3NGPA

High resolution structure of alpha-spectrin sh3 domain mutant with a redesigned core
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLVLYDYQEKSPRELTVKKGDILTLLNSTNKDWWKIEVNGRQGFVPAAYLKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of an alpha-spectrin SH3-domain mutant with a redesigned hydrophobic core.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ngpA00
3M0PA 1GCPA 1T0JA 4CC4B 2YT6A 3GBQA 1M30A 3EGUA 4LNPA 4J9EA 1M3BA 1AWOA 1SEMA 1H8KA 3SEMA 3SHWA 3EG2A 5GJVB 2KRNA 1RI9A 2CSQA 2KEAA 2RF0A 2YUOA 3THKA 1AOJA 2LQWA 1UE9A 2BZYA 2CDTA 2FG0A 1FMKA 3VS3A 2KBTA 1PKSA 3H0FA 4RTVA 2VVKA 3R6NA 4Z89A 2PTKA 2FO0A 2VKNA 1UUEA 1CKAA 2KR3A 2D8JA 4AFSC 2CUBA 3VS1A 3VS2A 3QWYA 2W0ZA 1YP5A 2GBQA 1HSQA 2LMJA 1GCQC 1N5ZA 3UF4A 2RQVA 1BB9A 4OMMA 1ZLMA 4OMQA 2MIOA 2CSIA 3FJ5A 2OJ2A 1UHCA 1VYTA 4HVWA 4RTUA 2DNUA 2DA9A 1U06A 2L2PA 2EGAA 2K79A 1WFWA 1WXBA 3M0QA 1X6BA 2RQWA 1MV0B 1ARKA 2FPFA 2E5KA 3I9QA 5EC7A 4RUGA 2RQRA 4LN2A 2EPDA 4HXJA 2C0OA 3M0RA 1ZUYA 1HJDA 3M0TA 2EYXA 2SRCA 3UA6A 2K9GA 4RTXA 2JMAA 1VA7A 2J05A 2ENMA 1EFNA 1UTIA 2EGEA 5FWCA 2KYBA 2CREA 4D8KA 5GJWB 2CH4A 2LJ1A 4AFZC 2FEIA 4IIOA 1JQQA 1M3AA 2L0AA 1ZSGA 3I35A 1H3HA 3NPFA 4CC2A 2FPDA 2YUNA 1B3QA 1KSWA 1OPLA 4DEYA 1MUZA 1ZUUA 1AWWA 4RTYA 1QKXA 2DMOA 2ROTA 4FSSA 1E7OA 2O9VA 2KRSA 2RNAA 1CSKA 2AZSA 1NLPC 2KNBB 1ZX6A 2HBWA 4J9DA 2M51A 5FWBA 2EBPA 2DL4A 2KYMA 2FRYA 1BBZA 3VS5A 5I11A 1S1NA 2J06A 1M27C 4OMOA 1X69A 3TSZA 1K4US 1WA7A 1NEGA 2JS2A 1K0SA 4HVVA 4RTZA 1UHFA 2DRMA 4JJCA 2W10A 1J3TA 2MCNA 1W70A 4AG1C 2NUZA 3ULRB 2ECZA 1PRLC 1ZBJA 3KFVA 2EQIA 3RNJA 5IH2A 1PKTA 1SRMA 2KT1A 3C0CA 1G2BA 2EKHA 1HD3A 5IHNA 2FPEA 4ZNXA 4GLMA 2DRKA 1JXMA 2A36A 2F2VA 2JM9A 1UG1A 1UDLA 1SHFA 2GNCA 1WXTA 2YDLA 4RTTA 2SEMA 1AZEA 1IO6A 1GRIA 1WX6A 2NWMA 2ROLA 2VWFA 2KXDA 2EYZA 1Y57A 2J6OA 2KT8A 2DL3A 1ABOA 3VS6A 1WI7A 2CH4W 2RMOA 2DM1A 2EW3A 1K1ZA 1BK2A 1TUDA 2DBKA 1UJ0A 1AWJA 2EYYA 1ABQA 1YN8A 2F2XA 3O5ZA 4ESRA 1KIKA 1AWXA 2J7IA 2AKKA 4LUEA 2DL5A 1JEGA 2J6FA 2JM8A 5IHIA 2GTJA 1QCFA 2FRWA 2LQNA 2DL7A 3H41A 4E6RA 4Y92A 1Z9ZA 4ORZA 1LCKA 2HSPA 5ECAA 2A28A 5I22A 2LCSA 1U3OA 1JXOA 2HEQA 3A98A 2X3WD 2HCKA 1ZUKA 4F17A 2DYBA 3CQTA 4HVUA 3VS0A 1UFFA 4J9FA 1QKWA 2O88A 1I07A 2A37A 1X6GA 2O9SA 1NYFA 4J9IA 2I0NA 2K3BA 1YWPA 2GQIA 1T0HA 3EG3A 3PVLA 4AFQC 2LJ0A 4J9HA 2EGCA 1PNJA 1U5SA 2A08A 4JJBA 1PWTA 3H0IA 1H92A 3M0UA 2GTOA 2YSQA 2DL8A 2PNIA 2IIMA 1E6HA 3JV3A 2OI3A 2K2MA 1SHGA 2CT3A 4AFUC 2CUDA 2KROA 3NHNA 3QWXX 5FW9A 2BZ8A 2O2OA 4OMPA 4X1VA 3EG0A 1VYVA 1WIEA 1JU5C 2RQTA 4A63B 2KE9A 2ABLA 1BU1A 3U23A 2KGTA 2DBMA 2YUPA 1AEYA 4WCIA 2D1XA 3EHRA 3RBBB 4KRTA 2DILA 2LZ6B 2ED0A 2KRMA 4GBQA 2AZVA 2C0TA 1W1FA 5IXBA 1E6GA 2KXCA 1GFCA 1KJWA 4K11A 1NLOC 4Z88A 2EVRA 1WLPB 2LX7A 4J9CA 3VRYA 2RQUA 2F2WA 1A0NB 1PHTA 2LJ3A 2L3PA 1X2QA 1B07A 1AZGB 3VRZA 4M4ZA 4JJDA 1WDXA 1SPKA 2JT4A 1RLPC 2G6FX 2D0NA 3IQLA 2EYWA 4J9BA 1NYGA 3VS4A 2O31A 3LH5A 2HDAA 1GBQA 2RPNA 2XMFA 1SRLA 3TSWA 5IHKA 1OOTA 1AVZC 3EHQA 1GCQA 1UGVA 2P4RA 4JZ3A 3ZL7C 2YUQA 1FYNA 2JXBA 2JS0A 3NMZC 1UECA 1M3CA 2C0IA 2L3QA 1NG2A 1WYXA 3EG1A 2OAWA 2BTTA 1QWEA 3I5RA 2ED1A 2J6KA 1UJYA 1YCSB 1Z9QA 2GGRA 2B86A 4AG2C 1KFZA 1V1CA 1I0CA 1X2KA 3REBB 3M0SA 2DF6A 1T3LA 1JO8A 2D8HA 4RTWA 1K0XA 1I1JA 2H8HA 2ESWA 3PVQA 4EIKA 4OMNA 2JMCA 1GBRA 4JPBW 1T3SA 2CT4A 1GL5A 4CC3A 3H0HA 4LE9A 2L3SA 1YNZA 1OV3A 4OMLA 2DX1A 1W6XA 2DJQA 4HCKA 4F14A 1X43A 1NEBA 1M8MA 1QLYA 1TUCA 1OPKA 2RN8A 3UATA 1RUWA 1Y0MA 2QDLA 2AKLA 2PZ1A 2DLPA 3PE0A 1SSHA 1NM7A 1CKBA 1PRMC 1QWFA 4R0KA 4F16A 2K7AA 1RLQC 4Z8AA 4IIMA 2LP5A 4D8DA 1YWOA 1X27A 4LUDA 4QT7A 4J9GA 5HCKA 1AD5A 2JTEA 3NGPA 3TVTA 2BZXA 3REAB 2V1RA 1XOVA 2V1QA 1K9AA 1G83A 3VS7A 4DEXA 2JW4A 1VYUA 5IXFA 1WXUA 1K76A 4CC7A 2DVJA 2AK5A 2LNHB 3UA7A 2X3XD 2MOXA 1OEBA 3I5SA 5L23A 2DE0X 1GFDA 2M0YA 1MV3A 2K6DA 1TG0A 4JZ4A
chains in the Genus database with same CATH superfamily
3JB9J 1OULA 2E12A 2X35A 1G8XA 2A7YA 3GBQA 2F1LA 4DQ2A 2OTJQ 1M30A 4C92D 1OU8A 3SHWA 2VUBA 3SEMA 3EG2A 3F70A 2JVVA 2KEAA 2XDPA 2RF0A 3FEOA 4C92E 2DXCA 2FG0A 3QG1A 5HK3A 2L8DA 4Y91A 3VS3A 2KBTA 3H0FA 4ATOA 3R6NA 2PTKA 2FO0A 1CKAA 4F7UB 5GANf 3G1JA 5CKDA 3CCLA 4MZPA 3CCMA 3CCQA 3CC7T 2OTJT 3QYHB 1IHVA 2GBQA 3JAME 1W4SA 2LMJA 3CMAA 1YI2A 1C1AA 1X6OA 5KYUA 2EJGA 1SSFA 1VQKA 2MIOA 2CSIA 2OJ2A 1VYTA 1LVKA 1KQ1A 4OB1B 5GAN7 4JS5A 4MDXA 4RTUA 2MWOA 2MYSA 1U06A 3BE3A 3CCRA 2DEQA 5CR2A 3I9QA 2R5MA 2R5AA 1NZ9A 4RUGA 2QASA 2EPDA 3CPWS 1RAGB 3M0RA 3M0TA 2CZ6B 3UA6A 3CBPA 2K9GA 1YJ9T 4KUIA 2K3YA 1ZBXA 1MHNA 3M57A 1F1BB 1OI1A 3MEWA 2KYBA 2CREA 3OYIA 3VU3C 4ZTFA 1ZSGA 3I35A 2M9UA 1H3ZA 1KSWA 1OPLA 4A53A 1M8VA 3PMTA 1ZUUA 3KBGA 2RK2A 4M78B 4ANJA 3OYKA 1I5OB 3OS2A 4A4GA 1VQOT 2RJFA 2NUTB 2M51A 5FWBA 2COYA 1VQ5T 1IHWA 2EBPA 4OB3B 3E9GA 2DL4A 3S3NA 1BBZA 2ZPFB 1VQ8T 5I11A 1SG5A 4OMOA 1M27C 4LD9K 2QTXA 1WA7A 5L8RE 2CS7A 4BACA 1UHFA 1ZSZC 4JJCA 4RG2A 3EH1A 1YJ9A 1J3TA 2MCNA 5KCHA 2DD4A 2HD0A 1PRLC 4OP0A 2WSFE 1VQ9Q 3S3MA 1KQSA 5IH2A 1PKTA 3CC2Q 1SRMA 1QVFA 3MJXA 3M4GA 3OB9A 1G2BA 4M7AG 1HD3A 4XTYA 1YJNQ 4M75A 2HNIA 5LJ3d 3URGA 4M77D 5GMKi 5KYXA 1UDLA 3JCMW 3GF5A 2DFUA 2GNCA 2YDLA 5GAN2 2SEMA 1WX6A 2NWMA 2KAFA 4M7AB 5CQXA 4ZN3A 2KXDA 1M90U 3ZBDA 4ZGDB 1Y57A 4M78E 3C12A 5GAOm 2KT8A 4KT0E 2DL3A 3G4ST 4DBFA 4A4HA 3VS6A 3PT9A 2V8KA 3I55T 1NPPA 3PNWC 3AHUA 3G71T 2EW3A 1D0YA 2HKNA 4HKEA 2WACA 1YN8A 4ESRA 3O5ZA 1KIKA 3LLRA 4M77C 4P5NA 1JEGA 5I21A 4FT2A 2GTJA 1QCFA 2RI3A 2DTOA 1WZOA 3X20B 2BE7D 3LX7A 2XDDA 2F5KA 4DBRA 3M4YA 3RUXA 3MPUB 2HMAA 4HA8A 4C92C 3A8MB 3OSVA 2QG9B 3HKSA 3PMIA 3I55Q 2X3WD 2HCKA 2DYBA 5KE3A 2GFAA 1MNDA 3VS0A 2HL3A 3VYGA 2O88A 2P4TA 4BI8B 1W2BA 2I2LA 2A37A 4BB7A 1G3TA 4J9IA 3QXEB 2X4WA 3AT1B 1JJ2P 1YWPA 2GQIA 3CCQT 1T0HA 3EG3A 3QSUA 4J9HA 2EWNA 2A08A 2O4XB 2DTHA 3C95A 1PWTA 4LDYA 2G3RA 2E6NA 1YIJA 4F04B 1X01A 2YSQA 3HTRA 3DLLA 1MNEA 3JV3A 4C8QD 2RO0A 2K2MA 1SHGA 4F7UA 2CT3A 2CUDA 2KROA 2YLCA 3NHNA 1Q81U 1BI1A 3A1PA 3QWXX 5FW9A 2JZ2A 4OMPA 3GOXA 1Q86U 4QKUA 2E41A 3U23A 2KGTA 4M75B 3EHRA 3RBBB 1JJ2A 3T9NA 3LGFA 5KE2A 3JCMX 2C0TA 1W1FA 3SB2A 1NLOC 2LC4A 2EVRA 1WLPB 5GMKl 4J9CA 2FVUA 2KVQG 5CVIA 4ZN1A 3CCST 1K73C 2Y4XA 3VRZA 4M4ZA 4JJDA 5I2MA 1WQWA 1WDXA 1TUGB 3G6EA 2EYQA 1RLPC 2G6FX 4KUDK 3I56A 1TOVA 4KGZB 2D0NA 3JCMV 1R0BG 2EQJA 1VQMT 4XQ3A 3FRNA 1NYGA 3QHSA 2E70A 1B34B 1GBQA 1MMAA 5FU6B 2XU8A 4PJOG 5FRMA 2L3RA 9ATCB 5KYUB 1OOTA 4IKFA 1AVZC 3JRZA 1UGVA 2KDSA 1FYNA 3CMAQ 3JCMQ 3NMZC 5LJ5g 3UWNA 3VJPA 4E7KA 3M9QA 4XTWA 3RKXA 2BTTA 1G3YA 1QWEA 2XICA 4KH0B 1VQ4A 3PGGA 2YRCA 2B86A 3ME9A 3H6ZA 1BIAA 1KFZA 4PLIA 4MZTA 4PJOC 4OB0B 1NJIR 4J6WA 2DF6A 2WSEE 1T3LA 4ZTJA 4AMCA 2D8HA 2H8HA 1GBRA 3L2WA 5HKCA 3PTAA 1R0CB 3CC7A 3QJYA 1VQMA 2VYTA 4CC3A 4M78A 5FU6C 3SWNC 2RJCA 4OMLA 2XK0A 1W6XA 2DJQA 1U8RA 1RAAB 1X43A 1TUCA 3UATA 2QDLA 2IVWA 1N9SA 4FM4B 2PZ1A 2DLPA 1VQKT 1PD0A 4XTVA 3HRTA 4F16A 4JRPA 3TU4K 4Z8AA 1RI0A 3CCUQ 1LJOA 2OX7A 4EDUA 3CCJT 3VV0A 3CCQQ 2JTEA 1TH7A 1Y07A 2BZXA 4HT9A 3RESA 2V1RA 1ZQ1A 3V7CA 4C8QF 4BY6C 1KC8U 4DEXA 2D0QB 4J5YA 1QCOA 2ZPGB 1WJSA 1VQ4T 1K76A 1QP3A 3QZ5B 4QQDA 5DLQE 5LL6S 3CCEA 4M78G 2AK5A 2LNHB 1VQ9A 2MOXA 1OEBA 3CMET 3MP8A 4JZ4A 1G5VA 1GCPA 2YT6A 2FZCB 2OAUA 2DPPB 4X34A 4FCYA 1AWOA 3OA6A 1SEMA 2KRNA 2CSQA 1UB4A 2QI2A 1M90R 2M0OA 3THKA 1PD1A 1YIJT 2LQWA 1Q81R 1N8RC 1TTHB 5GAN4 1VQ8A 1S72Q 1PKSA 1XJWB 4RTVA 3TREA 2AIRB 4Z89A 1TWBA 2VKNA 1UUEA 2YLBA 3LW5E 5CIUA 1LPLA 3CMEQ 2KR3A 3JB9D 2CUBA 3VS1A 3CCJA 3VS2A 2ZPEB 4C92B 1YHQT 1HSQA 3V8LA 1VQ7T 4QQGA 1N5ZA 2HQXA 1IXDA 3P8HA 1Q95G 4OMMA 3GIBA 4OMQA 2JUFA 3EGXB 3FJ5A 3QIIA 1UEBA 4HVWA 1D1BA 4M7DD 1M90C 2DNUA 2CP3A 2DA9A 2O01E 2EGAA 2K79A 4E2FB 5LJ3j 2RQWA 1ARKA 3ZFJA 2FB7A 2X4JA 3CCLT 4XAXB 2LTOA 3RDVA 2RQRA 2FYKA 3A5ZB 2OTJA 3CC2A 5LJ3h 3CCRT 3NFCA 2C0OA 1ZUYA 2EYXA 4RCCA 4RTXA 2JMAA 5GAOq 1VA7A 2J05A 4N4GA 3JB9H 1EFNA 4IUTA 5A0DA 4M7DC 4D8KA 5KYWA 5GAOp 1KK7A 3CEYA 1VQNA 1H3HA 5GANh 5A0GA 3OS1A 1B3QA 4DEYA 1BCOA 4XTXA 1AWWA 3CBMA 2DMOA 4PFOA 3CCLQ 2O9VA 2KRSA 2DIQA 1OQKA 2AZSA 3JCMh 1B34A 2HBWA 2KNBB 5LJ5j 5GAN5 1HK9A 1MMNA 2KYMA 4M7AF 3RERA 5EG2A 3HFOA 1VQKQ 2Y90A 1N27A 5GMKh 1K4US 1QVFS 3QZ9B 1YJWA 3P8DA 5M9OA 1K0SA 4HVVA 1WGSA 4RTZA 2COWA 1BIBA 4WTOB 1IREB 1QCNA 4KGVB 1VQLQ 5GAMd 3CC2T 4AG1C 1TXQA 5IN1A 2EQIA 3RNJA 2KT1A 3CC4A 2EKHA 4C92G 1KG1A 4GLMA 5GAMf 4L5GA 4R56A 1JXMA 4CRIA 4M78C 1K9MC 2V26A 4Z02A 2F2VA 3HP9A 1SHFA 1K8AU 1I5LA 3P8BB 1AZEA 2IPOB 4FL6A 4C0FA 4X9CA 1Q86R 1BKBA 4JRQA 2DXTA 3A8OB 1WHMA 3FLGA 2EYZA 4HT8A 2J6OA 1YIJQ 1KQSP 4R55A 1WI7A 4O6JA 3QDFA 1RAEB 2RMOA 2RA2A 1BK2A 4CI0C 3OYYA 2HL5C 2L89A 3MEVA 1AWJA 2EYYA 1ABQA 3CC4T 3WXMB 4DOWA 3CCMT 4LUEA 2PVGB 2JM8A 5IHIA 3OYJA 1BI0A 2FRWA 2XDBA 4E6RA 3M53A 4ORZA 2HSPA 4QQ6A 1LNXA 2A28A 5I22A 2LCSA 2P0PA 5J3BA 1QVGA 3A98A 4F7UE 2YWWA 4LDXA 3OYCA 1ZUKA 5FRNA 2JNGA 1WNLA 5GANe 4J6YA 4HVUA 1FMVA 2AT1B 2DZ9A 3SFMA 3G6EQ 1I07A 1X6GA 1NYFA 2I0NA 2K3BA 3OS5A 4ME7A 2GFUA 3PVLA 2LJ0A 4JJBA 2Y4YA 3H0IA 1H92A 3CCUA 2DETA 1KQ2A 1VQPQ 2OI3A 3RIRA 3X26B 3MHXA 1KC8R 3HSBA 2HKQB 2MI6A 3MP6A 3M56A 1NJIU 2O2OA 1UGPB 2RQTA 3OYGA 1BU1A 2HQEA 5LJ5f 1AEYA 1ZA1B 4KRTA 2HQHA 3EG9B 2XIDA 4RG8A 2LZ6B 4JLIA 1QVFP 4O5VA 2IG0A 1E6GA 2P0QA 4M7DE 2F2WA 3D7SB 5LJ5e 5D6YA 3GLXA 3QO3A 4QW2A 2L3PA 1YITQ 1U1TA 2F69A 1AZGB 2K3XA 1Q82R 2R57A 1NPRA 2FZGB 2JT4A 1VQMQ 1S72A 3S3OA 4LXCA 2CZ7B 3EFOB 3OYDA 2O31A 3MCAB 5GMKm 2VASA 2CZ0B 2JTMA 2RPNA 4DBQA 3BDLA 3CCET 4IUVA 4FW2A 5IHKA 1OZ3A 1GCQA 4JZ3A 1V76A 4EMKA 2KK4A 2MMPA 1M3CA 4E7IA 2L3QA 4Q5WA 1NG2A 2QQRA 1WYXA 1M5Q1 2CP2A 4OVAA 1QP2A 1FX7A 4FW1A 4J7IA 3OBYA 2GGRA 2DK3A 2YRVA 1M1GA 2D6FA 3M58A 1I0CA 1O9SA 2DJZA 4J8OA 3CCEQ 3M0SA 2ZPHB 4PJLA 3DB3A 1M1FA 4IUUA 2V8JA 4RTWA 1X75C 1I1JA 3CD6Q 3DKMA 4YTLA 2X9HA 3QPHA 3I56Q 3H0HA 1IGUA 3CCVQ 3ASKA 3SWNB 1P92A 1NEBA 1M8MA 1OZ2A 4EMGA 2OTLQ 2M16A 2RM4A 1Y0MA 1B7TA 2DAQA 2EQUA 4PFPA 2M1HA 1PCXA 1Y7XA 2KY9A 2DIGA 4PKCC 4PLLA 1NM7A 1PRMC 1QWFA 1RLQC 4C8QA 2NUPA 1YWOA 2YRDA 4E7LA 4LUDA 4M7DB 4HCBA 4M78D 2RHUA 3CCJQ 1AD5A 1C0MA 3TVTA 3OYFA 1EZZB 3REAB 2QA4Q 3A8LB 2CP0A 3LWIA 1BI3A 2K5IA 1VQPT 3L1AA 1VQ4Q 1G83A 3L2RA 1VYUA 4M75C 2RHIA 2RB6A 3X25B 4OF1A 2HBPA 4FYXB 1I8FA 3CC4Q 2DE0X 1KD1R 1RACB 2K6DA 3E2UA 4LDWA 4UC4A 3CC7Q 4HCCA 4LNPA 4J9EA 1C6VX 1M3BA 3QDRB 2E6ZA 2X51A 5GJVB 4V2SA 5AT1B 1RI9A 4C8QG 3VYHB 5CCAA 3OYAA 2DXBA 1UE9A 5GAOn 3CPWA 1VQNQ 3SD4A 1QVGP 3GPLA 5KH6A 3QYGB 3L42A 2DTIA 2RH2A 2D8JA 2CKKA 3BW1A 3R6OA 1GCQC 2QDYB 2RQVA 1BB9A 1YHQQ 2XD0A 1WQ7A 4VUBA 5D6WA 1UHCA 4M77B 4FT4A 3L2VA 1RL2A 4D6WA 1WXBA 3M0QA 1RAFB 3TEEA 1MV0B 2E5KA 1K8AR 1PSFA 4IUQA 1RABB 4HXJA 2MK5A 4Y28E 5KYNA 2EIFA 3OS0A 4OGEA 4PJOD 5IAYA 2QQ9A 2ENMA 1IRXA 2KQWA 1UTIA 5FWCA 4XU1A 4M7DA 5GJWB 2FEIA 2ATCB 1M3AA 3HPWA 4CC2A 2YUNA 3VUZA 2AHJB 4JRKA 2EAYA 5LJ5h 4PJOF 3OBWA 2E1HA 2LVMA 2ROTA 4LD6A 2RNAA 5GAMe 1NLPC 4QVDA 4J9DA 2BUDA 5LJ3e 4JLGA 1S1NA 2J06A 3DB4A 4M75G 1X69A 3TSZA 4PL6A 4J6XA 4NOYA 3L2QA 2E3IA 1RAIB 1WJRA 1VQLT 2EFIA 3J81E 1W70A 3FB9A 5CK9A 2QA4T 2NUZA 3ULRB 2QQBA 3HRUA 1FWZA 1M2VB 2A3LA 2E5QA 1XTDA 1WHHA 2VXFA 2NYSA 5IHNA 3FC3A 2FPEA 2VXEA 1KHIA 4ZNXA 3M5AA 1M1KC 3MP1A 4C5HA 2DRKA 1DJ7B 3JCMb 1YJWT 3GNFB 2A36A 2RK1A 2CZ1B 5FROA 2E3HA 2PUKB 3JSCA 2JM9A 5CQYA 2DO3A 2GF7A 4RTTA 4BE2A 1IO6A 1FXXA 4BDZA 4ZGEB 3CMAT 2V8IA 3ZEHA 3I56T 3BFMA 3V7SA 2VWFA 5GAN3 1N8RU 1VQ9T 3CCVT 4BI4A 2R58A 3CPFA 3PIPA 5KYYA 3CMEA 2EJFA 1D3BB 3OYNA 1YJNT 2RI5A 2EQMA 2CH4W 4MMLA 1YJWQ 2FHDA 2DM1A 2NUPB 1K1ZA 3DLMA 3VKIA 2DBKA 2DVEA 4NL2A 2QAZA 1UGRB 2F2XA 2J7IA 2AKKA 2DL5A 2J6FA 1VQLA 4XU3A 5KYWB 2LQNA 3H41A 4TVRA 2LQ8A 4E7SA 4Y92A 4N0AC 2ZPIB 1LCKA 5C6SA 3E19A 3CBOA 1VQ6A 2JN0A 3E1SA 3G4SQ 1WHGA 1V29B 1U1SA 1JXOA 2HEQA 4II1A 3S6WA 4NS5A 4BDYA 6AT1B 4E47A 1S72T 4M77G 1UFFA 4J9FA 1QKWA 3CCVA 3N5BB 2XKOC 2PU9B 2O9SA 4PJOB 3EGXA 4AFQC 1IZ6A 4E7ZA 2EGCA 1PNJA 4M77E 1SKUB 5GMKe 2DL8A 2PNIA 2IIMA 3L2ZA 1M9SA 4M7DG 1VQNT 1Q82U 1I4K1 2X4XA 4AFUC 3CCSQ 3H9NA 4FSXA 2GCXA 2KMTA 2LX9A 2XHCA 2BZ8A 4E7HA 1QVGS 3EG0A 1VYVA 1WIEA 2HZYA 5GAMj 3LGLA 3CXCP 4XTUA 4A63B 2KE9A 1VQOQ 3NTIA 2DBMA 4C0DB 4WCIA 4OGCA 4X9DA 3GP8A 4F7UF 4JUVA 2DILA 1WHKA 2ED0A 2KRMA 2YXYA 4GBQA 4ELZC 3JCMd 1G3SA 1KJWA 3LWHA 2QYZA 4M77A 4BI3A 4L59A 4Z88A 3EG9A 1YITT 1D1CA 4PJOA 1PHTA 2LJ3A 2QEXQ 4IUPA 1VQ6T 2COZA 1X2QA 2MF2A 1VUBA 4BUGA 4M75F 1SPKA 1HYOA 1K9MR 2ZAEA 1XQHA 1Q7YC 3IQLA 3JCMc 1O75A 4KH1B 4E7JA 1KD1C 2A0FB 3VS4A 1QQJA 2JJ9A 3CPWP 2LCLA 1Q81C 4M7AC 2DXUA 3LH5A 1VQ7Q 3PIOA 1D0XA 2OTLA 4C0GA 2MAMA 1ZA2B 1VQPA 1G3WA 2BKDN 1FMWA 1YBYA 3J80E 1Y71A 3O8VA 3C94A 5J26A 4BE1A 2PUOB 1Q7YR 5A2QE 4EMHA 2YUQA 2JXBA 2JS0A 1NBEB 2C0IA 2RJEA 1YHQA 2QXFA 3EG1A 2QTVA 4BY6B 1Y96B 2LT4A 1VQ5Q 4C5GA 3I5RA 2ED1A 2J6KA 1YCSB 3CCRQ 5GANj 4AG2C 1X2KA 5GMKj 2KSSA 2H3JA 2P84A 2RI2A 3REBB 4M75E 1YITA 2LRQA 1JO8A 1QVPA 3HHTB 1K0XA 8ATCB 2PVDB 4DOVA 4EIKA 5DLOA 2JMCA 4JPBW 5DY9A 1M2VA 2GQVA 4M75D 1HXDA 4NL3A 4B9WA 1QMCA 3CD6T 3J7AF 2JTFA 2CT4A 2B8AA 2L3SA 3NTKA 8AT1B 1OV3A 2WSCE 2DX1A 2K5FA 5FLXE 4F14A 1QLYA 1OPKA 2DERA 2AKLA 2C06A 1VOMA 4PJMA 4A4FA 1AT1B 3SWNA 4B9XA 2K4YA 1MMDA 5A0LA 1PSEA 4IIMA 2LP5A 3RMQA 3CCMQ 1BI2A 4ZGJB 4DA4A 4C8QB 2PVOB 1NJIC 1RAHB 5IT9E 1XOVA 2V1QA 1K9AA 5CKBA 1BYMA 3ER0A 3HFNA 2JW4A 5LJ5d 4F7UG 3G71Q 2DVJA 1EIFA 3M59A 5I2SA 2X3XD 1UGQB 3INZA 3V8JA 5L23A 4M7AE 2VB6A 1MV3A 3CD6A 3CCUT 4RMOA 2NLUA 3M0PA 1T0JA 4CC4B 2BE9B 3G6ET 1N6AA 3OMCA 4LDVA 3EGUA 5AYFA 1H8KA 4XK8E 4EMKB 3X24B 2E4HA 2YUOA 2QEXT 1AOJA 2BZYA 5KYYB 2CDTA 3LYIA 1FMKA 1D3BA 1JBMA 1I81A 4DBHA 3MO8A 1M1KR 2VVKA 1ZSZB 4C8QE 3CXCA 3OQ5A 3EAEA 3L2UA 1VIFA 2BIVA 5CKHA 4XU0A 1KC8C 3UPUA 3OMGA 2EKOA 3Q1JA 4AFSC 5FU7C 3QWYA 2W0ZA 1YP5A 1JJ2S 5GAMg 2RHYA 5KYXB 2QA4A 3UF4A 3OYHA 1ZLMA 5FU7B 3SDZA 1OX9A 3X28B 3JCMJ 2L2PA 1WFWA 3EFOA 1X6BA 2FPFA 3CXCS 5EC7A 3KXTA 3EFSA 4LN2A 2CYZB 3KUFA 2JOYA 4RKUE 1HJDA 2SRCA 1W2BS 2E10A 1YJNA 3WVDB 3PFSA 2EGEA 4PJJA 1K73R 3HRSA 4C5IA 2CH4A 2LJ1A 4AFZC 4IIOA 1JQQA 4BD3A 2L0AA 4PJOE 4AT1B 3NPFA 2FPDA 2LCCA 3C4SA 1MUZA 4MDWA 3TCJA 2NUTA 4RTYA 1QKXA 1M4ZA 4FSSA 1E7OA 1MGQA 3BDUA 1WPYA 1CSKA 4OB2B 4WF2A 5GAMh 1TS9A 2RHXA 1ZX6A 4FYVB 4OMFB 3V7RA 1K8AC 1TU0B 3HL8A 3OY9A 1AHJB 2FRYA 2DD5A 1Q86C 3VS5A 2ZGWA 4C92A 1NEGA 2JS2A 3RR6A 2O4XA 2ZCFB 4FYYB 2DRMA 3FJPA 2YHTA 2W10A 1Y96A 5LJ3f 2ECZA 1ZBJA 3EGDB 3KFVA 3C0CA 1K9MU 4GLKA 2QK0A 2DYIA 1ZSZA 1K73U 3G4SA 3OYLA 2QGGA 4C0DC 4RCBA 3I55A 2RHZA 4B6MA 4JJNK 3QUIA 1YI2T 4M78F 2EJ9A 4FYWB 1UG1A 4QVCA 1D09B 2LDMA 1WXTA 5J39A 1GRIA 2K57A 4A4EA 1WHLA 1VQ7A 3RKYA 1PG5B 2ZZDA 1ACMB 4C0ZA 2ROLA 4KGXB 3MKDA 2D9TA 2QQSA 2DZCA 2PQWA 3LH0A 1ABOA 1BCMA 3RKWA 2HSEB 4IURA 3JCMg 3OW2P 2L5QA 5GAOl 4HCZA 1VQ5A 4N0AA 2FZKB 1YI2Q 1TUDA 3MEAA 1UJ0A 1AWXA 2FL7A 5DM7R 3M54A 4PFZA 1WJQA 1SF9A 3EH2A 3MEUA 4C5EA 5GANg 5LJ3g 2DL7A 4J7FA 1Z9ZA 3JCMf 1OYXA 1R8OB 5ECAA 3FIFA 5C0MA 1NE8A 1U3OA 3FDRA 2MWPA 4F17A 5CO7A 3CQTA 4QVZA 5HK0A 1W2BP 1VIEA 3JCMP 5D6XA 2LQKA 4A4KA 4JS4A 1U5SA 3RMSA 3OSSC 3VUBA 4ELYC 2H3EB 1D1AA 5CAIA 3M0UA 2GTOA 4PK4A 1E6HA 5KCOA 3OYEA 1D0ZA 2CP6A 4L6V5 7AT1B 2K5LA 2KI7A 4X1VA 5GANd 2Z0WA 1JU5C 2ABLA 2K2VA 2YUPA 2D1XA 2XG8D 2X4YA 3G71A 2AZVA 5IXBA 2KXCA 3A8GB 1GFCA 4C8QC 4K11A 1YJ9Q 4BE0A 2DKGA 1VQ6Q 2LX7A 1Q7YU 3VRYA 2RQUA 3TQ7P 3UDCA 4A54A 4M7AD 1A0NB 1KD1U 2XI9A 1IB8A 3QJ6A 1B07A 2RD1A 3M55A 4M77F 2MPXC 3QKJA 2LT1A 5GAOr 2LNVA 4PNOA 1M1KU 1JRIA 2VV5A 3G7ZA 1H641 2EYWA 4J9BA 4EMKC 2HDAA 3EFRA 2XMFA 5CKEA 3OW2A 1YFNA 1SRLA 3TSWA 3EHQA 2HAXA 2P4RA 3ZL7C 4KULA 4LDUA 2F5TX 1LOJA 3JB9G 1UECA 4M7AA 3GNGA 1N8RR 1VQOA 3OYBA 1Q82C 1EX4A 3QBYA 4C92F 2QQAA 1RADB 1KQSS 2OAWA 4KBMB 3WVEB 2P0KA 4M7DF 1R77A 1UJYA 1Z9QA 4N4IA 4N4HA 2QGFB 1GXIE 2OTLT 1V1CA 4J83A 4MZMA 2VGMA 1IGQA 3NTHA 2QEXA 3JB9F 4FIBA 2ESWA 3PVQA 1MMGA 4OMNA 1XNIA 1YCYA 1T3SA 3EGDA 4JDSA 1TSFA 4XU2A 3UT1A 2RJDA 1UGSB 5CKFA 1GL5A 2VGNA 3OYMA 4LE9A 5GAN6 1YNZA 4PJNA 4HCKA 5GAN8 3JB9I 3H8ZA 2RN8A 1RUWA 1VQ8Q 4XTZA 1OU9A 1WHJA 3PE0A 5D7UA 1SSHA 1PM3A 4R0KA 1CKBA 1JB0E 1KHCA 4GY5A 2K7AA 1PC0A 4MMKA 2CGHA 4D8DA 1M2OA 1X27A 3A8HB 2CP5A 2M02A 3META 4QT7A 4J9GA 4EPCA 3BY7A 5HCKA 3NGPA 3CCSA 4JRIA 3JCMe 3V8KA 1QW1A 2DEUA 3VS7A 5IXFA 3E9FA 1WXUA 1OX8A 2EQKA 2CP7A 4CC7A 2VC8A 1N9RA 2ZPBB 2E64A 1ZHIA 5HY6A 2E65A 3OW2S 3UA7A 3I5SA 1GFDA 2M0YA 4FU6A 1TG0A
chains in the Genus database with same CATH topology
3M0PA 1GCPA 1T0JA 4CC4B 2YT6A 3GBQA 1M30A 3EGUA 4LNPA 4J9EA 1M3BA 1AWOA 1SEMA 1H8KA 3SEMA 3SHWA 3EG2A 5GJVB 2KRNA 1RI9A 2CSQA 2KEAA 2RF0A 2YUOA 3THKA 1AOJA 2LQWA 1UE9A 2BZYA 2CDTA 2FG0A 1FMKA 3VS3A 2KBTA 1PKSA 3H0FA 4RTVA 2VVKA 3R6NA 4Z89A 2PTKA 2FO0A 2VKNA 1UUEA 1CKAA 2KR3A 2D8JA 4AFSC 2CUBA 3VS1A 3VS2A 3QWYA 2W0ZA 1YP5A 2GBQA 1HSQA 2LMJA 1GCQC 1N5ZA 3UF4A 2RQVA 1BB9A 4OMMA 1ZLMA 4OMQA 2MIOA 2CSIA 3FJ5A 2OJ2A 1UHCA 1VYTA 4HVWA 4RTUA 2DNUA 2DA9A 1U06A 2L2PA 2EGAA 2K79A 1WFWA 1WXBA 3M0QA 1X6BA 2RQWA 1MV0B 1ARKA 2FPFA 2E5KA 3I9QA 5EC7A 4RUGA 2RQRA 4LN2A 2EPDA 4HXJA 2C0OA 3M0RA 1ZUYA 1HJDA 3M0TA 2EYXA 2SRCA 3UA6A 2K9GA 4RTXA 2JMAA 1VA7A 2J05A 2ENMA 1EFNA 1UTIA 2EGEA 5FWCA 2KYBA 2CREA 4D8KA 5GJWB 2CH4A 2LJ1A 4AFZC 2FEIA 4IIOA 1JQQA 1M3AA 2L0AA 1ZSGA 3I35A 1H3HA 3NPFA 4CC2A 2FPDA 2YUNA 1B3QA 1KSWA 1OPLA 4DEYA 1MUZA 1ZUUA 1AWWA 4RTYA 1QKXA 2DMOA 2ROTA 4FSSA 1E7OA 2O9VA 2KRSA 2RNAA 1CSKA 2AZSA 1NLPC 2KNBB 1ZX6A 2HBWA 4J9DA 2M51A 5FWBA 2EBPA 2DL4A 2KYMA 2FRYA 1BBZA 3VS5A 5I11A 1S1NA 2J06A 1M27C 4OMOA 1X69A 3TSZA 1K4US 1WA7A 1NEGA 2JS2A 1K0SA 4HVVA 4RTZA 1UHFA 2DRMA 4JJCA 2W10A 1J3TA 2MCNA 1W70A 4AG1C 2NUZA 3ULRB 2ECZA 1PRLC 1ZBJA 3KFVA 2EQIA 3RNJA 5IH2A 1PKTA 1SRMA 2KT1A 3C0CA 1G2BA 2EKHA 1HD3A 5IHNA 2FPEA 4ZNXA 4GLMA 2DRKA 1JXMA 2A36A 2F2VA 2JM9A 1UG1A 1UDLA 1SHFA 2GNCA 1WXTA 2YDLA 4RTTA 2SEMA 1AZEA 1IO6A 1GRIA 1WX6A 2NWMA 2ROLA 2VWFA 2KXDA 2EYZA 1Y57A 2J6OA 2KT8A 2DL3A 1ABOA 3VS6A 1WI7A 2CH4W 2RMOA 2DM1A 2EW3A 1K1ZA 1BK2A 1TUDA 2DBKA 1UJ0A 1AWJA 2EYYA 1ABQA 1YN8A 2F2XA 3O5ZA 4ESRA 1KIKA 1AWXA 2J7IA 2AKKA 4LUEA 2DL5A 1JEGA 2J6FA 2JM8A 5IHIA 2GTJA 1QCFA 2FRWA 2LQNA 2DL7A 3H41A 4E6RA 4Y92A 1Z9ZA 4ORZA 1LCKA 2HSPA 5ECAA 2A28A 5I22A 2LCSA 1U3OA 1JXOA 2HEQA 3A98A 2X3WD 2HCKA 1ZUKA 4F17A 2DYBA 3CQTA 4HVUA 3VS0A 1UFFA 4J9FA 1QKWA 2O88A 1I07A 2A37A 1X6GA 2O9SA 1NYFA 4J9IA 2I0NA 2K3BA 1YWPA 2GQIA 1T0HA 3EG3A 3PVLA 4AFQC 2LJ0A 4J9HA 2EGCA 1PNJA 1U5SA 2A08A 4JJBA 1PWTA 3H0IA 1H92A 3M0UA 2GTOA 2YSQA 2DL8A 2PNIA 2IIMA 1E6HA 3JV3A 2OI3A 2K2MA 1SHGA 2CT3A 4AFUC 2CUDA 2KROA 3NHNA 3QWXX 5FW9A 2BZ8A 2O2OA 4OMPA 4X1VA 3EG0A 1VYVA 1WIEA 1JU5C 2RQTA 4A63B 2KE9A 2ABLA 1BU1A 3U23A 2KGTA 2DBMA 2YUPA 1AEYA 4WCIA 2D1XA 3EHRA 3RBBB 4KRTA 2DILA 2LZ6B 2ED0A 2KRMA 4GBQA 2AZVA 2C0TA 1W1FA 5IXBA 1E6GA 2KXCA 1GFCA 1KJWA 4K11A 1NLOC 4Z88A 2EVRA 1WLPB 2LX7A 4J9CA 3VRYA 2RQUA 2F2WA 1A0NB 1PHTA 2LJ3A 2L3PA 1X2QA 1B07A 1AZGB 3VRZA 4M4ZA 4JJDA 1WDXA 1SPKA 2JT4A 1RLPC 2G6FX 2D0NA 3IQLA 2EYWA 4J9BA 1NYGA 3VS4A 2O31A 3LH5A 2HDAA 1GBQA 2RPNA 2XMFA 1SRLA 3TSWA 5IHKA 1OOTA 1AVZC 3EHQA 1GCQA 1UGVA 2P4RA 4JZ3A 3ZL7C 2YUQA 1FYNA 2JXBA 2JS0A 3NMZC 1UECA 1M3CA 2C0IA 2L3QA 1NG2A 1WYXA 3EG1A 2OAWA 2BTTA 1QWEA 3I5RA 2ED1A 2J6KA 1UJYA 1YCSB 1Z9QA 2GGRA 2B86A 4AG2C 1KFZA 1V1CA 1I0CA 1X2KA 3REBB 3M0SA 2DF6A 1T3LA 1JO8A 2D8HA 4RTWA 1K0XA 1I1JA 2H8HA 2ESWA 3PVQA 4EIKA 4OMNA 2JMCA 1GBRA 4JPBW 1T3SA 2CT4A 1GL5A 4CC3A 3H0HA 4LE9A 2L3SA 1YNZA 1OV3A 4OMLA 2DX1A 1W6XA 2DJQA 4HCKA 4F14A 1X43A 1NEBA 1M8MA 1QLYA 1TUCA 1OPKA 2RN8A 3UATA 1RUWA 1Y0MA 2QDLA 2AKLA 2PZ1A 2DLPA 3PE0A 1SSHA 1NM7A 1CKBA 1PRMC 1QWFA 4R0KA 4F16A 2K7AA 1RLQC 4Z8AA 4IIMA 2LP5A 4D8DA 1YWOA 1X27A 4LUDA 4QT7A 4J9GA 5HCKA 1AD5A 2JTEA 3NGPA 3TVTA 2BZXA 3REAB 2V1RA 1XOVA 2V1QA 1K9AA 1G83A 3VS7A 4DEXA 2JW4A 1VYUA 5IXFA 1WXUA 1K76A 4CC7A 2DVJA 2AK5A 2LNHB 3UA7A 2X3XD 2MOXA 1OEBA 3I5SA 5L23A 2DE0X 1GFDA 2M0YA 1MV3A 2K6DA 1TG0A 4JZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0P A;  1GCP A;  1T0J A;  4CC4 B;  2YT6 A;  3GBQ A;  1M30 A;  3EGU A;  4LNP A;  4J9E A;  1M3B A;  1AWO A;  1SEM A;  1H8K A;  3SEM A;  3SHW A;  3EG2 A;  5GJV B;  2KRN A;  1RI9 A;  2CSQ A;  2KEA A;  2RF0 A;  2YUO A;  3THK A;  1AOJ A;  2LQW A;  1UE9 A;  2BZY A;  2CDT A;  2FG0 A;  1FMK A;  3VS3 A;  2KBT A;  1PKS A;  3H0F A;  4RTV A;  2VVK A;  3R6N A;  4Z89 A;  2PTK A;  2FO0 A;  2VKN A;  1UUE A;  1CKA A;  2KR3 A;  2D8J A;  4AFS C;  2CUB A;  3VS1 A;  3VS2 A;  3QWY A;  2W0Z A;  1YP5 A;  2GBQ A;  1HSQ A;  2LMJ A;  1GCQ C;  1N5Z A;  3UF4 A;  2RQV A;  1BB9 A;  4OMM A;  1ZLM A;  4OMQ A;  2MIO A;  2CSI A;  3FJ5 A;  2OJ2 A;  1UHC A;  1VYT A;  4HVW A;  4RTU A;  2DNU A;  2DA9 A;  1U06 A;  2L2P A;  2EGA A;  2K79 A;  1WFW A;  1WXB A;  3M0Q A;  1X6B A;  2RQW A;  1MV0 B;  1ARK A;  2FPF A;  2E5K A;  3I9Q A;  5EC7 A;  4RUG A;  2RQR A;  4LN2 A;  2EPD A;  4HXJ A;  2C0O A;  3M0R A;  1ZUY A;  1HJD A;  3M0T A;  2EYX A;  2SRC A;  3UA6 A;  2K9G A;  4RTX A;  2JMA A;  1VA7 A;  2J05 A;  2ENM A;  1EFN A;  1UTI A;  2EGE A;  5FWC A;  2KYB A;  2CRE A;  4D8K A;  5GJW B;  2CH4 A;  2LJ1 A;  4AFZ C;  2FEI A;  4IIO A;  1JQQ A;  1M3A A;  2L0A A;  1ZSG A;  3I35 A;  1H3H A;  3NPF A;  4CC2 A;  2FPD A;  2YUN A;  1B3Q A;  1KSW A;  1OPL A;  4DEY A;  1MUZ A;  1ZUU A;  1AWW A;  4RTY A;  1QKX A;  2DMO A;  2ROT A;  4FSS A;  1E7O A;  2O9V A;  2KRS A;  2RNA A;  1CSK A;  2AZS A;  1NLP C;  2KNB B;  1ZX6 A;  2HBW A;  4J9D A;  2M51 A;  5FWB A;  2EBP A;  2DL4 A;  2KYM A;  2FRY A;  1BBZ A;  3VS5 A;  5I11 A;  1S1N A;  2J06 A;  1M27 C;  4OMO A;  1X69 A;  3TSZ A;  1K4U S;  1WA7 A;  1NEG A;  2JS2 A;  1K0S A;  4HVV A;  4RTZ A;  1UHF A;  2DRM A;  4JJC A;  2W10 A;  1J3T A;  2MCN A;  1W70 A;  4AG1 C;  2NUZ A;  3ULR B;  2ECZ A;  1PRL C;  1ZBJ A;  3KFV A;  2EQI A;  3RNJ A;  5IH2 A;  1PKT A;  1SRM A;  2KT1 A;  3C0C A;  1G2B A;  2EKH A;  1HD3 A;  5IHN A;  2FPE A;  4ZNX A;  4GLM A;  2DRK A;  1JXM A;  2A36 A;  2F2V A;  2JM9 A;  1UG1 A;  1UDL A;  1SHF A;  2GNC A;  1WXT A;  2YDL A;  4RTT A;  2SEM A;  1AZE A;  1IO6 A;  1GRI A;  1WX6 A;  2NWM A;  2ROL A;  2VWF A;  2KXD A;  2EYZ A;  1Y57 A;  2J6O A;  2KT8 A;  2DL3 A;  1ABO A;  3VS6 A;  1WI7 A;  2CH4 W;  2RMO A;  2DM1 A;  2EW3 A;  1K1Z A;  1BK2 A;  1TUD A;  2DBK A;  1UJ0 A;  1AWJ A;  2EYY A;  1ABQ A;  1YN8 A;  2F2X A;  3O5Z A;  4ESR A;  1KIK A;  1AWX A;  2J7I A;  2AKK A;  4LUE A;  2DL5 A;  1JEG A;  2J6F A;  2JM8 A;  5IHI A;  2GTJ A;  1QCF A;  2FRW A;  2LQN A;  2DL7 A;  3H41 A;  4E6R A;  4Y92 A;  1Z9Z A;  4ORZ A;  1LCK A;  2HSP A;  5ECA A;  2A28 A;  5I22 A;  2LCS A;  1U3O A;  1JXO A;  2HEQ A;  3A98 A;  2X3W D;  2HCK A;  1ZUK A;  4F17 A;  2DYB A;  3CQT A;  4HVU A;  3VS0 A;  1UFF A;  4J9F A;  1QKW A;  2O88 A;  1I07 A;  2A37 A;  1X6G A;  2O9S A;  1NYF A;  4J9I A;  2I0N A;  2K3B A;  1YWP A;  2GQI A;  1T0H A;  3EG3 A;  3PVL A;  4AFQ C;  2LJ0 A;  4J9H A;  2EGC A;  1PNJ A;  1U5S A;  2A08 A;  4JJB A;  1PWT A;  3H0I A;  1H92 A;  3M0U A;  2GTO A;  2YSQ A;  2DL8 A;  2PNI A;  2IIM A;  1E6H A;  3JV3 A;  2OI3 A;  2K2M A;  1SHG A;  2CT3 A;  4AFU C;  2CUD A;  2KRO A;  3NHN A;  3QWX X;  5FW9 A;  2BZ8 A;  2O2O A;  4OMP A;  4X1V A;  3EG0 A;  1VYV A;  1WIE A;  1JU5 C;  2RQT A;  4A63 B;  2KE9 A;  2ABL A;  1BU1 A;  3U23 A;  2KGT A;  2DBM A;  2YUP A;  1AEY A;  4WCI A;  2D1X A;  3EHR A;  3RBB B;  4KRT A;  2DIL A;  2LZ6 B;  2ED0 A;  2KRM A;  4GBQ A;  2AZV A;  2C0T A;  1W1F A;  5IXB A;  1E6G A;  2KXC A;  1GFC A;  1KJW A;  4K11 A;  1NLO C;  4Z88 A;  2EVR A;  1WLP B;  2LX7 A;  4J9C A;  3VRY A;  2RQU A;  2F2W A;  1A0N B;  1PHT A;  2LJ3 A;  2L3P A;  1X2Q A;  1B07 A;  1AZG B;  3VRZ A;  4M4Z A;  4JJD A;  1WDX A;  1SPK A;  2JT4 A;  1RLP C;  2G6F X;  2D0N A;  3IQL A;  2EYW A;  4J9B A;  1NYG A;  3VS4 A;  2O31 A;  3LH5 A;  2HDA A;  1GBQ A;  2RPN A;  2XMF A;  1SRL A;  3TSW A;  5IHK A;  1OOT A;  1AVZ C;  3EHQ A;  1GCQ A;  1UGV A;  2P4R A;  4JZ3 A;  3ZL7 C;  2YUQ A;  1FYN A;  2JXB A;  2JS0 A;  3NMZ C;  1UEC A;  1M3C A;  2C0I A;  2L3Q A;  1NG2 A;  1WYX A;  3EG1 A;  2OAW A;  2BTT A;  1QWE A;  3I5R A;  2ED1 A;  2J6K A;  1UJY A;  1YCS B;  1Z9Q A;  2GGR A;  2B86 A;  4AG2 C;  1KFZ A;  1V1C A;  1I0C A;  1X2K A;  3REB B;  3M0S A;  2DF6 A;  1T3L A;  1JO8 A;  2D8H A;  4RTW A;  1K0X A;  1I1J A;  2H8H A;  2ESW A;  3PVQ A;  4EIK A;  4OMN A;  2JMC A;  1GBR A;  4JPB W;  1T3S A;  2CT4 A;  1GL5 A;  4CC3 A;  3H0H A;  4LE9 A;  2L3S A;  1YNZ A;  1OV3 A;  4OML A;  2DX1 A;  1W6X A;  2DJQ A;  4HCK A;  4F14 A;  1X43 A;  1NEB A;  1M8M A;  1QLY A;  1TUC A;  1OPK A;  2RN8 A;  3UAT A;  1RUW A;  1Y0M A;  2QDL A;  2AKL A;  2PZ1 A;  2DLP A;  3PE0 A;  1SSH A;  1NM7 A;  1CKB A;  1PRM C;  1QWF A;  4R0K A;  4F16 A;  2K7A A;  1RLQ C;  4Z8A A;  4IIM A;  2LP5 A;  4D8D A;  1YWO A;  1X27 A;  4LUD A;  4QT7 A;  4J9G A;  5HCK A;  1AD5 A;  2JTE A;  3NGP A;  3TVT A;  2BZX A;  3REA B;  2V1R A;  1XOV A;  2V1Q A;  1K9A A;  1G83 A;  3VS7 A;  4DEX A;  2JW4 A;  1VYU A;  5IXF A;  1WXU A;  1K76 A;  4CC7 A;  2DVJ A;  2AK5 A;  2LNH B;  3UA7 A;  2X3X D;  2MOX A;  1OEB A;  3I5S A;  5L23 A;  2DE0 X;  1GFD A;  2M0Y A;  1MV3 A;  2K6D A;  1TG0 A;  4JZ4 A; 
#chains in the Genus database with same CATH topology
 3JB9 J;  1OUL A;  2E12 A;  2X35 A;  1G8X A;  2A7Y A;  3GBQ A;  2F1L A;  4DQ2 A;  2OTJ Q;  1M30 A;  4C92 D;  1OU8 A;  3SHW A;  2VUB A;  3SEM A;  3EG2 A;  3F70 A;  2JVV A;  2KEA A;  2XDP A;  2RF0 A;  3FEO A;  4C92 E;  2DXC A;  2FG0 A;  3QG1 A;  5HK3 A;  2L8D A;  4Y91 A;  3VS3 A;  2KBT A;  3H0F A;  4ATO A;  3R6N A;  2PTK A;  2FO0 A;  1CKA A;  4F7U B;  5GAN f;  3G1J A;  5CKD A;  3CCL A;  4MZP A;  3CCM A;  3CCQ A;  3CC7 T;  2OTJ T;  3QYH B;  1IHV A;  2GBQ A;  3JAM E;  1W4S A;  2LMJ A;  3CMA A;  1YI2 A;  1C1A A;  1X6O A;  5KYU A;  2EJG A;  1SSF A;  1VQK A;  2MIO A;  2CSI A;  2OJ2 A;  1VYT A;  1LVK A;  1KQ1 A;  4OB1 B;  5GAN 7;  4JS5 A;  4MDX A;  4RTU A;  2MWO A;  2MYS A;  1U06 A;  3BE3 A;  3CCR A;  2DEQ A;  5CR2 A;  3I9Q A;  2R5M A;  2R5A A;  1NZ9 A;  4RUG A;  2QAS A;  2EPD A;  3CPW S;  1RAG B;  3M0R A;  3M0T A;  2CZ6 B;  3UA6 A;  3CBP A;  2K9G A;  1YJ9 T;  4KUI A;  2K3Y A;  1ZBX A;  1MHN A;  3M57 A;  1F1B B;  1OI1 A;  3MEW A;  2KYB A;  2CRE A;  3OYI A;  3VU3 C;  4ZTF A;  1ZSG A;  3I35 A;  2M9U A;  1H3Z A;  1KSW A;  1OPL A;  4A53 A;  1M8V A;  3PMT A;  1ZUU A;  3KBG A;  2RK2 A;  4M78 B;  4ANJ A;  3OYK A;  1I5O B;  3OS2 A;  4A4G A;  1VQO T;  2RJF A;  2NUT B;  2M51 A;  5FWB A;  2COY A;  1VQ5 T;  1IHW A;  2EBP A;  4OB3 B;  3E9G A;  2DL4 A;  3S3N A;  1BBZ A;  2ZPF B;  1VQ8 T;  5I11 A;  1SG5 A;  4OMO A;  1M27 C;  4LD9 K;  2QTX A;  1WA7 A;  5L8R E;  2CS7 A;  4BAC A;  1UHF A;  1ZSZ C;  4JJC A;  4RG2 A;  3EH1 A;  1YJ9 A;  1J3T A;  2MCN A;  5KCH A;  2DD4 A;  2HD0 A;  1PRL C;  4OP0 A;  2WSF E;  1VQ9 Q;  3S3M A;  1KQS A;  5IH2 A;  1PKT A;  3CC2 Q;  1SRM A;  1QVF A;  3MJX A;  3M4G A;  3OB9 A;  1G2B A;  4M7A G;  1HD3 A;  4XTY A;  1YJN Q;  4M75 A;  2HNI A;  5LJ3 d;  3URG A;  4M77 D;  5GMK i;  5KYX A;  1UDL A;  3JCM W;  3GF5 A;  2DFU A;  2GNC A;  2YDL A;  5GAN 2;  2SEM A;  1WX6 A;  2NWM A;  2KAF A;  4M7A B;  5CQX A;  4ZN3 A;  2KXD A;  1M90 U;  3ZBD A;  4ZGD B;  1Y57 A;  4M78 E;  3C12 A;  5GAO m;  2KT8 A;  4KT0 E;  2DL3 A;  3G4S T;  4DBF A;  4A4H A;  3VS6 A;  3PT9 A;  2V8K A;  3I55 T;  1NPP A;  3PNW C;  3AHU A;  3G71 T;  2EW3 A;  1D0Y A;  2HKN A;  4HKE A;  2WAC A;  1YN8 A;  4ESR A;  3O5Z A;  1KIK A;  3LLR A;  4M77 C;  4P5N A;  1JEG A;  5I21 A;  4FT2 A;  2GTJ A;  1QCF A;  2RI3 A;  2DTO A;  1WZO A;  3X20 B;  2BE7 D;  3LX7 A;  2XDD A;  2F5K A;  4DBR A;  3M4Y A;  3RUX A;  3MPU B;  2HMA A;  4HA8 A;  4C92 C;  3A8M B;  3OSV A;  2QG9 B;  3HKS A;  3PMI A;  3I55 Q;  2X3W D;  2HCK A;  2DYB A;  5KE3 A;  2GFA A;  1MND A;  3VS0 A;  2HL3 A;  3VYG A;  2O88 A;  2P4T A;  4BI8 B;  1W2B A;  2I2L A;  2A37 A;  4BB7 A;  1G3T A;  4J9I A;  3QXE B;  2X4W A;  3AT1 B;  1JJ2 P;  1YWP A;  2GQI A;  3CCQ T;  1T0H A;  3EG3 A;  3QSU A;  4J9H A;  2EWN A;  2A08 A;  2O4X B;  2DTH A;  3C95 A;  1PWT A;  4LDY A;  2G3R A;  2E6N A;  1YIJ A;  4F04 B;  1X01 A;  2YSQ A;  3HTR A;  3DLL A;  1MNE A;  3JV3 A;  4C8Q D;  2RO0 A;  2K2M A;  1SHG A;  4F7U A;  2CT3 A;  2CUD A;  2KRO A;  2YLC A;  3NHN A;  1Q81 U;  1BI1 A;  3A1P A;  3QWX X;  5FW9 A;  2JZ2 A;  4OMP A;  3GOX A;  1Q86 U;  4QKU A;  2E41 A;  3U23 A;  2KGT A;  4M75 B;  3EHR A;  3RBB B;  1JJ2 A;  3T9N A;  3LGF A;  5KE2 A;  3JCM X;  2C0T A;  1W1F A;  3SB2 A;  1NLO C;  2LC4 A;  2EVR A;  1WLP B;  5GMK l;  4J9C A;  2FVU A;  2KVQ G;  5CVI A;  4ZN1 A;  3CCS T;  1K73 C;  2Y4X A;  3VRZ A;  4M4Z A;  4JJD A;  5I2M A;  1WQW A;  1WDX A;  1TUG B;  3G6E A;  2EYQ A;  1RLP C;  2G6F X;  4KUD K;  3I56 A;  1TOV A;  4KGZ B;  2D0N A;  3JCM V;  1R0B G;  2EQJ A;  1VQM T;  4XQ3 A;  3FRN A;  1NYG A;  3QHS A;  2E70 A;  1B34 B;  1GBQ A;  1MMA A;  5FU6 B;  2XU8 A;  4PJO G;  5FRM A;  2L3R A;  9ATC B;  5KYU B;  1OOT A;  4IKF A;  1AVZ C;  3JRZ A;  1UGV A;  2KDS A;  1FYN A;  3CMA Q;  3JCM Q;  3NMZ C;  5LJ5 g;  3UWN A;  3VJP A;  4E7K A;  3M9Q A;  4XTW A;  3RKX A;  2BTT A;  1G3Y A;  1QWE A;  2XIC A;  4KH0 B;  1VQ4 A;  3PGG A;  2YRC A;  2B86 A;  3ME9 A;  3H6Z A;  1BIA A;  1KFZ A;  4PLI A;  4MZT A;  4PJO C;  4OB0 B;  1NJI R;  4J6W A;  2DF6 A;  2WSE E;  1T3L A;  4ZTJ A;  4AMC A;  2D8H A;  2H8H A;  1GBR A;  3L2W A;  5HKC A;  3PTA A;  1R0C B;  3CC7 A;  3QJY A;  1VQM A;  2VYT A;  4CC3 A;  4M78 A;  5FU6 C;  3SWN C;  2RJC A;  4OML A;  2XK0 A;  1W6X A;  2DJQ A;  1U8R A;  1RAA B;  1X43 A;  1TUC A;  3UAT A;  2QDL A;  2IVW A;  1N9S A;  4FM4 B;  2PZ1 A;  2DLP A;  1VQK T;  1PD0 A;  4XTV A;  3HRT A;  4F16 A;  4JRP A;  3TU4 K;  4Z8A A;  1RI0 A;  3CCU Q;  1LJO A;  2OX7 A;  4EDU A;  3CCJ T;  3VV0 A;  3CCQ Q;  2JTE A;  1TH7 A;  1Y07 A;  2BZX A;  4HT9 A;  3RES A;  2V1R A;  1ZQ1 A;  3V7C A;  4C8Q F;  4BY6 C;  1KC8 U;  4DEX A;  2D0Q B;  4J5Y A;  1QCO A;  2ZPG B;  1WJS A;  1VQ4 T;  1K76 A;  1QP3 A;  3QZ5 B;  4QQD A;  5DLQ E;  5LL6 S;  3CCE A;  4M78 G;  2AK5 A;  2LNH B;  1VQ9 A;  2MOX A;  1OEB A;  3CME T;  3MP8 A;  4JZ4 A;  1G5V A;  1GCP A;  2YT6 A;  2FZC B;  2OAU A;  2DPP B;  4X34 A;  4FCY A;  1AWO A;  3OA6 A;  1SEM A;  2KRN A;  2CSQ A;  1UB4 A;  2QI2 A;  1M90 R;  2M0O A;  3THK A;  1PD1 A;  1YIJ T;  2LQW A;  1Q81 R;  1N8R C;  1TTH B;  5GAN 4;  1VQ8 A;  1S72 Q;  1PKS A;  1XJW B;  4RTV A;  3TRE A;  2AIR B;  4Z89 A;  1TWB A;  2VKN A;  1UUE A;  2YLB A;  3LW5 E;  5CIU A;  1LPL A;  3CME Q;  2KR3 A;  3JB9 D;  2CUB A;  3VS1 A;  3CCJ A;  3VS2 A;  2ZPE B;  4C92 B;  1YHQ T;  1HSQ A;  3V8L A;  1VQ7 T;  4QQG A;  1N5Z A;  2HQX A;  1IXD A;  3P8H A;  1Q95 G;  4OMM A;  3GIB A;  4OMQ A;  2JUF A;  3EGX B;  3FJ5 A;  3QII A;  1UEB A;  4HVW A;  1D1B A;  4M7D D;  1M90 C;  2DNU A;  2CP3 A;  2DA9 A;  2O01 E;  2EGA A;  2K79 A;  4E2F B;  5LJ3 j;  2RQW A;  1ARK A;  3ZFJ A;  2FB7 A;  2X4J A;  3CCL T;  4XAX B;  2LTO A;  3RDV A;  2RQR A;  2FYK A;  3A5Z B;  2OTJ A;  3CC2 A;  5LJ3 h;  3CCR T;  3NFC A;  2C0O A;  1ZUY A;  2EYX A;  4RCC A;  4RTX A;  2JMA A;  5GAO q;  1VA7 A;  2J05 A;  4N4G A;  3JB9 H;  1EFN A;  4IUT A;  5A0D A;  4M7D C;  4D8K A;  5KYW A;  5GAO p;  1KK7 A;  3CEY A;  1VQN A;  1H3H A;  5GAN h;  5A0G A;  3OS1 A;  1B3Q A;  4DEY A;  1BCO A;  4XTX A;  1AWW A;  3CBM A;  2DMO A;  4PFO A;  3CCL Q;  2O9V A;  2KRS A;  2DIQ A;  1OQK A;  2AZS A;  3JCM h;  1B34 A;  2HBW A;  2KNB B;  5LJ5 j;  5GAN 5;  1HK9 A;  1MMN A;  2KYM A;  4M7A F;  3RER A;  5EG2 A;  3HFO A;  1VQK Q;  2Y90 A;  1N27 A;  5GMK h;  1K4U S;  1QVF S;  3QZ9 B;  1YJW A;  3P8D A;  5M9O A;  1K0S A;  4HVV A;  1WGS A;  4RTZ A;  2COW A;  1BIB A;  4WTO B;  1IRE B;  1QCN A;  4KGV B;  1VQL Q;  5GAM d;  3CC2 T;  4AG1 C;  1TXQ A;  5IN1 A;  2EQI A;  3RNJ A;  2KT1 A;  3CC4 A;  2EKH A;  4C92 G;  1KG1 A;  4GLM A;  5GAM f;  4L5G A;  4R56 A;  1JXM A;  4CRI A;  4M78 C;  1K9M C;  2V26 A;  4Z02 A;  2F2V A;  3HP9 A;  1SHF A;  1K8A U;  1I5L A;  3P8B B;  1AZE A;  2IPO B;  4FL6 A;  4C0F A;  4X9C A;  1Q86 R;  1BKB A;  4JRQ A;  2DXT A;  3A8O B;  1WHM A;  3FLG A;  2EYZ A;  4HT8 A;  2J6O A;  1YIJ Q;  1KQS P;  4R55 A;  1WI7 A;  4O6J A;  3QDF A;  1RAE B;  2RMO A;  2RA2 A;  1BK2 A;  4CI0 C;  3OYY A;  2HL5 C;  2L89 A;  3MEV A;  1AWJ A;  2EYY A;  1ABQ A;  3CC4 T;  3WXM B;  4DOW A;  3CCM T;  4LUE A;  2PVG B;  2JM8 A;  5IHI A;  3OYJ A;  1BI0 A;  2FRW A;  2XDB A;  4E6R A;  3M53 A;  4ORZ A;  2HSP A;  4QQ6 A;  1LNX A;  2A28 A;  5I22 A;  2LCS A;  2P0P A;  5J3B A;  1QVG A;  3A98 A;  4F7U E;  2YWW A;  4LDX A;  3OYC A;  1ZUK A;  5FRN A;  2JNG A;  1WNL A;  5GAN e;  4J6Y A;  4HVU A;  1FMV A;  2AT1 B;  2DZ9 A;  3SFM A;  3G6E Q;  1I07 A;  1X6G A;  1NYF A;  2I0N A;  2K3B A;  3OS5 A;  4ME7 A;  2GFU A;  3PVL A;  2LJ0 A;  4JJB A;  2Y4Y A;  3H0I A;  1H92 A;  3CCU A;  2DET A;  1KQ2 A;  1VQP Q;  2OI3 A;  3RIR A;  3X26 B;  3MHX A;  1KC8 R;  3HSB A;  2HKQ B;  2MI6 A;  3MP6 A;  3M56 A;  1NJI U;  2O2O A;  1UGP B;  2RQT A;  3OYG A;  1BU1 A;  2HQE A;  5LJ5 f;  1AEY A;  1ZA1 B;  4KRT A;  2HQH A;  3EG9 B;  2XID A;  4RG8 A;  2LZ6 B;  4JLI A;  1QVF P;  4O5V A;  2IG0 A;  1E6G A;  2P0Q A;  4M7D E;  2F2W A;  3D7S B;  5LJ5 e;  5D6Y A;  3GLX A;  3QO3 A;  4QW2 A;  2L3P A;  1YIT Q;  1U1T A;  2F69 A;  1AZG B;  2K3X A;  1Q82 R;  2R57 A;  1NPR A;  2FZG B;  2JT4 A;  1VQM Q;  1S72 A;  3S3O A;  4LXC A;  2CZ7 B;  3EFO B;  3OYD A;  2O31 A;  3MCA B;  5GMK m;  2VAS A;  2CZ0 B;  2JTM A;  2RPN A;  4DBQ A;  3BDL A;  3CCE T;  4IUV A;  4FW2 A;  5IHK A;  1OZ3 A;  1GCQ A;  4JZ3 A;  1V76 A;  4EMK A;  2KK4 A;  2MMP A;  1M3C A;  4E7I A;  2L3Q A;  4Q5W A;  1NG2 A;  2QQR A;  1WYX A;  1M5Q 1;  2CP2 A;  4OVA A;  1QP2 A;  1FX7 A;  4FW1 A;  4J7I A;  3OBY A;  2GGR A;  2DK3 A;  2YRV A;  1M1G A;  2D6F A;  3M58 A;  1I0C A;  1O9S A;  2DJZ A;  4J8O A;  3CCE Q;  3M0S A;  2ZPH B;  4PJL A;  3DB3 A;  1M1F A;  4IUU A;  2V8J A;  4RTW A;  1X75 C;  1I1J A;  3CD6 Q;  3DKM A;  4YTL A;  2X9H A;  3QPH A;  3I56 Q;  3H0H A;  1IGU A;  3CCV Q;  3ASK A;  3SWN B;  1P92 A;  1NEB A;  1M8M A;  1OZ2 A;  4EMG A;  2OTL Q;  2M16 A;  2RM4 A;  1Y0M A;  1B7T A;  2DAQ A;  2EQU A;  4PFP A;  2M1H A;  1PCX A;  1Y7X A;  2KY9 A;  2DIG A;  4PKC C;  4PLL A;  1NM7 A;  1PRM C;  1QWF A;  1RLQ C;  4C8Q A;  2NUP A;  1YWO A;  2YRD A;  4E7L A;  4LUD A;  4M7D B;  4HCB A;  4M78 D;  2RHU A;  3CCJ Q;  1AD5 A;  1C0M A;  3TVT A;  3OYF A;  1EZZ B;  3REA B;  2QA4 Q;  3A8L B;  2CP0 A;  3LWI A;  1BI3 A;  2K5I A;  1VQP T;  3L1A A;  1VQ4 Q;  1G83 A;  3L2R A;  1VYU A;  4M75 C;  2RHI A;  2RB6 A;  3X25 B;  4OF1 A;  2HBP A;  4FYX B;  1I8F A;  3CC4 Q;  2DE0 X;  1KD1 R;  1RAC B;  2K6D A;  3E2U A;  4LDW A;  4UC4 A;  3CC7 Q;  4HCC A;  4LNP A;  4J9E A;  1C6V X;  1M3B A;  3QDR B;  2E6Z A;  2X51 A;  5GJV B;  4V2S A;  5AT1 B;  1RI9 A;  4C8Q G;  3VYH B;  5CCA A;  3OYA A;  2DXB A;  1UE9 A;  5GAO n;  3CPW A;  1VQN Q;  3SD4 A;  1QVG P;  3GPL A;  5KH6 A;  3QYG B;  3L42 A;  2DTI A;  2RH2 A;  2D8J A;  2CKK A;  3BW1 A;  3R6O A;  1GCQ C;  2QDY B;  2RQV A;  1BB9 A;  1YHQ Q;  2XD0 A;  1WQ7 A;  4VUB A;  5D6W A;  1UHC A;  4M77 B;  4FT4 A;  3L2V A;  1RL2 A;  4D6W A;  1WXB A;  3M0Q A;  1RAF B;  3TEE A;  1MV0 B;  2E5K A;  1K8A R;  1PSF A;  4IUQ A;  1RAB B;  4HXJ A;  2MK5 A;  4Y28 E;  5KYN A;  2EIF A;  3OS0 A;  4OGE A;  4PJO D;  5IAY A;  2QQ9 A;  2ENM A;  1IRX A;  2KQW A;  1UTI A;  5FWC A;  4XU1 A;  4M7D A;  5GJW B;  2FEI A;  2ATC B;  1M3A A;  3HPW A;  4CC2 A;  2YUN A;  3VUZ A;  2AHJ B;  4JRK A;  2EAY A;  5LJ5 h;  4PJO F;  3OBW A;  2E1H A;  2LVM A;  2ROT A;  4LD6 A;  2RNA A;  5GAM e;  1NLP C;  4QVD A;  4J9D A;  2BUD A;  5LJ3 e;  4JLG A;  1S1N A;  2J06 A;  3DB4 A;  4M75 G;  1X69 A;  3TSZ A;  4PL6 A;  4J6X A;  4NOY A;  3L2Q A;  2E3I A;  1RAI B;  1WJR A;  1VQL T;  2EFI A;  3J81 E;  1W70 A;  3FB9 A;  5CK9 A;  2QA4 T;  2NUZ A;  3ULR B;  2QQB A;  3HRU A;  1FWZ A;  1M2V B;  2A3L A;  2E5Q A;  1XTD A;  1WHH A;  2VXF A;  2NYS A;  5IHN A;  3FC3 A;  2FPE A;  2VXE A;  1KHI A;  4ZNX A;  3M5A A;  1M1K C;  3MP1 A;  4C5H A;  2DRK A;  1DJ7 B;  3JCM b;  1YJW T;  3GNF B;  2A36 A;  2RK1 A;  2CZ1 B;  5FRO A;  2E3H A;  2PUK B;  3JSC A;  2JM9 A;  5CQY A;  2DO3 A;  2GF7 A;  4RTT A;  4BE2 A;  1IO6 A;  1FXX A;  4BDZ A;  4ZGE B;  3CMA T;  2V8I A;  3ZEH A;  3I56 T;  3BFM A;  3V7S A;  2VWF A;  5GAN 3;  1N8R U;  1VQ9 T;  3CCV T;  4BI4 A;  2R58 A;  3CPF A;  3PIP A;  5KYY A;  3CME A;  2EJF A;  1D3B B;  3OYN A;  1YJN T;  2RI5 A;  2EQM A;  2CH4 W;  4MML A;  1YJW Q;  2FHD A;  2DM1 A;  2NUP B;  1K1Z A;  3DLM A;  3VKI A;  2DBK A;  2DVE A;  4NL2 A;  2QAZ A;  1UGR B;  2F2X A;  2J7I A;  2AKK A;  2DL5 A;  2J6F A;  1VQL A;  4XU3 A;  5KYW B;  2LQN A;  3H41 A;  4TVR A;  2LQ8 A;  4E7S A;  4Y92 A;  4N0A C;  2ZPI B;  1LCK A;  5C6S A;  3E19 A;  3CBO A;  1VQ6 A;  2JN0 A;  3E1S A;  3G4S Q;  1WHG A;  1V29 B;  1U1S A;  1JXO A;  2HEQ A;  4II1 A;  3S6W A;  4NS5 A;  4BDY A;  6AT1 B;  4E47 A;  1S72 T;  4M77 G;  1UFF A;  4J9F A;  1QKW A;  3CCV A;  3N5B B;  2XKO C;  2PU9 B;  2O9S A;  4PJO B;  3EGX A;  4AFQ C;  1IZ6 A;  4E7Z A;  2EGC A;  1PNJ A;  4M77 E;  1SKU B;  5GMK e;  2DL8 A;  2PNI A;  2IIM A;  3L2Z A;  1M9S A;  4M7D G;  1VQN T;  1Q82 U;  1I4K 1;  2X4X A;  4AFU C;  3CCS Q;  3H9N A;  4FSX A;  2GCX A;  2KMT A;  2LX9 A;  2XHC A;  2BZ8 A;  4E7H A;  1QVG S;  3EG0 A;  1VYV A;  1WIE A;  2HZY A;  5GAM j;  3LGL A;  3CXC P;  4XTU A;  4A63 B;  2KE9 A;  1VQO Q;  3NTI A;  2DBM A;  4C0D B;  4WCI A;  4OGC A;  4X9D A;  3GP8 A;  4F7U F;  4JUV A;  2DIL A;  1WHK A;  2ED0 A;  2KRM A;  2YXY A;  4GBQ A;  4ELZ C;  3JCM d;  1G3S A;  1KJW A;  3LWH A;  2QYZ A;  4M77 A;  4BI3 A;  4L59 A;  4Z88 A;  3EG9 A;  1YIT T;  1D1C A;  4PJO A;  1PHT A;  2LJ3 A;  2QEX Q;  4IUP A;  1VQ6 T;  2COZ A;  1X2Q A;  2MF2 A;  1VUB A;  4BUG A;  4M75 F;  1SPK A;  1HYO A;  1K9M R;  2ZAE A;  1XQH A;  1Q7Y C;  3IQL A;  3JCM c;  1O75 A;  4KH1 B;  4E7J A;  1KD1 C;  2A0F B;  3VS4 A;  1QQJ A;  2JJ9 A;  3CPW P;  2LCL A;  1Q81 C;  4M7A C;  2DXU A;  3LH5 A;  1VQ7 Q;  3PIO A;  1D0X A;  2OTL A;  4C0G A;  2MAM A;  1ZA2 B;  1VQP A;  1G3W A;  2BKD N;  1FMW A;  1YBY A;  3J80 E;  1Y71 A;  3O8V A;  3C94 A;  5J26 A;  4BE1 A;  2PUO B;  1Q7Y R;  5A2Q E;  4EMH A;  2YUQ A;  2JXB A;  2JS0 A;  1NBE B;  2C0I A;  2RJE A;  1YHQ A;  2QXF A;  3EG1 A;  2QTV A;  4BY6 B;  1Y96 B;  2LT4 A;  1VQ5 Q;  4C5G A;  3I5R A;  2ED1 A;  2J6K A;  1YCS B;  3CCR Q;  5GAN j;  4AG2 C;  1X2K A;  5GMK j;  2KSS A;  2H3J A;  2P84 A;  2RI2 A;  3REB B;  4M75 E;  1YIT A;  2LRQ A;  1JO8 A;  1QVP A;  3HHT B;  1K0X A;  8ATC B;  2PVD B;  4DOV A;  4EIK A;  5DLO A;  2JMC A;  4JPB W;  5DY9 A;  1M2V A;  2GQV A;  4M75 D;  1HXD A;  4NL3 A;  4B9W A;  1QMC A;  3CD6 T;  3J7A F;  2JTF A;  2CT4 A;  2B8A A;  2L3S A;  3NTK A;  8AT1 B;  1OV3 A;  2WSC E;  2DX1 A;  2K5F A;  5FLX E;  4F14 A;  1QLY A;  1OPK A;  2DER A;  2AKL A;  2C06 A;  1VOM A;  4PJM A;  4A4F A;  1AT1 B;  3SWN A;  4B9X A;  2K4Y A;  1MMD A;  5A0L A;  1PSE A;  4IIM A;  2LP5 A;  3RMQ A;  3CCM Q;  1BI2 A;  4ZGJ B;  4DA4 A;  4C8Q B;  2PVO B;  1NJI C;  1RAH B;  5IT9 E;  1XOV A;  2V1Q A;  1K9A A;  5CKB A;  1BYM A;  3ER0 A;  3HFN A;  2JW4 A;  5LJ5 d;  4F7U G;  3G71 Q;  2DVJ A;  1EIF A;  3M59 A;  5I2S A;  2X3X D;  1UGQ B;  3INZ A;  3V8J A;  5L23 A;  4M7A E;  2VB6 A;  1MV3 A;  3CD6 A;  3CCU T;  4RMO A;  2NLU A;  3M0P A;  1T0J A;  4CC4 B;  2BE9 B;  3G6E T;  1N6A A;  3OMC A;  4LDV A;  3EGU A;  5AYF A;  1H8K A;  4XK8 E;  4EMK B;  3X24 B;  2E4H A;  2YUO A;  2QEX T;  1AOJ A;  2BZY A;  5KYY B;  2CDT A;  3LYI A;  1FMK A;  1D3B A;  1JBM A;  1I81 A;  4DBH A;  3MO8 A;  1M1K R;  2VVK A;  1ZSZ B;  4C8Q E;  3CXC A;  3OQ5 A;  3EAE A;  3L2U A;  1VIF A;  2BIV A;  5CKH A;  4XU0 A;  1KC8 C;  3UPU A;  3OMG A;  2EKO A;  3Q1J A;  4AFS C;  5FU7 C;  3QWY A;  2W0Z A;  1YP5 A;  1JJ2 S;  5GAM g;  2RHY A;  5KYX B;  2QA4 A;  3UF4 A;  3OYH A;  1ZLM A;  5FU7 B;  3SDZ A;  1OX9 A;  3X28 B;  3JCM J;  2L2P A;  1WFW A;  3EFO A;  1X6B A;  2FPF A;  3CXC S;  5EC7 A;  3KXT A;  3EFS A;  4LN2 A;  2CYZ B;  3KUF A;  2JOY A;  4RKU E;  1HJD A;  2SRC A;  1W2B S;  2E10 A;  1YJN A;  3WVD B;  3PFS A;  2EGE A;  4PJJ A;  1K73 R;  3HRS A;  4C5I A;  2CH4 A;  2LJ1 A;  4AFZ C;  4IIO A;  1JQQ A;  4BD3 A;  2L0A A;  4PJO E;  4AT1 B;  3NPF A;  2FPD A;  2LCC A;  3C4S A;  1MUZ A;  4MDW A;  3TCJ A;  2NUT A;  4RTY A;  1QKX A;  1M4Z A;  4FSS A;  1E7O A;  1MGQ A;  3BDU A;  1WPY A;  1CSK A;  4OB2 B;  4WF2 A;  5GAM h;  1TS9 A;  2RHX A;  1ZX6 A;  4FYV B;  4OMF B;  3V7R A;  1K8A C;  1TU0 B;  3HL8 A;  3OY9 A;  1AHJ B;  2FRY A;  2DD5 A;  1Q86 C;  3VS5 A;  2ZGW A;  4C92 A;  1NEG A;  2JS2 A;  3RR6 A;  2O4X A;  2ZCF B;  4FYY B;  2DRM A;  3FJP A;  2YHT A;  2W10 A;  1Y96 A;  5LJ3 f;  2ECZ A;  1ZBJ A;  3EGD B;  3KFV A;  3C0C A;  1K9M U;  4GLK A;  2QK0 A;  2DYI A;  1ZSZ A;  1K73 U;  3G4S A;  3OYL A;  2QGG A;  4C0D C;  4RCB A;  3I55 A;  2RHZ A;  4B6M A;  4JJN K;  3QUI A;  1YI2 T;  4M78 F;  2EJ9 A;  4FYW B;  1UG1 A;  4QVC A;  1D09 B;  2LDM A;  1WXT A;  5J39 A;  1GRI A;  2K57 A;  4A4E A;  1WHL A;  1VQ7 A;  3RKY A;  1PG5 B;  2ZZD A;  1ACM B;  4C0Z A;  2ROL A;  4KGX B;  3MKD A;  2D9T A;  2QQS A;  2DZC A;  2PQW A;  3LH0 A;  1ABO A;  1BCM A;  3RKW A;  2HSE B;  4IUR A;  3JCM g;  3OW2 P;  2L5Q A;  5GAO l;  4HCZ A;  1VQ5 A;  4N0A A;  2FZK B;  1YI2 Q;  1TUD A;  3MEA A;  1UJ0 A;  1AWX A;  2FL7 A;  5DM7 R;  3M54 A;  4PFZ A;  1WJQ A;  1SF9 A;  3EH2 A;  3MEU A;  4C5E A;  5GAN g;  5LJ3 g;  2DL7 A;  4J7F A;  1Z9Z A;  3JCM f;  1OYX A;  1R8O B;  5ECA A;  3FIF A;  5C0M A;  1NE8 A;  1U3O A;  3FDR A;  2MWP A;  4F17 A;  5CO7 A;  3CQT A;  4QVZ A;  5HK0 A;  1W2B P;  1VIE A;  3JCM P;  5D6X A;  2LQK A;  4A4K A;  4JS4 A;  1U5S A;  3RMS A;  3OSS C;  3VUB A;  4ELY C;  2H3E B;  1D1A A;  5CAI A;  3M0U A;  2GTO A;  4PK4 A;  1E6H A;  5KCO A;  3OYE A;  1D0Z A;  2CP6 A;  4L6V 5;  7AT1 B;  2K5L A;  2KI7 A;  4X1V A;  5GAN d;  2Z0W A;  1JU5 C;  2ABL A;  2K2V A;  2YUP A;  2D1X A;  2XG8 D;  2X4Y A;  3G71 A;  2AZV A;  5IXB A;  2KXC A;  3A8G B;  1GFC A;  4C8Q C;  4K11 A;  1YJ9 Q;  4BE0 A;  2DKG A;  1VQ6 Q;  2LX7 A;  1Q7Y U;  3VRY A;  2RQU A;  3TQ7 P;  3UDC A;  4A54 A;  4M7A D;  1A0N B;  1KD1 U;  2XI9 A;  1IB8 A;  3QJ6 A;  1B07 A;  2RD1 A;  3M55 A;  4M77 F;  2MPX C;  3QKJ A;  2LT1 A;  5GAO r;  2LNV A;  4PNO A;  1M1K U;  1JRI A;  2VV5 A;  3G7Z A;  1H64 1;  2EYW A;  4J9B A;  4EMK C;  2HDA A;  3EFR A;  2XMF A;  5CKE A;  3OW2 A;  1YFN A;  1SRL A;  3TSW A;  3EHQ A;  2HAX A;  2P4R A;  3ZL7 C;  4KUL A;  4LDU A;  2F5T X;  1LOJ A;  3JB9 G;  1UEC A;  4M7A A;  3GNG A;  1N8R R;  1VQO A;  3OYB A;  1Q82 C;  1EX4 A;  3QBY A;  4C92 F;  2QQA A;  1RAD B;  1KQS S;  2OAW A;  4KBM B;  3WVE B;  2P0K A;  4M7D F;  1R77 A;  1UJY A;  1Z9Q A;  4N4I A;  4N4H A;  2QGF B;  1GXI E;  2OTL T;  1V1C A;  4J83 A;  4MZM A;  2VGM A;  1IGQ A;  3NTH A;  2QEX A;  3JB9 F;  4FIB A;  2ESW A;  3PVQ A;  1MMG A;  4OMN A;  1XNI A;  1YCY A;  1T3S A;  3EGD A;  4JDS A;  1TSF A;  4XU2 A;  3UT1 A;  2RJD A;  1UGS B;  5CKF A;  1GL5 A;  2VGN A;  3OYM A;  4LE9 A;  5GAN 6;  1YNZ A;  4PJN A;  4HCK A;  5GAN 8;  3JB9 I;  3H8Z A;  2RN8 A;  1RUW A;  1VQ8 Q;  4XTZ A;  1OU9 A;  1WHJ A;  3PE0 A;  5D7U A;  1SSH A;  1PM3 A;  4R0K A;  1CKB A;  1JB0 E;  1KHC A;  4GY5 A;  2K7A A;  1PC0 A;  4MMK A;  2CGH A;  4D8D A;  1M2O A;  1X27 A;  3A8H B;  2CP5 A;  2M02 A;  3MET A;  4QT7 A;  4J9G A;  4EPC A;  3BY7 A;  5HCK A;  3NGP A;  3CCS A;  4JRI A;  3JCM e;  3V8K A;  1QW1 A;  2DEU A;  3VS7 A;  5IXF A;  3E9F A;  1WXU A;  1OX8 A;  2EQK A;  2CP7 A;  4CC7 A;  2VC8 A;  1N9R A;  2ZPB B;  2E64 A;  1ZHI A;  5HY6 A;  2E65 A;  3OW2 S;  3UA7 A;  3I5S A;  1GFD A;  2M0Y A;  4FU6 A;  1TG0 A; 
#chains in the Genus database with same CATH homology
 3M0P A;  1GCP A;  1T0J A;  4CC4 B;  2YT6 A;  3GBQ A;  1M30 A;  3EGU A;  4LNP A;  4J9E A;  1M3B A;  1AWO A;  1SEM A;  1H8K A;  3SEM A;  3SHW A;  3EG2 A;  5GJV B;  2KRN A;  1RI9 A;  2CSQ A;  2KEA A;  2RF0 A;  2YUO A;  3THK A;  1AOJ A;  2LQW A;  1UE9 A;  2BZY A;  2CDT A;  2FG0 A;  1FMK A;  3VS3 A;  2KBT A;  1PKS A;  3H0F A;  4RTV A;  2VVK A;  3R6N A;  4Z89 A;  2PTK A;  2FO0 A;  2VKN A;  1UUE A;  1CKA A;  2KR3 A;  2D8J A;  4AFS C;  2CUB A;  3VS1 A;  3VS2 A;  3QWY A;  2W0Z A;  1YP5 A;  2GBQ A;  1HSQ A;  2LMJ A;  1GCQ C;  1N5Z A;  3UF4 A;  2RQV A;  1BB9 A;  4OMM A;  1ZLM A;  4OMQ A;  2MIO A;  2CSI A;  3FJ5 A;  2OJ2 A;  1UHC A;  1VYT A;  4HVW A;  4RTU A;  2DNU A;  2DA9 A;  1U06 A;  2L2P A;  2EGA A;  2K79 A;  1WFW A;  1WXB A;  3M0Q A;  1X6B A;  2RQW A;  1MV0 B;  1ARK A;  2FPF A;  2E5K A;  3I9Q A;  5EC7 A;  4RUG A;  2RQR A;  4LN2 A;  2EPD A;  4HXJ A;  2C0O A;  3M0R A;  1ZUY A;  1HJD A;  3M0T A;  2EYX A;  2SRC A;  3UA6 A;  2K9G A;  4RTX A;  2JMA A;  1VA7 A;  2J05 A;  2ENM A;  1EFN A;  1UTI A;  2EGE A;  5FWC A;  2KYB A;  2CRE A;  4D8K A;  5GJW B;  2CH4 A;  2LJ1 A;  4AFZ C;  2FEI A;  4IIO A;  1JQQ A;  1M3A A;  2L0A A;  1ZSG A;  3I35 A;  1H3H A;  3NPF A;  4CC2 A;  2FPD A;  2YUN A;  1B3Q A;  1KSW A;  1OPL A;  4DEY A;  1MUZ A;  1ZUU A;  1AWW A;  4RTY A;  1QKX A;  2DMO A;  2ROT A;  4FSS A;  1E7O A;  2O9V A;  2KRS A;  2RNA A;  1CSK A;  2AZS A;  1NLP C;  2KNB B;  1ZX6 A;  2HBW A;  4J9D A;  2M51 A;  5FWB A;  2EBP A;  2DL4 A;  2KYM A;  2FRY A;  1BBZ A;  3VS5 A;  5I11 A;  1S1N A;  2J06 A;  1M27 C;  4OMO A;  1X69 A;  3TSZ A;  1K4U S;  1WA7 A;  1NEG A;  2JS2 A;  1K0S A;  4HVV A;  4RTZ A;  1UHF A;  2DRM A;  4JJC A;  2W10 A;  1J3T A;  2MCN A;  1W70 A;  4AG1 C;  2NUZ A;  3ULR B;  2ECZ A;  1PRL C;  1ZBJ A;  3KFV A;  2EQI A;  3RNJ A;  5IH2 A;  1PKT A;  1SRM A;  2KT1 A;  3C0C A;  1G2B A;  2EKH A;  1HD3 A;  5IHN A;  2FPE A;  4ZNX A;  4GLM A;  2DRK A;  1JXM A;  2A36 A;  2F2V A;  2JM9 A;  1UG1 A;  1UDL A;  1SHF A;  2GNC A;  1WXT A;  2YDL A;  4RTT A;  2SEM A;  1AZE A;  1IO6 A;  1GRI A;  1WX6 A;  2NWM A;  2ROL A;  2VWF A;  2KXD A;  2EYZ A;  1Y57 A;  2J6O A;  2KT8 A;  2DL3 A;  1ABO A;  3VS6 A;  1WI7 A;  2CH4 W;  2RMO A;  2DM1 A;  2EW3 A;  1K1Z A;  1BK2 A;  1TUD A;  2DBK A;  1UJ0 A;  1AWJ A;  2EYY A;  1ABQ A;  1YN8 A;  2F2X A;  3O5Z A;  4ESR A;  1KIK A;  1AWX A;  2J7I A;  2AKK A;  4LUE A;  2DL5 A;  1JEG A;  2J6F A;  2JM8 A;  5IHI A;  2GTJ A;  1QCF A;  2FRW A;  2LQN A;  2DL7 A;  3H41 A;  4E6R A;  4Y92 A;  1Z9Z A;  4ORZ A;  1LCK A;  2HSP A;  5ECA A;  2A28 A;  5I22 A;  2LCS A;  1U3O A;  1JXO A;  2HEQ A;  3A98 A;  2X3W D;  2HCK A;  1ZUK A;  4F17 A;  2DYB A;  3CQT A;  4HVU A;  3VS0 A;  1UFF A;  4J9F A;  1QKW A;  2O88 A;  1I07 A;  2A37 A;  1X6G A;  2O9S A;  1NYF A;  4J9I A;  2I0N A;  2K3B A;  1YWP A;  2GQI A;  1T0H A;  3EG3 A;  3PVL A;  4AFQ C;  2LJ0 A;  4J9H A;  2EGC A;  1PNJ A;  1U5S A;  2A08 A;  4JJB A;  1PWT A;  3H0I A;  1H92 A;  3M0U A;  2GTO A;  2YSQ A;  2DL8 A;  2PNI A;  2IIM A;  1E6H A;  3JV3 A;  2OI3 A;  2K2M A;  1SHG A;  2CT3 A;  4AFU C;  2CUD A;  2KRO A;  3NHN A;  3QWX X;  5FW9 A;  2BZ8 A;  2O2O A;  4OMP A;  4X1V A;  3EG0 A;  1VYV A;  1WIE A;  1JU5 C;  2RQT A;  4A63 B;  2KE9 A;  2ABL A;  1BU1 A;  3U23 A;  2KGT A;  2DBM A;  2YUP A;  1AEY A;  4WCI A;  2D1X A;  3EHR A;  3RBB B;  4KRT A;  2DIL A;  2LZ6 B;  2ED0 A;  2KRM A;  4GBQ A;  2AZV A;  2C0T A;  1W1F A;  5IXB A;  1E6G A;  2KXC A;  1GFC A;  1KJW A;  4K11 A;  1NLO C;  4Z88 A;  2EVR A;  1WLP B;  2LX7 A;  4J9C A;  3VRY A;  2RQU A;  2F2W A;  1A0N B;  1PHT A;  2LJ3 A;  2L3P A;  1X2Q A;  1B07 A;  1AZG B;  3VRZ A;  4M4Z A;  4JJD A;  1WDX A;  1SPK A;  2JT4 A;  1RLP C;  2G6F X;  2D0N A;  3IQL A;  2EYW A;  4J9B A;  1NYG A;  3VS4 A;  2O31 A;  3LH5 A;  2HDA A;  1GBQ A;  2RPN A;  2XMF A;  1SRL A;  3TSW A;  5IHK A;  1OOT A;  1AVZ C;  3EHQ A;  1GCQ A;  1UGV A;  2P4R A;  4JZ3 A;  3ZL7 C;  2YUQ A;  1FYN A;  2JXB A;  2JS0 A;  3NMZ C;  1UEC A;  1M3C A;  2C0I A;  2L3Q A;  1NG2 A;  1WYX A;  3EG1 A;  2OAW A;  2BTT A;  1QWE A;  3I5R A;  2ED1 A;  2J6K A;  1UJY A;  1YCS B;  1Z9Q A;  2GGR A;  2B86 A;  4AG2 C;  1KFZ A;  1V1C A;  1I0C A;  1X2K A;  3REB B;  3M0S A;  2DF6 A;  1T3L A;  1JO8 A;  2D8H A;  4RTW A;  1K0X A;  1I1J A;  2H8H A;  2ESW A;  3PVQ A;  4EIK A;  4OMN A;  2JMC A;  1GBR A;  4JPB W;  1T3S A;  2CT4 A;  1GL5 A;  4CC3 A;  3H0H A;  4LE9 A;  2L3S A;  1YNZ A;  1OV3 A;  4OML A;  2DX1 A;  1W6X A;  2DJQ A;  4HCK A;  4F14 A;  1X43 A;  1NEB A;  1M8M A;  1QLY A;  1TUC A;  1OPK A;  2RN8 A;  3UAT A;  1RUW A;  1Y0M A;  2QDL A;  2AKL A;  2PZ1 A;  2DLP A;  3PE0 A;  1SSH A;  1NM7 A;  1CKB A;  1PRM C;  1QWF A;  4R0K A;  4F16 A;  2K7A A;  1RLQ C;  4Z8A A;  4IIM A;  2LP5 A;  4D8D A;  1YWO A;  1X27 A;  4LUD A;  4QT7 A;  4J9G A;  5HCK A;  1AD5 A;  2JTE A;  3NGP A;  3TVT A;  2BZX A;  3REA B;  2V1R A;  1XOV A;  2V1Q A;  1K9A A;  1G83 A;  3VS7 A;  4DEX A;  2JW4 A;  1VYU A;  5IXF A;  1WXU A;  1K76 A;  4CC7 A;  2DVJ A;  2AK5 A;  2LNH B;  3UA7 A;  2X3X D;  2MOX A;  1OEB A;  3I5S A;  5L23 A;  2DE0 X;  1GFD A;  2M0Y A;  1MV3 A;  2K6D A;  1TG0 A;  4JZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...