 2DVJA 2COYA 4RG8A 2RA2A 4LN2A 4PL6A 2X3XD 3H0IA 4J9BA 3URGA 3HP9A 1SSHA 2KRNA 2DL3A 2X35A 2K57A 4E6RA 1VQMQ 2RM4A 3KXTA 2HL3A 4C8QD 4J6YA 1FX7A 2EGAA 4TVRA 2G6FX 4C0FA 2FHDA 3FJ5A 4N4HA 3CCVT 1H641 4JLIA 5KYYB 3EGDA 1RAHB 1MGQA 3OS5A 1B3QA 5IHNA 4B9XA 3CCLT 2EYQA 3OYAA 1GCQA 1ZBXA 3DLLA 2E3IA 1IZ6A 1MMGA 3GIBA 3CCJQ 1Q7YC 2CT4A 1RAAB 1NBEB 1SRMA 2VYTA 4F7UB 4M78B 4PJOF 4AG2C 4A53A 2RK1A 2MWPA 4M78C 1YHQA 3NTIA 4JJNK 1WQ7A 4Y92A 2KI7A 1K4US 1P92A 4J5YA 2E1HA 4AG1C 3VUBA 5IXFA 3IQLA 2DA9A 4Z02A 3CCUT 1QVFA 2KAFA 2K2MA 5DY9A 2R58A 3JRZA 4DEXA 2DKGA 2XI9A 2BZYA 3I56Q 2QGGA 1OYXA 5FU7B 1X01A 4BE0A 2DIQA 3WXMB 3EH1A 5CKBA 2C0IA 2EJGA 1PG5B 1HD3A 2V1QA 2E65A 2AKLA 5CKFA 2FVUA 5A0LA 3OBWA 2MI6A 2AZSA 2O2OA 2FO0A 1VQ9T 3JAME 4UC4A 3EH2A 1X27A 1UHCA 2O4XB 3VS6A 5GJVB 1QVFS 1M2VA 1RAGB 2FPEA 1TUGB 1ZA2B 1B07A 3ULRB 3ER0A 2YRCA 4M7AD 4MZMA 3CCUA 1X43A 1VQOT 1IHWA 2CP3A 1BCMA 2COWA 1X6BA 2F5TX 5EG2A 2V1RA 4C92B 2O4XA 4PJOD 2AKKA 2EIFA 3U23A 2E5QA 5LJ3h 2AIRB 2DJZA 4EMHA 4C5EA 4M7AF 3CCQQ 1IHVA 2BE7D 3CMEA 4BUGA 3LYIA 5KYYA 3HFOA 1PWTA 2EKHA 4PKCC 4F04B 2LRQA 1VQ5T 1TTHB 1SEMA 2QA4A 2LCCA 2YUQA 4OMNA 1M3AA 2CP6A 1M90R 2ZPBB 3KFVA 2LX7A 1PRLC 3CC7A 1M3CA 3CC7T 3EFOB 3MP8A 2J05A 2H3JA 1YN8A 1JXOA 1WHHA 2QXFA 2KRSA 2RHYA 4F16A 2WACA 2LX9A 5J3BA 4J6WA 1UHFA 1C1AA 1ZBJA 4BACA 5IN1A 4N4GA 4M77E 2RI5A 1XJWB 1VQMT 1W2BS 4M7DF 1YCSB 3JCMf 2YUPA 2DLPA 1VQKA 1M8MA 5CQXA 1OV3A 3A8MB 2RF0A 3OQ5A 4C92A 3CCST 5FROA 1VQ7T 3CCLQ 1VQKT 3X20B 4F7UA 2GGRA 2MPXC 1D1CA 4Q5WA 2NLUA 3C94A 4F7UG 2DF6A 1K9AA 2RPNA 1TWBA 2CH4A 4QT7A 1YJNA 4FIBA 3CC2Q 4D6WA 1JJ2A 1PM3A 2EVRA 2KNBB 4C8QC 1AEYA 3HTRA 1Q81R 5CKHA 4GBQA 2D0QB 1HJDA 1U8RA 2PQWA 3FLGA 2EFIA 4GLKA 3REAB 3V8JA 1UECA 2ENMA 4OGCA 1QVGS 3FB9A 1PHTA 2D0NA 2LT4A 3VKIA 5A2QE 4IIMA 1VA7A 1K73R 5CKEA 4NS5A 4JUVA 2CZ7B 2YDLA 4RCBA 3CC7Q 2KBTA 8ATCB 4ANJA 2X4JA 1VQ6A 3CCMQ 5KCHA 3G6ET 3OSVA 2OJ2A 2YSQA 1WNLA 2XDDA 3JB9G 4LDVA 3O8VA 1YIJA 1MUZA 2PNIA 2LC4A 1M1KR 1VYVA 1Q95G 3LH0A 3QKJA 5D7UA 1U06A 2CYZB 2L0AA 3Q1JA 4MZPA 1GCQC 2FZGB 3OYHA 4QQ6A 4M77D 2VV5A 1BI2A 3M4GA 1MNEA 5CO7A 4FSSA 4LNPA 1JBMA 2RQWA 2JS0A 1W4SA 3J81E 3OYDA 1UGQB 2CH4W 1Q7YR 1JU5C 4JS5A 1AOJA 4LDYA 4N0AC 5HCKA 4E7JA 5J39A 3MP6A 3RKWA 1KC8U 4LDWA 5I21A 3TSWA 1BU1A 2GQIA 5LJ5j 2DX1A 4XTXA 5LJ3d 2VXFA 4CI0C 2AT1B 3N5BB 3JCMb 3M58A 1B34A 1I1JA 2EYXA 3JB9J 4KH1B 1T0HA 2CREA 4FYXB 1VYTA 4XU2A 3CBPA 4BDYA 1VQOA 1RI9A 1VQKQ 2A36A 4ORZA 2ZAEA 1N8RR 3L2RA 3SD4A 4HKEA 3I55T 1NE8A 1M1FA 1YITT 5GAN6 3LLRA 1M30A 4CC4B 4C0GA 2NUPB 2DXBA 5LJ3e 2LQ8A 2RO0A 1FWZA 1O9SA 4FM4B 2JN0A 2HKNA 3CCRT 3BDLA 4JLGA 2M0YA 1G3YA 4AMCA 1VOMA 3VS5A 2LCSA 2P4TA 4PJJA 4WTOB 1VQ4Q 1Z9QA 5GMKi 1F1BB 2FZCB 2PVOB 2NUPA 5A0DA 4NL2A 3CCJA 2V8JA 2X3WD 3QPHA 3OA6A 3NTKA 3L2QA 5KYUB 2WSFE 2DO3A 4LE9A 2K9GA 2YT6A 4C8QB 3CC4A 3TU4K 4C5HA 1LPLA 3UATA 3DKMA 1NLOC 2QQRA 2CP7A 4PJMA 4OB0B 3BW1A 3KBGA 4AT1B 4E7KA 1QVGP 1K8AU 1BI3A 1YFNA 2E41A 4E7SA 3BDUA 3PFSA 3EFOA 4PLIA 3LW5E 3PMIA 5LJ5h 2PTKA 3EFSA 2FRWA 2EGCA 3RBBB 1TUCA 4MMKA 1Q82C 4C92G 5GAN8 5GAMg 1Q81C 5GANg 5GAOl 3SB2A 4M77G 4A4HA 2Y4XA 2YRVA 1OZ2A 3CEYA 3UWNA 2FL7A 3A8GB 5GMKl 1HK9A 1QVGA 4ZTFA 1OPLA 2D8HA 4F14A 3VS4A 1VQ9A 2A0FB 4PJOA 2RQUA 4A4FA 4JRIA 2KY9A 2YRDA 2XU8A 3QIIA 3FDRA 3TSZA 1U1SA 3CQTA 4JJCA 4ME7A 1NYGA 2QG9B 3E2UA 4KGXB 1WX6A 4N0AA 1R8OB 4LUEA 3TCJA 2DL5A 5M9OA 3DLMA 2X51A 4BI4A 5L8RE 1QWFA 1VQ6Q 2CP0A 2DZ9A 1W2BP 3CMET 3P8HA 1YP5A 2L3PA 2KYMA
chains in the Genus database with same CATH topology
3JV3A 2H8HA 2K3BA 4AG1C 5IXFA 4D8DA 3IQLA 2DA9A 1SPKA 3EHQA 2K2MA 3UA7A 1HSQA 2J7IA 2K6DA 4DEXA 3I5SA 1K76A 2GBQA 2BZYA 2KXCA 1W6XA 2E5KA 1T0JA 2DRMA 2F2XA 4RTYA 2HDAA 1M27C 2JXBA 1UTIA 1TG0A 2CSQA 2QDLA 1N5ZA 2O9VA 1K0XA 4JJDA 2ED0A 1K0SA 2C0IA 5L23A 2JMCA 1WA7A 1HD3A 1QCFA 2V1QA 2LJ0A 1BB9A 1GBQA 3UA6A 3QWYA 2KR3A 2AKLA 2KRMA 2RQRA 1GFDA 1H3HA 2AZSA 2O2OA 2FO0A 1AWXA 4HVVA 2DL8A 2LMJA 1G2BA 1X27A 1UHCA 2ESWA 2FEIA 2EPDA 3VS6A 4JZ3A 2BTTA 2DILA 5GJVB 2SRCA 2FPFA 5FW9A 2EYWA 2FPEA 1QKWA 1B07A 4RUGA 3ULRB 4JPBW 1E7OA 3TVTA 1EFNA 2EGEA 2EBPA 3M0RA 1X43A 1GRIA 2A28A 1MV3A 3VS2A 1SRLA 2O31A 1X6BA 1FYNA 2V1RA 1WYXA 2LQWA 1NEGA 2AKKA 2L3QA 3U23A 4CC3A 1UDLA 3QWXX 2O9SA 1PWTA 2EKHA 1WI7A 3SHWA 2CT3A 1SEMA 1X2QA 4OMPA 2KT8A 1YWOA 4D8KA 2K7AA 2YUQA 4OMNA 1M3AA 4J9GA 4CC7A 3KFVA 2LX7A 1PRLC 3PE0A 1M3BA 1M3CA 2CSIA 1I0CA 3LH5A 4JJBA 2KYBA 2J05A 3PVLA 4ESRA 1W1FA 1J3TA 2ROTA 1T3SA 1YN8A 1JXOA 2KRSA 1YNZA 2J06A 4F16A 2JS2A 1WIEA 4J9DA 1MV0B 2DBKA 1UUEA 2XMFA 2F2VA 1JO8A 1UHFA 2JTEA 1ZBJA 2DMOA 5FWBA 2HSPA 1OEBA 1G83A 2EQIA 2PZ1A 1JQQA 4Z8AA 2L3SA 1YCSB 2DRKA 4AFSC 3VS3A 2YUPA 5I22A 2DLPA 2J6OA 1M8MA 4HVWA 1NEBA 1OV3A 1X69A 2C0TA 1GBRA 2RF0A 1ABOA 2ABLA 2DBMA 2B86A 2HBWA 1WDXA 1A0NB 1ZUUA 2K79A 2CDTA 2GGRA 3I35A 1ZX6A 3SEMA 1E6GA 1UGVA 2DF6A 1K9AA 2VVKA 2RPNA 3UF4A 2HEQA 2CH4A 3PVQA 4QT7A 1H92A 1UG1A 1XOVA 2DJQA 1UE9A 1AWOA 4J9HA 2ED1A 1QLYA 2YUNA 1NLPC 2EVRA 2KNBB 1UFFA 1AEYA 4J9FA 1PKSA 3A98A 4GBQA 1HJDA 1RLPC 1WXTA 2NUZA 3REAB 2A08A 1UECA 2RQTA 2ENMA 2LJ3A 1PHTA 3REBB 2D0NA 4IIMA 1VA7A 4M4ZA 2F2WA 2IIMA 3H0HA 2YDLA 1KJWA 1Z9ZA 2KBTA 1AWWA 2DYBA 3I5RA 4WCIA 4OMQA 1PNJA 2VKNA 3VS7A 2KEAA 2DM1A 2CUDA 2MCNA 1CKAA 2OJ2A 1KIKA 2HCKA 2JM9A 2YSQA 4EIKA 1Y57A 1CSKA 4AFUC 2MOXA 1MUZA 2PNIA 4OMLA 1H8KA 1S1NA 4HXJA 2SEMA 3EG1A 1VYVA 1ZSGA 2RQVA 1U06A 2L0AA 1WFWA 4R0KA 5EC7A 2RMOA 1GCQC 2FG0A 1YWPA 4RTTA 4Z88A 2W0ZA 3NGPA 1KFZA 2BZ8A 1TUDA 2FPDA 2KROA 4J9EA 1BK2A 1Y0MA 1OPKA 4FSSA 4LNPA 1LCKA 2RQWA 1ZLMA 2JS0A 2J6KA 3M0TA 2LNHB 2KT1A 2CH4W 1JEGA 3VRZA 1JU5C 3EGUA 2D8JA 1AOJA 2JW4A 3O5ZA 5HCKA 2RN8A 2JM8A 4K11A 1I07A 3TSWA 1VYUA 1BU1A 4JZ4A 2GQIA 2DX1A 1JXMA 4DEYA 3H41A 2DE0X 2W10A 5IHKA 1I1JA 4IIOA 2JMAA 2EYXA 4AFQC 1T0HA 2CREA 2C0OA 1VYTA 2CUBA 2A37A 1RI9A 2A36A 1AD5A 5IHIA 1RUWA 4ORZA 2BZXA 3NPFA 1X2KA 2GTJA 2RNAA 1X6GA 1PRMC 1M30A 3VS1A 4CC4B 2EYZA 4RTXA 2DNUA 4F17A 2GTOA 2I0NA 1E6HA 2VWFA 4RTWA 1SHGA 1GL5A 3EG3A 3NHNA 1NM7A 2M0YA 3M0PA 3VS5A 2AZVA 1KSWA 1K4US 1U3OA 2LCSA 3EHRA 3R6NA 1Z9QA 4X1VA 2L2PA 3M0SA 1QWEA 2O88A 1NYFA 2LP5A 2ROLA 4GLMA 1WXUA 5IXBA 1SHFA 2JT4A 3M0UA 1ZUYA 1AWJA 4AFZC 2X3WD 3C0CA 1OOTA 4LE9A 2EYYA 2K9GA 3VS0A 2YT6A 2LJ1A 4CC2A 3RNJA 1W70A 3UATA 1NLOC 4HVUA 1AVZC 2MIOA 1GCPA 2KGTA 4RTUA 3GBQA 5GJWB 3VRYA 2NWMA 1QKXA 4OMMA 4OMOA 1FMKA 3THKA 2OAWA 2AK5A 3ZL7C 1IO6A 2ECZA 1AZGB 1U5SA 1WXBA 2PTKA 1RLQC 4RTVA 3I9QA 4ZNXA 5ECAA 1BBZA 2FRWA 2P4RA 2EGCA 3RBBB 1TUCA 1T3LA 3H0FA 3EG0A 4KRTA 2DVJA 4LN2A 2LQNA 2X3XD 2DL4A 3H0IA 4J9BA 1CKBA 1PKTA 1SSHA 2KRNA 5FWCA 2KE9A 1ARKA 2DL3A 4E6RA 1K1ZA 2EGAA 2G6FX 1UJ0A 1AZEA 3EG2A 3FJ5A 3M0QA 1OPLA 2D8HA 4F14A 3VS4A 1ZUKA 2RQUA 1B3QA 5IHNA 2KXDA 1GCQA 2M51A 1NG2A 2OI3A 3TSZA 2FRYA 1ABQA 3CQTA 4JJCA 5I11A 2D1XA 4Z89A 1UJYA 1NYGA 2CT4A 2LZ6B 1WX6A 4LUDA 2YUOA 1SRMA 4HCKA 1WLPB 1V1CA 4LUEA 2J6FA 2GNCA 5IH2A 2DL5A 4AG2C 4RTZA 2DL7A 1QWFA 4J9CA 2EW3A 4A63B 4J9IA 3NMZC 4Y92A 1YP5A 2L3PA 2KYMA 1GFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV3 A;  2H8H A;  2K3B A;  4AG1 C;  5IXF A;  4D8D A;  3IQL A;  2DA9 A;  1SPK A;  3EHQ A;  2K2M A;  3UA7 A;  1HSQ A;  2J7I A;  2K6D A;  4DEX A;  3I5S A;  1K76 A;  2GBQ A;  2BZY A;  2KXC A;  1W6X A;  2E5K A;  1T0J A;  2DRM A;  2F2X A;  4RTY A;  2HDA A;  1M27 C;  2JXB A;  1UTI A;  1TG0 A;  2CSQ A;  2QDL A;  1N5Z A;  2O9V A;  1K0X A;  4JJD A;  2ED0 A;  1K0S A;  2C0I A;  5L23 A;  2JMC A;  1WA7 A;  1HD3 A;  1QCF A;  2V1Q A;  2LJ0 A;  1BB9 A;  1GBQ A;  3UA6 A;  3QWY A;  2KR3 A;  2AKL A;  2KRM A;  2RQR A;  1GFD A;  1H3H A;  2AZS A;  2O2O A;  2FO0 A;  1AWX A;  4HVV A;  2DL8 A;  2LMJ A;  1G2B A;  1X27 A;  1UHC A;  2ESW A;  2FEI A;  2EPD A;  3VS6 A;  4JZ3 A;  2BTT A;  2DIL A;  5GJV B;  2SRC A;  2FPF A;  5FW9 A;  2EYW A;  2FPE A;  1QKW A;  1B07 A;  4RUG A;  3ULR B;  4JPB W;  1E7O A;  3TVT A;  1EFN A;  2EGE A;  2EBP A;  3M0R A;  1X43 A;  1GRI A;  2A28 A;  1MV3 A;  3VS2 A;  1SRL A;  2O31 A;  1X6B A;  1FYN A;  2V1R A;  1WYX A;  2LQW A;  1NEG A;  2AKK A;  2L3Q A;  3U23 A;  4CC3 A;  1UDL A;  3QWX X;  2O9S A;  1PWT A;  2EKH A;  1WI7 A;  3SHW A;  2CT3 A;  1SEM A;  1X2Q A;  4OMP A;  2KT8 A;  1YWO A;  4D8K A;  2K7A A;  2YUQ A;  4OMN A;  1M3A A;  4J9G A;  4CC7 A;  3KFV A;  2LX7 A;  1PRL C;  3PE0 A;  1M3B A;  1M3C A;  2CSI A;  1I0C A;  3LH5 A;  4JJB A;  2KYB A;  2J05 A;  3PVL A;  4ESR A;  1W1F A;  1J3T A;  2ROT A;  1T3S A;  1YN8 A;  1JXO A;  2KRS A;  1YNZ A;  2J06 A;  4F16 A;  2JS2 A;  1WIE A;  4J9D A;  1MV0 B;  2DBK A;  1UUE A;  2XMF A;  2F2V A;  1JO8 A;  1UHF A;  2JTE A;  1ZBJ A;  2DMO A;  5FWB A;  2HSP A;  1OEB A;  1G83 A;  2EQI A;  2PZ1 A;  1JQQ A;  4Z8A A;  2L3S A;  1YCS B;  2DRK A;  4AFS C;  3VS3 A;  2YUP A;  5I22 A;  2DLP A;  2J6O A;  1M8M A;  4HVW A;  1NEB A;  1OV3 A;  1X69 A;  2C0T A;  1GBR A;  2RF0 A;  1ABO A;  2ABL A;  2DBM A;  2B86 A;  2HBW A;  1WDX A;  1A0N B;  1ZUU A;  2K79 A;  2CDT A;  2GGR A;  3I35 A;  1ZX6 A;  3SEM A;  1E6G A;  1UGV A;  2DF6 A;  1K9A A;  2VVK A;  2RPN A;  3UF4 A;  2HEQ A;  2CH4 A;  3PVQ A;  4QT7 A;  1H92 A;  1UG1 A;  1XOV A;  2DJQ A;  1UE9 A;  1AWO A;  4J9H A;  2ED1 A;  1QLY A;  2YUN A;  1NLP C;  2EVR A;  2KNB B;  1UFF A;  1AEY A;  4J9F A;  1PKS A;  3A98 A;  4GBQ A;  1HJD A;  1RLP C;  1WXT A;  2NUZ A;  3REA B;  2A08 A;  1UEC A;  2RQT A;  2ENM A;  2LJ3 A;  1PHT A;  3REB B;  2D0N A;  4IIM A;  1VA7 A;  4M4Z A;  2F2W A;  2IIM A;  3H0H A;  2YDL A;  1KJW A;  1Z9Z A;  2KBT A;  1AWW A;  2DYB A;  3I5R A;  4WCI A;  4OMQ A;  1PNJ A;  2VKN A;  3VS7 A;  2KEA A;  2DM1 A;  2CUD A;  2MCN A;  1CKA A;  2OJ2 A;  1KIK A;  2HCK A;  2JM9 A;  2YSQ A;  4EIK A;  1Y57 A;  1CSK A;  4AFU C;  2MOX A;  1MUZ A;  2PNI A;  4OML A;  1H8K A;  1S1N A;  4HXJ A;  2SEM A;  3EG1 A;  1VYV A;  1ZSG A;  2RQV A;  1U06 A;  2L0A A;  1WFW A;  4R0K A;  5EC7 A;  2RMO A;  1GCQ C;  2FG0 A;  1YWP A;  4RTT A;  4Z88 A;  2W0Z A;  3NGP A;  1KFZ A;  2BZ8 A;  1TUD A;  2FPD A;  2KRO A;  4J9E A;  1BK2 A;  1Y0M A;  1OPK A;  4FSS A;  4LNP A;  1LCK A;  2RQW A;  1ZLM A;  2JS0 A;  2J6K A;  3M0T A;  2LNH B;  2KT1 A;  2CH4 W;  1JEG A;  3VRZ A;  1JU5 C;  3EGU A;  2D8J A;  1AOJ A;  2JW4 A;  3O5Z A;  5HCK A;  2RN8 A;  2JM8 A;  4K11 A;  1I07 A;  3TSW A;  1VYU A;  1BU1 A;  4JZ4 A;  2GQI A;  2DX1 A;  1JXM A;  4DEY A;  3H41 A;  2DE0 X;  2W10 A;  5IHK A;  1I1J A;  4IIO A;  2JMA A;  2EYX A;  4AFQ C;  1T0H A;  2CRE A;  2C0O A;  1VYT A;  2CUB A;  2A37 A;  1RI9 A;  2A36 A;  1AD5 A;  5IHI A;  1RUW A;  4ORZ A;  2BZX A;  3NPF A;  1X2K A;  2GTJ A;  2RNA A;  1X6G A;  1PRM C;  1M30 A;  3VS1 A;  4CC4 B;  2EYZ A;  4RTX A;  2DNU A;  4F17 A;  2GTO A;  2I0N A;  1E6H A;  2VWF A;  4RTW A;  1SHG A;  1GL5 A;  3EG3 A;  3NHN A;  1NM7 A;  2M0Y A;  3M0P A;  3VS5 A;  2AZV A;  1KSW A;  1K4U S;  1U3O A;  2LCS A;  3EHR A;  3R6N A;  1Z9Q A;  4X1V A;  2L2P A;  3M0S A;  1QWE A;  2O88 A;  1NYF A;  2LP5 A;  2ROL A;  4GLM A;  1WXU A;  5IXB A;  1SHF A;  2JT4 A;  3M0U A;  1ZUY A;  1AWJ A;  4AFZ C;  2X3W D;  3C0C A;  1OOT A;  4LE9 A;  2EYY A;  2K9G A;  3VS0 A;  2YT6 A;  2LJ1 A;  4CC2 A;  3RNJ A;  1W70 A;  3UAT A;  1NLO C;  4HVU A;  1AVZ C;  2MIO A;  1GCP A;  2KGT A;  4RTU A;  3GBQ A;  5GJW B;  3VRY A;  2NWM A;  1QKX A;  4OMM A;  4OMO A;  1FMK A;  3THK A;  2OAW A;  2AK5 A;  3ZL7 C;  1IO6 A;  2ECZ A;  1AZG B;  1U5S A;  1WXB A;  2PTK A;  1RLQ C;  4RTV A;  3I9Q A;  4ZNX A;  5ECA A;  1BBZ A;  2FRW A;  2P4R A;  2EGC A;  3RBB B;  1TUC A;  1T3L A;  3H0F A;  3EG0 A;  4KRT A;  2DVJ A;  4LN2 A;  2LQN A;  2X3X D;  2DL4 A;  3H0I A;  4J9B A;  1CKB A;  1PKT A;  1SSH A;  2KRN A;  5FWC A;  2KE9 A;  1ARK A;  2DL3 A;  4E6R A;  1K1Z A;  2EGA A;  2G6F X;  1UJ0 A;  1AZE A;  3EG2 A;  3FJ5 A;  3M0Q A;  1OPL A;  2D8H A;  4F14 A;  3VS4 A;  1ZUK A;  2RQU A;  1B3Q A;  5IHN A;  2KXD A;  1GCQ A;  2M51 A;  1NG2 A;  2OI3 A;  3TSZ A;  2FRY A;  1ABQ A;  3CQT A;  4JJC A;  5I11 A;  2D1X A;  4Z89 A;  1UJY A;  1NYG A;  2CT4 A;  2LZ6 B;  1WX6 A;  4LUD A;  2YUO A;  1SRM A;  4HCK A;  1WLP B;  1V1C A;  4LUE A;  2J6F A;  2GNC A;  5IH2 A;  2DL5 A;  4AG2 C;  4RTZ A;  2DL7 A;  1QWF A;  4J9C A;  2EW3 A;  4A63 B;  4J9I A;  3NMZ C;  4Y92 A;  1YP5 A;  2L3P A;  2KYM A;  1GFC A; 
#chains in the Genus database with same CATH topology
 2K3B A;  1SPK A;  3PTA A;  1VQN Q;  3UA7 A;  3CCE T;  2K6D A;  3M4Y A;  3FC3 A;  1K76 A;  3BY7 A;  4M77 C;  1KD1 R;  3JCM c;  1W6X A;  5HK0 A;  1QVP A;  5KYU A;  1T0J A;  4M75 G;  1M27 C;  2K3X A;  4EMK C;  3JCM W;  2JXB A;  1TG0 A;  3CC2 A;  5IT9 E;  2JVV A;  2ED0 A;  4IUU A;  1WA7 A;  3A5Z B;  1QCF A;  3QYG B;  5GMK j;  4BB7 A;  3RMQ A;  2R57 A;  2LJ0 A;  2QA4 Q;  3M55 A;  1BB9 A;  2KR3 A;  2KRM A;  1GFD A;  3M57 A;  2COZ A;  4HVV A;  2QAS A;  3HPW A;  4DBQ A;  3L2U A;  1YJ9 T;  4FYV B;  4DOW A;  4JZ3 A;  2DIL A;  1JJ2 P;  2FPF A;  5FW9 A;  3G71 A;  3CXC P;  3SDZ A;  3G71 T;  1FMV A;  4XU3 A;  1VQ7 Q;  3TVT A;  4XTZ A;  1M4Z A;  1D0Y A;  2P0K A;  4C0Z A;  3M0R A;  2A28 A;  1W2B A;  1BIB A;  1SRL A;  2Y4Y A;  1VQL T;  3M54 A;  2LQW A;  1NEG A;  3P8D A;  4XTU A;  3QWX X;  2CZ1 B;  4M75 C;  2O9S A;  4MML A;  1WI7 A;  2JNG A;  2QYZ A;  4OMP A;  1X2Q A;  5AT1 B;  3V8K A;  3D7S B;  4E7Z A;  3CBM A;  3RKX A;  4L59 A;  3MO8 A;  2E6N A;  2K5F A;  1YI2 T;  3JCM g;  1I0C A;  2KYB A;  4ESR A;  1W1F A;  4DOV A;  3OYI A;  2QEX T;  1YNZ A;  2J06 A;  3QDR B;  3CCM T;  1I5O B;  1WIE A;  2DBK A;  3L1A A;  1R77 A;  2L89 A;  1JO8 A;  2JTE A;  2M16 A;  2DMO A;  2H3E B;  2MF2 A;  2QK0 A;  4F7U F;  2HSP A;  1BI1 A;  1OEB A;  1G83 A;  2RH2 A;  3VYG A;  3GOX A;  1KC8 R;  1VQ7 A;  3PNW C;  4PJO B;  2L3S A;  2DRK A;  4AFS C;  2DTH A;  2QEX A;  2HQH A;  5CVI A;  2QTX A;  4HVW A;  5FU6 C;  1GBR A;  1K8A C;  5KYW B;  1ABO A;  1QP3 A;  2B86 A;  1YIJ T;  4ZGJ B;  2HBW A;  5CIU A;  2DPP B;  2GCX A;  1D0Z A;  3M53 A;  1E6G A;  1VQ4 A;  1WPY A;  2VVK A;  1S72 Q;  1TU0 B;  2L8D A;  1UG1 A;  1XOV A;  5GAM e;  2DJQ A;  3PIO A;  4FYW B;  1IXD A;  2QQB A;  4DA4 A;  1NJI U;  1D09 B;  4L6V 5;  2ED1 A;  2KMT A;  2ZPI B;  1NLP C;  5CK9 A;  2RJE A;  3M56 A;  4OB1 B;  5CQY A;  2NUZ A;  5CAI A;  4C92 D;  3REB B;  1LNX A;  1WHJ A;  2KDS A;  4YTL A;  1AWW A;  2DFU A;  4JRK A;  4WCI A;  4OMQ A;  4II1 A;  2VKN A;  3VS7 A;  2KEA A;  4JRP A;  4ZTJ A;  2NUT B;  1LJO A;  1KQ1 A;  3JCM J;  2X4W A;  4BI3 A;  2HCK A;  5LL6 S;  1KK7 A;  1CSK A;  2KK4 A;  4MDW A;  2BKD N;  3C4S A;  5LJ5 f;  4OML A;  1H8K A;  3TRE A;  4OF1 A;  1VQ5 Q;  3EG1 A;  4ZGD B;  3CME Q;  3CCR A;  5D6Y A;  2RQV A;  4OB3 B;  4EDU A;  3CPW P;  5EC7 A;  1OU9 A;  1Y07 A;  2RMO A;  4RTT A;  2W0Z A;  2BZ8 A;  2MMP A;  4NL3 A;  4M78 F;  3VYH B;  3EGD B;  3SWN B;  2FPD A;  4J9E A;  3JCM d;  3JB9 F;  3OB9 A;  1ZA1 B;  1OPK A;  1LOJ A;  2R5M A;  1Q7Y U;  2C06 A;  1VQ5 A;  3VRZ A;  2OTL Q;  3EGU A;  1PD0 A;  3O5Z A;  2LDM A;  2RN8 A;  3JCM X;  4OMF B;  4K11 A;  2OX7 A;  3FIF A;  1BKB A;  1VYU A;  1VQL Q;  2M1H A;  4A4E A;  3GPL A;  2HAX A;  2KSS A;  1XQH A;  5IHK A;  4JRQ A;  4RG2 A;  1G3S A;  3L42 A;  1XNI A;  3JCM V;  2RI3 A;  2DD4 A;  4QVZ A;  4LD9 K;  3UT1 A;  3NPF A;  1MMN A;  3FRN A;  4BE1 A;  2GTJ A;  2VAS A;  2FYK A;  1NJI R;  1X6G A;  1PRM C;  3ME9 A;  3JCM e;  1RAB B;  1IRE B;  3SFM A;  4F17 A;  2GTO A;  2I0N A;  3AT1 B;  4O5V A;  4XK8 E;  2VWF A;  1IRX A;  5LJ3 g;  4Y91 A;  1ZHI A;  2F69 A;  2O01 E;  1PSE A;  2PVG B;  3NHN A;  4LXC A;  1YHQ Q;  3MEA A;  2XID A;  1K8A R;  2RJD A;  2RI2 A;  1SG5 A;  3M0P A;  4Y28 E;  2YXY A;  4M7D C;  2AZV A;  1WJQ A;  4X1V A;  4QVD A;  1VQL A;  2L2P A;  3CCV A;  2RK2 A;  4C5I A;  5LJ5 g;  3KUF A;  5IXB A;  2JT4 A;  3CCQ A;  4EMG A;  1ZUY A;  1WJS A;  1VUB A;  3CD6 Q;  2E3H A;  3J7A F;  1O75 A;  4R55 A;  3OYF A;  2EQJ A;  1HYO A;  3L2V A;  4E7L A;  3VS0 A;  1X75 C;  4X34 A;  2NYS A;  4XU0 A;  2WSE E;  1W70 A;  5GAO p;  3WVE B;  2LVM A;  3DB4 A;  4J7I A;  1AVZ C;  1MMA A;  1VQP A;  2DTI A;  2MIO A;  2KGT A;  3VRY A;  4M7A C;  1FMK A;  4A54 A;  3J80 E;  5GAN f;  1YIJ Q;  2AK5 A;  3ZL7 C;  1IO6 A;  4M7D A;  1IGU A;  3BE3 A;  3I55 A;  3EFR A;  3JB9 H;  4RTV A;  4DBF A;  2EQU A;  1BBZ A;  1T3L A;  4KRT A;  3EG0 A;  4F7U E;  1KQS A;  3H8Z A;  2V26 A;  3G4S A;  5GAN d;  2LQN A;  5CR2 A;  2DL4 A;  1CKB A;  1PKT A;  5FWC A;  2KE9 A;  4IUP A;  1K1Z A;  2EAY A;  1FMW A;  4JDS A;  1G3W A;  3PMT A;  3MJX A;  2NUT A;  2OTJ Q;  4QW2 A;  1PSF A;  3MCA B;  3M0Q A;  4ZN1 A;  3E19 A;  4PJL A;  3QBY A;  1M5Q 1;  1ZUK A;  2KXD A;  1KHC A;  5GAN 3;  3LWH A;  2YLB A;  5LJ5 e;  2M51 A;  1V29 B;  1ABQ A;  4PFO A;  4VUB A;  5I11 A;  2D1X A;  2HQE A;  1UJY A;  4XU1 A;  2LZ6 B;  2YUO A;  2V8K A;  1WLP B;  5GMK e;  1V1C A;  3X26 B;  2J6F A;  2GNC A;  2CP2 A;  5CCA A;  3VV0 A;  2QQS A;  4C0D C;  3HSB A;  1D3B B;  2F1L A;  4EPC A;  4RTZ A;  5GAO r;  2DL7 A;  5GAN e;  2EW3 A;  4A63 B;  4C92 F;  2VGN A;  3V7R A;  1YJW T;  3CCE A;  3QZ9 B;  4ELY C;  2WSC E;  1HSQ A;  4L5G A;  3I56 A;  4KGV B;  3UPU A;  5GAN j;  1I5L A;  1I81 A;  2VC8 A;  3V7C A;  4XTV A;  1VQN A;  2K5L A;  5D6X A;  3LWI A;  2DRM A;  2JTM A;  4FW2 A;  2A3L A;  2HDA A;  1M1K C;  1UTI A;  2D6F A;  2LT1 A;  3SWN C;  2QDL A;  3CMA Q;  3CXC A;  2E70 A;  4JJD A;  2DAQ A;  5L23 A;  1S72 A;  4KUI A;  3AHU A;  1UGR B;  1D0X A;  1NPR A;  3UA6 A;  3RR6 A;  2ZPF B;  2RQR A;  5A0G A;  4XAX B;  5KYX B;  2DL8 A;  2LMJ A;  1G3T A;  1KQS S;  1G2B A;  4M7D E;  2ESW A;  2FEI A;  4XTY A;  4PFP A;  3RUX A;  3RES A;  4FSX A;  5C0M A;  1QKW A;  2DXT A;  4RUG A;  4JPB W;  3JCM h;  1E7O A;  4FW1 A;  3M9Q A;  1Q86 R;  2EBP A;  2L3R A;  4E7H A;  1TXQ A;  1GRI A;  3VS2 A;  2O31 A;  2OTJ A;  2BUD A;  2IPO B;  1WYX A;  2OTJ T;  4C92 E;  4OVA A;  1Y96 A;  4CC3 A;  3CCR Q;  5AYF A;  2HMA A;  2PVD B;  3OS1 A;  1N8R C;  4P5N A;  4XTW A;  2HQX A;  4C8Q E;  2MK5 A;  3GLX A;  3SHW A;  5CKD A;  1VQ4 T;  2XDB A;  1KD1 U;  2KT8 A;  3ZEH A;  1YWO A;  4D8K A;  1WHG A;  2M9U A;  2K7A A;  3H9N A;  2XKO C;  4J9G A;  3I55 Q;  1TH7 A;  1BI0 A;  2IVW A;  3H6Z A;  1M1G A;  3LH5 A;  4JJB A;  3E9G A;  4GY5 A;  1WHL A;  3ASK A;  1T3S A;  4QQG A;  3HRU A;  1WGS A;  1RI0 A;  3HRT A;  4J9D A;  1MV0 B;  2X4X A;  2F2V A;  2DYI A;  5J26 A;  4E7I A;  2PZ1 A;  4Z8A A;  2QI2 A;  5I22 A;  7AT1 B;  2J6O A;  4R56 A;  3A1P A;  3EGX B;  1VQP T;  1X69 A;  2XD0 A;  2CGH A;  1EZZ B;  3L2W A;  3GNG A;  3OYC A;  2ABL A;  4MDX A;  3EG9 A;  2GF7 A;  3OMG A;  5LJ3 j;  3QJY A;  1A0N B;  2CDT A;  4M75 A;  3BFM A;  4C5G A;  2DXC A;  3SEM A;  4M75 E;  2JZ2 A;  2Z0W A;  4M7D D;  5FU7 C;  1PCX A;  3UF4 A;  4FYY B;  2CS7 A;  2KVQ G;  1K9M C;  3S3M A;  4J9H A;  5HKC A;  2RJC A;  3SWN A;  5KYW A;  3QJ6 A;  1UFF A;  1VQ9 Q;  5GAN 2;  4J9F A;  1RLP C;  2JUF A;  1WXT A;  5GAN 7;  2RQT A;  1M9S A;  2LJ3 A;  3QHS A;  2M0O A;  1Q82 R;  2DK3 A;  2F2W A;  3GF5 A;  3F70 A;  3H0H A;  5LJ5 d;  1FXX A;  1KJW A;  1N9S A;  1Z9Z A;  2KQW A;  3OBY A;  1VQO Q;  4M78 A;  1PNJ A;  2DM1 A;  3LX7 A;  2ZPG B;  3VU3 C;  1KIK A;  4J8O A;  4M77 F;  4EIK A;  1YJ9 A;  1KC8 C;  2VGM A;  4HT9 A;  1UGP B;  4OP0 A;  1RAF B;  3OYN A;  4HXJ A;  3OYJ A;  4M7D B;  1VQ8 A;  5KH6 A;  2HBP A;  1KQS P;  3PIP A;  2E6Z A;  4M77 A;  4PNO A;  1WFW A;  4R0K A;  1LVK A;  2X4Y A;  2FG0 A;  3EAE A;  2RHI A;  3CPF A;  2V8I A;  3NGP A;  2JJ9 A;  2ZCF B;  1QP2 A;  4ELZ C;  3VUZ A;  3I56 T;  1TUD A;  2K2V A;  3T9N A;  3E9F A;  3MEU A;  3UDC A;  1NPP A;  3G1J A;  5KYX A;  4RMO A;  1KQ2 A;  3M5A A;  4XQ3 A;  1LCK A;  1BCO A;  1TSF A;  5IAY A;  2J6K A;  3M0T A;  3G71 Q;  2KT1 A;  1MND A;  1RL2 A;  2D8J A;  5FLX E;  2P84 A;  3G4S Q;  2QA4 T;  1I07 A;  1JXM A;  4C92 C;  4DEY A;  3H41 A;  2W10 A;  4C0D B;  4IIO A;  4AFQ C;  2DZC A;  2AHJ B;  3MEV A;  2JTF A;  2QAZ A;  2CUB A;  2A37 A;  2DVE A;  2E12 A;  4RCC A;  1OUL A;  4M7A A;  1RUW A;  3G7Z A;  2BZX A;  5GAO q;  1Q81 U;  4LDX A;  1QCO A;  2CP5 A;  3X28 B;  4E2F B;  2RNA A;  2XIC A;  4BY6 C;  1KG1 A;  1G8X A;  1QVF P;  3QSU A;  3VS1 A;  3QXE B;  2E4H A;  4RTX A;  1WJR A;  2DNU A;  3OSS C;  3OW2 P;  2XDP A;  3EG9 B;  1E6H A;  4RTW A;  2YHT A;  4KBM B;  4BE2 A;  2ZPE B;  1SHG A;  1GL5 A;  2DIG A;  3OW2 A;  3CPW A;  3ZFJ A;  2ZGW A;  1KSW A;  2B8A A;  1U3O A;  2RB6 A;  1C0M A;  3C95 A;  1WQW A;  3RKY A;  1WZO A;  3CCV Q;  1YI2 Q;  2ROL A;  3JSC A;  4A4G A;  5GAO m;  3LGL A;  1D3B A;  3CBO A;  3C0C A;  5DLQ E;  1AHJ B;  5HY6 A;  2ZPH B;  1OOT A;  5FRM A;  2EYY A;  3FJP A;  2GFU A;  3RNJ A;  4M75 B;  1QW1 A;  1OX9 A;  4M75 F;  1PD1 A;  2LQK A;  5KCO A;  2DEU A;  4HVU A;  2BIV A;  1M90 U;  1QQJ A;  1AT1 B;  4HA8 A;  1VQM A;  2EQM A;  1GCP A;  2QGF B;  3GBQ A;  5GJW B;  1JRI A;  1VQ8 Q;  1YJW A;  2HSE B;  3DB3 A;  2NWM A;  1QKX A;  4OMM A;  5GAM f;  3HKS A;  2ECZ A;  1AZG B;  1U5S A;  2QTV A;  1YIT Q;  3OYK A;  3OYE A;  1RLQ C;  1YJ9 Q;  2PUO B;  3I9Q A;  4J83 A;  4ZNX A;  5GAN 5;  1SF9 A;  2P4R A;  2EJF A;  2CZ6 B;  2L5Q A;  3H0F A;  3X24 B;  1XTD A;  4X9C A;  1PC0 A;  3G4S T;  1JB0 E;  4PK4 A;  5GAM d;  2EKO A;  1N8R U;  1OI1 A;  1BIA A;  3CC2 T;  1ARK A;  4DBH A;  1VIF A;  5GAN h;  5FU6 B;  2GFA A;  4IUV A;  1UJ0 A;  5GAN 4;  1AZE A;  3EG2 A;  1H3Z A;  5D6W A;  2RHU A;  1WHK A;  4HCZ A;  4J6X A;  4FT2 A;  3CC4 Q;  2HNI A;  3E1S A;  3A8O B;  4PJO C;  1N9R A;  3CCS Q;  2DTO A;  3M59 A;  3C12 A;  2PU9 B;  5LJ3 f;  1NG2 A;  2OI3 A;  3CXC S;  2FRY A;  4Z89 A;  4KH0 B;  1I8F A;  4LUD A;  4DQ2 A;  3G6E A;  3G6E Q;  4HCK A;  3CCL A;  1D1B A;  1OX8 A;  5IH2 A;  1K73 U;  2OAU A;  2K4Y A;  5HK3 A;  4KUD K;  4J9C A;  1Y71 A;  2DD5 A;  3QZ5 B;  4J9I A;  4IUT A;  3NMZ C;  1VQ8 T;  3JB9 I;  1UB4 A;  1M1K U;  5KE2 A;  1GFC A;  3JV3 A;  2H8H A;  4M7A E;  4V2S A;  4D8D A;  1YBY A;  3EHQ A;  4PLL A;  2F5K A;  2M02 A;  2J7I A;  3MET A;  4IKF A;  3I5S A;  2GBQ A;  1QMC A;  4OGE A;  2KXC A;  2E5K A;  4E47 A;  4IUQ A;  3S3N A;  1ZSZ A;  2F2X A;  4RTY A;  4M7D G;  2K3Y A;  1M90 C;  2RD1 A;  2CSQ A;  1N5Z A;  2O9V A;  1K0X A;  1YJN Q;  4N4I A;  1K0S A;  2OTL T;  2JMC A;  3MEW A;  1S72 T;  4FL6 A;  1GBQ A;  3QWY A;  1YCY A;  1GXI E;  4M78 E;  1H3H A;  2RHZ A;  3A8H B;  1I4K 1;  3RDV A;  1AWX A;  2OTL A;  4QKU A;  3OS0 A;  1Q86 C;  2EPD A;  5KYN A;  2BTT A;  4BY6 B;  2VUB A;  2SRC A;  2EYW A;  3CCS A;  3OYM A;  1N6A A;  4C8Q A;  1K73 C;  3JCM P;  4CRI A;  1EFN A;  2EGE A;  3EGX A;  1MV3 A;  4M7A G;  4M77 B;  2E10 A;  1IB8 A;  3QO3 A;  2QQ9 A;  3OYY A;  1FYN A;  3OYG A;  1EX4 A;  3WVD B;  1WHM A;  2L3Q A;  2EJ9 A;  1UDL A;  3OW2 S;  2D9T A;  4O6J A;  4LDU A;  5GAO n;  2BE9 B;  3JCM Q;  1Q86 U;  3GNF B;  3V7S A;  3GP8 A;  2QQA A;  2X9H A;  2CT3 A;  4IUR A;  4BD3 A;  1TOV A;  3HL8 A;  1DJ7 B;  3CCM A;  3L2Z A;  4CC7 A;  3CCJ T;  3PT9 A;  2GQV A;  3HHT B;  2ZZD A;  3PE0 A;  5FRN A;  1M3B A;  2HKQ B;  2CSI A;  1VIE A;  4LD6 A;  3PVL A;  3RIR A;  5GAM j;  1J3T A;  2ROT A;  2JS2 A;  4HCC A;  1UUE A;  2XMF A;  1N27 A;  3VJP A;  3QDF A;  5FWB A;  2P0Q A;  2EQI A;  1JQQ A;  4FCY A;  3VS3 A;  1SSF A;  1BYM A;  1NEB A;  2QDY B;  2C0T A;  1ZQ1 A;  3OYL A;  6AT1 B;  1G5V A;  2Y90 A;  1K9M U;  2DBM A;  1Y7X A;  2VXE A;  5C6S A;  3CD6 T;  1WDX A;  1ZUU A;  2K79 A;  2YWW A;  3I35 A;  1ZX6 A;  1UGV A;  2YLC A;  2HEQ A;  3PVQ A;  2EWN A;  1RAC B;  1RAI B;  1H92 A;  2DEQ A;  1UE9 A;  1AWO A;  2MAM A;  1QLY A;  2YUN A;  4M7A B;  4EMK A;  4M75 D;  1PKS A;  3A98 A;  4HT8 A;  1ZSZ C;  3NFC A;  2DER A;  2A08 A;  2G3R A;  4PJO E;  2EQK A;  4A4K A;  2XHC A;  4M4Z A;  2IIM A;  3CCE Q;  2XG8 D;  2LNV A;  1MMD A;  3FEO A;  4PFZ A;  2DYB A;  3I5R A;  3QUI A;  4QQD A;  1Q82 U;  4KT0 E;  2RJF A;  1C6V X;  3TQ7 P;  2CUD A;  1TS9 A;  2MCN A;  1CKA A;  2JM9 A;  3A8L B;  1Y57 A;  2R5A A;  4AFU C;  2MOX A;  3JB9 D;  3RMS A;  1KD1 C;  1S1N A;  2SEM A;  4M78 D;  1ZSG A;  2DET A;  1VQP Q;  1YJW Q;  2ATC B;  1YHQ T;  1RAD B;  3ZBD A;  3OY9 A;  1YWP A;  1JJ2 S;  4Z88 A;  9ATC B;  5I2S A;  3MKD A;  3CCU Q;  3OS2 A;  1KFZ A;  1IGQ A;  2XK0 A;  2KRO A;  1UEB A;  1OZ3 A;  1BK2 A;  1Y0M A;  1M2O A;  2HZY A;  2HD0 A;  2CZ0 B;  4C8Q G;  4J7F A;  1ZLM A;  2LNH B;  3NTH A;  1JEG A;  1YJN T;  5KE3 A;  4FU6 A;  1M2V B;  4DBR A;  3CPW S;  1EIF A;  2JW4 A;  1ZSZ B;  4KGZ B;  4B6M A;  3R6O A;  2RHX A;  2JM8 A;  1YI2 A;  4JZ4 A;  4NOY A;  1U1T A;  3QG1 A;  1V76 A;  2DE0 X;  4ATO A;  2K5I A;  4QVC A;  1QCN A;  4BDZ A;  3P8B B;  4HCB A;  2JMA A;  8AT1 B;  5GMK h;  3X25 B;  3CMA A;  4JS4 A;  1Y96 B;  2C0O A;  1AD5 A;  2IG0 A;  5IHI A;  3CC4 T;  1X2K A;  4C8Q F;  2HL5 C;  1R0C B;  2MWO A;  4MZT A;  4BI8 B;  5GMK m;  2LCL A;  3S3O A;  3S6W A;  3V8L A;  3CMA T;  2CKK A;  2EYZ A;  2LTO A;  1B7T A;  4ZN3 A;  1NJI C;  3MHX A;  3EG3 A;  3CD6 A;  1NM7 A;  1D1A A;  3CCQ T;  1K9M R;  4ZGE B;  3MP1 A;  4WF2 A;  1SKU B;  3PGG A;  3EHR A;  3R6N A;  2DXU A;  3M0S A;  2MYS A;  5DLO A;  1QWE A;  1RAE B;  2O88 A;  1NYF A;  1R0B G;  1MHN A;  2LP5 A;  5GAM h;  4GLM A;  1WXU A;  1VQN T;  1SHF A;  3M0U A;  1AWJ A;  4AFZ C;  2I2L A;  4PJN A;  3RER A;  4FT4 A;  2QEX Q;  4PJO G;  3TEE A;  1KHI A;  3HRS A;  3OMC A;  4B9W A;  3INZ A;  2PUK B;  2FZK B;  2JOY A;  4EMK B;  2LJ1 A;  3HFN A;  5I2M A;  4CC2 A;  1OQK A;  2P0P A;  2FB7 A;  1ACM B;  5DM7 R;  4KUL A;  1UGS B;  2E64 A;  3LGF A;  3OYB A;  1X6O A;  1VQ6 T;  2VB6 A;  4RTU A;  1HXD A;  4OMO A;  1NZ9 A;  3THK A;  2OAW A;  2A7Y A;  3MPU B;  1M8V A;  4OB2 B;  1OU8 A;  1WXB A;  1YIT A;  3QYH B;  5ECA A;  4RKU E;  4M78 G;  1B34 B;  4X9D A;  2DVJ A;  2COY A;  4RG8 A;  2RA2 A;  4LN2 A;  4PL6 A;  2X3X D;  3H0I A;  4J9B A;  3URG A;  3HP9 A;  1SSH A;  2KRN A;  2DL3 A;  2X35 A;  2K57 A;  4E6R A;  1VQM Q;  2RM4 A;  3KXT A;  2HL3 A;  4C8Q D;  4J6Y A;  1FX7 A;  2EGA A;  4TVR A;  2G6F X;  4C0F A;  2FHD A;  3FJ5 A;  4N4H A;  3CCV T;  1H64 1;  4JLI A;  5KYY B;  3EGD A;  1RAH B;  1MGQ A;  3OS5 A;  1B3Q A;  5IHN A;  4B9X A;  3CCL T;  2EYQ A;  3OYA A;  1GCQ A;  1ZBX A;  3DLL A;  2E3I A;  1IZ6 A;  1MMG A;  3GIB A;  3CCJ Q;  1Q7Y C;  2CT4 A;  1RAA B;  1NBE B;  1SRM A;  2VYT A;  4F7U B;  4M78 B;  4PJO F;  4AG2 C;  4A53 A;  2RK1 A;  2MWP A;  4M78 C;  1YHQ A;  3NTI A;  4JJN K;  1WQ7 A;  4Y92 A;  2KI7 A;  1K4U S;  1P92 A;  4J5Y A;  2E1H A;  4AG1 C;  3VUB A;  5IXF A;  3IQL A;  2DA9 A;  4Z02 A;  3CCU T;  1QVF A;  2KAF A;  2K2M A;  5DY9 A;  2R58 A;  3JRZ A;  4DEX A;  2DKG A;  2XI9 A;  2BZY A;  3I56 Q;  2QGG A;  1OYX A;  5FU7 B;  1X01 A;  4BE0 A;  2DIQ A;  3WXM B;  3EH1 A;  5CKB A;  2C0I A;  2EJG A;  1PG5 B;  1HD3 A;  2V1Q A;  2E65 A;  2AKL A;  5CKF A;  2FVU A;  5A0L A;  3OBW A;  2MI6 A;  2AZS A;  2O2O A;  2FO0 A;  1VQ9 T;  3JAM E;  4UC4 A;  3EH2 A;  1X27 A;  1UHC A;  2O4X B;  3VS6 A;  5GJV B;  1QVF S;  1M2V A;  1RAG B;  2FPE A;  1TUG B;  1ZA2 B;  1B07 A;  3ULR B;  3ER0 A;  2YRC A;  4M7A D;  4MZM A;  3CCU A;  1X43 A;  1VQO T;  1IHW A;  2CP3 A;  1BCM A;  2COW A;  1X6B A;  2F5T X;  5EG2 A;  2V1R A;  4C92 B;  2O4X A;  4PJO D;  2AKK A;  2EIF A;  3U23 A;  2E5Q A;  5LJ3 h;  2AIR B;  2DJZ A;  4EMH A;  4C5E A;  4M7A F;  3CCQ Q;  1IHV A;  2BE7 D;  3CME A;  4BUG A;  3LYI A;  5KYY A;  3HFO A;  1PWT A;  2EKH A;  4PKC C;  4F04 B;  2LRQ A;  1VQ5 T;  1TTH B;  1SEM A;  2QA4 A;  2LCC A;  2YUQ A;  4OMN A;  1M3A A;  2CP6 A;  1M90 R;  2ZPB B;  3KFV A;  2LX7 A;  1PRL C;  3CC7 A;  1M3C A;  3CC7 T;  3EFO B;  3MP8 A;  2J05 A;  2H3J A;  1YN8 A;  1JXO A;  1WHH A;  2QXF A;  2KRS A;  2RHY A;  4F16 A;  2WAC A;  2LX9 A;  5J3B A;  4J6W A;  1UHF A;  1C1A A;  1ZBJ A;  4BAC A;  5IN1 A;  4N4G A;  4M77 E;  2RI5 A;  1XJW B;  1VQM T;  1W2B S;  4M7D F;  1YCS B;  3JCM f;  2YUP A;  2DLP A;  1VQK A;  1M8M A;  5CQX A;  1OV3 A;  3A8M B;  2RF0 A;  3OQ5 A;  4C92 A;  3CCS T;  5FRO A;  1VQ7 T;  3CCL Q;  1VQK T;  3X20 B;  4F7U A;  2GGR A;  2MPX C;  1D1C A;  4Q5W A;  2NLU A;  3C94 A;  4F7U G;  2DF6 A;  1K9A A;  2RPN A;  1TWB A;  2CH4 A;  4QT7 A;  1YJN A;  4FIB A;  3CC2 Q;  4D6W A;  1JJ2 A;  1PM3 A;  2EVR A;  2KNB B;  4C8Q C;  1AEY A;  3HTR A;  1Q81 R;  5CKH A;  4GBQ A;  2D0Q B;  1HJD A;  1U8R A;  2PQW A;  3FLG A;  2EFI A;  4GLK A;  3REA B;  3V8J A;  1UEC A;  2ENM A;  4OGC A;  1QVG S;  3FB9 A;  1PHT A;  2D0N A;  2LT4 A;  3VKI A;  5A2Q E;  4IIM A;  1VA7 A;  1K73 R;  5CKE A;  4NS5 A;  4JUV A;  2CZ7 B;  2YDL A;  4RCB A;  3CC7 Q;  2KBT A;  8ATC B;  4ANJ A;  2X4J A;  1VQ6 A;  3CCM Q;  5KCH A;  3G6E T;  3OSV A;  2OJ2 A;  2YSQ A;  1WNL A;  2XDD A;  3JB9 G;  4LDV A;  3O8V A;  1YIJ A;  1MUZ A;  2PNI A;  2LC4 A;  1M1K R;  1VYV A;  1Q95 G;  3LH0 A;  3QKJ A;  5D7U A;  1U06 A;  2CYZ B;  2L0A A;  3Q1J A;  4MZP A;  1GCQ C;  2FZG B;  3OYH A;  4QQ6 A;  4M77 D;  2VV5 A;  1BI2 A;  3M4G A;  1MNE A;  5CO7 A;  4FSS A;  4LNP A;  1JBM A;  2RQW A;  2JS0 A;  1W4S A;  3J81 E;  3OYD A;  1UGQ B;  2CH4 W;  1Q7Y R;  1JU5 C;  4JS5 A;  1AOJ A;  4LDY A;  4N0A C;  5HCK A;  4E7J A;  5J39 A;  3MP6 A;  3RKW A;  1KC8 U;  4LDW A;  5I21 A;  3TSW A;  1BU1 A;  2GQI A;  5LJ5 j;  2DX1 A;  4XTX A;  5LJ3 d;  2VXF A;  4CI0 C;  2AT1 B;  3N5B B;  3JCM b;  3M58 A;  1B34 A;  1I1J A;  2EYX A;  3JB9 J;  4KH1 B;  1T0H A;  2CRE A;  4FYX B;  1VYT A;  4XU2 A;  3CBP A;  4BDY A;  1VQO A;  1RI9 A;  1VQK Q;  2A36 A;  4ORZ A;  2ZAE A;  1N8R R;  3L2R A;  3SD4 A;  4HKE A;  3I55 T;  1NE8 A;  1M1F A;  1YIT T;  5GAN 6;  3LLR A;  1M30 A;  4CC4 B;  4C0G A;  2NUP B;  2DXB A;  5LJ3 e;  2LQ8 A;  2RO0 A;  1FWZ A;  1O9S A;  4FM4 B;  2JN0 A;  2HKN A;  3CCR T;  3BDL A;  4JLG A;  2M0Y A;  1G3Y A;  4AMC A;  1VOM A;  3VS5 A;  2LCS A;  2P4T A;  4PJJ A;  4WTO B;  1VQ4 Q;  1Z9Q A;  5GMK i;  1F1B B;  2FZC B;  2PVO B;  2NUP A;  5A0D A;  4NL2 A;  3CCJ A;  2V8J A;  2X3W D;  3QPH A;  3OA6 A;  3NTK A;  3L2Q A;  5KYU B;  2WSF E;  2DO3 A;  4LE9 A;  2K9G A;  2YT6 A;  4C8Q B;  3CC4 A;  3TU4 K;  4C5H A;  1LPL A;  3UAT A;  3DKM A;  1NLO C;  2QQR A;  2CP7 A;  4PJM A;  4OB0 B;  3BW1 A;  3KBG A;  4AT1 B;  4E7K A;  1QVG P;  1K8A U;  1BI3 A;  1YFN A;  2E41 A;  4E7S A;  3BDU A;  3PFS A;  3EFO A;  4PLI A;  3LW5 E;  3PMI A;  5LJ5 h;  2PTK A;  3EFS A;  2FRW A;  2EGC A;  3RBB B;  1TUC A;  4MMK A;  1Q82 C;  4C92 G;  5GAN 8;  5GAM g;  1Q81 C;  5GAN g;  5GAO l;  3SB2 A;  4M77 G;  4A4H A;  2Y4X A;  2YRV A;  1OZ2 A;  3CEY A;  3UWN A;  2FL7 A;  3A8G B;  5GMK l;  1HK9 A;  1QVG A;  4ZTF A;  1OPL A;  2D8H A;  4F14 A;  3VS4 A;  1VQ9 A;  2A0F B;  4PJO A;  2RQU A;  4A4F A;  4JRI A;  2KY9 A;  2YRD A;  2XU8 A;  3QII A;  3FDR A;  3TSZ A;  1U1S A;  3CQT A;  4JJC A;  4ME7 A;  1NYG A;  2QG9 B;  3E2U A;  4KGX B;  1WX6 A;  4N0A A;  1R8O B;  4LUE A;  3TCJ A;  2DL5 A;  5M9O A;  3DLM A;  2X51 A;  4BI4 A;  5L8R E;  1QWF A;  1VQ6 Q;  2CP0 A;  2DZ9 A;  1W2B P;  3CME T;  3P8H A;  1YP5 A;  2L3P A;  2KYM A; 
#chains in the Genus database with same CATH homology
 3JV3 A;  2H8H A;  2K3B A;  4AG1 C;  5IXF A;  4D8D A;  3IQL A;  2DA9 A;  1SPK A;  3EHQ A;  2K2M A;  3UA7 A;  1HSQ A;  2J7I A;  2K6D A;  4DEX A;  3I5S A;  1K76 A;  2GBQ A;  2BZY A;  2KXC A;  1W6X A;  2E5K A;  1T0J A;  2DRM A;  2F2X A;  4RTY A;  2HDA A;  1M27 C;  2JXB A;  1UTI A;  1TG0 A;  2CSQ A;  2QDL A;  1N5Z A;  2O9V A;  1K0X A;  4JJD A;  2ED0 A;  1K0S A;  2C0I A;  5L23 A;  2JMC A;  1WA7 A;  1HD3 A;  1QCF A;  2V1Q A;  2LJ0 A;  1BB9 A;  1GBQ A;  3UA6 A;  3QWY A;  2KR3 A;  2AKL A;  2KRM A;  2RQR A;  1GFD A;  1H3H A;  2AZS A;  2O2O A;  2FO0 A;  1AWX A;  4HVV A;  2DL8 A;  2LMJ A;  1G2B A;  1X27 A;  1UHC A;  2ESW A;  2FEI A;  2EPD A;  3VS6 A;  4JZ3 A;  2BTT A;  2DIL A;  5GJV B;  2SRC A;  2FPF A;  5FW9 A;  2EYW A;  2FPE A;  1QKW A;  1B07 A;  4RUG A;  3ULR B;  4JPB W;  1E7O A;  3TVT A;  1EFN A;  2EGE A;  2EBP A;  3M0R A;  1X43 A;  1GRI A;  2A28 A;  1MV3 A;  3VS2 A;  1SRL A;  2O31 A;  1X6B A;  1FYN A;  2V1R A;  1WYX A;  2LQW A;  1NEG A;  2AKK A;  2L3Q A;  3U23 A;  4CC3 A;  1UDL A;  3QWX X;  2O9S A;  1PWT A;  2EKH A;  1WI7 A;  3SHW A;  2CT3 A;  1SEM A;  1X2Q A;  4OMP A;  2KT8 A;  1YWO A;  4D8K A;  2K7A A;  2YUQ A;  4OMN A;  1M3A A;  4J9G A;  4CC7 A;  3KFV A;  2LX7 A;  1PRL C;  3PE0 A;  1M3B A;  1M3C A;  2CSI A;  1I0C A;  3LH5 A;  4JJB A;  2KYB A;  2J05 A;  3PVL A;  4ESR A;  1W1F A;  1J3T A;  2ROT A;  1T3S A;  1YN8 A;  1JXO A;  2KRS A;  1YNZ A;  2J06 A;  4F16 A;  2JS2 A;  1WIE A;  4J9D A;  1MV0 B;  2DBK A;  1UUE A;  2XMF A;  2F2V A;  1JO8 A;  1UHF A;  2JTE A;  1ZBJ A;  2DMO A;  5FWB A;  2HSP A;  1OEB A;  1G83 A;  2EQI A;  2PZ1 A;  1JQQ A;  4Z8A A;  2L3S A;  1YCS B;  2DRK A;  4AFS C;  3VS3 A;  2YUP A;  5I22 A;  2DLP A;  2J6O A;  1M8M A;  4HVW A;  1NEB A;  1OV3 A;  1X69 A;  2C0T A;  1GBR A;  2RF0 A;  1ABO A;  2ABL A;  2DBM A;  2B86 A;  2HBW A;  1WDX A;  1A0N B;  1ZUU A;  2K79 A;  2CDT A;  2GGR A;  3I35 A;  1ZX6 A;  3SEM A;  1E6G A;  1UGV A;  2DF6 A;  1K9A A;  2VVK A;  2RPN A;  3UF4 A;  2HEQ A;  2CH4 A;  3PVQ A;  4QT7 A;  1H92 A;  1UG1 A;  1XOV A;  2DJQ A;  1UE9 A;  1AWO A;  4J9H A;  2ED1 A;  1QLY A;  2YUN A;  1NLP C;  2EVR A;  2KNB B;  1UFF A;  1AEY A;  4J9F A;  1PKS A;  3A98 A;  4GBQ A;  1HJD A;  1RLP C;  1WXT A;  2NUZ A;  3REA B;  2A08 A;  1UEC A;  2RQT A;  2ENM A;  2LJ3 A;  1PHT A;  3REB B;  2D0N A;  4IIM A;  1VA7 A;  4M4Z A;  2F2W A;  2IIM A;  3H0H A;  2YDL A;  1KJW A;  1Z9Z A;  2KBT A;  1AWW A;  2DYB A;  3I5R A;  4WCI A;  4OMQ A;  1PNJ A;  2VKN A;  3VS7 A;  2KEA A;  2DM1 A;  2CUD A;  2MCN A;  1CKA A;  2OJ2 A;  1KIK A;  2HCK A;  2JM9 A;  2YSQ A;  4EIK A;  1Y57 A;  1CSK A;  4AFU C;  2MOX A;  1MUZ A;  2PNI A;  4OML A;  1H8K A;  1S1N A;  4HXJ A;  2SEM A;  3EG1 A;  1VYV A;  1ZSG A;  2RQV A;  1U06 A;  2L0A A;  1WFW A;  4R0K A;  5EC7 A;  2RMO A;  1GCQ C;  2FG0 A;  1YWP A;  4RTT A;  4Z88 A;  2W0Z A;  3NGP A;  1KFZ A;  2BZ8 A;  1TUD A;  2FPD A;  2KRO A;  4J9E A;  1BK2 A;  1Y0M A;  1OPK A;  4FSS A;  4LNP A;  1LCK A;  2RQW A;  1ZLM A;  2JS0 A;  2J6K A;  3M0T A;  2LNH B;  2KT1 A;  2CH4 W;  1JEG A;  3VRZ A;  1JU5 C;  3EGU A;  2D8J A;  1AOJ A;  2JW4 A;  3O5Z A;  5HCK A;  2RN8 A;  2JM8 A;  4K11 A;  1I07 A;  3TSW A;  1VYU A;  1BU1 A;  4JZ4 A;  2GQI A;  2DX1 A;  1JXM A;  4DEY A;  3H41 A;  2DE0 X;  2W10 A;  5IHK A;  1I1J A;  4IIO A;  2JMA A;  2EYX A;  4AFQ C;  1T0H A;  2CRE A;  2C0O A;  1VYT A;  2CUB A;  2A37 A;  1RI9 A;  2A36 A;  1AD5 A;  5IHI A;  1RUW A;  4ORZ A;  2BZX A;  3NPF A;  1X2K A;  2GTJ A;  2RNA A;  1X6G A;  1PRM C;  1M30 A;  3VS1 A;  4CC4 B;  2EYZ A;  4RTX A;  2DNU A;  4F17 A;  2GTO A;  2I0N A;  1E6H A;  2VWF A;  4RTW A;  1SHG A;  1GL5 A;  3EG3 A;  3NHN A;  1NM7 A;  2M0Y A;  3M0P A;  3VS5 A;  2AZV A;  1KSW A;  1K4U S;  1U3O A;  2LCS A;  3EHR A;  3R6N A;  1Z9Q A;  4X1V A;  2L2P A;  3M0S A;  1QWE A;  2O88 A;  1NYF A;  2LP5 A;  2ROL A;  4GLM A;  1WXU A;  5IXB A;  1SHF A;  2JT4 A;  3M0U A;  1ZUY A;  1AWJ A;  4AFZ C;  2X3W D;  3C0C A;  1OOT A;  4LE9 A;  2EYY A;  2K9G A;  3VS0 A;  2YT6 A;  2LJ1 A;  4CC2 A;  3RNJ A;  1W70 A;  3UAT A;  1NLO C;  4HVU A;  1AVZ C;  2MIO A;  1GCP A;  2KGT A;  4RTU A;  3GBQ A;  5GJW B;  3VRY A;  2NWM A;  1QKX A;  4OMM A;  4OMO A;  1FMK A;  3THK A;  2OAW A;  2AK5 A;  3ZL7 C;  1IO6 A;  2ECZ A;  1AZG B;  1U5S A;  1WXB A;  2PTK A;  1RLQ C;  4RTV A;  3I9Q A;  4ZNX A;  5ECA A;  1BBZ A;  2FRW A;  2P4R A;  2EGC A;  3RBB B;  1TUC A;  1T3L A;  3H0F A;  3EG0 A;  4KRT A;  2DVJ A;  4LN2 A;  2LQN A;  2X3X D;  2DL4 A;  3H0I A;  4J9B A;  1CKB A;  1PKT A;  1SSH A;  2KRN A;  5FWC A;  2KE9 A;  1ARK A;  2DL3 A;  4E6R A;  1K1Z A;  2EGA A;  2G6F X;  1UJ0 A;  1AZE A;  3EG2 A;  3FJ5 A;  3M0Q A;  1OPL A;  2D8H A;  4F14 A;  3VS4 A;  1ZUK A;  2RQU A;  1B3Q A;  5IHN A;  2KXD A;  1GCQ A;  2M51 A;  1NG2 A;  2OI3 A;  3TSZ A;  2FRY A;  1ABQ A;  3CQT A;  4JJC A;  5I11 A;  2D1X A;  4Z89 A;  1UJY A;  1NYG A;  2CT4 A;  2LZ6 B;  1WX6 A;  4LUD A;  2YUO A;  1SRM A;  4HCK A;  1WLP B;  1V1C A;  4LUE A;  2J6F A;  2GNC A;  5IH2 A;  2DL5 A;  4AG2 C;  4RTZ A;  2DL7 A;  1QWF A;  4J9C A;  2EW3 A;  4A63 B;  4J9I A;  3NMZ C;  4Y92 A;  1YP5 A;  2L3P A;  2KYM A;  1GFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...