3NGPA

High resolution structure of alpha-spectrin sh3 domain mutant with a redesigned core
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPRELTVKKGDILTLLNSTNKDWWKIEVNGRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of an alpha-spectrin SH3-domain mutant with a redesigned hydrophobic core.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ngpA00
2DL5A 2P4RA 2F2XA 4IIMA 1UECA 1H92A 1UGVA 1UTIA 4GLMA 2C0TA 2GNCA 2FRYA 2EKHA 4LN2A 2L0AA 2DL7A 5FWBA 2BZYA 2J06A 1AEYA 1PRLC 4JPBW 2FPFA 1GBQA 5HCKA 2KXCA 2DILA 1WXBA 2OJ2A 2X3WD 2FPEA 2I0NA 2KRSA 1KSWA 4JZ3A 1K4US 1OEBA 2LMJA 1UE9A 2YUNA 1NYGA 1X43A 2KT8A 1WDXA 3UA7A 3O5ZA 2J6KA 3NPFA 2EW3A 2M0YA 3PE0A 1WXUA 1FYNA 1TG0A 1HSQA 2HDAA 4RUGA 2LCSA 2YUQA 4OMLA 2KR3A 3PVLA 4Z8AA 2EPDA 2GTJA 4RTVA 4F16A 2DM1A 2YSQA 2CDTA 4M4ZA 2CH4W 2DL8A 3M0PA 2JTEA 2RQVA 2L3QA 1GCPA 4F14A 2D8JA 3IQLA 2CH4A 2LZ6B 3H0FA 2XMFA 4DEYA 2ED0A 1U06A 1IO6A 1VYVA 1W70A 1PNJA 3VS0A 1UHFA 1PHTA 2OI3A 2JS2A 4AFZC 2L3PA 2DBMA 1AWWA 1I1JA 1MV3A 2CSIA 3SEMA 3LH5A 4CC7A 3EG2A 2K6DA 2EYXA 2LQNA 2CT3A 3A98A 3I9QA 4J9GA 3EG3A 2KBTA 1PKTA 2EYZA 2D1XA 1WLPB 1GCQC 1OPLA 2K3BA 2EGEA 1T3LA 2A37A 4F17A 1TUDA 1NLOC 2DBKA 2IIMA 1G83A 1M3AA 1QWFA 3VRYA 2KYBA 4Z89A 2ABLA 1GRIA 2L3SA 1ARKA 2EVRA 2LJ3A 4CC3A 3THKA 1T0HA 3NGPA 2A28A 1ZLMA 4RTTA 2D0NA 1NM7A 4WCIA 1SRMA 1E7OA 1KIKA 1PWTA 2J6OA 4HVWA 3VS7A 1VYTA 1I0CA 2EBPA 5I11A 2D8HA 2ESWA 4JJBA 2DF6A 1K1ZA 3R6NA 1JXOA 1UFFA 2K2MA 2LP5A 1VA7A 4ORZA 2DYBA 1PRMC 2DJQA 3M0TA 2ROLA 2JW4A 4J9CA 1T0JA 1JEGA 1JQQA 2L2PA 3RBBB 1ZX6A 1WXTA 4J9HA 2HSPA 1NEGA 4JZ4A 2LJ0A 1ZUUA 1SSHA 1YWOA 1UDLA 2O9VA 5GJWB 4J9BA 1ABOA 2DRMA 4RTWA 1NG2A 3M0QA 3VS3A 4RTZA 1CSKA 2CUDA 1NEBA 1BU1A 3TSWA 2KXDA 2GQIA 2PZ1A 1YP5A 4GBQA 2VWFA 2SRCA 3NHNA 2AZVA 1ZUYA 2J05A 4OMMA 3NMZC 2EGAA 1GFCA 1N5ZA 2KYMA 2VKNA 5IH2A 4D8DA 1S1NA 2O2OA 3I5SA 4A63B 3EHRA 3CQTA 2O88A 2CREA 1X27A 3VS4A 2O9SA 1AWJA 1B07A 4LUDA 4JJCA 2K9GA 1TUCA 2KNBB 2YT6A 1ZBJA 2KRMA 2CSQA 4HXJA 1XOVA 2PTKA 1KJWA 2NWMA 1Z9ZA 2YUPA 1WFWA 3QWYA 4ESRA 1VYUA 1YWPA 1WYXA 4HVVA 2JMAA 3EG0A 1JO8A 2BTTA 2EGCA 4D8KA 1Y0MA 2KGTA 1K76A 1BK2A 5IHNA 2GTOA 2HEQA 1K9AA 1X2QA 1HJDA 5IXBA 2FO0A 1M27C 3JV3A 2A08A 1AZEA 1GBRA 1QWEA 1SEMA 2F2WA 5IHKA 2PNIA 2HCKA 1X6GA 4J9EA 4Z88A 3VRZA 3H0IA 1SHGA 2YUOA 1GL5A 2J7IA 2VVKA 1JU5C 1M8MA 5FWCA 5GJVB 1UG1A 1K0SA 1UJ0A 2YDLA 3ZL7C 3SHWA 5FW9A 2RPNA 1QKXA 4LUEA 4ZNXA 2C0OA 4R0KA 2JT4A 2DNUA 1AVZC 2H8HA 3REAB 2MIOA 4X1VA 2EYWA 2SEMA 2AKKA 1M3CA 1GCQA 1JXMA 4OMQA 1EFNA 2RQTA 3I35A 1NLPC 1T3SA 2KT1A 3EHQA 4CC2A 4IIOA 2KE9A 3M0RA 3M0UA 2AZSA 1WA7A 4LNPA 2O31A 1WIEA 2RQRA 2ECZA 1UUEA 3H0HA 1B3QA 1QCFA 2LJ1A 2BZXA 2LX7A 4KRTA 2W10A 2HBWA 1CKAA 1WI7A 2C0IA 2CT4A 1J3TA 3UA6A 1I07A 2JMCA 4J9DA 2KRNA 2CUBA 2AKLA 1RI9A 1YNZA 4QT7A 1Y57A 2JS0A 1UJYA 2DRKA 1E6HA 3UF4A 2DLPA 1GFDA 1AZGB 1OPKA 2ED1A 3EG1A 1HD3A 1FMKA 1X69A 4FSSA 1U3OA 2FG0A 2DE0X 1WX6A 2EYYA 1MUZA 1AD5A 2DL3A 4JJDA 3C0CA 2V1QA 1KFZA 1A0NB 2V1RA 3GBQA 1M30A 1MV0B 2JXBA 2BZ8A 3QWXX 2ENMA 1W6XA 1PKSA 3H41A 2RMOA 2MCNA 1RLPC 1X6BA 1W1FA 4HCKA 1H8KA 4J9IA 4HVUA 1CKBA 3TSZA 2EQIA 2FEIA 1UHCA 3VS6A 2F2VA 1H3HA 4J9FA 2DX1A 3KFVA 4OMOA 5L23A 5IHIA 2K7AA 2GBQA 2AK5A 2OAWA 3U23A 1YN8A 4AG2C 4AFQC 1RUWA 1LCKA 2A36A 2DL4A 4AG1C 2J6FA 2X3XD 2B86A 2DA9A 2RNAA 3EGUA 4DEXA 4LE9A 5EC7A 4OMNA 2LNHB 4RTXA 3UATA 2RN8A 1QKWA 1E6GA 2G6FX 1U5SA 2JM8A 3PVQA 5I22A 3I5RA 1K0XA 2ROTA 1AWOA 5ECAA 1BB9A 2E5KA 2DMOA 1QLYA 1ABQA 3REBB 4EIKA 4Y92A 2KROA 3FJ5A 1OOTA 3VS1A 1ZUKA 2FRWA 4RTUA 1Z9QA 4CC4B 4K11A 1AOJA 1M3BA 3VS5A 2W0ZA 2LQWA 1OV3A 2DVJA 1RLQC 2RF0A 3VS2A 2KEAA 2GGRA 1YCSB 2RQWA 2QDLA 1BBZA 3TVTA 4AFUC 1ZSGA 1G2BA 1NYFA 1SRLA 2JM9A 4AFSC 5IXFA 4RTYA 3RNJA 1V1CA 4E6RA 2NUZA 1AWXA 2K79A 1X2KA 2FPDA 1SPKA 2M51A 3ULRB 3M0SA 1SHFA 2MOXA 4OMPA 2RQUA
chains in the Genus database with same CATH superfamily
4C92G 1BIBA 4M7AA 1YHQQ 2HQHA 4XU0A 1UECA 4HA8A 1UGVA 2OX7A 1UTIA 1FX7A 3A8MB 4ZN1A 4LN2A 2L0AA 4O5VA 1TS9A 5A0GA 2DVEA 3CCJQ 3X25B 3G4SA 3QZ9B 3OYCA 3DB4A 1PRLC 2CP7A 3HSBA 5FU6C 2DILA 2KY9A 5HK0A 2FPEA 2KRSA 2RJDA 4C8QA 5CKBA 2FHDA 2CZ7B 3KUFA 3PFSA 3EGXB 2QASA 5LJ3e 4PL6A 1QCOA 1BCMA 2KT8A 1K73R 3CCLQ 1AT1B 3NPFA 4FL6A 2EW3A 2Z0WA 3PE0A 4XTYA 1FYNA 4RMOA 2E12A 1HSQA 2XU8A 1RAGB 2HDAA 4E2FB 4M78A 4RUGA 2DD5A 2KR3A 3JCMd 4Z8AA 4B9XA 1YJNA 2DIGA 4M75F 3SWNB 3CC7T 3CCEQ 2DM1A 2BE9B 4RCCA 1R77A 1Q82R 4TVRA 3KXTA 2CDTA 2JOYA 4FYYB 3QBYA 3PMTA 2R57A 5D6YA 3M0PA 1HYOA 3MJXA 2O01E 2RQVA 2WSCE 3OYBA 1GCPA 2D8JA 3IQLA 3H0FA 4DEYA 3JCMX 3CD6T 1VYVA 1W70A 3NTKA 3VS0A 4O6JA 3LW5E 4WF2A 3UWNA 2RHIA 1AWWA 1MV3A 5GAMh 2QEXT 1WHJA 4PJOF 1ZHIA 1PC0A 1PKTA 2EYZA 3RMQA 1KHIA 4M7DF 2D1XA 4XU1A 3QDFA 4HKEA 4IUPA 3QIIA 3AHUA 5CAIA 3EGDB 2DBKA 5LJ3f 2FZCB 2IIMA 1UB4A 1TXQA 4C8QF 2IPOB 3PNWC 4NL3A 4FIBA 4PJNA 2IG0A 1ARKA 2EVRA 3BFMA 3MO8A 4CC3A 2A28A 3EAEA 1ZLMA 1YJNQ 5GMKe 2K3XA 1PWTA 2ZPEB 2BUDA 2HKQB 3QJYA 2K4YA 4HCBA 5I11A 4JJBA 2DF6A 1JXOA 4FW2A 1LJOA 2LP5A 2JW4A 3G1JA 4J9HA 5LJ3j 3VJPA 1VQOA 2LCLA 2O9VA 1YITA 4J9BA 5I2MA 1NG2A 3QUIA 3VS3A 2CUDA 1YHQT 1NEBA 1NZ9A 1YJ9Q 2GQIA 1K9MR 2V8JA 3LH0A 2AZVA 1ZUYA 4A4GA 1VQMA 2EGAA 2NLUA 3LYIA 1N5ZA 4RCBA 2DO3A 2O2OA 1LPLA 3L1AA 1Q95G 3GNFB 1WNLA 1PCXA 2CREA 4C92C 2LT4A 3CBPA 1VQ4Q 1B07A 4L6V5 3OS5A 2ZPBB 4QVCA 4JJCA 1TUCA 2YT6A 4ME7A 5IN1A 1UGSB 4NL2A 1YCYA 4N4HA 1Z9ZA 3FRNA 3MP6A 1WFWA 3JCMP 1YWPA 4EMKA 3BY7A 4M7DA 2DKGA 3OS1A 2EGCA 1Y0MA 1YBYA 3QKJA 3TCJA 2F69A 1BK2A 3C4SA 1D1BA 2GTOA 2LQKA 1X2QA 2RH2A 2E6NA 1QW1A 4X34A 4M77G 4RG8A 3TEEA 2MWPA 2F2WA 4CI0C 2HCKA 1X6GA 1K8AU 1RL2A 4DOWA 4F7UF 3VRZA 4N4GA 2HKNA 2P0QA 5FU6B 1GL5A 2J7IA 4XTZA 4C92B 1W2BA 3HHTB 4J8OA 2DXUA 1VQNQ 5IAYA 3ASKA 1UJ0A 3OYAA 5GAN2 1JJ2P 3E9GA 3ZL7C 2RPNA 4ZNXA 3CCSQ 3H8ZA 4JLIA 4OGEA 3CC4T 2QTVA 3EG9A 3FEOA 5GMKj 3SDZA 3WXMB 1MMAA 4LDYA 1W2BP 1M3CA 1V76A 5KYXA 5HK3A 3CCEA 1QP3A 2E1HA 2MPXC 4OMQA 2PVDB 3M9QA 1QCNA 1RI0A 2RQTA 4QVDA 2KQWA 1M9SA 2YRVA 2R5AA 2O4XB 5LJ5f 1NLPC 1T3SA 3CCUA 3EHQA 1M1KC 1OULA 2RI2A 3M0RA 5L8RE 4LNPA 2O31A 3HFOA 1UEBA 2HNIA 3H0HA 4PJLA 4PJOB 2BZXA 2LX7A 4KRTA 5FU7B 2W10A 1QVGS 4OP0A 1CKAA 2LTOA 1VQ5Q 3M58A 2F5TX 4J9DA 1JJ2A 2CUBA 5GANd 2AKLA 2VB6A 1UJYA 1ACMB 1E6HA 5GMKh 1AZGB 3OYGA 2RO0A 1U3OA 2XDBA 4HT9A 2QDYB 3OYLA 4MZTA 1AD5A 1VQNA 4BY6B 4KGZB 2YLBA 3HPWA 3QJ6A 3GBQA 2QQRA 3CPWS 1BI2A 2BZ8A 4PJOG 2MK5A 1PKSA 3CCRQ 1M1KR 2E70A 3EG9B 1W1FA 5LL6S 4HVUA 3CMAQ 3TSZA 5LJ5h 2EQKA 2DEUA 5GAMd 3SFMA 2LX9A 2Y90A 3OYMA 2A36A 3INZA 2J6FA 2MMPA 4BB7A 1GXIE 3CC7A 3G7ZA 3CCRT 1E6GA 1K73U 4M75C 3UT1A 1VQ6T 1VQ9A 2A7YA 3NTIA 2ZPGB 2DMOA 2CP5A 4EIKA 1VQ5A 7AT1B 4B6MA 3MEAA 3FJ5A 4C0DC 2K2VA 1OOTA 1ZUKA 2HMAA 2PUKB 4OB0B 4J7IA 1M3BA 1SKUB 3CXCS 2LQWA 1OV3A 3G71Q 1ZA2B 1FWZA 1VQ6A 1ZSGA 1YJNT 1G2BA 1NYFA 2XHCA 1Y96B 5IXFA 4M7AB 8ATCB 1AWXA 3GNGA 2VXEA 2M51A 4IUQA 3CMEA 2JNGA 1LOJA 4OGCA 2M16A 1YIJT 2AIRB 4KGVB 5D7UA 2DL5A 2KSSA 4IIMA 1H92A 4M75A 2EKHA 2VC8A 4M78B 1VQ5T 1AEYA 1G3SA 3CCMT 3OY9A 4JPBW 4NS5A 2VGMA 5HCKA 2KXCA 4MDWA 4FW1A 2OJ2A 2I0NA 4FSXA 4JZ3A 3QHSA 3CC2Q 1VQ9Q 2LMJA 5C6SA 5DLOA 2EAYA 1NPRA 1M2VA 2GFUA 3JCMg 1PM3A 3PMIA 3VV0A 3MP1A 1Y7XA 3CBMA 2P0KA 3RKYA 5CQYA 4BE1A 4M7AF 3PVLA 1VQPT 5GMKi 2EPDA 1VQOT 4M77C 4RTVA 4F16A 4RKUE 1I8FA 2VXFA 2YSQA 1KQSS 5CCAA 3CCVT 2DL8A 3MP8A 3JB9D 2JTEA 5A2QE 1YITT 5GAN5 2ZGWA 5FLXE 1OU8A 4PJOA 2ZCFB 1U06A 1KD1C 2RM4A 1UHFA 1VQOQ 4MZMA 3OW2S 2OI3A 1OX8A 4OVAA 2L3PA 1I1JA 1X75C 3CCUQ 2CSIA 1VQ8Q 3LH5A 3L2ZA 4ELYC 2H3JA 3EG2A 4C8QG 3QG1A 2K6DA 5GAMe 2EYXA 2LQNA 2CT3A 3I9QA 4ELZC 2JN0A 4BI8B 1KK7A 1KHCA 1WLPB 3QXEB 4DQ2A 1SSFA 1TUDA 3DLLA 1Y71A 2RHXA 1G83A 1Q81U 4M7DG 4Z89A 1QVPA 1PD1A 2QQSA 2HSEB 2QA4A 3H6ZA 4JJNK 2QEXA 5GAOn 1QVGA 4X9CA 5CKEA 2LJ3A 3T9NA 5CIUA 3THKA 4RTTA 2D0NA 3VU3C 3HRSA 2L3RA 4WCIA 4M77A 1SRMA 1VQKT 1E7OA 2KMTA 1VQKQ 1QQJA 4HCCA 4JS4A 3J7AF 3VS7A 1VIEA 2P0PA 4QKUA 4PK4A 3ZBDA 4E7JA 5KYYA 3L2VA 1M2OA 3OS0A 1BI1A 4II1A 4X9DA 1K8AC 1ZA1B 2DYBA 2DJQA 3M0TA 2ROLA 2OTLT 1JEGA 4ZGDB 2XKOC 3RBBB 1IZ6A 1WXTA 1KQ2A 1NEGA 2LJ0A 1O75A 3BW1A 3V7CA 3CCQQ 5GJWB 1VQKA 1TWBA 4EMGA 4JLGA 4DBRA 1D09B 2PVOB 4IUTA 3TSWA 5CR2A 3QO3A 1IGQA 3OYJA 3C94A 2R58A 2PZ1A 3MEWA 3CC4A 1YP5A 4M78C 2SRCA 3NHNA 4XTXA 4OMMA 2HD0A 3A8OB 2DD4A 3M55A 5GMKm 1GFCA 1I81A 5IH2A 4D8DA 2QAZA 3I5SA 4A63B 3D7SB 5D6WA 2A3LA 1X01A 2O88A 3CCJA 4XAXB 1AWJA 2GCXA 2K9GA 1M5Q1 3ER0A 2P84A 3RMSA 1YITQ 4OB2B 2OTJQ 5GANj 1D3BB 3CC4Q 4HXJA 2DJZA 2DZCA 4M75E 1H3ZA 3OYDA 4M7AE 1VYUA 1WJRA 4PNOA 2JMAA 2BTTA 1N6AA 1WHGA 3GOXA 2MWOA 3JCMW 2ZPHB 2EWNA 3J81E 2VUBA 2KGTA 2E4HA 2OAUA 2FVUA 1G8XA 1HJDA 5IXBA 2FO0A 2RD1A 3M56A 5GMKl 2JZ2A 4D6WA 1M90C 4N0AA 2YWWA 4QW2A 1Q86R 2D6FA 4J9EA 2KDSA 1UGPB 4C5HA 2QG9B 3RKWA 1LNXA 3H0IA 1M2VB 2YUOA 2ZPFB 4JRKA 2QGFB 5GJVB 3O8VA 1IREB 1UG1A 4C8QE 1K0SA 4FM4B 3GP8A 3VYHB 3SHWA 3FC3A 3OYFA 2C0OA 3CCLT 4R0KA 1RAFB 1OI1A 2ZZDA 4AMCA 4M78G 3CCET 3WVDB 5KYWB 5LJ3d 1U1SA 2SEMA 4IKFA 4PJOE 1PSFA 3MHXA 2VV5A 2ZPIB 1JXMA 3V8LA 1VQPA 1D3BA 4CC2A 4C0DB 4V2SA 3HKSA 5DLQE 5GAN7 3CCSA 1D1CA 2AZSA 1WA7A 1R0CB 1WIEA 2ECZA 1WPYA 4LDWA 1Y96A 1QCFA 1WGSA 3VUBA 3G4ST 1M90U 4CRIA 2XI9A 2XD0A 5GANh 2EQUA 3E19A 1XJWB 2M0OA 2DYIA 3UF4A 1WJQA 1GFDA 5GAOm 1D1AA 3EG1A 1HD3A 1NE8A 4FSSA 5FROA 1ZQ1A 2EYYA 1P92A 1MUZA 2M9UA 4JJDA 3DB3A 4JRIA 3VYGA 1A0NB 4MDXA 1M30A 4QQGA 5GAOq 4FT2A 4AT1B 3HL8A 1WHKA 3QWXX 2QA4Q 2ENMA 3M53A 4JS5A 5LJ5e 1CKBA 4C8QB 3CPWA 3E2UA 2FEIA 1UHCA 1IHWA 1H3HA 3PIOA 3KFVA 5GAN3 3JB9F 2R5MA 1BI0A 1VUBA 4M7DB 2NUTB 1RUWA 4M77D 3M4GA 4E7KA 4KH0B 5CK9A 1VQ4A 1VQMT 2DA9A 4UC4A 4PFPA 3M4YA 4N0AC 1UGQB 5LJ3h 4GY5A 3CCMQ 2JM8A 2V26A 3PVQA 5I22A 1IHVA 3OMGA 3P8DA 3CMAA 5ECAA 1BB9A 3LWHA 1QLYA 2OTJA 3META 1MNDA 4BDYA 4Y92A 4MZPA 3VS1A 2HQEA 2FRWA 2CZ1B 4RTUA 2D9TA 2E3IA 2CYZB 4F7UG 2QQ9A 3VS5A 2YRCA 2W0ZA 2E5QA 5DM7R 3OYYA 2DVJA 3OYHA 2X4XA 4XU3A 4DBHA 4NOYA 4R56A 4M75G 5I2SA 4LXCA 4AFUC 4M75B 2JM9A 3JCMQ 4KUDK 1K8AR 3G6EQ 3FJPA 3CPWP 1MMGA 1V1CA 1X2KA 4HCZA 3OSSC 3NFCA 3ULRB 3QSUA 3OYNA 1SHFA 3M54A 3MKDA 2DFUA 1C0MA 5J26A 4EDUA 1FMVA 1DJ7B 1H641 2P4RA 2F2XA 3CEYA 5D6XA 4LDXA 3JCMV 4KT0E 4GLMA 2C0TA 2FRYA 1KQSA 5FWBA 2X4YA 2BZYA 2J06A 2CZ0B 4GLKA 4VUBA 1WQWA 1GBQA 1XTDA 1VQ6Q 1Q81R 3CCST 3JB9I 3G6EA 1QVFP 1KSWA 4ZN3A 1K4US 1UE9A 4KH1B 3A5ZB 2JUFA 4E7LA 1YIJA 1X43A 4C92A 3CBOA 3X26B 1N27A 3UA7A 2J6KA 2COYA 2QEXQ 2M0YA 1WXUA 1TG0A 1KD1U 2JJ9A 2VYTA 4OB1B 4C8QD 2LCSA 2JTMA 4OMLA 1WHHA 5FRMA 3RERA 2GTJA 3JAME 2QI2A 4F7UE 1BCOA 2CGHA 3HRTA 4EMKB 2CH4W 2FZKB 5GAN6 1KQSP 4DA4A 4PJOD 2DTHA 1PSEA 4E7IA 2L3QA 3LGFA 4QQ6A 1YIJQ 4FT4A 1JB0E 2LZ6B 3OYIA 3NTHA 1Q81C 2ED0A 5I21A 1IO6A 1PNJA 1D0ZA 4OMFB 4J7FA 4J6YA 3M59A 3UPUA 3WVEB 2JS2A 1ZBXA 3J80E 3OB9A 2DBMA 4BUGA 4ZGJB 1M1KU 2KI7A 1OYXA 4CC7A 1AHJB 5CO7A 5C0MA 2MYSA 1D0XA 1PG5B 2RJFA 4OF1A 3A98A 3EG3A 2KBTA 2DIQA 1Q7YR 3MCAB 3HRUA 1OPLA 4M7DE 2K3BA 3CPFA 4F17A 1IXDA 4YTLA 2KAFA 1M3AA 3VRYA 4A4FA 2KYBA 2LRQA 1GRIA 5KYUB 3L2UA 2L8DA 5KCOA 9ATCB 2O4XA 1WJSA 4EMKC 4Q5WA 1T0HA 2DK3A 3OA6A 1MNEA 1OZ2A 2GFAA 1KIKA 4HVWA 4BE0A 1VYTA 5EG2A 3HFNA 2D8HA 2ESWA 1UFFA 3JCMc 1G3TA 1VQPQ 4ORZA 1PRMC 2QK0A 4J9CA 1JQQA 2L2PA 3EFRA 1G5VA 3M5AA 3CCUT 1VQLA 4JZ4A 1ZUUA 3BDUA 4ZTJA 1I5LA 3G71T 4L59A 1YJ9A 2P4TA 1N8RR 2DRMA 1EZZB 4M7DC 4RTZA 2LQ8A 2Y4XA 4XTWA 5KYUA 4KGXB 2BKDN 1BU1A 1W4SA 2FB7A 4OB3B 1K73C 5IT9E 2VWFA 2NUPB 2CP6A 1KC8U 2XK0A 1YJWT 2VKNA 2KYMA 3S3MA 1I4K1 3CQTA 4P5NA 1S72Q 1M1FA 3VS4A 5A0LA 1SG5A 2JTFA 1IB8A 1BIAA 4FCYA 1ZBJA 2CSQA 3E9FA 2CP3A 2PTKA 3JCMb 1KJWA 2NWMA 3FDRA 3VKIA 2YUPA 3H9NA 4KULA 3QWYA 4ESRA 3JB9J 2DXBA 3X28B 4HVVA 1QMCA 1JO8A 2IVWA 4M7AC 4D8KA 3S3OA 3EFSA 3X24B 3JCMf 3I56T 5J39A 1K9AA 1EIFA 1QP2A 2QXFA 1GBRA 2EKOA 5KYYB 1V29B 2XG8D 1SHGA 4FYVB 2VVKA 3RIRA 1M8MA 5FWCA 3CCJT 2YRDA 2QQAA 5LJ5d 2YDLA 4BY6C 4JDSA 4Y91A 4LUEA 3AT1B 3G71A 1OU9A 2JT4A 5KYXB 2FL7A 4ATOA 2H8HA 4PJOC 3I55A 3QPHA 4C5IA 4BD3A 4X1VA 2AHJB 2E64A 2AKKA 1W2BS 3PIPA 2DZ9A 2LVMA 1GCQA 5CVIA 4BE2A 2PQWA 1TSFA 2CKKA 3I35A 3QDRB 2CZ6B 3QYGB 3VUZA 2BIVA 2KT1A 4XQ3A 1RABB 4IIOA 1RAEB 2B8AA 1LVKA 3M0UA 2RQRA 5GANg 1OQKA 4Z02A 4BDZA 1B3QA 1VQNT 6AT1B 3RESA 4E47A 5GAMj 1MMDA 1BKBA 5GANe 2C0IA 1VQLT 3FIFA 1Q82U 5J3BA 5CKHA 1RI9A 4QT7A 1Y57A 2JS0A 4C0FA 3JRZA 1Y07A 3CD6Q 3L2QA 5AT1B 2DLPA 4EPCA 2X51A 1OPKA 2ED1A 1FMKA 2LNVA 2FG0A 2DE0X 2DL3A 3C0CA 2K5LA 5CKFA 2V1QA 2X9HA 3GIBA 1KFZA 3X20B 8AT1B 1RADB 4PLIA 3JB9G 2JXBA 4DBQA 1TH7A 4M78E 2M1HA 1YJWQ 3V8KA 4DBFA 2QGGA 2EYQA 2MCNA 3L42A 1RLPC 1QVGP 2X4WA 3CD6A 3OS2A 4J9IA 1B7TA 1NJIC 1N9SA 3VS6A 2F2VA 3GF5A 2DX1A 2RJEA 4FU6A 5L23A 5IHIA 3L2WA 2K7AA 3HP9A 1K9MC 2GBQA 2AK5A 3ME9A 1NBEB 5LJ3g 4LD6A 4AFQC 1TUGB 1LCKA 1BYMA 4A4EA 1Q7YC 2CP2A 2X3XD 2RNAA 3EGUA 1YJWA 4DEXA 4LE9A 4RTXA 1QKWA 1FXXA 1ZSZB 3FB9A 4C0ZA 3CCVA 4A4KA 2MF2A 1PD0A 4M7AD 3GLXA 4CC4B 1Z9QA 5KCHA 2C06A 2E10A 3HTRA 1WHLA 4LDVA 1KG1A 1VQ9T 5AYFA 1NJIR 2GGRA 1BBZA 3TVTA 3CCVQ 3JCMe 1QVFS 1Q86U 3OYKA 1SRLA 3CMEQ 3JCMh 4J5YA 4RTYA 3LGLA 4E6RA 3Q1JA 2VGNA 5GAOl 2K79A 2LCCA 4MMKA 3M0SA 1TTHB 4Y28E 1N8RC 1MHNA 1K9MU 2GNCA 4IUVA 2DL7A 1Q7YU 4IUUA 2QQBA 1KQ1A 2VASA 3P8HA 1YI2A 2FPFA 3ZEHA 3TREA 4PJJA 1WXBA 3CCQA 3BDLA 3G4SQ 2X3WD 4J6WA 2EQMA 1YJ9T 3EGXA 1OEBA 1I5OB 3LWIA 2FZGB 4J6XA 2EJGA 3RR6A 2YUNA 3S6WA 1NYGA 2DETA 2MI6A 2XDPA 1B34B 1WDXA 1WHMA 3O5ZA 2BE7D 2A0FB 1ZSZC 2EIFA 2F5KA 1IGUA 2HL5C 3OMCA 2YUQA 1M90R 1Q86C 5CQXA 1R8OB 3G6ET 3OW2A 3R6OA 3F70A 4M4ZA 4C92D 2PVGB 2GF7A 1TOVA 3BE3A 5GANf 2NUPA 4QQDA 4F14A 2EFIA 2CH4A 5A0DA 2XICA 4E7SA 2XMFA 2E6ZA 1U8RA 3CCQT 1SF9A 4BACA 3MPUB 1PHTA 4AFZC 3A1PA 3M57A 1KC8C 5GAN8 1YI2T 3SEMA 5M9OA 2COWA 4C5GA 3TU4K 5KH6A 1VQ4T 4J9GA 3GPLA 4XTUA 1VQ8A 2V8KA 2K57A 1GCQC 4IURA 1U1TA 2HBPA 3PGGA 5GAOr 2EGEA 1T3LA 2A37A 1NLOC 1QWFA 4M77E 2K5FA 1M8VA 2ABLA 2V8IA 4EMHA 1B34A 2L3SA 4KBMB 3RKXA 3PTAA 3CC7Q 1C6VX 1XQHA 3OYEA 2RHZA 2X4JA 4LD9K 3LX7A 2DXTA 3NGPA 3CCMA 4JRQA 1M4ZA 3EH1A 3OQ5A 2PUOB 1NM7A 2J6OA 3RDVA 2DEQA 2DTOA 1I0CA 3A8LB 2EBPA 2Y4YA 5KYWA 3R6NA 1K1ZA 2K2MA 3CMET 2ATCB 1VA7A 2WSEE 4R55A 4MMLA 3SD4A 1T0JA 4BI3A 2X35A 3EFOB 1QVFA 1ZX6A 2CP0A 2HSPA 1VQ7Q 4C8QC 1SSHA 1YWOA 1UDLA 4JRPA 1MMNA 1ABOA 3CXCP 4RTWA 1VIFA 3M0QA 2OTLA 1CSKA 5GAN4 3LLRA 1RACB 2K3YA 2KXDA 3MEVA 4FYXB 1VQ8T 2DXCA 2E3HA 3V7SA 4GBQA 2M02A 2J05A 3NMZC 1JJ2S 4C92E 4RG2A 1S1NA 3FLGA 3TQ7P 3EHRA 2EQJA 2NUTA 4XK8E 1RAIB 1X27A 2COZA 2O9SA 2RA2A 2RK2A 4LUDA 4XU2A 2CS7A 4N4IA 4B9WA 2KNBB 3V8JA 2D0QB 2RK1A 5FRNA 2KRMA 2HQXA 5GAOp 1XOVA 2YLCA 3PT9A 1BI3A 4A53A 1JBMA 2YHTA 1WQ7A 3EGDA 1KD1R 1VOMA 1WYXA 1Q82C 3EG0A 3SWNC 3E1SA 2HAXA 4QVZA 2I2LA 1S72A 2EJFA 3A8GB 1K76A 3MEUA 5IHNA 2HEQA 1M27C 1TU0B 3JV3A 2A08A 4PKCC 1AZEA 3CC2T 2ZAEA 5FU7C 1QWEA 1SEMA 5IHKA 2PNIA 3CCLA 1IRXA 4PFOA 3QYHB 3RUXA 2YXYA 4Z88A 1UGRB 4M77F 1RAAB 2L89A 1JU5C 2DTIA 2K5IA 4XTVA 4E7HA 3I56A 2LT1A 3C95A 1WZOA 3EFOA 1G3YA 5FW9A 1QKXA 4F7UA 2WSFE 2L5QA 4JUVA 2DNUA 3CC2A 1AVZC 1YFNA 3REAB 2E65A 3A8HB 2MIOA 1HK9A 2EYWA 4HT8A 3S3NA 1VQ7T 1NPPA 3OW2P 2KK4A 1MGQA 1C1AA 4M7DD 2H3EB 4M77B 1EFNA 1M1GA 5HKCA 5CKDA 1FMWA 2KE9A 4BI4A 3I56Q 1D0YA 2RHYA 4LDUA 3I55Q 1UUEA 5KE3A 3I55T 2RI3A 1R0BG 3C12A 1F1BB 2LJ1A 2DPPB 2QYZA 3CCRA 2HBWA 1WI7A 1RAHB 2CT4A 1J3TA 2LC4A 3UA6A 1I07A 2JMCA 1NJIU 2KRNA 1YNZA 5KE2A 1JRIA 2DRKA 2QTXA 1X69A 4WTOB 1WX6A 4M7AG 1O9SA 2E41A 3CXCA 4PFZA 2EJ9A 1N8RU 2HL3A 2V1RA 4J83A 4A54A 1MV0B 2MAMA 4KUIA 2PU9B 1ZSZA 3P8BB 1HXDA 2GQVA 2WACA 4L5GA 1W6XA 3H41A 4C92F 2RMOA 3URGA 1X6BA 4HCKA 1H8KA 2OTLQ 4DOVA 3QZ5B 4F7UB 3OBWA 2DAQA 1KC8R 2EQIA 2XIDA 4J9FA 2RB6A 3ZFJA 4OMOA 3JCMJ 2OAWA 3U23A 1YN8A 4AG2C 1OZ3A 4F04B 2DL4A 3CMAT 4AG1C 4E7ZA 1YI2Q 5GAMg 2B86A 2RJCA 5EC7A 4OMNA 2LNHB 5LJ5j 3UATA 2DERA 2RN8A 2AT1B 2G6FX 1U5SA 2G3RA 2FYKA 4ANJA 3I5RA 1K0XA 1VQ7A 2ROTA 1AWOA 2E5KA 3V7RA 1XNIA 1ABQA 3REBB 4A4HA 3OSVA 4M75D 4M78F 3JSCA 4PJMA 5KYNA 2KROA 2KVQG 2LDMA 3SWNA 2QA4T 3JB9H 3N5BB 5GAMf 4K11A 1AOJA 2OTJT 2RHUA 3EH2A 4ZTFA 1RLQC 2RF0A 4C5EA 4PLLA 2F1LA 3VS2A 2KEAA 4ZGEB 1YHQA 1X6OA 2HZYA 1VQLQ 1YCSB 2RQWA 2QDLA 5LJ5g 1G3WA 2NYSA 4C0GA 3DLMA 1EX4A 3DKMA 4FYWB 4AFSC 1N9RA 3UDCA 1S72T 3RNJA 3L2RA 2NUZA 3SB2A 3KBGA 1OX9A 2JVVA 2RI5A 5HY6A 2XDDA 2FPDA 5DY9A 1SPKA 1VQMQ 4M78D 3OBYA 2MOXA 4OMPA 2RQUA
chains in the Genus database with same CATH topology
2DL5A 2P4RA 2F2XA 4IIMA 1UECA 1H92A 1UGVA 1UTIA 4GLMA 2C0TA 2GNCA 2FRYA 2EKHA 4LN2A 2L0AA 2DL7A 5FWBA 2BZYA 2J06A 1AEYA 1PRLC 4JPBW 2FPFA 1GBQA 5HCKA 2KXCA 2DILA 1WXBA 2OJ2A 2X3WD 2FPEA 2I0NA 2KRSA 1KSWA 4JZ3A 1K4US 1OEBA 2LMJA 1UE9A 2YUNA 1NYGA 1X43A 2KT8A 1WDXA 3UA7A 3O5ZA 2J6KA 3NPFA 2EW3A 2M0YA 3PE0A 1WXUA 1FYNA 1TG0A 1HSQA 2HDAA 4RUGA 2LCSA 2YUQA 4OMLA 2KR3A 3PVLA 4Z8AA 2EPDA 2GTJA 4RTVA 4F16A 2DM1A 2YSQA 2CDTA 4M4ZA 2CH4W 2DL8A 3M0PA 2JTEA 2RQVA 2L3QA 1GCPA 4F14A 2D8JA 3IQLA 2CH4A 2LZ6B 3H0FA 2XMFA 4DEYA 2ED0A 1U06A 1IO6A 1VYVA 1W70A 1PNJA 3VS0A 1UHFA 1PHTA 2OI3A 2JS2A 4AFZC 2L3PA 2DBMA 1AWWA 1I1JA 1MV3A 2CSIA 3SEMA 3LH5A 4CC7A 3EG2A 2K6DA 2EYXA 2LQNA 2CT3A 3A98A 3I9QA 4J9GA 3EG3A 2KBTA 1PKTA 2EYZA 2D1XA 1WLPB 1GCQC 1OPLA 2K3BA 2EGEA 1T3LA 2A37A 4F17A 1TUDA 1NLOC 2DBKA 2IIMA 1G83A 1M3AA 1QWFA 3VRYA 2KYBA 4Z89A 2ABLA 1GRIA 2L3SA 1ARKA 2EVRA 2LJ3A 4CC3A 3THKA 1T0HA 3NGPA 2A28A 1ZLMA 4RTTA 2D0NA 1NM7A 4WCIA 1SRMA 1E7OA 1KIKA 1PWTA 2J6OA 4HVWA 3VS7A 1VYTA 1I0CA 2EBPA 5I11A 2D8HA 2ESWA 4JJBA 2DF6A 1K1ZA 3R6NA 1JXOA 1UFFA 2K2MA 2LP5A 1VA7A 4ORZA 2DYBA 1PRMC 2DJQA 3M0TA 2ROLA 2JW4A 4J9CA 1T0JA 1JEGA 1JQQA 2L2PA 3RBBB 1ZX6A 1WXTA 4J9HA 2HSPA 1NEGA 4JZ4A 2LJ0A 1ZUUA 1SSHA 1YWOA 1UDLA 2O9VA 5GJWB 4J9BA 1ABOA 2DRMA 4RTWA 1NG2A 3M0QA 3VS3A 4RTZA 1CSKA 2CUDA 1NEBA 1BU1A 3TSWA 2KXDA 2GQIA 2PZ1A 1YP5A 4GBQA 2VWFA 2SRCA 3NHNA 2AZVA 1ZUYA 2J05A 4OMMA 3NMZC 2EGAA 1GFCA 1N5ZA 2KYMA 2VKNA 5IH2A 4D8DA 1S1NA 2O2OA 3I5SA 4A63B 3EHRA 3CQTA 2O88A 2CREA 1X27A 3VS4A 2O9SA 1AWJA 1B07A 4LUDA 4JJCA 2K9GA 1TUCA 2KNBB 2YT6A 1ZBJA 2KRMA 2CSQA 4HXJA 1XOVA 2PTKA 1KJWA 2NWMA 1Z9ZA 2YUPA 1WFWA 3QWYA 4ESRA 1VYUA 1YWPA 1WYXA 4HVVA 2JMAA 3EG0A 1JO8A 2BTTA 2EGCA 4D8KA 1Y0MA 2KGTA 1K76A 1BK2A 5IHNA 2GTOA 2HEQA 1K9AA 1X2QA 1HJDA 5IXBA 2FO0A 1M27C 3JV3A 2A08A 1AZEA 1GBRA 1QWEA 1SEMA 2F2WA 5IHKA 2PNIA 2HCKA 1X6GA 4J9EA 4Z88A 3VRZA 3H0IA 1SHGA 2YUOA 1GL5A 2J7IA 2VVKA 1JU5C 1M8MA 5FWCA 5GJVB 1UG1A 1K0SA 1UJ0A 2YDLA 3ZL7C 3SHWA 5FW9A 2RPNA 1QKXA 4LUEA 4ZNXA 2C0OA 4R0KA 2JT4A 2DNUA 1AVZC 2H8HA 3REAB 2MIOA 4X1VA 2EYWA 2SEMA 2AKKA 1M3CA 1GCQA 1JXMA 4OMQA 1EFNA 2RQTA 3I35A 1NLPC 1T3SA 2KT1A 3EHQA 4CC2A 4IIOA 2KE9A 3M0RA 3M0UA 2AZSA 1WA7A 4LNPA 2O31A 1WIEA 2RQRA 2ECZA 1UUEA 3H0HA 1B3QA 1QCFA 2LJ1A 2BZXA 2LX7A 4KRTA 2W10A 2HBWA 1CKAA 1WI7A 2C0IA 2CT4A 1J3TA 3UA6A 1I07A 2JMCA 4J9DA 2KRNA 2CUBA 2AKLA 1RI9A 1YNZA 4QT7A 1Y57A 2JS0A 1UJYA 2DRKA 1E6HA 3UF4A 2DLPA 1GFDA 1AZGB 1OPKA 2ED1A 3EG1A 1HD3A 1FMKA 1X69A 4FSSA 1U3OA 2FG0A 2DE0X 1WX6A 2EYYA 1MUZA 1AD5A 2DL3A 4JJDA 3C0CA 2V1QA 1KFZA 1A0NB 2V1RA 3GBQA 1M30A 1MV0B 2JXBA 2BZ8A 3QWXX 2ENMA 1W6XA 1PKSA 3H41A 2RMOA 2MCNA 1RLPC 1X6BA 1W1FA 4HCKA 1H8KA 4J9IA 4HVUA 1CKBA 3TSZA 2EQIA 2FEIA 1UHCA 3VS6A 2F2VA 1H3HA 4J9FA 2DX1A 3KFVA 4OMOA 5L23A 5IHIA 2K7AA 2GBQA 2AK5A 2OAWA 3U23A 1YN8A 4AG2C 4AFQC 1RUWA 1LCKA 2A36A 2DL4A 4AG1C 2J6FA 2X3XD 2B86A 2DA9A 2RNAA 3EGUA 4DEXA 4LE9A 5EC7A 4OMNA 2LNHB 4RTXA 3UATA 2RN8A 1QKWA 1E6GA 2G6FX 1U5SA 2JM8A 3PVQA 5I22A 3I5RA 1K0XA 2ROTA 1AWOA 5ECAA 1BB9A 2E5KA 2DMOA 1QLYA 1ABQA 3REBB 4EIKA 4Y92A 2KROA 3FJ5A 1OOTA 3VS1A 1ZUKA 2FRWA 4RTUA 1Z9QA 4CC4B 4K11A 1AOJA 1M3BA 3VS5A 2W0ZA 2LQWA 1OV3A 2DVJA 1RLQC 2RF0A 3VS2A 2KEAA 2GGRA 1YCSB 2RQWA 2QDLA 1BBZA 3TVTA 4AFUC 1ZSGA 1G2BA 1NYFA 1SRLA 2JM9A 4AFSC 5IXFA 4RTYA 3RNJA 1V1CA 4E6RA 2NUZA 1AWXA 2K79A 1X2KA 2FPDA 1SPKA 2M51A 3ULRB 3M0SA 1SHFA 2MOXA 4OMPA 2RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL5 A;  2P4R A;  2F2X A;  4IIM A;  1UEC A;  1H92 A;  1UGV A;  1UTI A;  4GLM A;  2C0T A;  2GNC A;  2FRY A;  2EKH A;  4LN2 A;  2L0A A;  2DL7 A;  5FWB A;  2BZY A;  2J06 A;  1AEY A;  1PRL C;  4JPB W;  2FPF A;  1GBQ A;  5HCK A;  2KXC A;  2DIL A;  1WXB A;  2OJ2 A;  2X3W D;  2FPE A;  2I0N A;  2KRS A;  1KSW A;  4JZ3 A;  1K4U S;  1OEB A;  2LMJ A;  1UE9 A;  2YUN A;  1NYG A;  1X43 A;  2KT8 A;  1WDX A;  3UA7 A;  3O5Z A;  2J6K A;  3NPF A;  2EW3 A;  2M0Y A;  3PE0 A;  1WXU A;  1FYN A;  1TG0 A;  1HSQ A;  2HDA A;  4RUG A;  2LCS A;  2YUQ A;  4OML A;  2KR3 A;  3PVL A;  4Z8A A;  2EPD A;  2GTJ A;  4RTV A;  4F16 A;  2DM1 A;  2YSQ A;  2CDT A;  4M4Z A;  2CH4 W;  2DL8 A;  3M0P A;  2JTE A;  2RQV A;  2L3Q A;  1GCP A;  4F14 A;  2D8J A;  3IQL A;  2CH4 A;  2LZ6 B;  3H0F A;  2XMF A;  4DEY A;  2ED0 A;  1U06 A;  1IO6 A;  1VYV A;  1W70 A;  1PNJ A;  3VS0 A;  1UHF A;  1PHT A;  2OI3 A;  2JS2 A;  4AFZ C;  2L3P A;  2DBM A;  1AWW A;  1I1J A;  1MV3 A;  2CSI A;  3SEM A;  3LH5 A;  4CC7 A;  3EG2 A;  2K6D A;  2EYX A;  2LQN A;  2CT3 A;  3A98 A;  3I9Q A;  4J9G A;  3EG3 A;  2KBT A;  1PKT A;  2EYZ A;  2D1X A;  1WLP B;  1GCQ C;  1OPL A;  2K3B A;  2EGE A;  1T3L A;  2A37 A;  4F17 A;  1TUD A;  1NLO C;  2DBK A;  2IIM A;  1G83 A;  1M3A A;  1QWF A;  3VRY A;  2KYB A;  4Z89 A;  2ABL A;  1GRI A;  2L3S A;  1ARK A;  2EVR A;  2LJ3 A;  4CC3 A;  3THK A;  1T0H A;  3NGP A;  2A28 A;  1ZLM A;  4RTT A;  2D0N A;  1NM7 A;  4WCI A;  1SRM A;  1E7O A;  1KIK A;  1PWT A;  2J6O A;  4HVW A;  3VS7 A;  1VYT A;  1I0C A;  2EBP A;  5I11 A;  2D8H A;  2ESW A;  4JJB A;  2DF6 A;  1K1Z A;  3R6N A;  1JXO A;  1UFF A;  2K2M A;  2LP5 A;  1VA7 A;  4ORZ A;  2DYB A;  1PRM C;  2DJQ A;  3M0T A;  2ROL A;  2JW4 A;  4J9C A;  1T0J A;  1JEG A;  1JQQ A;  2L2P A;  3RBB B;  1ZX6 A;  1WXT A;  4J9H A;  2HSP A;  1NEG A;  4JZ4 A;  2LJ0 A;  1ZUU A;  1SSH A;  1YWO A;  1UDL A;  2O9V A;  5GJW B;  4J9B A;  1ABO A;  2DRM A;  4RTW A;  1NG2 A;  3M0Q A;  3VS3 A;  4RTZ A;  1CSK A;  2CUD A;  1NEB A;  1BU1 A;  3TSW A;  2KXD A;  2GQI A;  2PZ1 A;  1YP5 A;  4GBQ A;  2VWF A;  2SRC A;  3NHN A;  2AZV A;  1ZUY A;  2J05 A;  4OMM A;  3NMZ C;  2EGA A;  1GFC A;  1N5Z A;  2KYM A;  2VKN A;  5IH2 A;  4D8D A;  1S1N A;  2O2O A;  3I5S A;  4A63 B;  3EHR A;  3CQT A;  2O88 A;  2CRE A;  1X27 A;  3VS4 A;  2O9S A;  1AWJ A;  1B07 A;  4LUD A;  4JJC A;  2K9G A;  1TUC A;  2KNB B;  2YT6 A;  1ZBJ A;  2KRM A;  2CSQ A;  4HXJ A;  1XOV A;  2PTK A;  1KJW A;  2NWM A;  1Z9Z A;  2YUP A;  1WFW A;  3QWY A;  4ESR A;  1VYU A;  1YWP A;  1WYX A;  4HVV A;  2JMA A;  3EG0 A;  1JO8 A;  2BTT A;  2EGC A;  4D8K A;  1Y0M A;  2KGT A;  1K76 A;  1BK2 A;  5IHN A;  2GTO A;  2HEQ A;  1K9A A;  1X2Q A;  1HJD A;  5IXB A;  2FO0 A;  1M27 C;  3JV3 A;  2A08 A;  1AZE A;  1GBR A;  1QWE A;  1SEM A;  2F2W A;  5IHK A;  2PNI A;  2HCK A;  1X6G A;  4J9E A;  4Z88 A;  3VRZ A;  3H0I A;  1SHG A;  2YUO A;  1GL5 A;  2J7I A;  2VVK A;  1JU5 C;  1M8M A;  5FWC A;  5GJV B;  1UG1 A;  1K0S A;  1UJ0 A;  2YDL A;  3ZL7 C;  3SHW A;  5FW9 A;  2RPN A;  1QKX A;  4LUE A;  4ZNX A;  2C0O A;  4R0K A;  2JT4 A;  2DNU A;  1AVZ C;  2H8H A;  3REA B;  2MIO A;  4X1V A;  2EYW A;  2SEM A;  2AKK A;  1M3C A;  1GCQ A;  1JXM A;  4OMQ A;  1EFN A;  2RQT A;  3I35 A;  1NLP C;  1T3S A;  2KT1 A;  3EHQ A;  4CC2 A;  4IIO A;  2KE9 A;  3M0R A;  3M0U A;  2AZS A;  1WA7 A;  4LNP A;  2O31 A;  1WIE A;  2RQR A;  2ECZ A;  1UUE A;  3H0H A;  1B3Q A;  1QCF A;  2LJ1 A;  2BZX A;  2LX7 A;  4KRT A;  2W10 A;  2HBW A;  1CKA A;  1WI7 A;  2C0I A;  2CT4 A;  1J3T A;  3UA6 A;  1I07 A;  2JMC A;  4J9D A;  2KRN A;  2CUB A;  2AKL A;  1RI9 A;  1YNZ A;  4QT7 A;  1Y57 A;  2JS0 A;  1UJY A;  2DRK A;  1E6H A;  3UF4 A;  2DLP A;  1GFD A;  1AZG B;  1OPK A;  2ED1 A;  3EG1 A;  1HD3 A;  1FMK A;  1X69 A;  4FSS A;  1U3O A;  2FG0 A;  2DE0 X;  1WX6 A;  2EYY A;  1MUZ A;  1AD5 A;  2DL3 A;  4JJD A;  3C0C A;  2V1Q A;  1KFZ A;  1A0N B;  2V1R A;  3GBQ A;  1M30 A;  1MV0 B;  2JXB A;  2BZ8 A;  3QWX X;  2ENM A;  1W6X A;  1PKS A;  3H41 A;  2RMO A;  2MCN A;  1RLP C;  1X6B A;  1W1F A;  4HCK A;  1H8K A;  4J9I A;  4HVU A;  1CKB A;  3TSZ A;  2EQI A;  2FEI A;  1UHC A;  3VS6 A;  2F2V A;  1H3H A;  4J9F A;  2DX1 A;  3KFV A;  4OMO A;  5L23 A;  5IHI A;  2K7A A;  2GBQ A;  2AK5 A;  2OAW A;  3U23 A;  1YN8 A;  4AG2 C;  4AFQ C;  1RUW A;  1LCK A;  2A36 A;  2DL4 A;  4AG1 C;  2J6F A;  2X3X D;  2B86 A;  2DA9 A;  2RNA A;  3EGU A;  4DEX A;  4LE9 A;  5EC7 A;  4OMN A;  2LNH B;  4RTX A;  3UAT A;  2RN8 A;  1QKW A;  1E6G A;  2G6F X;  1U5S A;  2JM8 A;  3PVQ A;  5I22 A;  3I5R A;  1K0X A;  2ROT A;  1AWO A;  5ECA A;  1BB9 A;  2E5K A;  2DMO A;  1QLY A;  1ABQ A;  3REB B;  4EIK A;  4Y92 A;  2KRO A;  3FJ5 A;  1OOT A;  3VS1 A;  1ZUK A;  2FRW A;  4RTU A;  1Z9Q A;  4CC4 B;  4K11 A;  1AOJ A;  1M3B A;  3VS5 A;  2W0Z A;  2LQW A;  1OV3 A;  2DVJ A;  1RLQ C;  2RF0 A;  3VS2 A;  2KEA A;  2GGR A;  1YCS B;  2RQW A;  2QDL A;  1BBZ A;  3TVT A;  4AFU C;  1ZSG A;  1G2B A;  1NYF A;  1SRL A;  2JM9 A;  4AFS C;  5IXF A;  4RTY A;  3RNJ A;  1V1C A;  4E6R A;  2NUZ A;  1AWX A;  2K79 A;  1X2K A;  2FPD A;  1SPK A;  2M51 A;  3ULR B;  3M0S A;  1SHF A;  2MOX A;  4OMP A;  2RQU A; 
#chains in the Genus database with same CATH topology
 4C92 G;  1BIB A;  4M7A A;  1YHQ Q;  2HQH A;  4XU0 A;  1UEC A;  4HA8 A;  1UGV A;  2OX7 A;  1UTI A;  1FX7 A;  3A8M B;  4ZN1 A;  4LN2 A;  2L0A A;  4O5V A;  1TS9 A;  5A0G A;  2DVE A;  3CCJ Q;  3X25 B;  3G4S A;  3QZ9 B;  3OYC A;  3DB4 A;  1PRL C;  2CP7 A;  3HSB A;  5FU6 C;  2DIL A;  2KY9 A;  5HK0 A;  2FPE A;  2KRS A;  2RJD A;  4C8Q A;  5CKB A;  2FHD A;  2CZ7 B;  3KUF A;  3PFS A;  3EGX B;  2QAS A;  5LJ3 e;  4PL6 A;  1QCO A;  1BCM A;  2KT8 A;  1K73 R;  3CCL Q;  1AT1 B;  3NPF A;  4FL6 A;  2EW3 A;  2Z0W A;  3PE0 A;  4XTY A;  1FYN A;  4RMO A;  2E12 A;  1HSQ A;  2XU8 A;  1RAG B;  2HDA A;  4E2F B;  4M78 A;  4RUG A;  2DD5 A;  2KR3 A;  3JCM d;  4Z8A A;  4B9X A;  1YJN A;  2DIG A;  4M75 F;  3SWN B;  3CC7 T;  3CCE Q;  2DM1 A;  2BE9 B;  4RCC A;  1R77 A;  1Q82 R;  4TVR A;  3KXT A;  2CDT A;  2JOY A;  4FYY B;  3QBY A;  3PMT A;  2R57 A;  5D6Y A;  3M0P A;  1HYO A;  3MJX A;  2O01 E;  2RQV A;  2WSC E;  3OYB A;  1GCP A;  2D8J A;  3IQL A;  3H0F A;  4DEY A;  3JCM X;  3CD6 T;  1VYV A;  1W70 A;  3NTK A;  3VS0 A;  4O6J A;  3LW5 E;  4WF2 A;  3UWN A;  2RHI A;  1AWW A;  1MV3 A;  5GAM h;  2QEX T;  1WHJ A;  4PJO F;  1ZHI A;  1PC0 A;  1PKT A;  2EYZ A;  3RMQ A;  1KHI A;  4M7D F;  2D1X A;  4XU1 A;  3QDF A;  4HKE A;  4IUP A;  3QII A;  3AHU A;  5CAI A;  3EGD B;  2DBK A;  5LJ3 f;  2FZC B;  2IIM A;  1UB4 A;  1TXQ A;  4C8Q F;  2IPO B;  3PNW C;  4NL3 A;  4FIB A;  4PJN A;  2IG0 A;  1ARK A;  2EVR A;  3BFM A;  3MO8 A;  4CC3 A;  2A28 A;  3EAE A;  1ZLM A;  1YJN Q;  5GMK e;  2K3X A;  1PWT A;  2ZPE B;  2BUD A;  2HKQ B;  3QJY A;  2K4Y A;  4HCB A;  5I11 A;  4JJB A;  2DF6 A;  1JXO A;  4FW2 A;  1LJO A;  2LP5 A;  2JW4 A;  3G1J A;  4J9H A;  5LJ3 j;  3VJP A;  1VQO A;  2LCL A;  2O9V A;  1YIT A;  4J9B A;  5I2M A;  1NG2 A;  3QUI A;  3VS3 A;  2CUD A;  1YHQ T;  1NEB A;  1NZ9 A;  1YJ9 Q;  2GQI A;  1K9M R;  2V8J A;  3LH0 A;  2AZV A;  1ZUY A;  4A4G A;  1VQM A;  2EGA A;  2NLU A;  3LYI A;  1N5Z A;  4RCB A;  2DO3 A;  2O2O A;  1LPL A;  3L1A A;  1Q95 G;  3GNF B;  1WNL A;  1PCX A;  2CRE A;  4C92 C;  2LT4 A;  3CBP A;  1VQ4 Q;  1B07 A;  4L6V 5;  3OS5 A;  2ZPB B;  4QVC A;  4JJC A;  1TUC A;  2YT6 A;  4ME7 A;  5IN1 A;  1UGS B;  4NL2 A;  1YCY A;  4N4H A;  1Z9Z A;  3FRN A;  3MP6 A;  1WFW A;  3JCM P;  1YWP A;  4EMK A;  3BY7 A;  4M7D A;  2DKG A;  3OS1 A;  2EGC A;  1Y0M A;  1YBY A;  3QKJ A;  3TCJ A;  2F69 A;  1BK2 A;  3C4S A;  1D1B A;  2GTO A;  2LQK A;  1X2Q A;  2RH2 A;  2E6N A;  1QW1 A;  4X34 A;  4M77 G;  4RG8 A;  3TEE A;  2MWP A;  2F2W A;  4CI0 C;  2HCK A;  1X6G A;  1K8A U;  1RL2 A;  4DOW A;  4F7U F;  3VRZ A;  4N4G A;  2HKN A;  2P0Q A;  5FU6 B;  1GL5 A;  2J7I A;  4XTZ A;  4C92 B;  1W2B A;  3HHT B;  4J8O A;  2DXU A;  1VQN Q;  5IAY A;  3ASK A;  1UJ0 A;  3OYA A;  5GAN 2;  1JJ2 P;  3E9G A;  3ZL7 C;  2RPN A;  4ZNX A;  3CCS Q;  3H8Z A;  4JLI A;  4OGE A;  3CC4 T;  2QTV A;  3EG9 A;  3FEO A;  5GMK j;  3SDZ A;  3WXM B;  1MMA A;  4LDY A;  1W2B P;  1M3C A;  1V76 A;  5KYX A;  5HK3 A;  3CCE A;  1QP3 A;  2E1H A;  2MPX C;  4OMQ A;  2PVD B;  3M9Q A;  1QCN A;  1RI0 A;  2RQT A;  4QVD A;  2KQW A;  1M9S A;  2YRV A;  2R5A A;  2O4X B;  5LJ5 f;  1NLP C;  1T3S A;  3CCU A;  3EHQ A;  1M1K C;  1OUL A;  2RI2 A;  3M0R A;  5L8R E;  4LNP A;  2O31 A;  3HFO A;  1UEB A;  2HNI A;  3H0H A;  4PJL A;  4PJO B;  2BZX A;  2LX7 A;  4KRT A;  5FU7 B;  2W10 A;  1QVG S;  4OP0 A;  1CKA A;  2LTO A;  1VQ5 Q;  3M58 A;  2F5T X;  4J9D A;  1JJ2 A;  2CUB A;  5GAN d;  2AKL A;  2VB6 A;  1UJY A;  1ACM B;  1E6H A;  5GMK h;  1AZG B;  3OYG A;  2RO0 A;  1U3O A;  2XDB A;  4HT9 A;  2QDY B;  3OYL A;  4MZT A;  1AD5 A;  1VQN A;  4BY6 B;  4KGZ B;  2YLB A;  3HPW A;  3QJ6 A;  3GBQ A;  2QQR A;  3CPW S;  1BI2 A;  2BZ8 A;  4PJO G;  2MK5 A;  1PKS A;  3CCR Q;  1M1K R;  2E70 A;  3EG9 B;  1W1F A;  5LL6 S;  4HVU A;  3CMA Q;  3TSZ A;  5LJ5 h;  2EQK A;  2DEU A;  5GAM d;  3SFM A;  2LX9 A;  2Y90 A;  3OYM A;  2A36 A;  3INZ A;  2J6F A;  2MMP A;  4BB7 A;  1GXI E;  3CC7 A;  3G7Z A;  3CCR T;  1E6G A;  1K73 U;  4M75 C;  3UT1 A;  1VQ6 T;  1VQ9 A;  2A7Y A;  3NTI A;  2ZPG B;  2DMO A;  2CP5 A;  4EIK A;  1VQ5 A;  7AT1 B;  4B6M A;  3MEA A;  3FJ5 A;  4C0D C;  2K2V A;  1OOT A;  1ZUK A;  2HMA A;  2PUK B;  4OB0 B;  4J7I A;  1M3B A;  1SKU B;  3CXC S;  2LQW A;  1OV3 A;  3G71 Q;  1ZA2 B;  1FWZ A;  1VQ6 A;  1ZSG A;  1YJN T;  1G2B A;  1NYF A;  2XHC A;  1Y96 B;  5IXF A;  4M7A B;  8ATC B;  1AWX A;  3GNG A;  2VXE A;  2M51 A;  4IUQ A;  3CME A;  2JNG A;  1LOJ A;  4OGC A;  2M16 A;  1YIJ T;  2AIR B;  4KGV B;  5D7U A;  2DL5 A;  2KSS A;  4IIM A;  1H92 A;  4M75 A;  2EKH A;  2VC8 A;  4M78 B;  1VQ5 T;  1AEY A;  1G3S A;  3CCM T;  3OY9 A;  4JPB W;  4NS5 A;  2VGM A;  5HCK A;  2KXC A;  4MDW A;  4FW1 A;  2OJ2 A;  2I0N A;  4FSX A;  4JZ3 A;  3QHS A;  3CC2 Q;  1VQ9 Q;  2LMJ A;  5C6S A;  5DLO A;  2EAY A;  1NPR A;  1M2V A;  2GFU A;  3JCM g;  1PM3 A;  3PMI A;  3VV0 A;  3MP1 A;  1Y7X A;  3CBM A;  2P0K A;  3RKY A;  5CQY A;  4BE1 A;  4M7A F;  3PVL A;  1VQP T;  5GMK i;  2EPD A;  1VQO T;  4M77 C;  4RTV A;  4F16 A;  4RKU E;  1I8F A;  2VXF A;  2YSQ A;  1KQS S;  5CCA A;  3CCV T;  2DL8 A;  3MP8 A;  3JB9 D;  2JTE A;  5A2Q E;  1YIT T;  5GAN 5;  2ZGW A;  5FLX E;  1OU8 A;  4PJO A;  2ZCF B;  1U06 A;  1KD1 C;  2RM4 A;  1UHF A;  1VQO Q;  4MZM A;  3OW2 S;  2OI3 A;  1OX8 A;  4OVA A;  2L3P A;  1I1J A;  1X75 C;  3CCU Q;  2CSI A;  1VQ8 Q;  3LH5 A;  3L2Z A;  4ELY C;  2H3J A;  3EG2 A;  4C8Q G;  3QG1 A;  2K6D A;  5GAM e;  2EYX A;  2LQN A;  2CT3 A;  3I9Q A;  4ELZ C;  2JN0 A;  4BI8 B;  1KK7 A;  1KHC A;  1WLP B;  3QXE B;  4DQ2 A;  1SSF A;  1TUD A;  3DLL A;  1Y71 A;  2RHX A;  1G83 A;  1Q81 U;  4M7D G;  4Z89 A;  1QVP A;  1PD1 A;  2QQS A;  2HSE B;  2QA4 A;  3H6Z A;  4JJN K;  2QEX A;  5GAO n;  1QVG A;  4X9C A;  5CKE A;  2LJ3 A;  3T9N A;  5CIU A;  3THK A;  4RTT A;  2D0N A;  3VU3 C;  3HRS A;  2L3R A;  4WCI A;  4M77 A;  1SRM A;  1VQK T;  1E7O A;  2KMT A;  1VQK Q;  1QQJ A;  4HCC A;  4JS4 A;  3J7A F;  3VS7 A;  1VIE A;  2P0P A;  4QKU A;  4PK4 A;  3ZBD A;  4E7J A;  5KYY A;  3L2V A;  1M2O A;  3OS0 A;  1BI1 A;  4II1 A;  4X9D A;  1K8A C;  1ZA1 B;  2DYB A;  2DJQ A;  3M0T A;  2ROL A;  2OTL T;  1JEG A;  4ZGD B;  2XKO C;  3RBB B;  1IZ6 A;  1WXT A;  1KQ2 A;  1NEG A;  2LJ0 A;  1O75 A;  3BW1 A;  3V7C A;  3CCQ Q;  5GJW B;  1VQK A;  1TWB A;  4EMG A;  4JLG A;  4DBR A;  1D09 B;  2PVO B;  4IUT A;  3TSW A;  5CR2 A;  3QO3 A;  1IGQ A;  3OYJ A;  3C94 A;  2R58 A;  2PZ1 A;  3MEW A;  3CC4 A;  1YP5 A;  4M78 C;  2SRC A;  3NHN A;  4XTX A;  4OMM A;  2HD0 A;  3A8O B;  2DD4 A;  3M55 A;  5GMK m;  1GFC A;  1I81 A;  5IH2 A;  4D8D A;  2QAZ A;  3I5S A;  4A63 B;  3D7S B;  5D6W A;  2A3L A;  1X01 A;  2O88 A;  3CCJ A;  4XAX B;  1AWJ A;  2GCX A;  2K9G A;  1M5Q 1;  3ER0 A;  2P84 A;  3RMS A;  1YIT Q;  4OB2 B;  2OTJ Q;  5GAN j;  1D3B B;  3CC4 Q;  4HXJ A;  2DJZ A;  2DZC A;  4M75 E;  1H3Z A;  3OYD A;  4M7A E;  1VYU A;  1WJR A;  4PNO A;  2JMA A;  2BTT A;  1N6A A;  1WHG A;  3GOX A;  2MWO A;  3JCM W;  2ZPH B;  2EWN A;  3J81 E;  2VUB A;  2KGT A;  2E4H A;  2OAU A;  2FVU A;  1G8X A;  1HJD A;  5IXB A;  2FO0 A;  2RD1 A;  3M56 A;  5GMK l;  2JZ2 A;  4D6W A;  1M90 C;  4N0A A;  2YWW A;  4QW2 A;  1Q86 R;  2D6F A;  4J9E A;  2KDS A;  1UGP B;  4C5H A;  2QG9 B;  3RKW A;  1LNX A;  3H0I A;  1M2V B;  2YUO A;  2ZPF B;  4JRK A;  2QGF B;  5GJV B;  3O8V A;  1IRE B;  1UG1 A;  4C8Q E;  1K0S A;  4FM4 B;  3GP8 A;  3VYH B;  3SHW A;  3FC3 A;  3OYF A;  2C0O A;  3CCL T;  4R0K A;  1RAF B;  1OI1 A;  2ZZD A;  4AMC A;  4M78 G;  3CCE T;  3WVD B;  5KYW B;  5LJ3 d;  1U1S A;  2SEM A;  4IKF A;  4PJO E;  1PSF A;  3MHX A;  2VV5 A;  2ZPI B;  1JXM A;  3V8L A;  1VQP A;  1D3B A;  4CC2 A;  4C0D B;  4V2S A;  3HKS A;  5DLQ E;  5GAN 7;  3CCS A;  1D1C A;  2AZS A;  1WA7 A;  1R0C B;  1WIE A;  2ECZ A;  1WPY A;  4LDW A;  1Y96 A;  1QCF A;  1WGS A;  3VUB A;  3G4S T;  1M90 U;  4CRI A;  2XI9 A;  2XD0 A;  5GAN h;  2EQU A;  3E19 A;  1XJW B;  2M0O A;  2DYI A;  3UF4 A;  1WJQ A;  1GFD A;  5GAO m;  1D1A A;  3EG1 A;  1HD3 A;  1NE8 A;  4FSS A;  5FRO A;  1ZQ1 A;  2EYY A;  1P92 A;  1MUZ A;  2M9U A;  4JJD A;  3DB3 A;  4JRI A;  3VYG A;  1A0N B;  4MDX A;  1M30 A;  4QQG A;  5GAO q;  4FT2 A;  4AT1 B;  3HL8 A;  1WHK A;  3QWX X;  2QA4 Q;  2ENM A;  3M53 A;  4JS5 A;  5LJ5 e;  1CKB A;  4C8Q B;  3CPW A;  3E2U A;  2FEI A;  1UHC A;  1IHW A;  1H3H A;  3PIO A;  3KFV A;  5GAN 3;  3JB9 F;  2R5M A;  1BI0 A;  1VUB A;  4M7D B;  2NUT B;  1RUW A;  4M77 D;  3M4G A;  4E7K A;  4KH0 B;  5CK9 A;  1VQ4 A;  1VQM T;  2DA9 A;  4UC4 A;  4PFP A;  3M4Y A;  4N0A C;  1UGQ B;  5LJ3 h;  4GY5 A;  3CCM Q;  2JM8 A;  2V26 A;  3PVQ A;  5I22 A;  1IHV A;  3OMG A;  3P8D A;  3CMA A;  5ECA A;  1BB9 A;  3LWH A;  1QLY A;  2OTJ A;  3MET A;  1MND A;  4BDY A;  4Y92 A;  4MZP A;  3VS1 A;  2HQE A;  2FRW A;  2CZ1 B;  4RTU A;  2D9T A;  2E3I A;  2CYZ B;  4F7U G;  2QQ9 A;  3VS5 A;  2YRC A;  2W0Z A;  2E5Q A;  5DM7 R;  3OYY A;  2DVJ A;  3OYH A;  2X4X A;  4XU3 A;  4DBH A;  4NOY A;  4R56 A;  4M75 G;  5I2S A;  4LXC A;  4AFU C;  4M75 B;  2JM9 A;  3JCM Q;  4KUD K;  1K8A R;  3G6E Q;  3FJP A;  3CPW P;  1MMG A;  1V1C A;  1X2K A;  4HCZ A;  3OSS C;  3NFC A;  3ULR B;  3QSU A;  3OYN A;  1SHF A;  3M54 A;  3MKD A;  2DFU A;  1C0M A;  5J26 A;  4EDU A;  1FMV A;  1DJ7 B;  1H64 1;  2P4R A;  2F2X A;  3CEY A;  5D6X A;  4LDX A;  3JCM V;  4KT0 E;  4GLM A;  2C0T A;  2FRY A;  1KQS A;  5FWB A;  2X4Y A;  2BZY A;  2J06 A;  2CZ0 B;  4GLK A;  4VUB A;  1WQW A;  1GBQ A;  1XTD A;  1VQ6 Q;  1Q81 R;  3CCS T;  3JB9 I;  3G6E A;  1QVF P;  1KSW A;  4ZN3 A;  1K4U S;  1UE9 A;  4KH1 B;  3A5Z B;  2JUF A;  4E7L A;  1YIJ A;  1X43 A;  4C92 A;  3CBO A;  3X26 B;  1N27 A;  3UA7 A;  2J6K A;  2COY A;  2QEX Q;  2M0Y A;  1WXU A;  1TG0 A;  1KD1 U;  2JJ9 A;  2VYT A;  4OB1 B;  4C8Q D;  2LCS A;  2JTM A;  4OML A;  1WHH A;  5FRM A;  3RER A;  2GTJ A;  3JAM E;  2QI2 A;  4F7U E;  1BCO A;  2CGH A;  3HRT A;  4EMK B;  2CH4 W;  2FZK B;  5GAN 6;  1KQS P;  4DA4 A;  4PJO D;  2DTH A;  1PSE A;  4E7I A;  2L3Q A;  3LGF A;  4QQ6 A;  1YIJ Q;  4FT4 A;  1JB0 E;  2LZ6 B;  3OYI A;  3NTH A;  1Q81 C;  2ED0 A;  5I21 A;  1IO6 A;  1PNJ A;  1D0Z A;  4OMF B;  4J7F A;  4J6Y A;  3M59 A;  3UPU A;  3WVE B;  2JS2 A;  1ZBX A;  3J80 E;  3OB9 A;  2DBM A;  4BUG A;  4ZGJ B;  1M1K U;  2KI7 A;  1OYX A;  4CC7 A;  1AHJ B;  5CO7 A;  5C0M A;  2MYS A;  1D0X A;  1PG5 B;  2RJF A;  4OF1 A;  3A98 A;  3EG3 A;  2KBT A;  2DIQ A;  1Q7Y R;  3MCA B;  3HRU A;  1OPL A;  4M7D E;  2K3B A;  3CPF A;  4F17 A;  1IXD A;  4YTL A;  2KAF A;  1M3A A;  3VRY A;  4A4F A;  2KYB A;  2LRQ A;  1GRI A;  5KYU B;  3L2U A;  2L8D A;  5KCO A;  9ATC B;  2O4X A;  1WJS A;  4EMK C;  4Q5W A;  1T0H A;  2DK3 A;  3OA6 A;  1MNE A;  1OZ2 A;  2GFA A;  1KIK A;  4HVW A;  4BE0 A;  1VYT A;  5EG2 A;  3HFN A;  2D8H A;  2ESW A;  1UFF A;  3JCM c;  1G3T A;  1VQP Q;  4ORZ A;  1PRM C;  2QK0 A;  4J9C A;  1JQQ A;  2L2P A;  3EFR A;  1G5V A;  3M5A A;  3CCU T;  1VQL A;  4JZ4 A;  1ZUU A;  3BDU A;  4ZTJ A;  1I5L A;  3G71 T;  4L59 A;  1YJ9 A;  2P4T A;  1N8R R;  2DRM A;  1EZZ B;  4M7D C;  4RTZ A;  2LQ8 A;  2Y4X A;  4XTW A;  5KYU A;  4KGX B;  2BKD N;  1BU1 A;  1W4S A;  2FB7 A;  4OB3 B;  1K73 C;  5IT9 E;  2VWF A;  2NUP B;  2CP6 A;  1KC8 U;  2XK0 A;  1YJW T;  2VKN A;  2KYM A;  3S3M A;  1I4K 1;  3CQT A;  4P5N A;  1S72 Q;  1M1F A;  3VS4 A;  5A0L A;  1SG5 A;  2JTF A;  1IB8 A;  1BIA A;  4FCY A;  1ZBJ A;  2CSQ A;  3E9F A;  2CP3 A;  2PTK A;  3JCM b;  1KJW A;  2NWM A;  3FDR A;  3VKI A;  2YUP A;  3H9N A;  4KUL A;  3QWY A;  4ESR A;  3JB9 J;  2DXB A;  3X28 B;  4HVV A;  1QMC A;  1JO8 A;  2IVW A;  4M7A C;  4D8K A;  3S3O A;  3EFS A;  3X24 B;  3JCM f;  3I56 T;  5J39 A;  1K9A A;  1EIF A;  1QP2 A;  2QXF A;  1GBR A;  2EKO A;  5KYY B;  1V29 B;  2XG8 D;  1SHG A;  4FYV B;  2VVK A;  3RIR A;  1M8M A;  5FWC A;  3CCJ T;  2YRD A;  2QQA A;  5LJ5 d;  2YDL A;  4BY6 C;  4JDS A;  4Y91 A;  4LUE A;  3AT1 B;  3G71 A;  1OU9 A;  2JT4 A;  5KYX B;  2FL7 A;  4ATO A;  2H8H A;  4PJO C;  3I55 A;  3QPH A;  4C5I A;  4BD3 A;  4X1V A;  2AHJ B;  2E64 A;  2AKK A;  1W2B S;  3PIP A;  2DZ9 A;  2LVM A;  1GCQ A;  5CVI A;  4BE2 A;  2PQW A;  1TSF A;  2CKK A;  3I35 A;  3QDR B;  2CZ6 B;  3QYG B;  3VUZ A;  2BIV A;  2KT1 A;  4XQ3 A;  1RAB B;  4IIO A;  1RAE B;  2B8A A;  1LVK A;  3M0U A;  2RQR A;  5GAN g;  1OQK A;  4Z02 A;  4BDZ A;  1B3Q A;  1VQN T;  6AT1 B;  3RES A;  4E47 A;  5GAM j;  1MMD A;  1BKB A;  5GAN e;  2C0I A;  1VQL T;  3FIF A;  1Q82 U;  5J3B A;  5CKH A;  1RI9 A;  4QT7 A;  1Y57 A;  2JS0 A;  4C0F A;  3JRZ A;  1Y07 A;  3CD6 Q;  3L2Q A;  5AT1 B;  2DLP A;  4EPC A;  2X51 A;  1OPK A;  2ED1 A;  1FMK A;  2LNV A;  2FG0 A;  2DE0 X;  2DL3 A;  3C0C A;  2K5L A;  5CKF A;  2V1Q A;  2X9H A;  3GIB A;  1KFZ A;  3X20 B;  8AT1 B;  1RAD B;  4PLI A;  3JB9 G;  2JXB A;  4DBQ A;  1TH7 A;  4M78 E;  2M1H A;  1YJW Q;  3V8K A;  4DBF A;  2QGG A;  2EYQ A;  2MCN A;  3L42 A;  1RLP C;  1QVG P;  2X4W A;  3CD6 A;  3OS2 A;  4J9I A;  1B7T A;  1NJI C;  1N9S A;  3VS6 A;  2F2V A;  3GF5 A;  2DX1 A;  2RJE A;  4FU6 A;  5L23 A;  5IHI A;  3L2W A;  2K7A A;  3HP9 A;  1K9M C;  2GBQ A;  2AK5 A;  3ME9 A;  1NBE B;  5LJ3 g;  4LD6 A;  4AFQ C;  1TUG B;  1LCK A;  1BYM A;  4A4E A;  1Q7Y C;  2CP2 A;  2X3X D;  2RNA A;  3EGU A;  1YJW A;  4DEX A;  4LE9 A;  4RTX A;  1QKW A;  1FXX A;  1ZSZ B;  3FB9 A;  4C0Z A;  3CCV A;  4A4K A;  2MF2 A;  1PD0 A;  4M7A D;  3GLX A;  4CC4 B;  1Z9Q A;  5KCH A;  2C06 A;  2E10 A;  3HTR A;  1WHL A;  4LDV A;  1KG1 A;  1VQ9 T;  5AYF A;  1NJI R;  2GGR A;  1BBZ A;  3TVT A;  3CCV Q;  3JCM e;  1QVF S;  1Q86 U;  3OYK A;  1SRL A;  3CME Q;  3JCM h;  4J5Y A;  4RTY A;  3LGL A;  4E6R A;  3Q1J A;  2VGN A;  5GAO l;  2K79 A;  2LCC A;  4MMK A;  3M0S A;  1TTH B;  4Y28 E;  1N8R C;  1MHN A;  1K9M U;  2GNC A;  4IUV A;  2DL7 A;  1Q7Y U;  4IUU A;  2QQB A;  1KQ1 A;  2VAS A;  3P8H A;  1YI2 A;  2FPF A;  3ZEH A;  3TRE A;  4PJJ A;  1WXB A;  3CCQ A;  3BDL A;  3G4S Q;  2X3W D;  4J6W A;  2EQM A;  1YJ9 T;  3EGX A;  1OEB A;  1I5O B;  3LWI A;  2FZG B;  4J6X A;  2EJG A;  3RR6 A;  2YUN A;  3S6W A;  1NYG A;  2DET A;  2MI6 A;  2XDP A;  1B34 B;  1WDX A;  1WHM A;  3O5Z A;  2BE7 D;  2A0F B;  1ZSZ C;  2EIF A;  2F5K A;  1IGU A;  2HL5 C;  3OMC A;  2YUQ A;  1M90 R;  1Q86 C;  5CQX A;  1R8O B;  3G6E T;  3OW2 A;  3R6O A;  3F70 A;  4M4Z A;  4C92 D;  2PVG B;  2GF7 A;  1TOV A;  3BE3 A;  5GAN f;  2NUP A;  4QQD A;  4F14 A;  2EFI A;  2CH4 A;  5A0D A;  2XIC A;  4E7S A;  2XMF A;  2E6Z A;  1U8R A;  3CCQ T;  1SF9 A;  4BAC A;  3MPU B;  1PHT A;  4AFZ C;  3A1P A;  3M57 A;  1KC8 C;  5GAN 8;  1YI2 T;  3SEM A;  5M9O A;  2COW A;  4C5G A;  3TU4 K;  5KH6 A;  1VQ4 T;  4J9G A;  3GPL A;  4XTU A;  1VQ8 A;  2V8K A;  2K57 A;  1GCQ C;  4IUR A;  1U1T A;  2HBP A;  3PGG A;  5GAO r;  2EGE A;  1T3L A;  2A37 A;  1NLO C;  1QWF A;  4M77 E;  2K5F A;  1M8V A;  2ABL A;  2V8I A;  4EMH A;  1B34 A;  2L3S A;  4KBM B;  3RKX A;  3PTA A;  3CC7 Q;  1C6V X;  1XQH A;  3OYE A;  2RHZ A;  2X4J A;  4LD9 K;  3LX7 A;  2DXT A;  3NGP A;  3CCM A;  4JRQ A;  1M4Z A;  3EH1 A;  3OQ5 A;  2PUO B;  1NM7 A;  2J6O A;  3RDV A;  2DEQ A;  2DTO A;  1I0C A;  3A8L B;  2EBP A;  2Y4Y A;  5KYW A;  3R6N A;  1K1Z A;  2K2M A;  3CME T;  2ATC B;  1VA7 A;  2WSE E;  4R55 A;  4MML A;  3SD4 A;  1T0J A;  4BI3 A;  2X35 A;  3EFO B;  1QVF A;  1ZX6 A;  2CP0 A;  2HSP A;  1VQ7 Q;  4C8Q C;  1SSH A;  1YWO A;  1UDL A;  4JRP A;  1MMN A;  1ABO A;  3CXC P;  4RTW A;  1VIF A;  3M0Q A;  2OTL A;  1CSK A;  5GAN 4;  3LLR A;  1RAC B;  2K3Y A;  2KXD A;  3MEV A;  4FYX B;  1VQ8 T;  2DXC A;  2E3H A;  3V7S A;  4GBQ A;  2M02 A;  2J05 A;  3NMZ C;  1JJ2 S;  4C92 E;  4RG2 A;  1S1N A;  3FLG A;  3TQ7 P;  3EHR A;  2EQJ A;  2NUT A;  4XK8 E;  1RAI B;  1X27 A;  2COZ A;  2O9S A;  2RA2 A;  2RK2 A;  4LUD A;  4XU2 A;  2CS7 A;  4N4I A;  4B9W A;  2KNB B;  3V8J A;  2D0Q B;  2RK1 A;  5FRN A;  2KRM A;  2HQX A;  5GAO p;  1XOV A;  2YLC A;  3PT9 A;  1BI3 A;  4A53 A;  1JBM A;  2YHT A;  1WQ7 A;  3EGD A;  1KD1 R;  1VOM A;  1WYX A;  1Q82 C;  3EG0 A;  3SWN C;  3E1S A;  2HAX A;  4QVZ A;  2I2L A;  1S72 A;  2EJF A;  3A8G B;  1K76 A;  3MEU A;  5IHN A;  2HEQ A;  1M27 C;  1TU0 B;  3JV3 A;  2A08 A;  4PKC C;  1AZE A;  3CC2 T;  2ZAE A;  5FU7 C;  1QWE A;  1SEM A;  5IHK A;  2PNI A;  3CCL A;  1IRX A;  4PFO A;  3QYH B;  3RUX A;  2YXY A;  4Z88 A;  1UGR B;  4M77 F;  1RAA B;  2L89 A;  1JU5 C;  2DTI A;  2K5I A;  4XTV A;  4E7H A;  3I56 A;  2LT1 A;  3C95 A;  1WZO A;  3EFO A;  1G3Y A;  5FW9 A;  1QKX A;  4F7U A;  2WSF E;  2L5Q A;  4JUV A;  2DNU A;  3CC2 A;  1AVZ C;  1YFN A;  3REA B;  2E65 A;  3A8H B;  2MIO A;  1HK9 A;  2EYW A;  4HT8 A;  3S3N A;  1VQ7 T;  1NPP A;  3OW2 P;  2KK4 A;  1MGQ A;  1C1A A;  4M7D D;  2H3E B;  4M77 B;  1EFN A;  1M1G A;  5HKC A;  5CKD A;  1FMW A;  2KE9 A;  4BI4 A;  3I56 Q;  1D0Y A;  2RHY A;  4LDU A;  3I55 Q;  1UUE A;  5KE3 A;  3I55 T;  2RI3 A;  1R0B G;  3C12 A;  1F1B B;  2LJ1 A;  2DPP B;  2QYZ A;  3CCR A;  2HBW A;  1WI7 A;  1RAH B;  2CT4 A;  1J3T A;  2LC4 A;  3UA6 A;  1I07 A;  2JMC A;  1NJI U;  2KRN A;  1YNZ A;  5KE2 A;  1JRI A;  2DRK A;  2QTX A;  1X69 A;  4WTO B;  1WX6 A;  4M7A G;  1O9S A;  2E41 A;  3CXC A;  4PFZ A;  2EJ9 A;  1N8R U;  2HL3 A;  2V1R A;  4J83 A;  4A54 A;  1MV0 B;  2MAM A;  4KUI A;  2PU9 B;  1ZSZ A;  3P8B B;  1HXD A;  2GQV A;  2WAC A;  4L5G A;  1W6X A;  3H41 A;  4C92 F;  2RMO A;  3URG A;  1X6B A;  4HCK A;  1H8K A;  2OTL Q;  4DOV A;  3QZ5 B;  4F7U B;  3OBW A;  2DAQ A;  1KC8 R;  2EQI A;  2XID A;  4J9F A;  2RB6 A;  3ZFJ A;  4OMO A;  3JCM J;  2OAW A;  3U23 A;  1YN8 A;  4AG2 C;  1OZ3 A;  4F04 B;  2DL4 A;  3CMA T;  4AG1 C;  4E7Z A;  1YI2 Q;  5GAM g;  2B86 A;  2RJC A;  5EC7 A;  4OMN A;  2LNH B;  5LJ5 j;  3UAT A;  2DER A;  2RN8 A;  2AT1 B;  2G6F X;  1U5S A;  2G3R A;  2FYK A;  4ANJ A;  3I5R A;  1K0X A;  1VQ7 A;  2ROT A;  1AWO A;  2E5K A;  3V7R A;  1XNI A;  1ABQ A;  3REB B;  4A4H A;  3OSV A;  4M75 D;  4M78 F;  3JSC A;  4PJM A;  5KYN A;  2KRO A;  2KVQ G;  2LDM A;  3SWN A;  2QA4 T;  3JB9 H;  3N5B B;  5GAM f;  4K11 A;  1AOJ A;  2OTJ T;  2RHU A;  3EH2 A;  4ZTF A;  1RLQ C;  2RF0 A;  4C5E A;  4PLL A;  2F1L A;  3VS2 A;  2KEA A;  4ZGE B;  1YHQ A;  1X6O A;  2HZY A;  1VQL Q;  1YCS B;  2RQW A;  2QDL A;  5LJ5 g;  1G3W A;  2NYS A;  4C0G A;  3DLM A;  1EX4 A;  3DKM A;  4FYW B;  4AFS C;  1N9R A;  3UDC A;  1S72 T;  3RNJ A;  3L2R A;  2NUZ A;  3SB2 A;  3KBG A;  1OX9 A;  2JVV A;  2RI5 A;  5HY6 A;  2XDD A;  2FPD A;  5DY9 A;  1SPK A;  1VQM Q;  4M78 D;  3OBY A;  2MOX A;  4OMP A;  2RQU A; 
#chains in the Genus database with same CATH homology
 2DL5 A;  2P4R A;  2F2X A;  4IIM A;  1UEC A;  1H92 A;  1UGV A;  1UTI A;  4GLM A;  2C0T A;  2GNC A;  2FRY A;  2EKH A;  4LN2 A;  2L0A A;  2DL7 A;  5FWB A;  2BZY A;  2J06 A;  1AEY A;  1PRL C;  4JPB W;  2FPF A;  1GBQ A;  5HCK A;  2KXC A;  2DIL A;  1WXB A;  2OJ2 A;  2X3W D;  2FPE A;  2I0N A;  2KRS A;  1KSW A;  4JZ3 A;  1K4U S;  1OEB A;  2LMJ A;  1UE9 A;  2YUN A;  1NYG A;  1X43 A;  2KT8 A;  1WDX A;  3UA7 A;  3O5Z A;  2J6K A;  3NPF A;  2EW3 A;  2M0Y A;  3PE0 A;  1WXU A;  1FYN A;  1TG0 A;  1HSQ A;  2HDA A;  4RUG A;  2LCS A;  2YUQ A;  4OML A;  2KR3 A;  3PVL A;  4Z8A A;  2EPD A;  2GTJ A;  4RTV A;  4F16 A;  2DM1 A;  2YSQ A;  2CDT A;  4M4Z A;  2CH4 W;  2DL8 A;  3M0P A;  2JTE A;  2RQV A;  2L3Q A;  1GCP A;  4F14 A;  2D8J A;  3IQL A;  2CH4 A;  2LZ6 B;  3H0F A;  2XMF A;  4DEY A;  2ED0 A;  1U06 A;  1IO6 A;  1VYV A;  1W70 A;  1PNJ A;  3VS0 A;  1UHF A;  1PHT A;  2OI3 A;  2JS2 A;  4AFZ C;  2L3P A;  2DBM A;  1AWW A;  1I1J A;  1MV3 A;  2CSI A;  3SEM A;  3LH5 A;  4CC7 A;  3EG2 A;  2K6D A;  2EYX A;  2LQN A;  2CT3 A;  3A98 A;  3I9Q A;  4J9G A;  3EG3 A;  2KBT A;  1PKT A;  2EYZ A;  2D1X A;  1WLP B;  1GCQ C;  1OPL A;  2K3B A;  2EGE A;  1T3L A;  2A37 A;  4F17 A;  1TUD A;  1NLO C;  2DBK A;  2IIM A;  1G83 A;  1M3A A;  1QWF A;  3VRY A;  2KYB A;  4Z89 A;  2ABL A;  1GRI A;  2L3S A;  1ARK A;  2EVR A;  2LJ3 A;  4CC3 A;  3THK A;  1T0H A;  3NGP A;  2A28 A;  1ZLM A;  4RTT A;  2D0N A;  1NM7 A;  4WCI A;  1SRM A;  1E7O A;  1KIK A;  1PWT A;  2J6O A;  4HVW A;  3VS7 A;  1VYT A;  1I0C A;  2EBP A;  5I11 A;  2D8H A;  2ESW A;  4JJB A;  2DF6 A;  1K1Z A;  3R6N A;  1JXO A;  1UFF A;  2K2M A;  2LP5 A;  1VA7 A;  4ORZ A;  2DYB A;  1PRM C;  2DJQ A;  3M0T A;  2ROL A;  2JW4 A;  4J9C A;  1T0J A;  1JEG A;  1JQQ A;  2L2P A;  3RBB B;  1ZX6 A;  1WXT A;  4J9H A;  2HSP A;  1NEG A;  4JZ4 A;  2LJ0 A;  1ZUU A;  1SSH A;  1YWO A;  1UDL A;  2O9V A;  5GJW B;  4J9B A;  1ABO A;  2DRM A;  4RTW A;  1NG2 A;  3M0Q A;  3VS3 A;  4RTZ A;  1CSK A;  2CUD A;  1NEB A;  1BU1 A;  3TSW A;  2KXD A;  2GQI A;  2PZ1 A;  1YP5 A;  4GBQ A;  2VWF A;  2SRC A;  3NHN A;  2AZV A;  1ZUY A;  2J05 A;  4OMM A;  3NMZ C;  2EGA A;  1GFC A;  1N5Z A;  2KYM A;  2VKN A;  5IH2 A;  4D8D A;  1S1N A;  2O2O A;  3I5S A;  4A63 B;  3EHR A;  3CQT A;  2O88 A;  2CRE A;  1X27 A;  3VS4 A;  2O9S A;  1AWJ A;  1B07 A;  4LUD A;  4JJC A;  2K9G A;  1TUC A;  2KNB B;  2YT6 A;  1ZBJ A;  2KRM A;  2CSQ A;  4HXJ A;  1XOV A;  2PTK A;  1KJW A;  2NWM A;  1Z9Z A;  2YUP A;  1WFW A;  3QWY A;  4ESR A;  1VYU A;  1YWP A;  1WYX A;  4HVV A;  2JMA A;  3EG0 A;  1JO8 A;  2BTT A;  2EGC A;  4D8K A;  1Y0M A;  2KGT A;  1K76 A;  1BK2 A;  5IHN A;  2GTO A;  2HEQ A;  1K9A A;  1X2Q A;  1HJD A;  5IXB A;  2FO0 A;  1M27 C;  3JV3 A;  2A08 A;  1AZE A;  1GBR A;  1QWE A;  1SEM A;  2F2W A;  5IHK A;  2PNI A;  2HCK A;  1X6G A;  4J9E A;  4Z88 A;  3VRZ A;  3H0I A;  1SHG A;  2YUO A;  1GL5 A;  2J7I A;  2VVK A;  1JU5 C;  1M8M A;  5FWC A;  5GJV B;  1UG1 A;  1K0S A;  1UJ0 A;  2YDL A;  3ZL7 C;  3SHW A;  5FW9 A;  2RPN A;  1QKX A;  4LUE A;  4ZNX A;  2C0O A;  4R0K A;  2JT4 A;  2DNU A;  1AVZ C;  2H8H A;  3REA B;  2MIO A;  4X1V A;  2EYW A;  2SEM A;  2AKK A;  1M3C A;  1GCQ A;  1JXM A;  4OMQ A;  1EFN A;  2RQT A;  3I35 A;  1NLP C;  1T3S A;  2KT1 A;  3EHQ A;  4CC2 A;  4IIO A;  2KE9 A;  3M0R A;  3M0U A;  2AZS A;  1WA7 A;  4LNP A;  2O31 A;  1WIE A;  2RQR A;  2ECZ A;  1UUE A;  3H0H A;  1B3Q A;  1QCF A;  2LJ1 A;  2BZX A;  2LX7 A;  4KRT A;  2W10 A;  2HBW A;  1CKA A;  1WI7 A;  2C0I A;  2CT4 A;  1J3T A;  3UA6 A;  1I07 A;  2JMC A;  4J9D A;  2KRN A;  2CUB A;  2AKL A;  1RI9 A;  1YNZ A;  4QT7 A;  1Y57 A;  2JS0 A;  1UJY A;  2DRK A;  1E6H A;  3UF4 A;  2DLP A;  1GFD A;  1AZG B;  1OPK A;  2ED1 A;  3EG1 A;  1HD3 A;  1FMK A;  1X69 A;  4FSS A;  1U3O A;  2FG0 A;  2DE0 X;  1WX6 A;  2EYY A;  1MUZ A;  1AD5 A;  2DL3 A;  4JJD A;  3C0C A;  2V1Q A;  1KFZ A;  1A0N B;  2V1R A;  3GBQ A;  1M30 A;  1MV0 B;  2JXB A;  2BZ8 A;  3QWX X;  2ENM A;  1W6X A;  1PKS A;  3H41 A;  2RMO A;  2MCN A;  1RLP C;  1X6B A;  1W1F A;  4HCK A;  1H8K A;  4J9I A;  4HVU A;  1CKB A;  3TSZ A;  2EQI A;  2FEI A;  1UHC A;  3VS6 A;  2F2V A;  1H3H A;  4J9F A;  2DX1 A;  3KFV A;  4OMO A;  5L23 A;  5IHI A;  2K7A A;  2GBQ A;  2AK5 A;  2OAW A;  3U23 A;  1YN8 A;  4AG2 C;  4AFQ C;  1RUW A;  1LCK A;  2A36 A;  2DL4 A;  4AG1 C;  2J6F A;  2X3X D;  2B86 A;  2DA9 A;  2RNA A;  3EGU A;  4DEX A;  4LE9 A;  5EC7 A;  4OMN A;  2LNH B;  4RTX A;  3UAT A;  2RN8 A;  1QKW A;  1E6G A;  2G6F X;  1U5S A;  2JM8 A;  3PVQ A;  5I22 A;  3I5R A;  1K0X A;  2ROT A;  1AWO A;  5ECA A;  1BB9 A;  2E5K A;  2DMO A;  1QLY A;  1ABQ A;  3REB B;  4EIK A;  4Y92 A;  2KRO A;  3FJ5 A;  1OOT A;  3VS1 A;  1ZUK A;  2FRW A;  4RTU A;  1Z9Q A;  4CC4 B;  4K11 A;  1AOJ A;  1M3B A;  3VS5 A;  2W0Z A;  2LQW A;  1OV3 A;  2DVJ A;  1RLQ C;  2RF0 A;  3VS2 A;  2KEA A;  2GGR A;  1YCS B;  2RQW A;  2QDL A;  1BBZ A;  3TVT A;  4AFU C;  1ZSG A;  1G2B A;  1NYF A;  1SRL A;  2JM9 A;  4AFS C;  5IXF A;  4RTY A;  3RNJ A;  1V1C A;  4E6R A;  2NUZ A;  1AWX A;  2K79 A;  1X2K A;  2FPD A;  1SPK A;  2M51 A;  3ULR B;  3M0S A;  1SHF A;  2MOX A;  4OMP A;  2RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...