3NGRA

Crystal structure of leishmania nucleoside diphosphate kinase b with unordered nucleotide-binding loop.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
144
structure length
117
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular adaptability of nucleoside diphosphate kinase b from trypanosomatid parasites: stability, oligomerization and structural determinants of nucleotide binding.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 24
structure length 117
sequence length 144
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ngrA00
4ANEA 3FBFA 3EVMA 3B54A 3L7UA 5C7PA 3NGTA 2BEFA 4HR2A 5IOLA 3Q8YA 1NSQA 2NCKL 1S57A 1W7WA 2HVDA 1S59A 1UCNA 3R9LA 3VGSA 1B99A 2B8QA 4ANDA 2HVEA 1F6TA 3FBEA 4FKXA 3EVOA 3B6BA 1BHNA 2DXEA 3VGUA 1BE4A 1WKJA 1PAEX 1MN7A 1K44A 3JS9A 1B4SA 2B8PA 4KPCA 3BBFA 5CAAA 3ZTRA 2VU5A 3PJ9A 3FBCA 1NDLA 3ENAA 2DY9A 2AZ3A 5CABA 3Q83A 3ETMA 1HLWA 3PRVA 3ZTOA 3MPDA 2CWKA 1MN9A 3EVWA 3DKDA 3ELHA 4S0MA 3EMTA 3FC9A 3VVTA 3NGRA 1EHWA 5BXIA 1U8WA 2BX6A 3GP9A 3VGVA 3ZTSA 4ANCA 3DDIA 3FBBA 4ENOA 1NDKA 4UOFA 3NGUA 3FCVA 3BH7B 4CP5A 3BH6B 3EICA 4DUTA 1ZS6A 3BBBA 3G2XA 3Q86A 1NDCA 2DXFA 1LEOA 1KDNA 3Q89A 1NHKL 4UOHA 4WBFA 1NDPA 1NB2A 1BUXA 3EJMA 4FKYA 3BBCA 1NUEA 1NCLA 1F3FA 3FKBA 1HHQA 3GPAA 3ZTQA 1LWXA 1XIQA 2HURA 3WX8A 2ZUAA 4W98A 1NSKL 3EM1A 2DXDA 3VVUA 4F36A 1NLKL 1S5ZA 1WKKA 4O0NA 2AZ1A 3FCWA 1PKUA 4C6AA 1HIYA 1VYAA 3VGTA 2DYAA 1WKLA 1XQIA 4DZ6A 4F4AA 1JXVA 3EE3A 3Q8VA 4EK2A 4DI6A 3NGSA 3Q8UA 3ZTPA 4UOGA 1NSPA 1NPKA
chains in the Genus database with same CATH superfamily
1S1TB 3FBFA 4U8YA 3EWGA 3MEGA 1HW9A 3DCAA 4OFZA 4U9RA 4YB6A 4DX6A 1YQHA 2V9WA 4IUFA 5C7PA 4QYZJ 1BMQB 1X4GA 1GH8A 4ZP6A 3LWLA 3IS9B 1VQOS 1TFYA 1IJFB 3GG0A 4RU9A 2F4VJ 2YKMA 3DXBA 5AE1A 2FB0A 2Y8WA 1RHJB 1Q5VA 4X4RA 1WOOA 1S57A 2ZNZA 3EGWB 1VLOA 3IRXB 4XAKA 1S9FA 4AFFA 3CULA 1D1UA 1DY3A 1KN6A 2C2ZB 1VIXA 2RHSB 1FEHA 2CNLB 4AT1B 2VOPA 1X5TA 3NBPB 2WBRA 2HFZA 3D66A 1NK5A 2OP5A 1N5SA 2DBBA 2YX1A 3ENWA 3EVOA 3MCMA 3GFZA 1TUVA 4ED8A 4PEOA 3W61A 5IT0A 1K73T 1GX5A 2Q79A 1FNMA 2YNHB 3MM6A 3NRBA 3QT6A 1HMVA 3R3TA 5BJRA 2VQEJ 1SKRA 2YH1A 4JI7F 1R0AB 4A4JA 4LBPA 2GIFA 1P9YA 2OPRA 4G1QB 3TA2A 4J9QA 4DV3J 4C97A 3I56S 3M6XA 3MPVA 4OX7A 2NYHA 2IRUA 4U8VA 4DV6J 4A8QA 2VICA 1OWXA 1L5UA 1LK7A 2CPXA 1EB0A 3W2VB 1TR0A 1RWMB 1M5SA 4H4KA 2M9KA 1QSYA 3PJ9A 3PNIA 4F67A 3V4IB 1QLNA 2YWKA 4O3PA 3AOAA 3GLJA 3ZZUA 2ZBIA 2ZBQA 1S76D 3RBEA 1QAXA 1VC5A 2JLFA 2LVWA 3RB6A 3H59A 5DM6Q 3DOLA 4HEA9 1S1VA 4QWBA 3HVWA 2HS0A 2ZE2B 4NYOA 1VRTA 3MZIA 5H1SV 1FD8A 2D3OR 3MD1A 1RP5A 5GADU 3M05A 2ZEJA 5KG3A 2MZ1A 3M6UA 3H25A 2R9LA 3F56A 4OZNA 1HD0A 2H4WB 3MAQA 1RHRB 1V3ZA 3KJNB 3R5CA 5LMUJ 3RAXA 1R8HA 2E7VA 4KHMA 2CUYA 2H65B 2M52A 3D68A 1QE1B 5EDWA 3G6YA 1B70B 2FZGB 4ALZA 4A8MP 4ZVHA 3TA1A 1YBAA 4LR8A 4X4QA 3DRXA 1RAEB 4LREA 1WUUA 3KLVA 5DO2A 1IWAA 4RW7B 1HPZB 2HQDA 5KG1A 4Q45A 5DRKA 4LF1A 4K5SA 3IR5B 4Q43A 1K1SA 5F41A 4BWJA 3E51A 3M7VA 3GPAA 3POTB 1N32F 1Y3JA 1N5TA 2Z8QA 3TQ1A 2APOA 2IBOA 3W2WA 2DHSA 2DNLA 3IO1A 1CS4B 2BJEA 1LW0B 2CQGA 3M32B 3GG1A 3QFHA 4OX6A 3SXLA 3VCDA 2RDJA 2D9OA 3QT7A 5JJBA 2WB4A 2Q6BA 3TUJC 1HWUA 1LWFB 4NOHA 2MQQA 4F36A 3GJQB 1NLKL 3N0VA 3K5OA 1S1XA 4A8OA 2QLJB 2ZZNA 2FHJD 1U1NA 2XQCA 3QRRA 1HHSA 1T05B 3JSMA 3BSOA 4JYAJ 2EBGA 1RK8A 1RBOB 3MEKA 2R7UA 1MMDA 2CPEA 4TY8A 4PG6A 5I4MA 5IWAF 4LF5J 4PYAA 2KO1A 3MEDA 5K8PA 4TVAB 4KYZA 4UUWA 3CUNA 1N56A 2W7PA 3SI8A 3TQEA 1CPZA 1BQMA 4ZPWR 2OTJS 2QL9B 2FC8A 4PWWA 4QU7A 3E8OA 1RAIB 4WXOA 2HSEB 4X62F 2XEXA 3LOUA 1JIHA 4BS2A 2B6AB 1GFWB 1H2VZ 2JL9A 2RH3A 2W2QP 3JTPA 1JNRB 1U1PA 4EBDA 3CMES 4DSIA 3TANA 3ENQA 4NLTA 3BZQA 3SIPB 2CG4A 2B43A 4ZLLA 4UY85 2ZITA 4GMKA 1O0PA 2VL1A 5B08A 3GIMA 1HNWF 1RADB 3G4SS 1Q78A 4K2XA 2V2QA 3HHKA 4KY3A 3DXSX 4A8KA 1VK8A 1LXNA 1YJRA 3TYTA 2U1AA 1MWYA 3D0IE 3VTIA 2HQ3A 3V81B 4LFCJ 1RA7A 2LQ5A 2GIRA 4EZ6A 1EJ7L 1NZ8A 1PCAA 4G1IA 4ZVPB 4USHA 4IOCQ 4B3SF 3PIOQ 3VAGA 1N5VA 1JJHA 2BV3A 2MMYA 1FVSA 3QAUA 1XR6A 2XMTA 4WTYA 4ZPCA 3W2WB 2B9XA 2CZ9A 4DR6J 2KTQA 1YRTA 2J9DA 1T95A 4DPTA 4X66F 1HBMA 4NLWA 2AX0A 4CLZA 3K5NA 1HD1A 1R8CA 1U26A 1X4BA 2D9PA 2GAGC 4GRSA 4LSZB 3OL6A 4B3RJ 5KG2A 4X4SA 1PYSB 3M8WA 3PYEA 1YJVA 3G71S 3F44A 4DLGA 4C0OC 4ZVFA 4KE5A 1B4SA 4USWA 2H51B 4CNZA 3NAHA 1WEZA 1SC3B 3TUPA 4ED7A 3CW2C 2R2UA 4IRCA 1N5YA 1RTJB 1WTBA 4N76A 3TR5A 4ECVA 3PO4A 3H2UB 2CYYA 1YJ9S 3GR1A 3I5CA 3H40A 1BQNA 2DY9A 2ZD1A 1HFEL 1OMSA 1EARA 2V2VA 5CABA 4P9SA 1S48A 2CQ3A 3JXOA 4K59A 3V4IA 3CC4S 4QWDA 1BQNB 2DIUA 2C28A 4UTGA 1BC6A 1K47A 2XG8A 3QBCA 3QGGA 1R0CB 4UQTA 2V50A 2FJXA 2IM0A 4PXBA 1JJCB 2PC6A 4F0HA 1JLCA 2GMHA 2IA0A 4HACB 5KFSA 2JHEA 3ZNJ1 2MKIA 4L3KA 3U1LA 3GV7B 5DQIA 1CEZA 2RRAA 1QY7A 2DGVA 2OSRA 1TFWA 3QRQA 4PWUA 2GVZA 5I3QA 1WI6A 2OPPA 4Y2IA 3BQ2A 4C8KA 3BGFA 3EICA 3GONA 4A8XA 4DUTA 3RTVA 4W92B 1S1UB 2W9BB 1FCAA 4CWBA 2EBEA 3VHQA 3BB5A 2KHCA 4FPIA 5M2UA 4KQZA 2CQ2A 2OPRB 4NYPA 2VQFJ 4TNOA 3TP2A 2IAJA 2LQ8A 4RW9B 1Y3KA 2J0WA 4CT8A 4ED5A 3BGRB 1RXOB 3KDNA 1FDBA 4CO2A 1HPZA 2HFUA 1O6XA 1C1BA 3AA8A 4G65A 2COLA 4Y34A 5G0RB 1BXNA 3BQ1A 4OYZA 3HM9A 4P6QA 1RDRA 3WX8A 4ES2A 3J7YU 3PW2A 4B3OA 1LW2B 1Y10A 3CCTA 4RNNA 1HBOB 3HSJA 4NCGB 4V1Ak 3TJAA 3CCLS 2HHSA 4I7FA 2IY5B 2D3UA 2HS4A 4FXVA 2X1FA 1YRXA 2DO0A 2JWNA 1YJNS 2Y0SD 5A8RA 4HH0A 4PG4A 4I1TA 4E8UA 1S5ZA 4PKDB 2YPZA 4TYBA 1LWFA 3SYZA 1JLBA 2ASDA 4QJVA 1RISA 2DJWA 1TL7A 1IKXA 1RKIA 1VS3A 3PXGa 1SC1B 5L9NA 2N7CA 4JI5F 3W5YA 1WNEA 3BGOP 1JLEB 2HBQB 2YWGA 3SEOA 3R2CJ 1F2GA 3DLKB 4RWWA 1WHYA 4YR0A 1RSCA 1S99A 4J9UE 3FCHA 4F4AA 4L72B 2HNZB 2LU1A 4WYWA 2ZDPA 2HFNA 1KEKA 4ZJOA 3M30A 2L9NA 4RU2A 4JI1J 1WELA 1IXKA 2WSEC 1ACMB 3PYFA 3S7RA 5M2RA 2V2ZA 5KG0A 2DR9A 2LEAA 3LAKA 1BLUA 1KNZA 3EVMA 4O3OA 3UO0A 3BQ0A 4C11A 2H48B 1N5QA 3GFYA 4BBYA 1Q7YT 1X9MA 1FDNA 2WVBA 3TVYA 5HQLA 3Q0AA 4H54A 2WVCA 5D4NA 2XMJA 4ETXA 2LLZA 4RBUA 1CJUA 4USMA 3KOAA 4URGA 5H9FK 1R43A 2JZ5A 3KK3A 4P2SA 5ETVA 3QJLA 4ICLA 1HBUB 5F0UA 5MLCV 4Y2KA 2RB7A 4NZ7A 2F8EX 5AE2A 3HVTA 4NLXA 4QCLA 4WZQA 2IRXA 5KG4A 2XS5A 3I96A 4Z7CA 5BR8F 3SFGA 4CH0S 3GV5B 2PFDA 3FK4A 1CSJA 2LQ9A 3F73A 3DGPA 2VG5A 2ATLA 1PAEX 2B9YA 1UFWA 3UW1A 3EX7B 1H72C 4UW2A 1T9VA 3GJRB 5HMWA 2UVUA 2AEJA 1U1RA 1FDDA 4OI4A 4DPWA 3MR2A 2UUBF 2LXFA 3FEYB 2CJBA 3LP2B 1NPPA 4Q8EA 3M1VA 4OI1A 1M5VC 2CXEA 2ADBA 1NDLA 3IMQJ 1MU2B 2CQIA 4DV2J 2Y1LB 1GT8A 1T3OA 1U24A 4LF5F 4Y2MA 2KYZA 1TL5A 4OZ2A 1CJTA 5L8RC 2E9TA 4FP9A 5C2CA 3TWZA 1QDUB 2V34A 1NK9A 1FE0A 3I32A 2L08A 4N8OA 4JV2A 4YB1P 2B4PA 3CD0A 1X5OA 3FVYA 4KGZB 2JOQA 3BR9A 1X5PA 1QD1A 3TUIC 1TUGB 4QQBA 3VVTA 4CLUA 2HNYA 4LF4J 3JTNA 3ZZ0A 5F9LA 1Y11A 2WCXA 2VFUA 4LBIA 4ZP9A 5DM7Q 1LWCB 2ZHOA 3IGVA 2MKJA 3LPYA 3NWRA 2JEIA 4KFBB 5C24B 1OYDA 4LRDA 2FUG9 2PO4A 2BABA 3ULHA 2QN6B 1EKRA 3HSZA 4MYUA 3BJYA 4LSLA 4M95A 1RYSA 3KXDA 4K4ZA 2DVIA 4GKJJ 3OUYB 3A3PB 5AXMA 5GAGU 4OZ0A 4QR0A 2XS7A 2BE2B 4NLQA 1QSSA 2WSFC 2NLWA 3FKBA 3KLHA 2WB1D 4ZVGA 5KTQA 5E41A 3MWBA 1OQ6A 2YNFB 4KHRA 2Y1IA 1VRUA 4OHZA 1FERA 3GYNA 5B0EA 3W8PA 4FXWA 3A3NB 3J81U 4YUDA 1TZ0A 2CQHA 2MYFA 3TOQA 4RO0A 1E6VB 2YTCA 3BO2A 3IA0A 2RQKA 2FLPA 4CLPA 4ED0A 2KM8C 2NYIA 1DTQA 3M8SA 1U47A 2ZOFA 3R5AA 1RWUA 1UW9A 3CWJA 5EHHA 5D6GA 4DV2F 3I9ZA 4IOAQ 3IG1A 3FSIA 3Q2TC 3R7SB 4IH7A 3K5LA 1HIYA 2XHCA 4EWTA 2HGLA 2PMWA 4MKVA 4U6PA 2MGZB 1EKSA 1A6LA 1IKXB 2N4DA 3QGHA 2EK6A 3K59A 4HI2A 1UA0A 1QSLA 4NXMJ 1WI8A 1SIZA 1Q8IA 2RNEA 1WDTA 3MPWA 1KLNA 3AH6A 3AT1B 2KU7A 3CCMS 3KLFA 1FJEB 3PCOB 4F0MA 1FXRA 3DOMA 5LJ5Y 3SQOP 4RUHA 5B0FA 2H54B 2ZZTA 3GB0A 2HHXA 1QE1A 1Z4UA 2BXJA 2OJ3A 1MG7A 1V3RA 4M5LA 1HI8A 1GMUA 1KP6A 4YB5A 3EZUA 2UV8A 5HBMA 1M5PC 3NGTA 4LFBJ 2PD1A 4OLPA 2GQQA 2BJ9A 2C3OA 3K17A 3HP6A 2P9CA 3DHWC 1WG1A 4Y2CA 5K9FA 1T9XA 2XM3A 3VGSA 3AQPA 1IN0A 4DUZF 1UZDA 2K1RB 2O1PA 2O67A 4FNHA 4J7CA 4J9VA 1CC8A 4NL5A 3KMSA 3DLGA 4NPOA 2WZ1A 2UXDJ 1UVNA 1TU0B 2EKYA 3V4MA 4Q5VA 1KVIA 2HZVA 4XK8C 4RBVA 4DX5A 5HAOA 3FEXB 3KJVB 4Z2XA 3RRGA 3D6FB 4O44B 4DLEA 1C0TB 1GNKA 1BE4A 2E1PA 2HBRB 3HHEA 2N4CA 4IG0A 2ZH7A 4EO6A 4WFYA 2P8IA 3JSMB 5KT7A 1SB6A 1N6QA 2E5JA 2FJBB 3BREA 3DM2A 4RNFA 2ASLA 1VC0A 5J2PB 1W26A 1NKBA 1W2BR 1AFIA 3A8JA 3LO3A 3AFGA 3DRPB 3QT8A 4AL7A 1X0FA 2DGWA 3T6BA 2RS2A 1NPRA 3FMBA 2DHAA 4NXMF 1TAQA 2AX1A 1PGZA 1QAIA 4YS2A 3MEEB 2GX8A 3TEGA 2FVSA 2OPQB 2ADCA 1RCOB 3HI9A 2ZC4A 4JI7J 2E44A 2PA3A 1U2FA 2HHPA 3MEEA 3VAMA 5AXNA 4DR7F 1PBAA 3MTKA 3O2IA 1ZAVA 5A8WA 4PRFA 4ECTA 2WVDA 3NGRA 1DRZA 1U8WA 2ZDOA 2A18A 4NLPA 2QYCA 2K8GA 3GP9A 4RL1A 2CJYB 1WEYA 3HT3A 3BGLA 2J6TA 1X5SA 2J0QD 1N33J 2YQ1A 2ZVSA 1S9GB 3J80Y 4Y6IA 3R97A 2HNDB 3SCKE 2WOMA 5E3RA 2V9KA 1FRKA 2DH8A 2V5HG 3OTOF 3H5UA 2EFGA 2DK2A 3ILIA 4WU3A 4R8UB 1E6YB 3HHDA 4ID5A 4A8WA 1NH7A 1VR6A 2A3JA 2HK2A 2MJUA 3M2RB 2V4JB 4IYQA 1FK9B 3ZNUA 4F26A 4ECZA 2ACMA 4J9PA 4GKJF 2M8DB 2GIQA 1NUEA 2ZBCA 3ILOA 3B8HA 3BO3A 4USJC 2G2ZA 3I5AA 2ZKUA 3ZTQA 5KFBA 3GILA 2HGNA 3AY0A 4IDKB 2K7JA 2PSZA 4NLYA 2W8KA 1I5OB 2VHGA 1VC6A 3UQSA 2MZQA 4USVA 1VQ9S 2DNNA 1KTVA 4NE9C 1U4BA 1N5YB 3W65A 4ZMMA 3TX8A 5A8KA 4RW6A 3KLEB 2M2BA 3ISND 2XGPA 3E3XA 1R6YA 2QV6A 2QE5A 2VF3A 4U67Q 1E6VA 4JI3F 2DHXA 3CJKB 4CH7A 2P6SA 4OYAA 2HS3A 3BSNA 2B56A 5EGYA 4Z37A 3D54A 2R7QA 5KFVA 3CMQA 1FFGB 1VYAA 5LSRA 2G1DA 3PHEA 2QSWA 3OR2B 3NOCA 4YDDB 3FSXA 2CQ0A 3ET6B 5A0YA 3H4BA 1REVA 3S1TA 1ZM3A 3TEHB 4EUVA 1YJTA 2ZH6A 4N41A 1IUJA 2AU0A 1U1QA 1L3KA 1SVDA 1UL3A 2OAUA 2VIHA 2I5JA 4M5IA 1DAXA 2WONB 3DOKA 2V63A 3RU0A 1TAUA 5KFLA 2R7TA 4K0KF 1PYTA 1VMBA 1HW8A 1FWPA 2ZJPQ 1VIOA 3VAHA 1Q4RA 1M90T 4OX8A 4ZCLA 4ANEA 5C2GA 5F8GA 2OEKA 1RHUB 1KWMA 3T3FA 2DT9A 3OBIA 2CDRB 5L1IA 1X4CA 3J7A1 3E2EA 4HR2A 3S6EA 1LOUA 3M8QA 5CYJA 3H5SA 1PAUB 3IAS9 3I87A 4B08A 1QM9A 4RWXA 2HVDA 3RYLA 3UCZP 5KFAA 3VQTA 3AAWB 1ZAXA 5KFQA 3FGVA 4JI6F 2R7OA 4X62J 4PQAA 2HZCA 1F6TA 3NS7B 2RMLA 1MNEA 3G87A 3VAIA 2DR7A 1GTEA 1AXQA 4P75A 3S8SA 4B9SA 2NS1B 5KFOA 2BW7A 2O3DA 1WOSA 3BEGB 4LIWA 5DDOC 3SCJE 3D1QA 4C3LA 3NBPA 3KLIB 4OHYA 2F40A 1MWQA 1JWWA 3N79A 3CIMA 3OPKA 2BJDA 4ILLA 3M2VB 1JLBB 1LKZA 1MN7A 2DO4A 2V6AA 3OLBA 2DGXA 2Y1JA 2AF6A 1X7VA 4DV5J 1O51A 1NXIA 1SXLA 2D69A 2HRTA 1WSVA 4ZLPA 4KV8B 3LTOA 3D6TB 3OVSA 2JEFA 1WHVA 4O23A 1SJFA 2MEWA 3NS6A 3RR8A 2QJ3A 2HKEA 4DV6F 4QIWD 4DPYA 3TAQA 3UD5A 2QYGA 4Q0BB 1F60B 2O66A 2KI2A 2RAQA 2WONA 3UR3C 2WSCC 1UP1A 4NXNF 1KLMB 3MCSA 2UUBJ 4KR0B 5ETRA 3GIKA 3HDSA 1S0OA 4H4MA 2UU9J 1P1TA 2E5LJ 3OJUA 1W2IA 3GU0A 1XJWB 1YJUA 3CJ5A 3I9V9 2VZ9A 4RLEA 1TKTB 4KRWA 3RBXA 3DLEB 3ZTSA 1RQ0A 3C6UA 5DZ7A 4ENOA 3BSAA 1EETA 1RBLA 4DX7A 2KT2A 4V19J 4YHHF 1U02A 2HVZA 2MPUA 1IWGA 1SJ1A 1TL4A 3BBBA 1WC1A 4B3MF 4MH8A 4OZJA 3A13A 4F4YA 2C42A 2Q3PA 3C16A 1T9WA 2YPYA 3CSKA 3I5BA 2PT0A 4J37A 4Q7AA 3H4DA 3T1HF 4KB7A 5F8NA 2IPOB 4L75A 1NJIT 3L7OA 3KMQA 1EP4A 2CNNB 2WRMA 2BMBA 3A1YG 4RW4B 4KGXB 2PE8A 4GVBA 4KO0B 1JKHB 2H5IB 4OHXA 5C42A 1HHQA 3OHAA 3C46A 4JI8J 2NSBA 4B02A 2X1GA 2WTFA 2KYXA 3H2VE 2MQNA 4O3RA 5CXTA 4O3SA 2CQPA 3RW6A 3TZZA 1FE4A 2ROPA 3FRYA 4C8OA 4CLKA 3BR8A 4OYXA 2P6TA 1VBXA 3BO4A 1VQNS 2GNKA 1NNDA 3FZBA 4EU0A 1FXDA 4QPXA 2QFJA 5D4PA 1Y5IB 4JI3J 1T7PA 1WWHA 1PSDA 3W66A 3WZ0A 3ITHB 4W4MA 2EI5A 2YNIA 3CVKA 4XDDA 5KFJA 1CULB 1BY9A 2CJAA 2OMLA 3NWGA 1WKLA 2YKNB 4ZCIA 5DDRC 1I6JA 1TKTA 1X31C 1H7XA 2PA8D 4PXEA 4MIBA 4OYIA 4EK2A 3BPSP 5IWAJ 5FDLA 1XWLA 5E5NA 4KC5A 1TKZA 2FDNA 3OSNA 4LF6J 3QIPA 2XO7A 3UWTA 1RAJA 4LFAF 3OL7A 2E9RX 5J1EB 1R3NA 1WSRA 2AP6A 4DPOA 3QQCD 1VHIA 4P73A 2B3TB 4KBIA 4FYYB 1H2UX 2HHHF 3ENVA 2ZKTA 4LRAA 1N6QB 5CH7B 1AUSL 3TVZA 2HZAA 1TL1B 1S59A 4ELTA 1JLAB 1FD2A 1FF2A 1WJ9A 2LEPA 2QL5B 3O8WA 4ZVQB 3X3UA 2ILZA 4X65J 2VJVA 4DQSA 2XZWA 2KKHA 1TQLA 3CT9A 4MTPA 1LFWA 2LKZA 3QWUA 3VWSA 1JLAA 1H73A 1HI1A 2DNKA 2XCAA 1RWWB 1SBRA 4XDCA 4ED3A 4M94A 1AYEA 2IAJB 2CDQA 1Y5NB 4JI4J 2BJ7A 4RW9A 2JSXA 4F2SA 3NNHA 3CJ2A 4QOTA 1C1CB 4PPZA 4YDXA 1SL2A 4R5PB 3G82B 5L1JA 3QLHB 1FEEA 2VD3A 3GCXP 5GAEI 1S1WA 3P49B 1HMVB 2C2MB 2OEJA 5LMNF 4OV6A 3M2VA 3T6JA 3C3LA 4ER8A 1ZA1B 1OY6A 3G6VA 1S4FA 2HLUA 3NAIA 2OIHA 4J9SA 1OSDA 4B9MA 1SV5B 3RB3A 2XSJA 1SJRA 4I2QB 2BM1A 3KHRA 5LSOA 2BVZA 5HMYA 5FDLB 4F04B 2HHTA 2HIYA 3DOMB 3MOZA 3FZ2A 3SQGB 2YQ3A 4N47A 5B0CA 5LSLA 4BDPA 2C2DA 3BKUA 3BV8A 4LSNB 1OPIA 1Z2ZA 3CDUA 3KDOA 3SBMA 2MY8A 2VA3A 2VG6B 1MROA 4MMOA 4M63A 1VQMS 4OJ3A 2BX6A 2FHOB 4C4WA 3FBBA 2Y8YA 1HQUA 8RUCA 4UY8T 1U2CA 3FCVA 1FJGF 2JX2A 3HVAA 3DRRA 2W9CB 3OTEA 2XS2A 3GE9A 4A8FA 4GKKJ 2HIQA 4X64J 4NZ0A 1F1BB 5EWEA 4DL2A 1XMQF 2DXFA 3NS5A 2HHUA 3DDNA 2GVZB 2ZZMA 4QIVA 3N4WA 2XY6A 4UOHA 4P2XA 4B3MJ 4LJMA 4OZ3A 7FD1A 1SI9A 2Q43A 4NLRA 2DR6A 3V5RA 4Y65A 5M2PA 3GJSB 1X4EA 4ZP7A 5DDPC 1FTCA 2L41A 4LQ3A 4WFBQ 4GC7A 3AA9A 5H9EJ 2GAHC 1HI0P 4I67A 3R5GA 1EP4B 1FFSB 1LWXA 3EZ5A 4U7UD 4KHPF 2BYCA 3W62A 2YKOA 2RE1A 3GSDA 1RTZA 3UNGC 3P5BP 1RWKB 4CLSA 3G8QA 1UFKA 2KT5A 7FDRA 1UJ5A 3CCES 2FIUA 1KVKA 2RQ4A 4X4OA 1ZTTA 1XNRJ 5T7LA 2IMOA 4K4XA 4F7VA 2ZWOA 3JAMU 1VQ8S 3OFGA 4WK3A 3DGPB 1KTQA 2AYBA 3A4TA 2MQPA 3W9HA 2E9ZA 2MTLA 1WF2A 2CNKB 1H0HB 2B4UA 4URQU 4ZITA 2G2OA 2AJ4A 3M4XA 3HZGA 4MAKA 1RE1B 4ECUA 2DCUB 3VGTA 5KFMA 1YSJA 2R7WA 3LAMA 1SKWA 4QIFA 4TYAA 5IZHA 3ZZPA 3EGNA 1XQIA 2BE7D 1CULA 3PZPA 4FXDA 1RA6A 3PACA 2A2DA 2PIIA 4KT0C 4CO4A 4F4KA 2N82B 4JI5J 2R7SA 5DDQC 3G6ES 1B64A 4DWIA 1UA1A 3DRRB 4PQUB 4YOEA 2WOMB 3GQCA 2VFTA 2MLZA 3TUZC 3MMCB 4C0HA 2EG2A 2CPDA 3ZZTA 1B3TA 3Q8QB 4L3NA 2GV1A 4JUZA 4DZDA 1XMBA 3V81A 2AYEA 2G13A 2HFOA 1NZAA 2D7SA 3CJSA 3THTA 1Y7PA 1S1TA 4FVMA 2VV5A 1YI2S 2DGOA 3NY0A 1U0SA 4GC6A 2QA2A 2BKPA 2R3VA 3G86A 3U7JA 4U7CA 1X4AA 4NCBA 2HQCA 3RAMA 3OTCA 2AJ0A 3LF0A 2FY8A 4IDKA 5E3AA 3UN3A 3MM5A 2C3UA 3PDNA 1NB7A 1VQKS 4FS1A 1ZM9A 4ANDA 1RT3B 2FJEB 2XMWA 5U47A 2AV5A 5B09A 3TX0A 1RWNB 5GAEU 4NLVA 3BF4A 2DGSA 1BHNA 2ROEA 1RWPB 2C3YA 2DNQA 3B4MA 3FSYA 2KFZA 3MUMP 1FA0A 2V68A 4AD6A 1HNXF 2PFFB 1A0OB 1K44A 1WDDA 3SDEA 4DL7A 1U1OA 4YY3F 4R5PA 4IRKA 2DRAA 2D41A 1HWKA 1ZAWA 1WD6A 3MECA 3CMAS 3MDFA 5KFFA 3AJ1A 2RDIA 2VG7B 2WW4A 3WDOA 1RABB 2I0XA 2MB0B 1RLDA 4B9LA 1OIAA 2XI2A 4LVNP 4NWBA 1NAQA 3Q8PB 3PRDA 3CC7S 4B9VA 2KN4A 3U1MA 5ETTA 4PQUA 2C22A 2EFOA 1RHKB 1EIYB 3HF5A 4W90B 4HH1A 2VQEF 3DKDA 4ECYA 2UV8G 4ZVEA 2X1BA 3ZC4A 2OFGX 4DV3F 2CNOB 2E5IA 4HTJA 5HN0A 3MOJB 1RI7A 1L3TA 3M8PB 2B9WA 3MF5A 1HWLA 4M5HA 1JLFA 2ATCB 2V8DA 1Q16B 2RQCA 4DV7J 3HFKA 2C2RA 2QLBB 1V3SA 2FLLA 1N36J 4DCJB 2RUSA 3M8PA 5E3PA 4XIUA 1WC4A 1BGXT 4DN0A 1IBMJ 2UXCJ 2K7KA 1NBEB 1UMJA 2BM0A 3DYAA 2ZVIA 1YKWA 3NGKA 3UDLA 5EWGA 3OTOJ 3CCJS 4L76A 3QAEA 2HHHJ 3NMAA 1HNWJ 1RLCL 1RT6B 2VKRA 1VCTA 3J7Z5 1RAOA 3MR5A 1X4FA 3GSIA 4KSEB 1YHQS 3PFEA 4G6VB 1GMVA 4FKYA 1FRIA 1J5OA 2GMJA 1BWVA 4TLQA 1S79A 4X84A 3T1YJ 2D3ZA 1LV5A 2SXLA 3MXHP 2CJ9A 4NZ6A 1O8BA 4WP8A 4EO8A 3GIRA 5IV4A 1ELOA 2BE9B 1YIJS 4ZA1A 2BQUA 2C2EA 3UD3P 1RTDB 4NLUA 4O4RA 3PRBA 3IBWA 4ZVTB 1S1XB 3KLGA 4LF8F 2ZH8A 4HTIA 1Q8KA 3RB0A 1JLGB 1K9MT 3OW2R 4KH1B 1VQ6S 3PX0A 4V19X 1EQ0A 3OLAA 1MROB 2KVQE 2UUAJ 5J1PA 1KLMA 1OY9A 3AHPA 3NCRA 4IO1A 4OV1A 4WFZA 3EXYA 5EX3A 3IM8A 4CYUA 2FVRA 1N34J 4CM0A 2PMHA 3H98A 5KFXA 2XULA 3P3DA 2AEMA 2KXFA 3GIIA 4BC7A 4DR4J 3MD3A 1SH0A 2R8HA 2ACYA 4M5MA 1FKOB 5FLXU 3R7NB 4HYKA 5HVGA 3TW0A 1DQAA 1VQYA 2RKIA 1FKAF 1FX4A 4DG1B 2FTRA 3ILJA 1YZ7A 4Q2LA 4E98A 1TKDA 2B51A 2BQ3A 1U48A 3QJJA 2IFXA 2EC2A 2H1YA 2G0CA 2M8HA 2QT7A 1D3WA 5D77A 4JV0A 4C48A 1MU2A 4WKYA 4TQSA 5D8HB 4P2MA 1UAWA 4M1KA 3G8TA 4OJ1A 1LNQA 1LW2A 2E1AA 4BHQA 2V94A 1JMTA 3IR7B 1FT8A 3C19A 3MM7B 3W64A 5KT6A 4O0IA 2OPSB 4CYUB 2VB6A 3MCNA 5BYSA 4F4ZA 2XLKA 3CDBA 2UZAA 1CS4A 1S9EA 1UPMB 3BYPA 3LPEA 4HT5A 5DETA 2F7VA 4DEZA 1UWAA 2IVFB 1FK9A 1Q8BA 4H4OA 4QWCA 1OS5A 4L6V3 3MMJA 3JYTA 2K3IA 4CI0B 3TI0A 3DC2A 3LUYA 2EWHA 5HQMA 1MW7A 4I64A 3ZFVA 2C3MA 1IR1A 3BSCA 4MYTA 3MMAB 5GVQA 4Y00A 1NK4A 2DH9A 2M5YA 5KOXA 2KZZA 2VPXB 3EGZA 4L73A 3I6PA 2KT3A 3ZZOA 2Z4PA 5K14A 3MMAA 1O5JA 2EK1A 2AHOB 2O5DA 4J90A 1RYRA 3ZTRA 1FKOA 4IR1A 3QJPA 1N4LA 3ZZYA 4A47A 5FD1A 2GJ2A 2W7OA 2FJVA 2AJFE 5KFHA 4DR6F 3ETMA 5KFDA 4UOCA 3J7AN 4RNOA 1KR4A 2ZD1B 4B3RF 1MN9A 3D4JA 4C98A 1L3UA 1G2EA 1CJTB 1RU1A 4Y2AA 3UE2A 4P71A 3MM5B 1TK0A 2N3OA 5ETPA 1D0EA 2D74B 2IJNA 2VPYB 4OHWA 2GQ2A 1JLQA 2W01A 2CZ4A 1NDKA 2PMZD 4DV1F 5HLFA 1Q86T 2V69A 1WF1A 4X2BA 1GQEA 3BH7B 4B3TF 4C8ZA 1FX2A 3MM6B 4DFMA 4QIGA 1JLFB 4CO5A 3GWCA 1T0TV 5L1KA 3PV8A 3JQMA 4DSEA 1LK5A 2OGUA 1N34F 1W25A 2X1AA 2UUCF 2IVYA 2DNYA 5DGBA 4QYZK 1CLFA 1X8DA 3T19A 1VQ7S 1NHKL 3AD7C 4ZPAA 4UT4A 4H4OB 1M5HA 1X4HA 3HHLC 3WQPA 1FJGJ 2JJ4D 1NJXA 4ID5B 2GO8A 2MZTA 2CADA 1AA1B 3C15A 2DH7A 5GADI 3PKMA 1B0PA 3K5MA 2MSTA 5D0EA 1N0VC 4HHHA 2AGOA 3I0SA 2Z57B 3ETOA 5KFYA 4K4TA 3IRWP 3VZHA 2ZUAA 3K0JA 4KIAA 5A8RB 4B9NA 3KYLA 1UJ4A 3CCZA 5HROB 3T1HJ 2FZKB 2W2NP 3FDSA 4F8RA 2IDEA 2U2FA 2ZH4A 3UVJB 1HBOA 3MURP 2DR5A 3L95X 5HL7Q 3QWPA 5J2MA 1FRHA 2PI4A 4NEYA 2AJQA 2MKCA 4DDFA 2BKNA 2VFRA 1M1KT 1RTIB 4JI0J 5KAKA 4YR2A 1QJHA 2EFPA 2LA4A 3J81j 3KJVA 3R5DA 3T5JA 1T9TA 3CDEA 1HARA 5DG9A 3Q8SB 3DLLQ 3OXGA 1RTIA 5DLFA 3EXCX 4DFKA 2XNQA 1PO6A 2IMWP 3HT0A 1RT6A 3N6LA 4DI6A 3Q8RB 2XBPA 3IWNC 5B0BA 4GO5X 3WBZA 4QU6A 1PYOB 3PEHA 4FYXB 3VALA 3MFHA 1VQ4S 1NKCA 1CJVB 5J2QB 3KG1A 1ZM4A 2E5HA 4AQYF 1UVMA 1F9FA 1HNVA 1LW0A 1VFJA 2J0XA 2XY7A 2OH2A 5F3ZA 5IOLA 1Q82T 2WVFA 2QRRA 1D9FA 4YR3A 1S0VA 2LMIA 1HNZJ 4DSKA 2J9CA 3HD2A 2M88A 4URSA 1N48A 4DR7J 1VHFA 3K89A 3KJQB 1GXLA 3VAKA 5ADZA 1DFDA 4ECWA 1U0HA 3D1HA 2IM3A 3GZ7A 4IKAA 1LFPA 4GVLA 1S4EA 1IR2A 2MLXA 1IKVA 1UVIA 1Q53A 1Q7LB 3LALA 1L3SA 2NXNA 3VGUA 2RS8A 4X4PA 4RUBA 2NXJA 1TL3B 3PVXA 4B9UA 2VC0A 4RKUC 1DTTA 2W24A 3I0RB 4R8UA 3UI3A 1QUPA 1G6BA 1ZBTA 2ZH1A 3L09A 4LT6A 2HHVA 5EN1A 5ETMA 4EMDA 2V8HA 4P10A 4RPFA 1SQFA 3BBFA 5AJ3F 4CLTA 2AT1B 5J2PA 3FBCA 2OD6A 4WJBA 2BQRA 4IFVA 2UUAF 3M6VA 4JI6J 1UKUA 1NJYA 2W2OP 2F8MA 2OHDA 2XNRA 2OSQA 2AZ3A 2XYPB 3CCQS 2R7RA 4DR4F 1SCJB 1RWVB 2W2PP 2MY7A 5F8JA 1RACB 2NPIA 3HVRA 4JB8B 2DEIA 4KKOA 2CWKA 2FJDB 5KFIA 4PXDA 3AQOA 5HJXA 3U02A 1HWIA 1OPZA 1PILA 1Q5YA 3NXZA 3UDEA 1ZETA 1P8GA 3HJVA 1IBKJ 2K1RA 3QATA 3CJKA 2NZCA 1C0UA 2JRSA 3DDIA 5F0WA 4CO3A 4AQYJ 5D3GA 2ZBPA 3U1NA 1UETA 2RUGA 3HZEA 3DLEA 1NKEA 5FIIA 2B5JB 2DY1A 2XZDB 3BH6B 4O4GA 2IYGA 2I38A 3A12A 1KHWA 2KM8B 1AFJA 1WHXA 3CGIA 2G9OA 3J7ZT 1J5EJ 4DV0F 4PUOA 4IG0B 2GO9A 2OPPB 1JQGA 2HEKA 3H2LA 4G3IA 3Q89A 1XMQJ 3KNGA 1UEKA 2A6MA 2CPHA 2P9GA 4TXSA 4Y3CA 5KFZA 1J2VA 2UUWA 1VI7A 2HBYB 2WBMA 3KK1B 4LSLB 3JQJA 2V4JA 1HHTP 3Q24A 4K0KJ 2MZRA 3PYDA 3KWMA 4DQRA 3WX4A 3CCUS 3N5FA 2CG8A 1U1LA 4IO9Q 1T9YA 4RR5A 3UDVA 4DUYJ 4FBTA 2BACA 3IS9A 4XO0A 4W98A 1UVKA 1NSKL 3W5ZA 1CJKB 2V4RA 5CHCB 4HDGA 2DTJA 2RF2A 2IA6A 5AJ3J 3RW7A 4F50A 2A10A 2ILYA 4LF7F 1XR7A 3CJ3A 1JLCB 3PW0A 1R7IA 3QSYB 2RIJA 2HQIA 3PYGA 5FJ4A 1CBKA 2FLNA 4FF4A 2VH7A 5AXLA 2XMUA 3HKWA 1BQXA 3RBZA 3QT5A 3RAQA 5D4OA 3UPFA 4TU7A 3NG8A 3TAMA 2YNHA 3CDWA 4LR9A 2GGPA 1ZPVA 1SV5A 2V8GA 1BD6A 2F4FA 3VF0B 4J9LA 1TK8A 1PJ5A 1JLEA 1Q79A 3EDQB 3NCQA 2LXUA 1RAAB 3ET6A 1XR5A 1VBYA 4YB7A 2AIRB 1UWBA 3E01B 1RAHB 3Q8UA 1KQFB 4UQGA 1ITPA 5KFPA 3LP0A 5IM0A 4LFBF 4JV5F 1REGX 4YQWA 2FGOA 4I2PA 2DGQA 1VBKA 3RGIA 2IBKA 4DL0C 2VBZA 2VG6A 3MR6A 5G4DA 3CCRS 2MDAA 6FDRA 5GAGI 1AZSB 3GFXA 2QZ8A 4Q8FA 3KLHB 4ZHRB 2UU9F 4OL8A 5CQGA 2HMIA 1KVJA 2YNFA 3MM8B 4A46A 3IWXA 4U96A 4AL6A 4LIRA 2FGCA 3FBEA 2QO3A 4FKXA 1ZZNA 4GKKF 2HMIB 5H9FJ 2E1CA 2ZFHA 2CKWA 1RBAA 2VDIA 1ZH5A 1SH3A 4OYBA 3ADAC 2LDIA 2NUUG 2F9JA 2JC0A 4CM2A 4K4UA 4CQ1A 1QUVA 3W9IA 1RTHA 4ED1A 1UPPA 3I4HX 1SC6A 3IG1B 3M9OB 2FYXA 4C8MA 4AUKA 5ETQA 4DQQA 1UZHA 2E7XA 4HL9A 3QLHA 4WFXA 4FZVA 2LECA 1R8AA 1I51B 2OLWA 4CRJA 2NZ4A 2EG1A 3CIZA 3JSBA 4R0EA 2W1BA 5D0GA 3AODA 5ETOA 3UNYA 2F3JA 1LXJA 1R89A 1RJJA 2K2PA 4OI3A 3BYRA 4IQMA 3D3CJ 3P4UB 2MZSA 1KKHA 3M32A 2XZTB 1XTZA 3UCGA 3M8QB 4OZLA 1APSA 5EWFA 3CF5Q 3RJMB 4ED2A 1YG0A 3AXMA 5BR8J 4CTAA 4YY3J 2R8JA 2M3DA 2UP1A 2OPQA 4OYOA 3DLBA 3W8GA 1XC9A 1XEZA 1QVFR 2DD8S 2P5VA 3SCIE 3UN5A 3V6HA 4ICLB 1S9GA 2R8KA 4M5GA 1FRLA 1UVLA 1T05A 3I4PA 1AZSA 2ROGA 3L4BC 4QYRA 4WIQA 3NGUA 3MM7A 4WWSA 1DLOA 2ZM6J 4DR2F 3IFEA 3THVA 1ZTWA 4KPYA 3R7BB 4IG3A 4CP5A 3LP1B 5K8MA 3T5HA 2HWHA 3NOGA 3MPYA 1LWCA 2WAQD 2B5JA 4O4GB 3OV7A 4LMZA 4ES1A 2B7CB 2W4DA 3D9BA 3PJXA 4NI2A 4DV0J 3P8BB 2QL7B 1HNZF 1HYSA 4WU2A 1NDPA 1IVZA 1BUXA 3OUYA 2CRLA 2CJKA 2R7VA 2KRBA 5LOQA 3JAMY 1Z1ZA 2AYMA 2YX7A 3IRXA 3CCSS 2XMKA 2EKNA 3UCUP 1AUDA 1N36F 3D0HE 2DNPA 2W4PA 3ISZA 2HAFA 1X0PA 2YX4A 1HBNB 3EM1A 2GQCA 2MXYA 2ZOGA 2X51A 1EAYC 4DR5F 4PZVA 4NLGA 2DGUA 3RB4A 2AKWB 4CT9A 3BDPA 1B7YB 3U27A 2MKKA 1ULRA 1VQSA 3AD9C 5F9NA 1K0TA 1VQPS 1M0SA 5B0GA 4I6AA 2XB2D 1UTAA 1WF0A 3CJRA 3FUYA 4TKTA 1HNIB 1RT1A 4J91A 2OELA 2ASYA 4MK9A 1C1CA 4RX6A 1IKYA 4O3NA 4DF4A 1T8EA 4K50A 1SH2A 4PUOB 5L46A 5DQHA 4RUCA 1U6ZA 2GFFA 4QR2A 3Q8VA 5DQGA 4ECRA 3DLJA 2QGFB 4U95A 3WC2A 5E7OB 1PG5B 6FD1A 1RT7A 2R4FA 4IG3B 4NA2A 2BRLA 9RUBA 3HULA 4FN5A 4YP3A 2HFSA 2IC3B 5KT3A 4OZ5A 5GMDA 1FKPB 1PJ7A 5KFRA 1FI4A 3T41A 4LRFA 2CIMA 1TMJA 3BN4A 4DSLA 3NP5A 3MMCA 3V6KA 3F41A 1BWEA 1Y5LB 3VQSA 2WK4A 1Q1KA 3AB2B 3DI6B 1NK7A 3N6MA 2Q6CA 3C15B 2VKZG 1YZ6A 2J9DE 1NSQA 3SV3A 2RF2B 4WKRA 4LSNA 2ALZA 1B99A 2PN6A 3D67A 1TMMA 3LH2S 5H9EK 2Z58B 4MIWA 1ROFA 2IJRA 2QMUB 4HACA 1WTFA 1SKUB 4OI2A 5HSPA 2DNZA 3FMWA 2W9AA 1F2HA 5KT4A 1YJWS 2MJNA 4K4YA 1GK8A 1S12A 2RU9A 1FTRA 2B0GA 1RWOB 3UVJA 2W8LA 1T03B 4M5DA 3RUBL 3KTQA 2V8PA 2VJUA 1XNQF 2OMOA 4YHHJ 2QFIA 2B9EA 2ZHBA 5LXYA 2B8PA 4FYDA 4JI2F 1B0VA 1IKWA 1S1WB 1WC5A 2BW2A 2JC1A 4ZPDA 5HATA 4Q44A 3DM2B 3OL9A 2LEBA 4DL4A 5A0YB 2VONA 4AL5A 1ZA2B 2DNHA 4IR9A 2F65A 1SJ3P 4MKAA 1XN9A 2CQCA 2ZNYA 4P2FA 4D3HA 4FPRA 4A8YA 2HRUA 3IR6B 3QFWA 3AOBA 3DOLB 4EBCA 4PAAA 4DL3A 3Q83A 4H4MB 4PG7A 3M2UA 4OYPA 1HLWA 1WG4A 2CVIA 3PR4A 5JVGQ 3GFHA 2HGMA 4ZIVA 1WORA 1PIEA 3UD4P 3QMQA 1JJ4A 4ZHRA 4KHPJ 1SUQB 3FQLA 1IQZA 1CJVA 1RGVA 3EMTA 4P7TA 1VQLS 4ATNA 2YY3A 3RG6A 4DPXA 5CZVA 1RT4A 1UFLA 5KFTA 1SL1A 2CA9A 2HFVA 1PC5A 1IJEB 4C9DA 1D8YA 1HQEA 4NA3A 1X60A 2W9BA 3ZZRA 4TU9A 3HJFA 2AYGA 3J7YI 3A3OB 2XWYA 1C0TA 1DLOB 3JB9k 2E5GA 5I42A 2JFKA 1KDNA 3NCPA 4ZCKA 3EPGA 1TV6B 4OJHA 3ILLA 3BGRA 2RRNA 4GO7X 1JK9B 2B4VA 3M30B 1HR0F 2HVHA 1N54B 2GMLA 2GA7A 6AT1B 1RT5A 1SQEA 2Z2LA 4PCQA 5I3PA 2XSJB 2RT3A 1YWXA 2YWFA 3FRZA 3GYGA 4I2QA 4IH5A 1FFWB 5IC6B 1XERA 2ZWPA 3ZXWA 5JUMA 4X64F 1KQKA 3KHLA 3VAFA 4ITSA 1J5OB 4K8RA 1S49A 1V5IB 4WFAQ 5KG7A 2KFYA 3MI7X 4NLOA 1GMWD 5C5JA 2FHKA 1N33F 1CC7A 1RT2B 3C14B 3HLUA 2H5EA 2RSQA 1DBDA 3VVUA 2EFVA 1TKXA 3CD6S 2JNJA 3KLGB 1NHVA 4F3MA 2G4BA 3HVTB 1RHQB 4AXJA 2GHWA 3FCWA 4FYVB 2M4MA 3PY8A 3L7PA 4JI0F 3T5KA 2OTLS 1Y9OA 1SUQA 1GXUA 3DNCA 1HKAA 1M5KC 4ZLNA 1DURA 4WK1A 4F3OA 4X4NA 3N9UC 5DJBA 4TY8B 1HNXJ 1C4AA 3EE3A 3MEDB 1N0UA 3P45B 3G8SA 4PWDA 1PJ6A 1N32J 3LA0A 3HO1A 3B4DA 2W25A 3BM7A 2NREA 3FFIA 5CYMB 3CCVS 4TU8A 4RJVA 3C66A 4C11B 1UVJA 3VV2B 2AMCB 3M1VB 4CZCA 2EC0A 3LW5C 5F8MA 3BN7A 5I42B 5SZTA 5LM7E 1U49A 5D78A 1S6OA 4F25A 2ZM6F 1B0TA 1WEXA 4KH0B 4DR2J 3P6YC 2Z56B 1DQ9A 3D2WA 2AJ2A 2BOPA 3JTOA 3Q8YA 2E7WA 2K06A 2J5AA 4J9OA 4GVBB 5A6PA 5C42B 2NCKL 1T9UA 3D3BJ 4DBQA 3OVAA 1UCNA 5B0AA 4WCEQ 2FZCB 3MPUB 5ETKA 4B17A 1VISA 1J27A 5D0RA 3GTYX 2OPSA 3K8WA 2ABYA 5THWA 4ZN1A 4EYIB 2X7IA 2GW8A 1C2PA 3JSYA 2KL8A 2H3EB 4LFAJ 3UN2A 4C3KA 2H9ZA 2XC9A 4WP3A 1H98A 2DXEA 2A6OA 3Q23A 5HVFA 3OR1B 3MR3A 4B9TA 4KTQA 3OR2A 2F8HA 4YFUA 2UXCF 4QW8A 5IV3A 5KT5A 3MECB 2AWZA 5ITHA 1YDLA 1RTJA 1T03A 2I1RA 1IBLJ 3MAAB 2UXBJ 3QIDA 4I56A 3TVKA 4B3OB 5E2QA 4G1QA 2VFSA 1D9DA 2QSFA 2R2TA 3W7BA 2YH0A 2XY5A 1MWZA 1Y0HA 3Q2SC 4WFNQ 3EPIA 2DGTA 5J2NB 4DCOB 4IOBA 2AW0A 4K4WA 3CCWA 5CZXA 3KK2B 3GIJA 3MM9A 3N5BA 4J9MA 1LQ9A 1S1VB 1L3VA 2IHR1 3NMRA 3MR7A 3PRVA 1NSAA 2VPZB 3QGPA 1JX4A 3MPDA 1OJ4A 5A6WA 3MM9B 3TZYA 4LF8J 2OD4A 1MMLA 4RBTA 5B0DA 1RZMA 2RJZA 3DN9A 4CNYA 5F8IA 4FF2A 3FC9A 2LCWA 4I68A 1EHWA 4DU8A 4QPTA 3HPOA 3X1LB 4ZVOB 5HI7A 2ZC3A 3DDKA 2CZVC 2XMAA 3FJ2A 5EX0A 2HPUA 3IP0A 1JJ2R 3A8IA 1JLQB 4OHVA 4M5DB 1I3OB 4LBHA 2CWXA 4FF3A 4JV5J 4ZPBA 4DV1J 1J5EF 2CPFA 2J6SA 5KFEA 4N8NA 2NPFA 4HLBA 1ZM2A 2XSFA 4QW9A 3I55S 2N7YA 3CPWR 5ETSA 1FNOA 4DG1A 4WBFA 3B78A 1IBKF 4N77A 1NB2A 4RW8A 2L9WA 3DLHA 4TN2A 5A2QU 2VG7A 3N01A 1HQ2A 3HX9A 1YJ7A 2EFNA 1TVRB 3JQKA 3OFFA 4LR7A 1H6KX 4M8LA 5KT2A 4JYAF 3DRSA 2ZOMA 3DGVA 4ZVRB 2FHMA 4CO0A 2R8IA 2BANB 3DHXA 2NXUA 1DTQB 3HCXA 3SFUA 3K7RA 3US5A 5GAHI 4LF9J 4YMEA 4OX9J 2BR0A 2X3GA 3CO0P 1MSWD 3BKTA 1EQMA 2OO4A 1VRTB 2A0FB 3MUVP 4C3MA 1H2TZ 1WKKA 1P27B 5GAHU 4MFBA 2EFQA 1R8BA 5AXKA 2FVCA 3C6UB 3K2YA 1T02A 3W5XA 2FVQA 4XPEA 3QZ7A 1I1GA 3P5TL 5KG6A 3H7HB 4CTAB 4WZMA 7AT1B 4O44A 4LF2A 2G1HA 3SSQA 3GV8B 2CAJA 2JLGA 2CPZA 1U25A 2QIFA 2YNIB 3DYAB 4NCAA 4P72A 2QLXA 1TV6A 3D6HB 1KOHA 3IXQA 4DCPB 5JMNA 3LQVA 5JXSA 1TELA 4DQPA 4RW7A 1XMOJ 3MEGB 2J76E 4UOGA 2GVDA 5LXRA 1CG2A 1FNXH 4OI0A 3DRPA 1VJQA 4DR1J 4DR3F 5K20B 1KBRA 3IGNA 1D8ZA 5CYQB 2PEHA 1GAOA 2VBWA 4ZP8A 1KS2A 1I94F 1JB0C 5HO4A 1XK8A 2HQFA 2FD2A 2YKMB 1H38A 4CLLA 3CE8A 2FLOA 2FQQB 2RRBA 2H4YB 1YBUA 2ZBRA 5CYQA 3NEKA 4O3QA 2CFXA 4C7QA 1Z2LA 5J1EA 2BEFA 3TJ8A 2H5JB 3IWLA 5T14A 4F4WA 1S0MA 1CVJA 5HJYA 1VGYA 1HBUA 3I82A 3R1HA 2YWHA 2HWTA 4CLYA 4ETZA 3C6TB 3PIPQ 4G1PA 2KRRA 4MKBA 4NLSA 4XPCA 3JYTB 2HHWA 2YNGA 5GMEA 4DF8A 2EXUA 3TAPA 1S9EB 8AT1B 2WVEA 1U0HB 2HNDA 2VFVA 4DSJA 2F5GA 2XGQA 5DG7A 2KDOA 2XTJP 4WPAA 4YN3B 3HKZD 2D1CA 2UUCJ 2W4CA 2F1FA 3PG9A 3OL8A 2NQPA 3CJ0A 3JS9A 4NASA 3M2RA 4ZIWA 2YWWA 1TK5A 3QNWB 4IH6A 4MIAA 5MAOA 1GEHA 3LGNA 4LRBA 2VG5B 2QMXA 1ZOTA 4NRUA 3FFIB 5CYMA 2E29A 1M1HA 3OT9A 2BBEA 1OO0B 2C1EB 3ENAA 2IRYA 1KFDA 1RKJA 4ZKAA 3CJQA 3HHLD 3KUGA 2JVRA 3CNQP 4LF7J 2CVEA 4QR1A 2MQ8A 4UZCA 2V8VA 2P9EA 3W60A 2HAIA 5HVHA 3H5YA 1XNRF 5HP1A 4C0BA 1YK9A 5IT9Y 2FJAB 1OSCA 4B3SJ 4FNIA 3TAMB 1H74A 1IBMF 2JDJA 4HT7A 2E1RA 1NJZA 4FF1A 1URNA 5J2MB 3HFVA 3CB4A 3UDCA 3VGVA 2E66A 4PYDA 3QO9B 3ISNC 4NRTA 4F3QA 3OVBA 2V4QA 2XHWA 1DARA 1Q81T 1R0BG 3PFOA 4MKYA 5DS7A 3QO9A 3V2UC 3Q22A 1TP7A 1Y00A 2Z2MA 3G82A 1AB8A 4MJKA 3PW4A 5IXUA 2W9CA 3KNAA 4I2PB 1AW0A 4JV1A 3V6DB 2HNZA 2MKSA 5HK4A 1UEUA 5BYRA 4DFPA 3L3CA 4ZLJA 1HA1A 2DITA 1VOMA 3CJTA 3IM9A 2YQ0A 4HI1A 3VZIA 4DOZA 3P96A 3EZOA 4EGLA 4WTOB 1FESA 1NCLA 1CQMA 2VBYA 3PR5B 3OHBA 5A2QY 4ZJLA 3SV4A 3VR1A 3KK1A 5ETNA 1NJWA 4ILMA 1XIQA 2L3MA 5J2QA 1KD1T 1F9EB 2QEXS 2DNGA 2KB2A 2HG4A 2QLFB 2RILA 3CD5A 4CLWA 4CO1A 2KH9A 2ZJQQ 2N3LA 2BJ3A 4DXLA 4QWAA 2J0SD 3NNCA 4LQ9A 5BYQA 2KXHA 1QAJA 3KUHA 2NR0A 1RTDA 1RUSA 2CQ4A 4DQIA 4I7FB 4USTA 3ZZZA 2HK3A 1YITS 5IC4B 2IIHA 4DV4F 4EI2A 4QZVB 4TLRA 5FLXY 2RVJA 1JLGA 3L9ZA 2HWIA 2BOAA 5IFMA 2AZ1A 3GCWP 3KHHA 5HP1B 5HLFB 3AB4B 1PKUA 4C8LA 1WC3A 4ECSA 1REVB 2ZE2A 2XMVA 3KLIA 2RKIB 4I6WA 3A8EA 1TTHB 4USUA 3MHYA 5K5MA 3NNAA 1KONA 3AJ2A 1HWJA 1UJ6A 1S6QA 3WIVA 1U1KA 4C2MA 1VDHA 3OJSA 4NMLA 2XO6A 1JXLA 1DJ0A 2YBVA 4PG8A 4DX8H 4TQRA 4UUXA 3K58A 2V67A 1RAFB 3O1LA 4F0KA 5KFUA 4DN9A 5LMNJ 1NHUA 3THPA 1NPKA 3D7SB 2MKYA 2IDLA 4EEYA 1U45A 2GVDB 2J6UA 2XWXA 4A48A 4DHVA 3I0SB 2AJ1A 1YBTA 4OJGA 3M9MB 2KZMA 2IM2A 2CJXB 2DPIA 2MKHA 2R2SA 3J80U 5JVHQ 2ERRA 1WG5A 1RT5B 2DCLA 3GR0A 2XYHB 4MT1A 2Z0GA 3LGMA 4RNHA 1WC6A 1S7HA 3HSDA 3OQ2A 2VDHA 5T7LB 3R9LA 4DU7A 1NO8A 3UR0A 4QWEA 1NK8A 1U2RA 2B8QA 4I6YA 2LFVA 1V9OA 2HVEA 2GHVC 4QIEA 3KK3B 2K3KA 4C8NA 1YTYA 3PX6A 1RT3A 3IBCB 3NKYA 1RB0A 2QLWA 4BLGA 3NLCA 1HR0J 1IQTA 2AQ4A 3MUTP 5HMXA 1KHVA 1GX6A 4NLDA 2J7UA 4OYWA 2MGZA 3H90A 4B3TJ 2W2MP 2GJFA 3CDAA 4L74A 4DPUA 2CQBA 1S6UA 1TUWA 4KPCA 3RR7A 3TJ9A 4ZJQA 1F3VA 1LWEA 1RTHB 2OEMA 3B82A 3N28A 4NA1A 2G0JA 5KG5A 1T3NA 1JNZB 2JFDA 2L9DA 5CAAA 3LWMA 1SL0A 2DNRA 2E1MC 2EEYA 1JKHA 3CEDA 1SPBP 3MCOA 2OI2A 4RW6B 5T41A 1WACA 3SMZA 3TZXA 4NX9A 1VJWA 4N56A 2CQDA 1KFSA 2UVVA 4LF4F 3CD7A 1IBLF 2BZ2A 2V0NA 2UVWA 4JBCA 2QMWA 4DR5J 4EZ9A 1EX8A 2GCFA 2OUGA 4CH1A 3D6MB 2BJ1A 4FBUA 1ZYQA 2ZJRQ 2X3DA 1CJUB 3OD2A 1B7FA 3BDEA 5DLGA 1A9NB 1NEEA 4ELVA 2R42A 1X9WA 5GMKa 4ZPVR 3MMBB 2JLEA 4J9NA 4ECQA 4R25A 1NM2A 1RU2A 2DISA 2F4VF 3MGJA 1F5AA 4UF4A 5DZ6A 5CCMA 2HNYB 3RRKA 4WYLA 2HYIB 1SQGA 3DMJA 3Q86A 1TL3A 3WHIA 1C4CA 3OFEA 2UUTA 2M70A 2PEBA 1MMNA 3R8YA 3H5XA 4Y0FA 2C3PA 2V2KA 2GS8A 1KOOA 1HBMB 4RW4A 1C1BB 5G0RA 2F63A 1S6PB 2LP4A 3QIPB 1IM4A 2JVOA 2LA6A 4ZVSB 3CJ8A 4PG5A 3M9NB 4USIA 2A1BA 3BBCA 1YLXA 4N7TA 4NI2B 2FJWA 1HYSB 1NH8A 2NUHA 1G4CA 2OFHX 4P52A 2CJQA 1RCXB 2MSSA 3DU5A 3G6XA 5K14B 1GMWA 1LWEB 2OKQA 2QA1A 2Y1RI 2ZUGA 3BPDA 1VQ5S 1V5VA 2VBXA 3AOCA 3EDRB 3K57A 4A8SA 5J2NA 3O3LA 3SZ2A 4AXIA 3QPIA 2DXDA 2G0IA 3N6NA 2AD9A 2BJ8A 2E5LF 4NYZA 2IVMA 3D5MA 2PDAA 3ONQA 2WW8A 1R0AA 1SKSA 3DLGB 3EUNA 3KFWX 4KGVB 4O0NA 2MQOA 1P9QC 2LDYA 3DRYA 4FVCA 2I6WA 4DV5F 1RAGB 3SCLE 2QG9B 4HHJA 1U09A 4OX9F 1SJ4P 3HK2A 5KFKA 4OQJA 2DNMA 4EBEA 4MK7A 4JI2J 2DR8A 3HD1A 3TARA 1TKZB 5CD4A 4DZ6A 8ATCB 3G9CA 2POKA 2LQBA 4P7VA 1QAYA 5K8OA 4J9RA 2DHHA 3NGSA 1S6QB 1DZ5A 3ZTPA 2Y9HA 5IT9U 3GJTB 2VQFF 3T9ZA 3DMJB 3OFHA 1S1UA 4OMFG 5E33A 1R6VA 3OTDA 1HNVB 1X4DA 5HBMB 1ZPWX 4X66J 2FY1A 2UXDF 5E0OA 3HFZB 1Y4ZB 2IC3A 2RHQB 2KJVA 5D0HA 2AGQA 3BS9A 1S72S 3QGIA 5F8LA 2FVPA 2HRYA 2QA4S 2I8EA 2AGPA 4LFCF 4P74A 1R8PA 1FJCA 5KFNA 2C2OB 3K5PA 1W7WA 1SJQA 3M8RA 1TVRA 2DHGA 1GTHA 4CIOA 2B4OA 2LU2A 4IFYA 3DRSB 1K1QA 4QBUA 5KFCA 4FS2A 2ASJA 5HANA 3PM9A 2HLTA 5L9XA 3W9JA 4JOUA 3A8KA 4TY9A 3LGHA 2DPJA 1FRXA 1URRA 1T11A 2VC1A 2VASA 2Z2ZA 4J5OA 4D3GA 5IS2A 3TO8A 3LP1A 3FNNA 2CPIA 3M8YA 4ELUA 2GGPB 2LYVA 3QYYA 5C25A 3IN5A 1WKJA 2DKOB 2IM1A 4KV8A 4ECXA 1E6YA 1N88A 5I3UB 3W3SA 1YRUA 4HVZA 4Y28C 3AD8C 3EYZA 4DL6A 2EVZA 4KJIA 1DTTB 1D9AA 3I0RA 5DGAA 2DIVA 1FVQA 3LP0B 5IM0B 2J8SA 3V6JA 4KGMA 5I3UA 2LQJA 1RT2A 2VU5A 2J7KA 1FDAA 1KQSR 2VODA 1S10A 3FEZA 3HHNB 4BC9A 2KXNB 4LUBA 4OYMA 4WE1A 4E0DA 3AXKA 3H42A 2QA4G 4X4UA 2PGCA 5EUHA 1WHWA 2RDDA 2FHJA 1XBWA 4S0MA 3ELHA 3PO5A 5K8NA 4NEZA 2ZH5A 4I0WA 2J7WA 2M0GB 1OYEA 4WE1B 4DUYF 1G1XA 4USKA 2KFNA 3OXFA 4LRCA 5E3CA 1HQUB 1S7IA 5BXIA 4JI8F 2I2YA 3KHGA 2R7XA 4KFBA 5C24A 3D0GE 4H4KC 3RBDA 1S77D 3TZWA 3K8VA 3PHTA 4YEAA 3R6LB 1FXLA 3G2XA 2YWEA 4DR3J 4DR1F 1YX2A 1HQEB 2JEJA 1LEOA 3F0NA 1F9HA 1MLAA 4K7QA 3FQKA 2HHQA 2YNGB 1D09B 2C2KB 4BCAA 2BE2A 2YVSA 1FO1A 2O01C 1H3DA 3CJ4A 3ICLA 3RZAA 1Q95G 2YXLA 1IKVB 2BKOA 4OLOA 3DOKB 5D15A 4AE5A 4DS5A 2UXBF 3C16B 1QTNB 3BKFA 3EJMA 4WIIA 5A76A 1KQGB 1VRUB 2YKQA 1S6PA 1VK3A 1VLYA 1TL1A 3LANA 5B7WA 1U6BA 4PPDA 3MFIA 1X9SA 2M7SA 2HURA 2Q66A 1DQ8A 3KLEA 1HBNA 2ZH9A 3LP2A 2J8AA 2Y3YA 2Z30B 3O44A 5RUBA 1KC8T 3GMGA 1T94A 2GHPA 2J9EA 3MAHA 4IFVB 4DL5A 4F02A 4LF9F 2CPJA 2IYIA 1U8SA 1UEVA 2F9DA 3CTRA 4LVOP 5A8KB 5L38A 1CJKA 3PTWA 3CC2S 5HROA 1RWXB 1R27B 2Z2YB 3IAM9 3MMBA 1A7GE 4CLFA 4CCHA 4RZRA 4HKQA 3J81Y 3ZO7A 1M5OC 4KKOB 1SIWB 4RUAA 3PX4A 4ED6A 4PR6A 2MZJA 4Q2MA 5KFWA 4X4VA 3HHLB 3O5TB 1UWBB 3E01A 2YKPA 4XTTA 2DRDA 3ITHA 3C2PA 2DB1A 1Q8LA 4I69A 4PXCA 5L1LA 2MHEA 1XNQJ 1VRQC 1KRPA 1SC4B 1IM6A 1P6TA 1UW4A 2DNOA 1IKWB 1FWKA 2Y0BB 4K2JA 1YVFA 5J1NA 2QX0A 2C2NA 3BGUA 4ZS6A 3W2VA 2XLJA 3T1YF 1G7CB 1V6HA 1ZZFA 2QTWA 1HL6A 2RD5C 2XI3A 3CO9A 4WF9Q 4ES3A 1GXTA 4K5RA 2W7AA 4RNMA 3V6DA 3DI6A 1M1GA 2LXIA 3B54A 1R31A 3L7UA 3D28A 4JP8A 4ZK7M 5LT5A 1FKPA 2ZHAA 2HQGA 4C8YA 1Q0NA 4ZOSA 3W1YC 5LJ3Y 3PEJA 1JXEA 4U7UK 2IJFA 2GZOA 5CCLA 5AT1B 3VAJA 3KJFB 3PW7A 3C8YA 3WC0A 4DSFA 4HHUA 2A2CA 3R6GB 1G3OA 1NRKA 1XMOF 4ED4A 4N5SA 2WHOA 3I31A 3AJDA 3CXCR 3DFEA 3KG0A 4DFJA 1S0NA 4IFYB 4ZCMA 3MM8A 1I94J 3HSGA 3B6BA 4DS4A 4X4TA 3PJWA 2QC3A 2GJIA 2HW3A 1HNIA 1RT1B 3W63A 4IRDA 3SDEB 3T1AA 4LF6F 4F4XA 4F2RA 3S01A 4WXWA 4NXNJ 3OXLA 4M5KA 2VA2A 3EGVA 1KSPA 3OR1A 1NU4A 2I5JB 4DV7F 1RHMB 1RT7B 5KOWA 3M8ZA 2VOOA 3HXMA 4ZDNA 4NCGA 3MAAA 3HHLA 2DRBA 3M2UB 1YGYA 2ALYB 3POTA 3KLFB 3R5JB 4HDHA 2RU3A 2JEGA 3IBFB 5CA5A 2ZH3A 2D3O1 4MFBB 5IQQA 2R8GA 2R2RA 3ZTOA 1TL7B 2B7BB 2G2YA 4ID8A 3KK2A 4K4VA 5F3TA 3EVWA 2XCPA 4KGKA 2NXCA 1NMEB 2VUGA 3SQGA 1NK6A 4JI4F 5L39A 3KKFA 1WOPA 3DU6A 4R0JA 3DLKA 1EETB 1N8RT 3QZ8A 2MQMA 4E2FB 4NMXA 1FRMA 4M5NA 4DJBA 2EW9A 1N52B 2MLYA 4ANCA 1FRJA 3G96A 4ZVUB 5LMUF 2VPWB 1U7LA 2NXEA 3KG4A 4UOFA 3PW5A 3WIUA 2XYGB 3KUEA 1K0VA 1C0UB 2BUNA 1IR0A 4J9KA 2MHNA 1QTMA 1ZS6A 3R1LA 5SUHA 3MTJA 5C25B 1NDCA 4ZPTR 1F5BA 1PC4A 2HVIA 4ZN3A 1DHMA 4ILRA 1F5CA 3D1OA 4IQXA 4OIXA 5AE3A 3NL0A 4PWDB 3NGDA 3R5BA 2XMMA 2B6AA 2L48A 1U6FA 2RQMA 3PKYA 2I9SA 1VBZA 1NK0A 3SSSA 1F3FA 3H0PA 3QSIA 5E3QA 2CPYA 1QVGR 2JH3A 3H8YA 3C6TA 4RW8B 5IQ6A 1OY8A 3JSRA 4KO0A 3GYXB 4KAIA 5CD4H 1IBCB 5IT4A 3C14A 3IC1A 4Q0BA 2PI5A 1ICEB 1CQNA 2KJWA 1EZZB 1WC0A 2FPHX 1OQ3A 2FC9A 3H20A 1TKXB 4M5JA 2EPIA 4WP9A 4BWMA 3SSRA 5HMZA 4UZBA 2KG1A 3QRPA 3TNVA 5ETLA 2BANA 2KHDA 4ERDA 5KFGA 3OTBA 4EYHB 3R2DJ 2BDPA 2KVIA 1AROP 2Q1LA 2AEFA 1RT4B 2XLIA 1H7WA 4DMZA 4FDFA 2BA9A 5D3GB 1P1LA 2YKNA 3T5LA 4JI1F 3M6WA 4AYBD 4C6AA 9ATCB 1BQMB 4MK8A 2CQ1A 4OI6A 2DYAA 5A8WB 1PBUA 3T9NA 3TA0A 3R27A 2MQLA 4OZ1A 3TRGA 5DG8A 2KG0A 4K4SA 2GC8A 2NSCA 1F0XA 3O6QA 3RRHA 3OSPA 1FHTA 1K8AT 1FJ7A 1JXVA 1FWLA 5F8HA 2P2CB 4Z7YA 4I4BA 1IKYB 5D4LA 5LL6d 3HMJG 2HBZB 4FYWB 4PABA 1AT1B 3UFCX 5HQ8A 4CDIA 4EFAC 4DUZJ 4X65F 2BRKA 1S97A 2YKAA 2UVRA 4DV4J 1U1MA 2DEJA 1NSPA 2ZH2A
chains in the Genus database with same CATH topology
4ANEA 3FBFA 3EVMA 3B54A 3L7UA 5C7PA 3NGTA 2BEFA 4HR2A 5IOLA 3Q8YA 1NSQA 2NCKL 1S57A 1W7WA 2HVDA 1S59A 1UCNA 3R9LA 3VGSA 1B99A 2B8QA 4ANDA 2HVEA 1F6TA 3FBEA 4FKXA 3EVOA 3B6BA 1BHNA 2DXEA 3VGUA 1BE4A 1WKJA 1PAEX 1MN7A 1K44A 3JS9A 1B4SA 2B8PA 4KPCA 3BBFA 5CAAA 3ZTRA 2VU5A 3PJ9A 3FBCA 1NDLA 3ENAA 2DY9A 2AZ3A 5CABA 3Q83A 3ETMA 1HLWA 3PRVA 3ZTOA 3MPDA 2CWKA 1MN9A 3EVWA 3DKDA 3ELHA 4S0MA 3EMTA 3FC9A 3VVTA 3NGRA 1EHWA 5BXIA 1U8WA 2BX6A 3GP9A 3VGVA 3ZTSA 4ANCA 3DDIA 3FBBA 4ENOA 1NDKA 4UOFA 3NGUA 3FCVA 3BH7B 4CP5A 3BH6B 3EICA 4DUTA 1ZS6A 3BBBA 3G2XA 3Q86A 1NDCA 2DXFA 1LEOA 1KDNA 3Q89A 1NHKL 4UOHA 4WBFA 1NDPA 1NB2A 1BUXA 3EJMA 4FKYA 3BBCA 1NUEA 1NCLA 1F3FA 3FKBA 1HHQA 3GPAA 3ZTQA 1LWXA 1XIQA 2HURA 3WX8A 2ZUAA 4W98A 1NSKL 3EM1A 2DXDA 3VVUA 4F36A 1NLKL 1S5ZA 1WKKA 4O0NA 2AZ1A 3FCWA 1PKUA 4C6AA 1HIYA 1VYAA 3VGTA 2DYAA 1WKLA 1XQIA 4DZ6A 4F4AA 1JXVA 3EE3A 3Q8VA 4EK2A 4DI6A 3NGSA 3Q8UA 3ZTPA 4UOGA 1NSPA 1NPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANE A;  3FBF A;  3EVM A;  3B54 A;  3L7U A;  5C7P A;  3NGT A;  2BEF A;  4HR2 A;  5IOL A;  3Q8Y A;  1NSQ A;  2NCK L;  1S57 A;  1W7W A;  2HVD A;  1S59 A;  1UCN A;  3R9L A;  3VGS A;  1B99 A;  2B8Q A;  4AND A;  2HVE A;  1F6T A;  3FBE A;  4FKX A;  3EVO A;  3B6B A;  1BHN A;  2DXE A;  3VGU A;  1BE4 A;  1WKJ A;  1PAE X;  1MN7 A;  1K44 A;  3JS9 A;  1B4S A;  2B8P A;  4KPC A;  3BBF A;  5CAA A;  3ZTR A;  2VU5 A;  3PJ9 A;  3FBC A;  1NDL A;  3ENA A;  2DY9 A;  2AZ3 A;  5CAB A;  3Q83 A;  3ETM A;  1HLW A;  3PRV A;  3ZTO A;  3MPD A;  2CWK A;  1MN9 A;  3EVW A;  3DKD A;  3ELH A;  4S0M A;  3EMT A;  3FC9 A;  3VVT A;  3NGR A;  1EHW A;  5BXI A;  1U8W A;  2BX6 A;  3GP9 A;  3VGV A;  3ZTS A;  4ANC A;  3DDI A;  3FBB A;  4ENO A;  1NDK A;  4UOF A;  3NGU A;  3FCV A;  3BH7 B;  4CP5 A;  3BH6 B;  3EIC A;  4DUT A;  1ZS6 A;  3BBB A;  3G2X A;  3Q86 A;  1NDC A;  2DXF A;  1LEO A;  1KDN A;  3Q89 A;  1NHK L;  4UOH A;  4WBF A;  1NDP A;  1NB2 A;  1BUX A;  3EJM A;  4FKY A;  3BBC A;  1NUE A;  1NCL A;  1F3F A;  3FKB A;  1HHQ A;  3GPA A;  3ZTQ A;  1LWX A;  1XIQ A;  2HUR A;  3WX8 A;  2ZUA A;  4W98 A;  1NSK L;  3EM1 A;  2DXD A;  3VVU A;  4F36 A;  1NLK L;  1S5Z A;  1WKK A;  4O0N A;  2AZ1 A;  3FCW A;  1PKU A;  4C6A A;  1HIY A;  1VYA A;  3VGT A;  2DYA A;  1WKL A;  1XQI A;  4DZ6 A;  4F4A A;  1JXV A;  3EE3 A;  3Q8V A;  4EK2 A;  4DI6 A;  3NGS A;  3Q8U A;  3ZTP A;  4UOG A;  1NSP A;  1NPK A; 
#chains in the Genus database with same CATH topology
 1S1T B;  3FBF A;  4U8Y A;  3EWG A;  3MEG A;  1HW9 A;  3DCA A;  4OFZ A;  4U9R A;  4YB6 A;  4DX6 A;  1YQH A;  2V9W A;  4IUF A;  5C7P A;  4QYZ J;  1BMQ B;  1X4G A;  1GH8 A;  4ZP6 A;  3LWL A;  3IS9 B;  1VQO S;  1TFY A;  1IJF B;  3GG0 A;  4RU9 A;  2F4V J;  2YKM A;  3DXB A;  5AE1 A;  2FB0 A;  2Y8W A;  1RHJ B;  1Q5V A;  4X4R A;  1WOO A;  1S57 A;  2ZNZ A;  3EGW B;  1VLO A;  3IRX B;  4XAK A;  1S9F A;  4AFF A;  3CUL A;  1D1U A;  1DY3 A;  1KN6 A;  2C2Z B;  1VIX A;  2RHS B;  1FEH A;  2CNL B;  4AT1 B;  2VOP A;  1X5T A;  3NBP B;  2WBR A;  2HFZ A;  3D66 A;  1NK5 A;  2OP5 A;  1N5S A;  2DBB A;  2YX1 A;  3ENW A;  3EVO A;  3MCM A;  3GFZ A;  1TUV A;  4ED8 A;  4PEO A;  3W61 A;  5IT0 A;  1K73 T;  1GX5 A;  2Q79 A;  1FNM A;  2YNH B;  3MM6 A;  3NRB A;  3QT6 A;  1HMV A;  3R3T A;  5BJR A;  2VQE J;  1SKR A;  2YH1 A;  4JI7 F;  1R0A B;  4A4J A;  4LBP A;  2GIF A;  1P9Y A;  2OPR A;  4G1Q B;  3TA2 A;  4J9Q A;  4DV3 J;  4C97 A;  3I56 S;  3M6X A;  3MPV A;  4OX7 A;  2NYH A;  2IRU A;  4U8V A;  4DV6 J;  4A8Q A;  2VIC A;  1OWX A;  1L5U A;  1LK7 A;  2CPX A;  1EB0 A;  3W2V B;  1TR0 A;  1RWM B;  1M5S A;  4H4K A;  2M9K A;  1QSY A;  3PJ9 A;  3PNI A;  4F67 A;  3V4I B;  1QLN A;  2YWK A;  4O3P A;  3AOA A;  3GLJ A;  3ZZU A;  2ZBI A;  2ZBQ A;  1S76 D;  3RBE A;  1QAX A;  1VC5 A;  2JLF A;  2LVW A;  3RB6 A;  3H59 A;  5DM6 Q;  3DOL A;  4HEA 9;  1S1V A;  4QWB A;  3HVW A;  2HS0 A;  2ZE2 B;  4NYO A;  1VRT A;  3MZI A;  5H1S V;  1FD8 A;  2D3O R;  3MD1 A;  1RP5 A;  5GAD U;  3M05 A;  2ZEJ A;  5KG3 A;  2MZ1 A;  3M6U A;  3H25 A;  2R9L A;  3F56 A;  4OZN A;  1HD0 A;  2H4W B;  3MAQ A;  1RHR B;  1V3Z A;  3KJN B;  3R5C A;  5LMU J;  3RAX A;  1R8H A;  2E7V A;  4KHM A;  2CUY A;  2H65 B;  2M52 A;  3D68 A;  1QE1 B;  5EDW A;  3G6Y A;  1B70 B;  2FZG B;  4ALZ A;  4A8M P;  4ZVH A;  3TA1 A;  1YBA A;  4LR8 A;  4X4Q A;  3DRX A;  1RAE B;  4LRE A;  1WUU A;  3KLV A;  5DO2 A;  1IWA A;  4RW7 B;  1HPZ B;  2HQD A;  5KG1 A;  4Q45 A;  5DRK A;  4LF1 A;  4K5S A;  3IR5 B;  4Q43 A;  1K1S A;  5F41 A;  4BWJ A;  3E51 A;  3M7V A;  3GPA A;  3POT B;  1N32 F;  1Y3J A;  1N5T A;  2Z8Q A;  3TQ1 A;  2APO A;  2IBO A;  3W2W A;  2DHS A;  2DNL A;  3IO1 A;  1CS4 B;  2BJE A;  1LW0 B;  2CQG A;  3M32 B;  3GG1 A;  3QFH A;  4OX6 A;  3SXL A;  3VCD A;  2RDJ A;  2D9O A;  3QT7 A;  5JJB A;  2WB4 A;  2Q6B A;  3TUJ C;  1HWU A;  1LWF B;  4NOH A;  2MQQ A;  4F36 A;  3GJQ B;  1NLK L;  3N0V A;  3K5O A;  1S1X A;  4A8O A;  2QLJ B;  2ZZN A;  2FHJ D;  1U1N A;  2XQC A;  3QRR A;  1HHS A;  1T05 B;  3JSM A;  3BSO A;  4JYA J;  2EBG A;  1RK8 A;  1RBO B;  3MEK A;  2R7U A;  1MMD A;  2CPE A;  4TY8 A;  4PG6 A;  5I4M A;  5IWA F;  4LF5 J;  4PYA A;  2KO1 A;  3MED A;  5K8P A;  4TVA B;  4KYZ A;  4UUW A;  3CUN A;  1N56 A;  2W7P A;  3SI8 A;  3TQE A;  1CPZ A;  1BQM A;  4ZPW R;  2OTJ S;  2QL9 B;  2FC8 A;  4PWW A;  4QU7 A;  3E8O A;  1RAI B;  4WXO A;  2HSE B;  4X62 F;  2XEX A;  3LOU A;  1JIH A;  4BS2 A;  2B6A B;  1GFW B;  1H2V Z;  2JL9 A;  2RH3 A;  2W2Q P;  3JTP A;  1JNR B;  1U1P A;  4EBD A;  3CME S;  4DSI A;  3TAN A;  3ENQ A;  4NLT A;  3BZQ A;  3SIP B;  2CG4 A;  2B43 A;  4ZLL A;  4UY8 5;  2ZIT A;  4GMK A;  1O0P A;  2VL1 A;  5B08 A;  3GIM A;  1HNW F;  1RAD B;  3G4S S;  1Q78 A;  4K2X A;  2V2Q A;  3HHK A;  4KY3 A;  3DXS X;  4A8K A;  1VK8 A;  1LXN A;  1YJR A;  3TYT A;  2U1A A;  1MWY A;  3D0I E;  3VTI A;  2HQ3 A;  3V81 B;  4LFC J;  1RA7 A;  2LQ5 A;  2GIR A;  4EZ6 A;  1EJ7 L;  1NZ8 A;  1PCA A;  4G1I A;  4ZVP B;  4USH A;  4IOC Q;  4B3S F;  3PIO Q;  3VAG A;  1N5V A;  1JJH A;  2BV3 A;  2MMY A;  1FVS A;  3QAU A;  1XR6 A;  2XMT A;  4WTY A;  4ZPC A;  3W2W B;  2B9X A;  2CZ9 A;  4DR6 J;  2KTQ A;  1YRT A;  2J9D A;  1T95 A;  4DPT A;  4X66 F;  1HBM A;  4NLW A;  2AX0 A;  4CLZ A;  3K5N A;  1HD1 A;  1R8C A;  1U26 A;  1X4B A;  2D9P A;  2GAG C;  4GRS A;  4LSZ B;  3OL6 A;  4B3R J;  5KG2 A;  4X4S A;  1PYS B;  3M8W A;  3PYE A;  1YJV A;  3G71 S;  3F44 A;  4DLG A;  4C0O C;  4ZVF A;  4KE5 A;  1B4S A;  4USW A;  2H51 B;  4CNZ A;  3NAH A;  1WEZ A;  1SC3 B;  3TUP A;  4ED7 A;  3CW2 C;  2R2U A;  4IRC A;  1N5Y A;  1RTJ B;  1WTB A;  4N76 A;  3TR5 A;  4ECV A;  3PO4 A;  3H2U B;  2CYY A;  1YJ9 S;  3GR1 A;  3I5C A;  3H40 A;  1BQN A;  2DY9 A;  2ZD1 A;  1HFE L;  1OMS A;  1EAR A;  2V2V A;  5CAB A;  4P9S A;  1S48 A;  2CQ3 A;  3JXO A;  4K59 A;  3V4I A;  3CC4 S;  4QWD A;  1BQN B;  2DIU A;  2C28 A;  4UTG A;  1BC6 A;  1K47 A;  2XG8 A;  3QBC A;  3QGG A;  1R0C B;  4UQT A;  2V50 A;  2FJX A;  2IM0 A;  4PXB A;  1JJC B;  2PC6 A;  4F0H A;  1JLC A;  2GMH A;  2IA0 A;  4HAC B;  5KFS A;  2JHE A;  3ZNJ 1;  2MKI A;  4L3K A;  3U1L A;  3GV7 B;  5DQI A;  1CEZ A;  2RRA A;  1QY7 A;  2DGV A;  2OSR A;  1TFW A;  3QRQ A;  4PWU A;  2GVZ A;  5I3Q A;  1WI6 A;  2OPP A;  4Y2I A;  3BQ2 A;  4C8K A;  3BGF A;  3EIC A;  3GON A;  4A8X A;  4DUT A;  3RTV A;  4W92 B;  1S1U B;  2W9B B;  1FCA A;  4CWB A;  2EBE A;  3VHQ A;  3BB5 A;  2KHC A;  4FPI A;  5M2U A;  4KQZ A;  2CQ2 A;  2OPR B;  4NYP A;  2VQF J;  4TNO A;  3TP2 A;  2IAJ A;  2LQ8 A;  4RW9 B;  1Y3K A;  2J0W A;  4CT8 A;  4ED5 A;  3BGR B;  1RXO B;  3KDN A;  1FDB A;  4CO2 A;  1HPZ A;  2HFU A;  1O6X A;  1C1B A;  3AA8 A;  4G65 A;  2COL A;  4Y34 A;  5G0R B;  1BXN A;  3BQ1 A;  4OYZ A;  3HM9 A;  4P6Q A;  1RDR A;  3WX8 A;  4ES2 A;  3J7Y U;  3PW2 A;  4B3O A;  1LW2 B;  1Y10 A;  3CCT A;  4RNN A;  1HBO B;  3HSJ A;  4NCG B;  4V1A k;  3TJA A;  3CCL S;  2HHS A;  4I7F A;  2IY5 B;  2D3U A;  2HS4 A;  4FXV A;  2X1F A;  1YRX A;  2DO0 A;  2JWN A;  1YJN S;  2Y0S D;  5A8R A;  4HH0 A;  4PG4 A;  4I1T A;  4E8U A;  1S5Z A;  4PKD B;  2YPZ A;  4TYB A;  1LWF A;  3SYZ A;  1JLB A;  2ASD A;  4QJV A;  1RIS A;  2DJW A;  1TL7 A;  1IKX A;  1RKI A;  1VS3 A;  3PXG a;  1SC1 B;  5L9N A;  2N7C A;  4JI5 F;  3W5Y A;  1WNE A;  3BGO P;  1JLE B;  2HBQ B;  2YWG A;  3SEO A;  3R2C J;  1F2G A;  3DLK B;  4RWW A;  1WHY A;  4YR0 A;  1RSC A;  1S99 A;  4J9U E;  3FCH A;  4F4A A;  4L72 B;  2HNZ B;  2LU1 A;  4WYW A;  2ZDP A;  2HFN A;  1KEK A;  4ZJO A;  3M30 A;  2L9N A;  4RU2 A;  4JI1 J;  1WEL A;  1IXK A;  2WSE C;  1ACM B;  3PYF A;  3S7R A;  5M2R A;  2V2Z A;  5KG0 A;  2DR9 A;  2LEA A;  3LAK A;  1BLU A;  1KNZ A;  3EVM A;  4O3O A;  3UO0 A;  3BQ0 A;  4C11 A;  2H48 B;  1N5Q A;  3GFY A;  4BBY A;  1Q7Y T;  1X9M A;  1FDN A;  2WVB A;  3TVY A;  5HQL A;  3Q0A A;  4H54 A;  2WVC A;  5D4N A;  2XMJ A;  4ETX A;  2LLZ A;  4RBU A;  1CJU A;  4USM A;  3KOA A;  4URG A;  5H9F K;  1R43 A;  2JZ5 A;  3KK3 A;  4P2S A;  5ETV A;  3QJL A;  4ICL A;  1HBU B;  5F0U A;  5MLC V;  4Y2K A;  2RB7 A;  4NZ7 A;  2F8E X;  5AE2 A;  3HVT A;  4NLX A;  4QCL A;  4WZQ A;  2IRX A;  5KG4 A;  2XS5 A;  3I96 A;  4Z7C A;  5BR8 F;  3SFG A;  4CH0 S;  3GV5 B;  2PFD A;  3FK4 A;  1CSJ A;  2LQ9 A;  3F73 A;  3DGP A;  2VG5 A;  2ATL A;  1PAE X;  2B9Y A;  1UFW A;  3UW1 A;  3EX7 B;  1H72 C;  4UW2 A;  1T9V A;  3GJR B;  5HMW A;  2UVU A;  2AEJ A;  1U1R A;  1FDD A;  4OI4 A;  4DPW A;  3MR2 A;  2UUB F;  2LXF A;  3FEY B;  2CJB A;  3LP2 B;  1NPP A;  4Q8E A;  3M1V A;  4OI1 A;  1M5V C;  2CXE A;  2ADB A;  1NDL A;  3IMQ J;  1MU2 B;  2CQI A;  4DV2 J;  2Y1L B;  1GT8 A;  1T3O A;  1U24 A;  4LF5 F;  4Y2M A;  2KYZ A;  1TL5 A;  4OZ2 A;  1CJT A;  5L8R C;  2E9T A;  4FP9 A;  5C2C A;  3TWZ A;  1QDU B;  2V34 A;  1NK9 A;  1FE0 A;  3I32 A;  2L08 A;  4N8O A;  4JV2 A;  4YB1 P;  2B4P A;  3CD0 A;  1X5O A;  3FVY A;  4KGZ B;  2JOQ A;  3BR9 A;  1X5P A;  1QD1 A;  3TUI C;  1TUG B;  4QQB A;  3VVT A;  4CLU A;  2HNY A;  4LF4 J;  3JTN A;  3ZZ0 A;  5F9L A;  1Y11 A;  2WCX A;  2VFU A;  4LBI A;  4ZP9 A;  5DM7 Q;  1LWC B;  2ZHO A;  3IGV A;  2MKJ A;  3LPY A;  3NWR A;  2JEI A;  4KFB B;  5C24 B;  1OYD A;  4LRD A;  2FUG 9;  2PO4 A;  2BAB A;  3ULH A;  2QN6 B;  1EKR A;  3HSZ A;  4MYU A;  3BJY A;  4LSL A;  4M95 A;  1RYS A;  3KXD A;  4K4Z A;  2DVI A;  4GKJ J;  3OUY B;  3A3P B;  5AXM A;  5GAG U;  4OZ0 A;  4QR0 A;  2XS7 A;  2BE2 B;  4NLQ A;  1QSS A;  2WSF C;  2NLW A;  3FKB A;  3KLH A;  2WB1 D;  4ZVG A;  5KTQ A;  5E41 A;  3MWB A;  1OQ6 A;  2YNF B;  4KHR A;  2Y1I A;  1VRU A;  4OHZ A;  1FER A;  3GYN A;  5B0E A;  3W8P A;  4FXW A;  3A3N B;  3J81 U;  4YUD A;  1TZ0 A;  2CQH A;  2MYF A;  3TOQ A;  4RO0 A;  1E6V B;  2YTC A;  3BO2 A;  3IA0 A;  2RQK A;  2FLP A;  4CLP A;  4ED0 A;  2KM8 C;  2NYI A;  1DTQ A;  3M8S A;  1U47 A;  2ZOF A;  3R5A A;  1RWU A;  1UW9 A;  3CWJ A;  5EHH A;  5D6G A;  4DV2 F;  3I9Z A;  4IOA Q;  3IG1 A;  3FSI A;  3Q2T C;  3R7S B;  4IH7 A;  3K5L A;  1HIY A;  2XHC A;  4EWT A;  2HGL A;  2PMW A;  4MKV A;  4U6P A;  2MGZ B;  1EKS A;  1A6L A;  1IKX B;  2N4D A;  3QGH A;  2EK6 A;  3K59 A;  4HI2 A;  1UA0 A;  1QSL A;  4NXM J;  1WI8 A;  1SIZ A;  1Q8I A;  2RNE A;  1WDT A;  3MPW A;  1KLN A;  3AH6 A;  3AT1 B;  2KU7 A;  3CCM S;  3KLF A;  1FJE B;  3PCO B;  4F0M A;  1FXR A;  3DOM A;  5LJ5 Y;  3SQO P;  4RUH A;  5B0F A;  2H54 B;  2ZZT A;  3GB0 A;  2HHX A;  1QE1 A;  1Z4U A;  2BXJ A;  2OJ3 A;  1MG7 A;  1V3R A;  4M5L A;  1HI8 A;  1GMU A;  1KP6 A;  4YB5 A;  3EZU A;  2UV8 A;  5HBM A;  1M5P C;  3NGT A;  4LFB J;  2PD1 A;  4OLP A;  2GQQ A;  2BJ9 A;  2C3O A;  3K17 A;  3HP6 A;  2P9C A;  3DHW C;  1WG1 A;  4Y2C A;  5K9F A;  1T9X A;  2XM3 A;  3VGS A;  3AQP A;  1IN0 A;  4DUZ F;  1UZD A;  2K1R B;  2O1P A;  2O67 A;  4FNH A;  4J7C A;  4J9V A;  1CC8 A;  4NL5 A;  3KMS A;  3DLG A;  4NPO A;  2WZ1 A;  2UXD J;  1UVN A;  1TU0 B;  2EKY A;  3V4M A;  4Q5V A;  1KVI A;  2HZV A;  4XK8 C;  4RBV A;  4DX5 A;  5HAO A;  3FEX B;  3KJV B;  4Z2X A;  3RRG A;  3D6F B;  4O44 B;  4DLE A;  1C0T B;  1GNK A;  1BE4 A;  2E1P A;  2HBR B;  3HHE A;  2N4C A;  4IG0 A;  2ZH7 A;  4EO6 A;  4WFY A;  2P8I A;  3JSM B;  5KT7 A;  1SB6 A;  1N6Q A;  2E5J A;  2FJB B;  3BRE A;  3DM2 A;  4RNF A;  2ASL A;  1VC0 A;  5J2P B;  1W26 A;  1NKB A;  1W2B R;  1AFI A;  3A8J A;  3LO3 A;  3AFG A;  3DRP B;  3QT8 A;  4AL7 A;  1X0F A;  2DGW A;  3T6B A;  2RS2 A;  1NPR A;  3FMB A;  2DHA A;  4NXM F;  1TAQ A;  2AX1 A;  1PGZ A;  1QAI A;  4YS2 A;  3MEE B;  2GX8 A;  3TEG A;  2FVS A;  2OPQ B;  2ADC A;  1RCO B;  3HI9 A;  2ZC4 A;  4JI7 J;  2E44 A;  2PA3 A;  1U2F A;  2HHP A;  3MEE A;  3VAM A;  5AXN A;  4DR7 F;  1PBA A;  3MTK A;  3O2I A;  1ZAV A;  5A8W A;  4PRF A;  4ECT A;  2WVD A;  3NGR A;  1DRZ A;  1U8W A;  2ZDO A;  2A18 A;  4NLP A;  2QYC A;  2K8G A;  3GP9 A;  4RL1 A;  2CJY B;  1WEY A;  3HT3 A;  3BGL A;  2J6T A;  1X5S A;  2J0Q D;  1N33 J;  2YQ1 A;  2ZVS A;  1S9G B;  3J80 Y;  4Y6I A;  3R97 A;  2HND B;  3SCK E;  2WOM A;  5E3R A;  2V9K A;  1FRK A;  2DH8 A;  2V5H G;  3OTO F;  3H5U A;  2EFG A;  2DK2 A;  3ILI A;  4WU3 A;  4R8U B;  1E6Y B;  3HHD A;  4ID5 A;  4A8W A;  1NH7 A;  1VR6 A;  2A3J A;  2HK2 A;  2MJU A;  3M2R B;  2V4J B;  4IYQ A;  1FK9 B;  3ZNU A;  4F26 A;  4ECZ A;  2ACM A;  4J9P A;  4GKJ F;  2M8D B;  2GIQ A;  1NUE A;  2ZBC A;  3ILO A;  3B8H A;  3BO3 A;  4USJ C;  2G2Z A;  3I5A A;  2ZKU A;  3ZTQ A;  5KFB A;  3GIL A;  2HGN A;  3AY0 A;  4IDK B;  2K7J A;  2PSZ A;  4NLY A;  2W8K A;  1I5O B;  2VHG A;  1VC6 A;  3UQS A;  2MZQ A;  4USV A;  1VQ9 S;  2DNN A;  1KTV A;  4NE9 C;  1U4B A;  1N5Y B;  3W65 A;  4ZMM A;  3TX8 A;  5A8K A;  4RW6 A;  3KLE B;  2M2B A;  3ISN D;  2XGP A;  3E3X A;  1R6Y A;  2QV6 A;  2QE5 A;  2VF3 A;  4U67 Q;  1E6V A;  4JI3 F;  2DHX A;  3CJK B;  4CH7 A;  2P6S A;  4OYA A;  2HS3 A;  3BSN A;  2B56 A;  5EGY A;  4Z37 A;  3D54 A;  2R7Q A;  5KFV A;  3CMQ A;  1FFG B;  1VYA A;  5LSR A;  2G1D A;  3PHE A;  2QSW A;  3OR2 B;  3NOC A;  4YDD B;  3FSX A;  2CQ0 A;  3ET6 B;  5A0Y A;  3H4B A;  1REV A;  3S1T A;  1ZM3 A;  3TEH B;  4EUV A;  1YJT A;  2ZH6 A;  4N41 A;  1IUJ A;  2AU0 A;  1U1Q A;  1L3K A;  1SVD A;  1UL3 A;  2OAU A;  2VIH A;  2I5J A;  4M5I A;  1DAX A;  2WON B;  3DOK A;  2V63 A;  3RU0 A;  1TAU A;  5KFL A;  2R7T A;  4K0K F;  1PYT A;  1VMB A;  1HW8 A;  1FWP A;  2ZJP Q;  1VIO A;  3VAH A;  1Q4R A;  1M90 T;  4OX8 A;  4ZCL A;  4ANE A;  5C2G A;  5F8G A;  2OEK A;  1RHU B;  1KWM A;  3T3F A;  2DT9 A;  3OBI A;  2CDR B;  5L1I A;  1X4C A;  3J7A 1;  3E2E A;  4HR2 A;  3S6E A;  1LOU A;  3M8Q A;  5CYJ A;  3H5S A;  1PAU B;  3IAS 9;  3I87 A;  4B08 A;  1QM9 A;  4RWX A;  2HVD A;  3RYL A;  3UCZ P;  5KFA A;  3VQT A;  3AAW B;  1ZAX A;  5KFQ A;  3FGV A;  4JI6 F;  2R7O A;  4X62 J;  4PQA A;  2HZC A;  1F6T A;  3NS7 B;  2RML A;  1MNE A;  3G87 A;  3VAI A;  2DR7 A;  1GTE A;  1AXQ A;  4P75 A;  3S8S A;  4B9S A;  2NS1 B;  5KFO A;  2BW7 A;  2O3D A;  1WOS A;  3BEG B;  4LIW A;  5DDO C;  3SCJ E;  3D1Q A;  4C3L A;  3NBP A;  3KLI B;  4OHY A;  2F40 A;  1MWQ A;  1JWW A;  3N79 A;  3CIM A;  3OPK A;  2BJD A;  4ILL A;  3M2V B;  1JLB B;  1LKZ A;  1MN7 A;  2DO4 A;  2V6A A;  3OLB A;  2DGX A;  2Y1J A;  2AF6 A;  1X7V A;  4DV5 J;  1O51 A;  1NXI A;  1SXL A;  2D69 A;  2HRT A;  1WSV A;  4ZLP A;  4KV8 B;  3LTO A;  3D6T B;  3OVS A;  2JEF A;  1WHV A;  4O23 A;  1SJF A;  2MEW A;  3NS6 A;  3RR8 A;  2QJ3 A;  2HKE A;  4DV6 F;  4QIW D;  4DPY A;  3TAQ A;  3UD5 A;  2QYG A;  4Q0B B;  1F60 B;  2O66 A;  2KI2 A;  2RAQ A;  2WON A;  3UR3 C;  2WSC C;  1UP1 A;  4NXN F;  1KLM B;  3MCS A;  2UUB J;  4KR0 B;  5ETR A;  3GIK A;  3HDS A;  1S0O A;  4H4M A;  2UU9 J;  1P1T A;  2E5L J;  3OJU A;  1W2I A;  3GU0 A;  1XJW B;  1YJU A;  3CJ5 A;  3I9V 9;  2VZ9 A;  4RLE A;  1TKT B;  4KRW A;  3RBX A;  3DLE B;  3ZTS A;  1RQ0 A;  3C6U A;  5DZ7 A;  4ENO A;  3BSA A;  1EET A;  1RBL A;  4DX7 A;  2KT2 A;  4V19 J;  4YHH F;  1U02 A;  2HVZ A;  2MPU A;  1IWG A;  1SJ1 A;  1TL4 A;  3BBB A;  1WC1 A;  4B3M F;  4MH8 A;  4OZJ A;  3A13 A;  4F4Y A;  2C42 A;  2Q3P A;  3C16 A;  1T9W A;  2YPY A;  3CSK A;  3I5B A;  2PT0 A;  4J37 A;  4Q7A A;  3H4D A;  3T1H F;  4KB7 A;  5F8N A;  2IPO B;  4L75 A;  1NJI T;  3L7O A;  3KMQ A;  1EP4 A;  2CNN B;  2WRM A;  2BMB A;  3A1Y G;  4RW4 B;  4KGX B;  2PE8 A;  4GVB A;  4KO0 B;  1JKH B;  2H5I B;  4OHX A;  5C42 A;  1HHQ A;  3OHA A;  3C46 A;  4JI8 J;  2NSB A;  4B02 A;  2X1G A;  2WTF A;  2KYX A;  3H2V E;  2MQN A;  4O3R A;  5CXT A;  4O3S A;  2CQP A;  3RW6 A;  3TZZ A;  1FE4 A;  2ROP A;  3FRY A;  4C8O A;  4CLK A;  3BR8 A;  4OYX A;  2P6T A;  1VBX A;  3BO4 A;  1VQN S;  2GNK A;  1NND A;  3FZB A;  4EU0 A;  1FXD A;  4QPX A;  2QFJ A;  5D4P A;  1Y5I B;  4JI3 J;  1T7P A;  1WWH A;  1PSD A;  3W66 A;  3WZ0 A;  3ITH B;  4W4M A;  2EI5 A;  2YNI A;  3CVK A;  4XDD A;  5KFJ A;  1CUL B;  1BY9 A;  2CJA A;  2OML A;  3NWG A;  1WKL A;  2YKN B;  4ZCI A;  5DDR C;  1I6J A;  1TKT A;  1X31 C;  1H7X A;  2PA8 D;  4PXE A;  4MIB A;  4OYI A;  4EK2 A;  3BPS P;  5IWA J;  5FDL A;  1XWL A;  5E5N A;  4KC5 A;  1TKZ A;  2FDN A;  3OSN A;  4LF6 J;  3QIP A;  2XO7 A;  3UWT A;  1RAJ A;  4LFA F;  3OL7 A;  2E9R X;  5J1E B;  1R3N A;  1WSR A;  2AP6 A;  4DPO A;  3QQC D;  1VHI A;  4P73 A;  2B3T B;  4KBI A;  4FYY B;  1H2U X;  2HHH F;  3ENV A;  2ZKT A;  4LRA A;  1N6Q B;  5CH7 B;  1AUS L;  3TVZ A;  2HZA A;  1TL1 B;  1S59 A;  4ELT A;  1JLA B;  1FD2 A;  1FF2 A;  1WJ9 A;  2LEP A;  2QL5 B;  3O8W A;  4ZVQ B;  3X3U A;  2ILZ A;  4X65 J;  2VJV A;  4DQS A;  2XZW A;  2KKH A;  1TQL A;  3CT9 A;  4MTP A;  1LFW A;  2LKZ A;  3QWU A;  3VWS A;  1JLA A;  1H73 A;  1HI1 A;  2DNK A;  2XCA A;  1RWW B;  1SBR A;  4XDC A;  4ED3 A;  4M94 A;  1AYE A;  2IAJ B;  2CDQ A;  1Y5N B;  4JI4 J;  2BJ7 A;  4RW9 A;  2JSX A;  4F2S A;  3NNH A;  3CJ2 A;  4QOT A;  1C1C B;  4PPZ A;  4YDX A;  1SL2 A;  4R5P B;  3G82 B;  5L1J A;  3QLH B;  1FEE A;  2VD3 A;  3GCX P;  5GAE I;  1S1W A;  3P49 B;  1HMV B;  2C2M B;  2OEJ A;  5LMN F;  4OV6 A;  3M2V A;  3T6J A;  3C3L A;  4ER8 A;  1ZA1 B;  1OY6 A;  3G6V A;  1S4F A;  2HLU A;  3NAI A;  2OIH A;  4J9S A;  1OSD A;  4B9M A;  1SV5 B;  3RB3 A;  2XSJ A;  1SJR A;  4I2Q B;  2BM1 A;  3KHR A;  5LSO A;  2BVZ A;  5HMY A;  5FDL B;  4F04 B;  2HHT A;  2HIY A;  3DOM B;  3MOZ A;  3FZ2 A;  3SQG B;  2YQ3 A;  4N47 A;  5B0C A;  5LSL A;  4BDP A;  2C2D A;  3BKU A;  3BV8 A;  4LSN B;  1OPI A;  1Z2Z A;  3CDU A;  3KDO A;  3SBM A;  2MY8 A;  2VA3 A;  2VG6 B;  1MRO A;  4MMO A;  4M63 A;  1VQM S;  4OJ3 A;  2BX6 A;  2FHO B;  4C4W A;  3FBB A;  2Y8Y A;  1HQU A;  8RUC A;  4UY8 T;  1U2C A;  3FCV A;  1FJG F;  2JX2 A;  3HVA A;  3DRR A;  2W9C B;  3OTE A;  2XS2 A;  3GE9 A;  4A8F A;  4GKK J;  2HIQ A;  4X64 J;  4NZ0 A;  1F1B B;  5EWE A;  4DL2 A;  1XMQ F;  2DXF A;  3NS5 A;  2HHU A;  3DDN A;  2GVZ B;  2ZZM A;  4QIV A;  3N4W A;  2XY6 A;  4UOH A;  4P2X A;  4B3M J;  4LJM A;  4OZ3 A;  7FD1 A;  1SI9 A;  2Q43 A;  4NLR A;  2DR6 A;  3V5R A;  4Y65 A;  5M2P A;  3GJS B;  1X4E A;  4ZP7 A;  5DDP C;  1FTC A;  2L41 A;  4LQ3 A;  4WFB Q;  4GC7 A;  3AA9 A;  5H9E J;  2GAH C;  1HI0 P;  4I67 A;  3R5G A;  1EP4 B;  1FFS B;  1LWX A;  3EZ5 A;  4U7U D;  4KHP F;  2BYC A;  3W62 A;  2YKO A;  2RE1 A;  3GSD A;  1RTZ A;  3UNG C;  3P5B P;  1RWK B;  4CLS A;  3G8Q A;  1UFK A;  2KT5 A;  7FDR A;  1UJ5 A;  3CCE S;  2FIU A;  1KVK A;  2RQ4 A;  4X4O A;  1ZTT A;  1XNR J;  5T7L A;  2IMO A;  4K4X A;  4F7V A;  2ZWO A;  3JAM U;  1VQ8 S;  3OFG A;  4WK3 A;  3DGP B;  1KTQ A;  2AYB A;  3A4T A;  2MQP A;  3W9H A;  2E9Z A;  2MTL A;  1WF2 A;  2CNK B;  1H0H B;  2B4U A;  4URQ U;  4ZIT A;  2G2O A;  2AJ4 A;  3M4X A;  3HZG A;  4MAK A;  1RE1 B;  4ECU A;  2DCU B;  3VGT A;  5KFM A;  1YSJ A;  2R7W A;  3LAM A;  1SKW A;  4QIF A;  4TYA A;  5IZH A;  3ZZP A;  3EGN A;  1XQI A;  2BE7 D;  1CUL A;  3PZP A;  4FXD A;  1RA6 A;  3PAC A;  2A2D A;  2PII A;  4KT0 C;  4CO4 A;  4F4K A;  2N82 B;  4JI5 J;  2R7S A;  5DDQ C;  3G6E S;  1B64 A;  4DWI A;  1UA1 A;  3DRR B;  4PQU B;  4YOE A;  2WOM B;  3GQC A;  2VFT A;  2MLZ A;  3TUZ C;  3MMC B;  4C0H A;  2EG2 A;  2CPD A;  3ZZT A;  1B3T A;  3Q8Q B;  4L3N A;  2GV1 A;  4JUZ A;  4DZD A;  1XMB A;  3V81 A;  2AYE A;  2G13 A;  2HFO A;  1NZA A;  2D7S A;  3CJS A;  3THT A;  1Y7P A;  1S1T A;  4FVM A;  2VV5 A;  1YI2 S;  2DGO A;  3NY0 A;  1U0S A;  4GC6 A;  2QA2 A;  2BKP A;  2R3V A;  3G86 A;  3U7J A;  4U7C A;  1X4A A;  4NCB A;  2HQC A;  3RAM A;  3OTC A;  2AJ0 A;  3LF0 A;  2FY8 A;  4IDK A;  5E3A A;  3UN3 A;  3MM5 A;  2C3U A;  3PDN A;  1NB7 A;  1VQK S;  4FS1 A;  1ZM9 A;  4AND A;  1RT3 B;  2FJE B;  2XMW A;  5U47 A;  2AV5 A;  5B09 A;  3TX0 A;  1RWN B;  5GAE U;  4NLV A;  3BF4 A;  2DGS A;  1BHN A;  2ROE A;  1RWP B;  2C3Y A;  2DNQ A;  3B4M A;  3FSY A;  2KFZ A;  3MUM P;  1FA0 A;  2V68 A;  4AD6 A;  1HNX F;  2PFF B;  1A0O B;  1K44 A;  1WDD A;  3SDE A;  4DL7 A;  1U1O A;  4YY3 F;  4R5P A;  4IRK A;  2DRA A;  2D41 A;  1HWK A;  1ZAW A;  1WD6 A;  3MEC A;  3CMA S;  3MDF A;  5KFF A;  3AJ1 A;  2RDI A;  2VG7 B;  2WW4 A;  3WDO A;  1RAB B;  2I0X A;  2MB0 B;  1RLD A;  4B9L A;  1OIA A;  2XI2 A;  4LVN P;  4NWB A;  1NAQ A;  3Q8P B;  3PRD A;  3CC7 S;  4B9V A;  2KN4 A;  3U1M A;  5ETT A;  4PQU A;  2C22 A;  2EFO A;  1RHK B;  1EIY B;  3HF5 A;  4W90 B;  4HH1 A;  2VQE F;  3DKD A;  4ECY A;  2UV8 G;  4ZVE A;  2X1B A;  3ZC4 A;  2OFG X;  4DV3 F;  2CNO B;  2E5I A;  4HTJ A;  5HN0 A;  3MOJ B;  1RI7 A;  1L3T A;  3M8P B;  2B9W A;  3MF5 A;  1HWL A;  4M5H A;  1JLF A;  2ATC B;  2V8D A;  1Q16 B;  2RQC A;  4DV7 J;  3HFK A;  2C2R A;  2QLB B;  1V3S A;  2FLL A;  1N36 J;  4DCJ B;  2RUS A;  3M8P A;  5E3P A;  4XIU A;  1WC4 A;  1BGX T;  4DN0 A;  1IBM J;  2UXC J;  2K7K A;  1NBE B;  1UMJ A;  2BM0 A;  3DYA A;  2ZVI A;  1YKW A;  3NGK A;  3UDL A;  5EWG A;  3OTO J;  3CCJ S;  4L76 A;  3QAE A;  2HHH J;  3NMA A;  1HNW J;  1RLC L;  1RT6 B;  2VKR A;  1VCT A;  3J7Z 5;  1RAO A;  3MR5 A;  1X4F A;  3GSI A;  4KSE B;  1YHQ S;  3PFE A;  4G6V B;  1GMV A;  4FKY A;  1FRI A;  1J5O A;  2GMJ A;  1BWV A;  4TLQ A;  1S79 A;  4X84 A;  3T1Y J;  2D3Z A;  1LV5 A;  2SXL A;  3MXH P;  2CJ9 A;  4NZ6 A;  1O8B A;  4WP8 A;  4EO8 A;  3GIR A;  5IV4 A;  1ELO A;  2BE9 B;  1YIJ S;  4ZA1 A;  2BQU A;  2C2E A;  3UD3 P;  1RTD B;  4NLU A;  4O4R A;  3PRB A;  3IBW A;  4ZVT B;  1S1X B;  3KLG A;  4LF8 F;  2ZH8 A;  4HTI A;  1Q8K A;  3RB0 A;  1JLG B;  1K9M T;  3OW2 R;  4KH1 B;  1VQ6 S;  3PX0 A;  4V19 X;  1EQ0 A;  3OLA A;  1MRO B;  2KVQ E;  2UUA J;  5J1P A;  1KLM A;  1OY9 A;  3AHP A;  3NCR A;  4IO1 A;  4OV1 A;  4WFZ A;  3EXY A;  5EX3 A;  3IM8 A;  4CYU A;  2FVR A;  1N34 J;  4CM0 A;  2PMH A;  3H98 A;  5KFX A;  2XUL A;  3P3D A;  2AEM A;  2KXF A;  3GII A;  4BC7 A;  4DR4 J;  3MD3 A;  1SH0 A;  2R8H A;  2ACY A;  4M5M A;  1FKO B;  5FLX U;  3R7N B;  4HYK A;  5HVG A;  3TW0 A;  1DQA A;  1VQY A;  2RKI A;  1FKA F;  1FX4 A;  4DG1 B;  2FTR A;  3ILJ A;  1YZ7 A;  4Q2L A;  4E98 A;  1TKD A;  2B51 A;  2BQ3 A;  1U48 A;  3QJJ A;  2IFX A;  2EC2 A;  2H1Y A;  2G0C A;  2M8H A;  2QT7 A;  1D3W A;  5D77 A;  4JV0 A;  4C48 A;  1MU2 A;  4WKY A;  4TQS A;  5D8H B;  4P2M A;  1UAW A;  4M1K A;  3G8T A;  4OJ1 A;  1LNQ A;  1LW2 A;  2E1A A;  4BHQ A;  2V94 A;  1JMT A;  3IR7 B;  1FT8 A;  3C19 A;  3MM7 B;  3W64 A;  5KT6 A;  4O0I A;  2OPS B;  4CYU B;  2VB6 A;  3MCN A;  5BYS A;  4F4Z A;  2XLK A;  3CDB A;  2UZA A;  1CS4 A;  1S9E A;  1UPM B;  3BYP A;  3LPE A;  4HT5 A;  5DET A;  2F7V A;  4DEZ A;  1UWA A;  2IVF B;  1FK9 A;  1Q8B A;  4H4O A;  4QWC A;  1OS5 A;  4L6V 3;  3MMJ A;  3JYT A;  2K3I A;  4CI0 B;  3TI0 A;  3DC2 A;  3LUY A;  2EWH A;  5HQM A;  1MW7 A;  4I64 A;  3ZFV A;  2C3M A;  1IR1 A;  3BSC A;  4MYT A;  3MMA B;  5GVQ A;  4Y00 A;  1NK4 A;  2DH9 A;  2M5Y A;  5KOX A;  2KZZ A;  2VPX B;  3EGZ A;  4L73 A;  3I6P A;  2KT3 A;  3ZZO A;  2Z4P A;  5K14 A;  3MMA A;  1O5J A;  2EK1 A;  2AHO B;  2O5D A;  4J90 A;  1RYR A;  3ZTR A;  1FKO A;  4IR1 A;  3QJP A;  1N4L A;  3ZZY A;  4A47 A;  5FD1 A;  2GJ2 A;  2W7O A;  2FJV A;  2AJF E;  5KFH A;  4DR6 F;  3ETM A;  5KFD A;  4UOC A;  3J7A N;  4RNO A;  1KR4 A;  2ZD1 B;  4B3R F;  1MN9 A;  3D4J A;  4C98 A;  1L3U A;  1G2E A;  1CJT B;  1RU1 A;  4Y2A A;  3UE2 A;  4P71 A;  3MM5 B;  1TK0 A;  2N3O A;  5ETP A;  1D0E A;  2D74 B;  2IJN A;  2VPY B;  4OHW A;  2GQ2 A;  1JLQ A;  2W01 A;  2CZ4 A;  1NDK A;  2PMZ D;  4DV1 F;  5HLF A;  1Q86 T;  2V69 A;  1WF1 A;  4X2B A;  1GQE A;  3BH7 B;  4B3T F;  4C8Z A;  1FX2 A;  3MM6 B;  4DFM A;  4QIG A;  1JLF B;  4CO5 A;  3GWC A;  1T0T V;  5L1K A;  3PV8 A;  3JQM A;  4DSE A;  1LK5 A;  2OGU A;  1N34 F;  1W25 A;  2X1A A;  2UUC F;  2IVY A;  2DNY A;  5DGB A;  4QYZ K;  1CLF A;  1X8D A;  3T19 A;  1VQ7 S;  1NHK L;  3AD7 C;  4ZPA A;  4UT4 A;  4H4O B;  1M5H A;  1X4H A;  3HHL C;  3WQP A;  1FJG J;  2JJ4 D;  1NJX A;  4ID5 B;  2GO8 A;  2MZT A;  2CAD A;  1AA1 B;  3C15 A;  2DH7 A;  5GAD I;  3PKM A;  1B0P A;  3K5M A;  2MST A;  5D0E A;  1N0V C;  4HHH A;  2AGO A;  3I0S A;  2Z57 B;  3ETO A;  5KFY A;  4K4T A;  3IRW P;  3VZH A;  2ZUA A;  3K0J A;  4KIA A;  5A8R B;  4B9N A;  3KYL A;  1UJ4 A;  3CCZ A;  5HRO B;  3T1H J;  2FZK B;  2W2N P;  3FDS A;  4F8R A;  2IDE A;  2U2F A;  2ZH4 A;  3UVJ B;  1HBO A;  3MUR P;  2DR5 A;  3L95 X;  5HL7 Q;  3QWP A;  5J2M A;  1FRH A;  2PI4 A;  4NEY A;  2AJQ A;  2MKC A;  4DDF A;  2BKN A;  2VFR A;  1M1K T;  1RTI B;  4JI0 J;  5KAK A;  4YR2 A;  1QJH A;  2EFP A;  2LA4 A;  3J81 j;  3KJV A;  3R5D A;  3T5J A;  1T9T A;  3CDE A;  1HAR A;  5DG9 A;  3Q8S B;  3DLL Q;  3OXG A;  1RTI A;  5DLF A;  3EXC X;  4DFK A;  2XNQ A;  1PO6 A;  2IMW P;  3HT0 A;  1RT6 A;  3N6L A;  4DI6 A;  3Q8R B;  2XBP A;  3IWN C;  5B0B A;  4GO5 X;  3WBZ A;  4QU6 A;  1PYO B;  3PEH A;  4FYX B;  3VAL A;  3MFH A;  1VQ4 S;  1NKC A;  1CJV B;  5J2Q B;  3KG1 A;  1ZM4 A;  2E5H A;  4AQY F;  1UVM A;  1F9F A;  1HNV A;  1LW0 A;  1VFJ A;  2J0X A;  2XY7 A;  2OH2 A;  5F3Z A;  5IOL A;  1Q82 T;  2WVF A;  2QRR A;  1D9F A;  4YR3 A;  1S0V A;  2LMI A;  1HNZ J;  4DSK A;  2J9C A;  3HD2 A;  2M88 A;  4URS A;  1N48 A;  4DR7 J;  1VHF A;  3K89 A;  3KJQ B;  1GXL A;  3VAK A;  5ADZ A;  1DFD A;  4ECW A;  1U0H A;  3D1H A;  2IM3 A;  3GZ7 A;  4IKA A;  1LFP A;  4GVL A;  1S4E A;  1IR2 A;  2MLX A;  1IKV A;  1UVI A;  1Q53 A;  1Q7L B;  3LAL A;  1L3S A;  2NXN A;  3VGU A;  2RS8 A;  4X4P A;  4RUB A;  2NXJ A;  1TL3 B;  3PVX A;  4B9U A;  2VC0 A;  4RKU C;  1DTT A;  2W24 A;  3I0R B;  4R8U A;  3UI3 A;  1QUP A;  1G6B A;  1ZBT A;  2ZH1 A;  3L09 A;  4LT6 A;  2HHV A;  5EN1 A;  5ETM A;  4EMD A;  2V8H A;  4P10 A;  4RPF A;  1SQF A;  3BBF A;  5AJ3 F;  4CLT A;  2AT1 B;  5J2P A;  3FBC A;  2OD6 A;  4WJB A;  2BQR A;  4IFV A;  2UUA F;  3M6V A;  4JI6 J;  1UKU A;  1NJY A;  2W2O P;  2F8M A;  2OHD A;  2XNR A;  2OSQ A;  2AZ3 A;  2XYP B;  3CCQ S;  2R7R A;  4DR4 F;  1SCJ B;  1RWV B;  2W2P P;  2MY7 A;  5F8J A;  1RAC B;  2NPI A;  3HVR A;  4JB8 B;  2DEI A;  4KKO A;  2CWK A;  2FJD B;  5KFI A;  4PXD A;  3AQO A;  5HJX A;  3U02 A;  1HWI A;  1OPZ A;  1PIL A;  1Q5Y A;  3NXZ A;  3UDE A;  1ZET A;  1P8G A;  3HJV A;  1IBK J;  2K1R A;  3QAT A;  3CJK A;  2NZC A;  1C0U A;  2JRS A;  3DDI A;  5F0W A;  4CO3 A;  4AQY J;  5D3G A;  2ZBP A;  3U1N A;  1UET A;  2RUG A;  3HZE A;  3DLE A;  1NKE A;  5FII A;  2B5J B;  2DY1 A;  2XZD B;  3BH6 B;  4O4G A;  2IYG A;  2I38 A;  3A12 A;  1KHW A;  2KM8 B;  1AFJ A;  1WHX A;  3CGI A;  2G9O A;  3J7Z T;  1J5E J;  4DV0 F;  4PUO A;  4IG0 B;  2GO9 A;  2OPP B;  1JQG A;  2HEK A;  3H2L A;  4G3I A;  3Q89 A;  1XMQ J;  3KNG A;  1UEK A;  2A6M A;  2CPH A;  2P9G A;  4TXS A;  4Y3C A;  5KFZ A;  1J2V A;  2UUW A;  1VI7 A;  2HBY B;  2WBM A;  3KK1 B;  4LSL B;  3JQJ A;  2V4J A;  1HHT P;  3Q24 A;  4K0K J;  2MZR A;  3PYD A;  3KWM A;  4DQR A;  3WX4 A;  3CCU S;  3N5F A;  2CG8 A;  1U1L A;  4IO9 Q;  1T9Y A;  4RR5 A;  3UDV A;  4DUY J;  4FBT A;  2BAC A;  3IS9 A;  4XO0 A;  4W98 A;  1UVK A;  1NSK L;  3W5Z A;  1CJK B;  2V4R A;  5CHC B;  4HDG A;  2DTJ A;  2RF2 A;  2IA6 A;  5AJ3 J;  3RW7 A;  4F50 A;  2A10 A;  2ILY A;  4LF7 F;  1XR7 A;  3CJ3 A;  1JLC B;  3PW0 A;  1R7I A;  3QSY B;  2RIJ A;  2HQI A;  3PYG A;  5FJ4 A;  1CBK A;  2FLN A;  4FF4 A;  2VH7 A;  5AXL A;  2XMU A;  3HKW A;  1BQX A;  3RBZ A;  3QT5 A;  3RAQ A;  5D4O A;  3UPF A;  4TU7 A;  3NG8 A;  3TAM A;  2YNH A;  3CDW A;  4LR9 A;  2GGP A;  1ZPV A;  1SV5 A;  2V8G A;  1BD6 A;  2F4F A;  3VF0 B;  4J9L A;  1TK8 A;  1PJ5 A;  1JLE A;  1Q79 A;  3EDQ B;  3NCQ A;  2LXU A;  1RAA B;  3ET6 A;  1XR5 A;  1VBY A;  4YB7 A;  2AIR B;  1UWB A;  3E01 B;  1RAH B;  3Q8U A;  1KQF B;  4UQG A;  1ITP A;  5KFP A;  3LP0 A;  5IM0 A;  4LFB F;  4JV5 F;  1REG X;  4YQW A;  2FGO A;  4I2P A;  2DGQ A;  1VBK A;  3RGI A;  2IBK A;  4DL0 C;  2VBZ A;  2VG6 A;  3MR6 A;  5G4D A;  3CCR S;  2MDA A;  6FDR A;  5GAG I;  1AZS B;  3GFX A;  2QZ8 A;  4Q8F A;  3KLH B;  4ZHR B;  2UU9 F;  4OL8 A;  5CQG A;  2HMI A;  1KVJ A;  2YNF A;  3MM8 B;  4A46 A;  3IWX A;  4U96 A;  4AL6 A;  4LIR A;  2FGC A;  3FBE A;  2QO3 A;  4FKX A;  1ZZN A;  4GKK F;  2HMI B;  5H9F J;  2E1C A;  2ZFH A;  2CKW A;  1RBA A;  2VDI A;  1ZH5 A;  1SH3 A;  4OYB A;  3ADA C;  2LDI A;  2NUU G;  2F9J A;  2JC0 A;  4CM2 A;  4K4U A;  4CQ1 A;  1QUV A;  3W9I A;  1RTH A;  4ED1 A;  1UPP A;  3I4H X;  1SC6 A;  3IG1 B;  3M9O B;  2FYX A;  4C8M A;  4AUK A;  5ETQ A;  4DQQ A;  1UZH A;  2E7X A;  4HL9 A;  3QLH A;  4WFX A;  4FZV A;  2LEC A;  1R8A A;  1I51 B;  2OLW A;  4CRJ A;  2NZ4 A;  2EG1 A;  3CIZ A;  3JSB A;  4R0E A;  2W1B A;  5D0G A;  3AOD A;  5ETO A;  3UNY A;  2F3J A;  1LXJ A;  1R89 A;  1RJJ A;  2K2P A;  4OI3 A;  3BYR A;  4IQM A;  3D3C J;  3P4U B;  2MZS A;  1KKH A;  3M32 A;  2XZT B;  1XTZ A;  3UCG A;  3M8Q B;  4OZL A;  1APS A;  5EWF A;  3CF5 Q;  3RJM B;  4ED2 A;  1YG0 A;  3AXM A;  5BR8 J;  4CTA A;  4YY3 J;  2R8J A;  2M3D A;  2UP1 A;  2OPQ A;  4OYO A;  3DLB A;  3W8G A;  1XC9 A;  1XEZ A;  1QVF R;  2DD8 S;  2P5V A;  3SCI E;  3UN5 A;  3V6H A;  4ICL B;  1S9G A;  2R8K A;  4M5G A;  1FRL A;  1UVL A;  1T05 A;  3I4P A;  1AZS A;  2ROG A;  3L4B C;  4QYR A;  4WIQ A;  3NGU A;  3MM7 A;  4WWS A;  1DLO A;  2ZM6 J;  4DR2 F;  3IFE A;  3THV A;  1ZTW A;  4KPY A;  3R7B B;  4IG3 A;  4CP5 A;  3LP1 B;  5K8M A;  3T5H A;  2HWH A;  3NOG A;  3MPY A;  1LWC A;  2WAQ D;  2B5J A;  4O4G B;  3OV7 A;  4LMZ A;  4ES1 A;  2B7C B;  2W4D A;  3D9B A;  3PJX A;  4NI2 A;  4DV0 J;  3P8B B;  2QL7 B;  1HNZ F;  1HYS A;  4WU2 A;  1NDP A;  1IVZ A;  1BUX A;  3OUY A;  2CRL A;  2CJK A;  2R7V A;  2KRB A;  5LOQ A;  3JAM Y;  1Z1Z A;  2AYM A;  2YX7 A;  3IRX A;  3CCS S;  2XMK A;  2EKN A;  3UCU P;  1AUD A;  1N36 F;  3D0H E;  2DNP A;  2W4P A;  3ISZ A;  2HAF A;  1X0P A;  2YX4 A;  1HBN B;  3EM1 A;  2GQC A;  2MXY A;  2ZOG A;  2X51 A;  1EAY C;  4DR5 F;  4PZV A;  4NLG A;  2DGU A;  3RB4 A;  2AKW B;  4CT9 A;  3BDP A;  1B7Y B;  3U27 A;  2MKK A;  1ULR A;  1VQS A;  3AD9 C;  5F9N A;  1K0T A;  1VQP S;  1M0S A;  5B0G A;  4I6A A;  2XB2 D;  1UTA A;  1WF0 A;  3CJR A;  3FUY A;  4TKT A;  1HNI B;  1RT1 A;  4J91 A;  2OEL A;  2ASY A;  4MK9 A;  1C1C A;  4RX6 A;  1IKY A;  4O3N A;  4DF4 A;  1T8E A;  4K50 A;  1SH2 A;  4PUO B;  5L46 A;  5DQH A;  4RUC A;  1U6Z A;  2GFF A;  4QR2 A;  3Q8V A;  5DQG A;  4ECR A;  3DLJ A;  2QGF B;  4U95 A;  3WC2 A;  5E7O B;  1PG5 B;  6FD1 A;  1RT7 A;  2R4F A;  4IG3 B;  4NA2 A;  2BRL A;  9RUB A;  3HUL A;  4FN5 A;  4YP3 A;  2HFS A;  2IC3 B;  5KT3 A;  4OZ5 A;  5GMD A;  1FKP B;  1PJ7 A;  5KFR A;  1FI4 A;  3T41 A;  4LRF A;  2CIM A;  1TMJ A;  3BN4 A;  4DSL A;  3NP5 A;  3MMC A;  3V6K A;  3F41 A;  1BWE A;  1Y5L B;  3VQS A;  2WK4 A;  1Q1K A;  3AB2 B;  3DI6 B;  1NK7 A;  3N6M A;  2Q6C A;  3C15 B;  2VKZ G;  1YZ6 A;  2J9D E;  1NSQ A;  3SV3 A;  2RF2 B;  4WKR A;  4LSN A;  2ALZ A;  1B99 A;  2PN6 A;  3D67 A;  1TMM A;  3LH2 S;  5H9E K;  2Z58 B;  4MIW A;  1ROF A;  2IJR A;  2QMU B;  4HAC A;  1WTF A;  1SKU B;  4OI2 A;  5HSP A;  2DNZ A;  3FMW A;  2W9A A;  1F2H A;  5KT4 A;  1YJW S;  2MJN A;  4K4Y A;  1GK8 A;  1S12 A;  2RU9 A;  1FTR A;  2B0G A;  1RWO B;  3UVJ A;  2W8L A;  1T03 B;  4M5D A;  3RUB L;  3KTQ A;  2V8P A;  2VJU A;  1XNQ F;  2OMO A;  4YHH J;  2QFI A;  2B9E A;  2ZHB A;  5LXY A;  2B8P A;  4FYD A;  4JI2 F;  1B0V A;  1IKW A;  1S1W B;  1WC5 A;  2BW2 A;  2JC1 A;  4ZPD A;  5HAT A;  4Q44 A;  3DM2 B;  3OL9 A;  2LEB A;  4DL4 A;  5A0Y B;  2VON A;  4AL5 A;  1ZA2 B;  2DNH A;  4IR9 A;  2F65 A;  1SJ3 P;  4MKA A;  1XN9 A;  2CQC A;  2ZNY A;  4P2F A;  4D3H A;  4FPR A;  4A8Y A;  2HRU A;  3IR6 B;  3QFW A;  3AOB A;  3DOL B;  4EBC A;  4PAA A;  4DL3 A;  3Q83 A;  4H4M B;  4PG7 A;  3M2U A;  4OYP A;  1HLW A;  1WG4 A;  2CVI A;  3PR4 A;  5JVG Q;  3GFH A;  2HGM A;  4ZIV A;  1WOR A;  1PIE A;  3UD4 P;  3QMQ A;  1JJ4 A;  4ZHR A;  4KHP J;  1SUQ B;  3FQL A;  1IQZ A;  1CJV A;  1RGV A;  3EMT A;  4P7T A;  1VQL S;  4ATN A;  2YY3 A;  3RG6 A;  4DPX A;  5CZV A;  1RT4 A;  1UFL A;  5KFT A;  1SL1 A;  2CA9 A;  2HFV A;  1PC5 A;  1IJE B;  4C9D A;  1D8Y A;  1HQE A;  4NA3 A;  1X60 A;  2W9B A;  3ZZR A;  4TU9 A;  3HJF A;  2AYG A;  3J7Y I;  3A3O B;  2XWY A;  1C0T A;  1DLO B;  3JB9 k;  2E5G A;  5I42 A;  2JFK A;  1KDN A;  3NCP A;  4ZCK A;  3EPG A;  1TV6 B;  4OJH A;  3ILL A;  3BGR A;  2RRN A;  4GO7 X;  1JK9 B;  2B4V A;  3M30 B;  1HR0 F;  2HVH A;  1N54 B;  2GML A;  2GA7 A;  6AT1 B;  1RT5 A;  1SQE A;  2Z2L A;  4PCQ A;  5I3P A;  2XSJ B;  2RT3 A;  1YWX A;  2YWF A;  3FRZ A;  3GYG A;  4I2Q A;  4IH5 A;  1FFW B;  5IC6 B;  1XER A;  2ZWP A;  3ZXW A;  5JUM A;  4X64 F;  1KQK A;  3KHL A;  3VAF A;  4ITS A;  1J5O B;  4K8R A;  1S49 A;  1V5I B;  4WFA Q;  5KG7 A;  2KFY A;  3MI7 X;  4NLO A;  1GMW D;  5C5J A;  2FHK A;  1N33 F;  1CC7 A;  1RT2 B;  3C14 B;  3HLU A;  2H5E A;  2RSQ A;  1DBD A;  3VVU A;  2EFV A;  1TKX A;  3CD6 S;  2JNJ A;  3KLG B;  1NHV A;  4F3M A;  2G4B A;  3HVT B;  1RHQ B;  4AXJ A;  2GHW A;  3FCW A;  4FYV B;  2M4M A;  3PY8 A;  3L7P A;  4JI0 F;  3T5K A;  2OTL S;  1Y9O A;  1SUQ A;  1GXU A;  3DNC A;  1HKA A;  1M5K C;  4ZLN A;  1DUR A;  4WK1 A;  4F3O A;  4X4N A;  3N9U C;  5DJB A;  4TY8 B;  1HNX J;  1C4A A;  3EE3 A;  3MED B;  1N0U A;  3P45 B;  3G8S A;  4PWD A;  1PJ6 A;  1N32 J;  3LA0 A;  3HO1 A;  3B4D A;  2W25 A;  3BM7 A;  2NRE A;  3FFI A;  5CYM B;  3CCV S;  4TU8 A;  4RJV A;  3C66 A;  4C11 B;  1UVJ A;  3VV2 B;  2AMC B;  3M1V B;  4CZC A;  2EC0 A;  3LW5 C;  5F8M A;  3BN7 A;  5I42 B;  5SZT A;  5LM7 E;  1U49 A;  5D78 A;  1S6O A;  4F25 A;  2ZM6 F;  1B0T A;  1WEX A;  4KH0 B;  4DR2 J;  3P6Y C;  2Z56 B;  1DQ9 A;  3D2W A;  2AJ2 A;  2BOP A;  3JTO A;  3Q8Y A;  2E7W A;  2K06 A;  2J5A A;  4J9O A;  4GVB B;  5A6P A;  5C42 B;  2NCK L;  1T9U A;  3D3B J;  4DBQ A;  3OVA A;  1UCN A;  5B0A A;  4WCE Q;  2FZC B;  3MPU B;  5ETK A;  4B17 A;  1VIS A;  1J27 A;  5D0R A;  3GTY X;  2OPS A;  3K8W A;  2ABY A;  5THW A;  4ZN1 A;  4EYI B;  2X7I A;  2GW8 A;  1C2P A;  3JSY A;  2KL8 A;  2H3E B;  4LFA J;  3UN2 A;  4C3K A;  2H9Z A;  2XC9 A;  4WP3 A;  1H98 A;  2DXE A;  2A6O A;  3Q23 A;  5HVF A;  3OR1 B;  3MR3 A;  4B9T A;  4KTQ A;  3OR2 A;  2F8H A;  4YFU A;  2UXC F;  4QW8 A;  5IV3 A;  5KT5 A;  3MEC B;  2AWZ A;  5ITH A;  1YDL A;  1RTJ A;  1T03 A;  2I1R A;  1IBL J;  3MAA B;  2UXB J;  3QID A;  4I56 A;  3TVK A;  4B3O B;  5E2Q A;  4G1Q A;  2VFS A;  1D9D A;  2QSF A;  2R2T A;  3W7B A;  2YH0 A;  2XY5 A;  1MWZ A;  1Y0H A;  3Q2S C;  4WFN Q;  3EPI A;  2DGT A;  5J2N B;  4DCO B;  4IOB A;  2AW0 A;  4K4W A;  3CCW A;  5CZX A;  3KK2 B;  3GIJ A;  3MM9 A;  3N5B A;  4J9M A;  1LQ9 A;  1S1V B;  1L3V A;  2IHR 1;  3NMR A;  3MR7 A;  3PRV A;  1NSA A;  2VPZ B;  3QGP A;  1JX4 A;  3MPD A;  1OJ4 A;  5A6W A;  3MM9 B;  3TZY A;  4LF8 J;  2OD4 A;  1MML A;  4RBT A;  5B0D A;  1RZM A;  2RJZ A;  3DN9 A;  4CNY A;  5F8I A;  4FF2 A;  3FC9 A;  2LCW A;  4I68 A;  1EHW A;  4DU8 A;  4QPT A;  3HPO A;  3X1L B;  4ZVO B;  5HI7 A;  2ZC3 A;  3DDK A;  2CZV C;  2XMA A;  3FJ2 A;  5EX0 A;  2HPU A;  3IP0 A;  1JJ2 R;  3A8I A;  1JLQ B;  4OHV A;  4M5D B;  1I3O B;  4LBH A;  2CWX A;  4FF3 A;  4JV5 J;  4ZPB A;  4DV1 J;  1J5E F;  2CPF A;  2J6S A;  5KFE A;  4N8N A;  2NPF A;  4HLB A;  1ZM2 A;  2XSF A;  4QW9 A;  3I55 S;  2N7Y A;  3CPW R;  5ETS A;  1FNO A;  4DG1 A;  4WBF A;  3B78 A;  1IBK F;  4N77 A;  1NB2 A;  4RW8 A;  2L9W A;  3DLH A;  4TN2 A;  5A2Q U;  2VG7 A;  3N01 A;  1HQ2 A;  3HX9 A;  1YJ7 A;  2EFN A;  1TVR B;  3JQK A;  3OFF A;  4LR7 A;  1H6K X;  4M8L A;  5KT2 A;  4JYA F;  3DRS A;  2ZOM A;  3DGV A;  4ZVR B;  2FHM A;  4CO0 A;  2R8I A;  2BAN B;  3DHX A;  2NXU A;  1DTQ B;  3HCX A;  3SFU A;  3K7R A;  3US5 A;  5GAH I;  4LF9 J;  4YME A;  4OX9 J;  2BR0 A;  2X3G A;  3CO0 P;  1MSW D;  3BKT A;  1EQM A;  2OO4 A;  1VRT B;  2A0F B;  3MUV P;  4C3M A;  1H2T Z;  1WKK A;  1P27 B;  5GAH U;  4MFB A;  2EFQ A;  1R8B A;  5AXK A;  2FVC A;  3C6U B;  3K2Y A;  1T02 A;  3W5X A;  2FVQ A;  4XPE A;  3QZ7 A;  1I1G A;  3P5T L;  5KG6 A;  3H7H B;  4CTA B;  4WZM A;  7AT1 B;  4O44 A;  4LF2 A;  2G1H A;  3SSQ A;  3GV8 B;  2CAJ A;  2JLG A;  2CPZ A;  1U25 A;  2QIF A;  2YNI B;  3DYA B;  4NCA A;  4P72 A;  2QLX A;  1TV6 A;  3D6H B;  1KOH A;  3IXQ A;  4DCP B;  5JMN A;  3LQV A;  5JXS A;  1TEL A;  4DQP A;  4RW7 A;  1XMO J;  3MEG B;  2J76 E;  4UOG A;  2GVD A;  5LXR A;  1CG2 A;  1FNX H;  4OI0 A;  3DRP A;  1VJQ A;  4DR1 J;  4DR3 F;  5K20 B;  1KBR A;  3IGN A;  1D8Z A;  5CYQ B;  2PEH A;  1GAO A;  2VBW A;  4ZP8 A;  1KS2 A;  1I94 F;  1JB0 C;  5HO4 A;  1XK8 A;  2HQF A;  2FD2 A;  2YKM B;  1H38 A;  4CLL A;  3CE8 A;  2FLO A;  2FQQ B;  2RRB A;  2H4Y B;  1YBU A;  2ZBR A;  5CYQ A;  3NEK A;  4O3Q A;  2CFX A;  4C7Q A;  1Z2L A;  5J1E A;  2BEF A;  3TJ8 A;  2H5J B;  3IWL A;  5T14 A;  4F4W A;  1S0M A;  1CVJ A;  5HJY A;  1VGY A;  1HBU A;  3I82 A;  3R1H A;  2YWH A;  2HWT A;  4CLY A;  4ETZ A;  3C6T B;  3PIP Q;  4G1P A;  2KRR A;  4MKB A;  4NLS A;  4XPC A;  3JYT B;  2HHW A;  2YNG A;  5GME A;  4DF8 A;  2EXU A;  3TAP A;  1S9E B;  8AT1 B;  2WVE A;  1U0H B;  2HND A;  2VFV A;  4DSJ A;  2F5G A;  2XGQ A;  5DG7 A;  2KDO A;  2XTJ P;  4WPA A;  4YN3 B;  3HKZ D;  2D1C A;  2UUC J;  2W4C A;  2F1F A;  3PG9 A;  3OL8 A;  2NQP A;  3CJ0 A;  3JS9 A;  4NAS A;  3M2R A;  4ZIW A;  2YWW A;  1TK5 A;  3QNW B;  4IH6 A;  4MIA A;  5MAO A;  1GEH A;  3LGN A;  4LRB A;  2VG5 B;  2QMX A;  1ZOT A;  4NRU A;  3FFI B;  5CYM A;  2E29 A;  1M1H A;  3OT9 A;  2BBE A;  1OO0 B;  2C1E B;  3ENA A;  2IRY A;  1KFD A;  1RKJ A;  4ZKA A;  3CJQ A;  3HHL D;  3KUG A;  2JVR A;  3CNQ P;  4LF7 J;  2CVE A;  4QR1 A;  2MQ8 A;  4UZC A;  2V8V A;  2P9E A;  3W60 A;  2HAI A;  5HVH A;  3H5Y A;  1XNR F;  5HP1 A;  4C0B A;  1YK9 A;  5IT9 Y;  2FJA B;  1OSC A;  4B3S J;  4FNI A;  3TAM B;  1H74 A;  1IBM F;  2JDJ A;  4HT7 A;  2E1R A;  1NJZ A;  4FF1 A;  1URN A;  5J2M B;  3HFV A;  3CB4 A;  3UDC A;  3VGV A;  2E66 A;  4PYD A;  3QO9 B;  3ISN C;  4NRT A;  4F3Q A;  3OVB A;  2V4Q A;  2XHW A;  1DAR A;  1Q81 T;  1R0B G;  3PFO A;  4MKY A;  5DS7 A;  3QO9 A;  3V2U C;  3Q22 A;  1TP7 A;  1Y00 A;  2Z2M A;  3G82 A;  1AB8 A;  4MJK A;  3PW4 A;  5IXU A;  2W9C A;  3KNA A;  4I2P B;  1AW0 A;  4JV1 A;  3V6D B;  2HNZ A;  2MKS A;  5HK4 A;  1UEU A;  5BYR A;  4DFP A;  3L3C A;  4ZLJ A;  1HA1 A;  2DIT A;  1VOM A;  3CJT A;  3IM9 A;  2YQ0 A;  4HI1 A;  3VZI A;  4DOZ A;  3P96 A;  3EZO A;  4EGL A;  4WTO B;  1FES A;  1NCL A;  1CQM A;  2VBY A;  3PR5 B;  3OHB A;  5A2Q Y;  4ZJL A;  3SV4 A;  3VR1 A;  3KK1 A;  5ETN A;  1NJW A;  4ILM A;  1XIQ A;  2L3M A;  5J2Q A;  1KD1 T;  1F9E B;  2QEX S;  2DNG A;  2KB2 A;  2HG4 A;  2QLF B;  2RIL A;  3CD5 A;  4CLW A;  4CO1 A;  2KH9 A;  2ZJQ Q;  2N3L A;  2BJ3 A;  4DXL A;  4QWA A;  2J0S D;  3NNC A;  4LQ9 A;  5BYQ A;  2KXH A;  1QAJ A;  3KUH A;  2NR0 A;  1RTD A;  1RUS A;  2CQ4 A;  4DQI A;  4I7F B;  4UST A;  3ZZZ A;  2HK3 A;  1YIT S;  5IC4 B;  2IIH A;  4DV4 F;  4EI2 A;  4QZV B;  4TLR A;  5FLX Y;  2RVJ A;  1JLG A;  3L9Z A;  2HWI A;  2BOA A;  5IFM A;  2AZ1 A;  3GCW P;  3KHH A;  5HP1 B;  5HLF B;  3AB4 B;  1PKU A;  4C8L A;  1WC3 A;  4ECS A;  1REV B;  2ZE2 A;  2XMV A;  3KLI A;  2RKI B;  4I6W A;  3A8E A;  1TTH B;  4USU A;  3MHY A;  5K5M A;  3NNA A;  1KON A;  3AJ2 A;  1HWJ A;  1UJ6 A;  1S6Q A;  3WIV A;  1U1K A;  4C2M A;  1VDH A;  3OJS A;  4NML A;  2XO6 A;  1JXL A;  1DJ0 A;  2YBV A;  4PG8 A;  4DX8 H;  4TQR A;  4UUX A;  3K58 A;  2V67 A;  1RAF B;  3O1L A;  4F0K A;  5KFU A;  4DN9 A;  5LMN J;  1NHU A;  3THP A;  1NPK A;  3D7S B;  2MKY A;  2IDL A;  4EEY A;  1U45 A;  2GVD B;  2J6U A;  2XWX A;  4A48 A;  4DHV A;  3I0S B;  2AJ1 A;  1YBT A;  4OJG A;  3M9M B;  2KZM A;  2IM2 A;  2CJX B;  2DPI A;  2MKH A;  2R2S A;  3J80 U;  5JVH Q;  2ERR A;  1WG5 A;  1RT5 B;  2DCL A;  3GR0 A;  2XYH B;  4MT1 A;  2Z0G A;  3LGM A;  4RNH A;  1WC6 A;  1S7H A;  3HSD A;  3OQ2 A;  2VDH A;  5T7L B;  3R9L A;  4DU7 A;  1NO8 A;  3UR0 A;  4QWE A;  1NK8 A;  1U2R A;  2B8Q A;  4I6Y A;  2LFV A;  1V9O A;  2HVE A;  2GHV C;  4QIE A;  3KK3 B;  2K3K A;  4C8N A;  1YTY A;  3PX6 A;  1RT3 A;  3IBC B;  3NKY A;  1RB0 A;  2QLW A;  4BLG A;  3NLC A;  1HR0 J;  1IQT A;  2AQ4 A;  3MUT P;  5HMX A;  1KHV A;  1GX6 A;  4NLD A;  2J7U A;  4OYW A;  2MGZ A;  3H90 A;  4B3T J;  2W2M P;  2GJF A;  3CDA A;  4L74 A;  4DPU A;  2CQB A;  1S6U A;  1TUW A;  4KPC A;  3RR7 A;  3TJ9 A;  4ZJQ A;  1F3V A;  1LWE A;  1RTH B;  2OEM A;  3B82 A;  3N28 A;  4NA1 A;  2G0J A;  5KG5 A;  1T3N A;  1JNZ B;  2JFD A;  2L9D A;  5CAA A;  3LWM A;  1SL0 A;  2DNR A;  2E1M C;  2EEY A;  1JKH A;  3CED A;  1SPB P;  3MCO A;  2OI2 A;  4RW6 B;  5T41 A;  1WAC A;  3SMZ A;  3TZX A;  4NX9 A;  1VJW A;  4N56 A;  2CQD A;  1KFS A;  2UVV A;  4LF4 F;  3CD7 A;  1IBL F;  2BZ2 A;  2V0N A;  2UVW A;  4JBC A;  2QMW A;  4DR5 J;  4EZ9 A;  1EX8 A;  2GCF A;  2OUG A;  4CH1 A;  3D6M B;  2BJ1 A;  4FBU A;  1ZYQ A;  2ZJR Q;  2X3D A;  1CJU B;  3OD2 A;  1B7F A;  3BDE A;  5DLG A;  1A9N B;  1NEE A;  4ELV A;  2R42 A;  1X9W A;  5GMK a;  4ZPV R;  3MMB B;  2JLE A;  4J9N A;  4ECQ A;  4R25 A;  1NM2 A;  1RU2 A;  2DIS A;  2F4V F;  3MGJ A;  1F5A A;  4UF4 A;  5DZ6 A;  5CCM A;  2HNY B;  3RRK A;  4WYL A;  2HYI B;  1SQG A;  3DMJ A;  3Q86 A;  1TL3 A;  3WHI A;  1C4C A;  3OFE A;  2UUT A;  2M70 A;  2PEB A;  1MMN A;  3R8Y A;  3H5X A;  4Y0F A;  2C3P A;  2V2K A;  2GS8 A;  1KOO A;  1HBM B;  4RW4 A;  1C1B B;  5G0R A;  2F63 A;  1S6P B;  2LP4 A;  3QIP B;  1IM4 A;  2JVO A;  2LA6 A;  4ZVS B;  3CJ8 A;  4PG5 A;  3M9N B;  4USI A;  2A1B A;  3BBC A;  1YLX A;  4N7T A;  4NI2 B;  2FJW A;  1HYS B;  1NH8 A;  2NUH A;  1G4C A;  2OFH X;  4P52 A;  2CJQ A;  1RCX B;  2MSS A;  3DU5 A;  3G6X A;  5K14 B;  1GMW A;  1LWE B;  2OKQ A;  2QA1 A;  2Y1R I;  2ZUG A;  3BPD A;  1VQ5 S;  1V5V A;  2VBX A;  3AOC A;  3EDR B;  3K57 A;  4A8S A;  5J2N A;  3O3L A;  3SZ2 A;  4AXI A;  3QPI A;  2DXD A;  2G0I A;  3N6N A;  2AD9 A;  2BJ8 A;  2E5L F;  4NYZ A;  2IVM A;  3D5M A;  2PDA A;  3ONQ A;  2WW8 A;  1R0A A;  1SKS A;  3DLG B;  3EUN A;  3KFW X;  4KGV B;  4O0N A;  2MQO A;  1P9Q C;  2LDY A;  3DRY A;  4FVC A;  2I6W A;  4DV5 F;  1RAG B;  3SCL E;  2QG9 B;  4HHJ A;  1U09 A;  4OX9 F;  1SJ4 P;  3HK2 A;  5KFK A;  4OQJ A;  2DNM A;  4EBE A;  4MK7 A;  4JI2 J;  2DR8 A;  3HD1 A;  3TAR A;  1TKZ B;  5CD4 A;  4DZ6 A;  8ATC B;  3G9C A;  2POK A;  2LQB A;  4P7V A;  1QAY A;  5K8O A;  4J9R A;  2DHH A;  3NGS A;  1S6Q B;  1DZ5 A;  3ZTP A;  2Y9H A;  5IT9 U;  3GJT B;  2VQF F;  3T9Z A;  3DMJ B;  3OFH A;  1S1U A;  4OMF G;  5E33 A;  1R6V A;  3OTD A;  1HNV B;  1X4D A;  5HBM B;  1ZPW X;  4X66 J;  2FY1 A;  2UXD F;  5E0O A;  3HFZ B;  1Y4Z B;  2IC3 A;  2RHQ B;  2KJV A;  5D0H A;  2AGQ A;  3BS9 A;  1S72 S;  3QGI A;  5F8L A;  2FVP A;  2HRY A;  2QA4 S;  2I8E A;  2AGP A;  4LFC F;  4P74 A;  1R8P A;  1FJC A;  5KFN A;  2C2O B;  3K5P A;  1W7W A;  1SJQ A;  3M8R A;  1TVR A;  2DHG A;  1GTH A;  4CIO A;  2B4O A;  2LU2 A;  4IFY A;  3DRS B;  1K1Q A;  4QBU A;  5KFC A;  4FS2 A;  2ASJ A;  5HAN A;  3PM9 A;  2HLT A;  5L9X A;  3W9J A;  4JOU A;  3A8K A;  4TY9 A;  3LGH A;  2DPJ A;  1FRX A;  1URR A;  1T11 A;  2VC1 A;  2VAS A;  2Z2Z A;  4J5O A;  4D3G A;  5IS2 A;  3TO8 A;  3LP1 A;  3FNN A;  2CPI A;  3M8Y A;  4ELU A;  2GGP B;  2LYV A;  3QYY A;  5C25 A;  3IN5 A;  1WKJ A;  2DKO B;  2IM1 A;  4KV8 A;  4ECX A;  1E6Y A;  1N88 A;  5I3U B;  3W3S A;  1YRU A;  4HVZ A;  4Y28 C;  3AD8 C;  3EYZ A;  4DL6 A;  2EVZ A;  4KJI A;  1DTT B;  1D9A A;  3I0R A;  5DGA A;  2DIV A;  1FVQ A;  3LP0 B;  5IM0 B;  2J8S A;  3V6J A;  4KGM A;  5I3U A;  2LQJ A;  1RT2 A;  2VU5 A;  2J7K A;  1FDA A;  1KQS R;  2VOD A;  1S10 A;  3FEZ A;  3HHN B;  4BC9 A;  2KXN B;  4LUB A;  4OYM A;  4WE1 A;  4E0D A;  3AXK A;  3H42 A;  2QA4 G;  4X4U A;  2PGC A;  5EUH A;  1WHW A;  2RDD A;  2FHJ A;  1XBW A;  4S0M A;  3ELH A;  3PO5 A;  5K8N A;  4NEZ A;  2ZH5 A;  4I0W A;  2J7W A;  2M0G B;  1OYE A;  4WE1 B;  4DUY F;  1G1X A;  4USK A;  2KFN A;  3OXF A;  4LRC A;  5E3C A;  1HQU B;  1S7I A;  5BXI A;  4JI8 F;  2I2Y A;  3KHG A;  2R7X A;  4KFB A;  5C24 A;  3D0G E;  4H4K C;  3RBD A;  1S77 D;  3TZW A;  3K8V A;  3PHT A;  4YEA A;  3R6L B;  1FXL A;  3G2X A;  2YWE A;  4DR3 J;  4DR1 F;  1YX2 A;  1HQE B;  2JEJ A;  1LEO A;  3F0N A;  1F9H A;  1MLA A;  4K7Q A;  3FQK A;  2HHQ A;  2YNG B;  1D09 B;  2C2K B;  4BCA A;  2BE2 A;  2YVS A;  1FO1 A;  2O01 C;  1H3D A;  3CJ4 A;  3ICL A;  3RZA A;  1Q95 G;  2YXL A;  1IKV B;  2BKO A;  4OLO A;  3DOK B;  5D15 A;  4AE5 A;  4DS5 A;  2UXB F;  3C16 B;  1QTN B;  3BKF A;  3EJM A;  4WII A;  5A76 A;  1KQG B;  1VRU B;  2YKQ A;  1S6P A;  1VK3 A;  1VLY A;  1TL1 A;  3LAN A;  5B7W A;  1U6B A;  4PPD A;  3MFI A;  1X9S A;  2M7S A;  2HUR A;  2Q66 A;  1DQ8 A;  3KLE A;  1HBN A;  2ZH9 A;  3LP2 A;  2J8A A;  2Y3Y A;  2Z30 B;  3O44 A;  5RUB A;  1KC8 T;  3GMG A;  1T94 A;  2GHP A;  2J9E A;  3MAH A;  4IFV B;  4DL5 A;  4F02 A;  4LF9 F;  2CPJ A;  2IYI A;  1U8S A;  1UEV A;  2F9D A;  3CTR A;  4LVO P;  5A8K B;  5L38 A;  1CJK A;  3PTW A;  3CC2 S;  5HRO A;  1RWX B;  1R27 B;  2Z2Y B;  3IAM 9;  3MMB A;  1A7G E;  4CLF A;  4CCH A;  4RZR A;  4HKQ A;  3J81 Y;  3ZO7 A;  1M5O C;  4KKO B;  1SIW B;  4RUA A;  3PX4 A;  4ED6 A;  4PR6 A;  2MZJ A;  4Q2M A;  5KFW A;  4X4V A;  3HHL B;  3O5T B;  1UWB B;  3E01 A;  2YKP A;  4XTT A;  2DRD A;  3ITH A;  3C2P A;  2DB1 A;  1Q8L A;  4I69 A;  4PXC A;  5L1L A;  2MHE A;  1XNQ J;  1VRQ C;  1KRP A;  1SC4 B;  1IM6 A;  1P6T A;  1UW4 A;  2DNO A;  1IKW B;  1FWK A;  2Y0B B;  4K2J A;  1YVF A;  5J1N A;  2QX0 A;  2C2N A;  3BGU A;  4ZS6 A;  3W2V A;  2XLJ A;  3T1Y F;  1G7C B;  1V6H A;  1ZZF A;  2QTW A;  1HL6 A;  2RD5 C;  2XI3 A;  3CO9 A;  4WF9 Q;  4ES3 A;  1GXT A;  4K5R A;  2W7A A;  4RNM A;  3V6D A;  3DI6 A;  1M1G A;  2LXI A;  3B54 A;  1R31 A;  3L7U A;  3D28 A;  4JP8 A;  4ZK7 M;  5LT5 A;  1FKP A;  2ZHA A;  2HQG A;  4C8Y A;  1Q0N A;  4ZOS A;  3W1Y C;  5LJ3 Y;  3PEJ A;  1JXE A;  4U7U K;  2IJF A;  2GZO A;  5CCL A;  5AT1 B;  3VAJ A;  3KJF B;  3PW7 A;  3C8Y A;  3WC0 A;  4DSF A;  4HHU A;  2A2C A;  3R6G B;  1G3O A;  1NRK A;  1XMO F;  4ED4 A;  4N5S A;  2WHO A;  3I31 A;  3AJD A;  3CXC R;  3DFE A;  3KG0 A;  4DFJ A;  1S0N A;  4IFY B;  4ZCM A;  3MM8 A;  1I94 J;  3HSG A;  3B6B A;  4DS4 A;  4X4T A;  3PJW A;  2QC3 A;  2GJI A;  2HW3 A;  1HNI A;  1RT1 B;  3W63 A;  4IRD A;  3SDE B;  3T1A A;  4LF6 F;  4F4X A;  4F2R A;  3S01 A;  4WXW A;  4NXN J;  3OXL A;  4M5K A;  2VA2 A;  3EGV A;  1KSP A;  3OR1 A;  1NU4 A;  2I5J B;  4DV7 F;  1RHM B;  1RT7 B;  5KOW A;  3M8Z A;  2VOO A;  3HXM A;  4ZDN A;  4NCG A;  3MAA A;  3HHL A;  2DRB A;  3M2U B;  1YGY A;  2ALY B;  3POT A;  3KLF B;  3R5J B;  4HDH A;  2RU3 A;  2JEG A;  3IBF B;  5CA5 A;  2ZH3 A;  2D3O 1;  4MFB B;  5IQQ A;  2R8G A;  2R2R A;  3ZTO A;  1TL7 B;  2B7B B;  2G2Y A;  4ID8 A;  3KK2 A;  4K4V A;  5F3T A;  3EVW A;  2XCP A;  4KGK A;  2NXC A;  1NME B;  2VUG A;  3SQG A;  1NK6 A;  4JI4 F;  5L39 A;  3KKF A;  1WOP A;  3DU6 A;  4R0J A;  3DLK A;  1EET B;  1N8R T;  3QZ8 A;  2MQM A;  4E2F B;  4NMX A;  1FRM A;  4M5N A;  4DJB A;  2EW9 A;  1N52 B;  2MLY A;  4ANC A;  1FRJ A;  3G96 A;  4ZVU B;  5LMU F;  2VPW B;  1U7L A;  2NXE A;  3KG4 A;  4UOF A;  3PW5 A;  3WIU A;  2XYG B;  3KUE A;  1K0V A;  1C0U B;  2BUN A;  1IR0 A;  4J9K A;  2MHN A;  1QTM A;  1ZS6 A;  3R1L A;  5SUH A;  3MTJ A;  5C25 B;  1NDC A;  4ZPT R;  1F5B A;  1PC4 A;  2HVI A;  4ZN3 A;  1DHM A;  4ILR A;  1F5C A;  3D1O A;  4IQX A;  4OIX A;  5AE3 A;  3NL0 A;  4PWD B;  3NGD A;  3R5B A;  2XMM A;  2B6A A;  2L48 A;  1U6F A;  2RQM A;  3PKY A;  2I9S A;  1VBZ A;  1NK0 A;  3SSS A;  1F3F A;  3H0P A;  3QSI A;  5E3Q A;  2CPY A;  1QVG R;  2JH3 A;  3H8Y A;  3C6T A;  4RW8 B;  5IQ6 A;  1OY8 A;  3JSR A;  4KO0 A;  3GYX B;  4KAI A;  5CD4 H;  1IBC B;  5IT4 A;  3C14 A;  3IC1 A;  4Q0B A;  2PI5 A;  1ICE B;  1CQN A;  2KJW A;  1EZZ B;  1WC0 A;  2FPH X;  1OQ3 A;  2FC9 A;  3H20 A;  1TKX B;  4M5J A;  2EPI A;  4WP9 A;  4BWM A;  3SSR A;  5HMZ A;  4UZB A;  2KG1 A;  3QRP A;  3TNV A;  5ETL A;  2BAN A;  2KHD A;  4ERD A;  5KFG A;  3OTB A;  4EYH B;  3R2D J;  2BDP A;  2KVI A;  1ARO P;  2Q1L A;  2AEF A;  1RT4 B;  2XLI A;  1H7W A;  4DMZ A;  4FDF A;  2BA9 A;  5D3G B;  1P1L A;  2YKN A;  3T5L A;  4JI1 F;  3M6W A;  4AYB D;  4C6A A;  9ATC B;  1BQM B;  4MK8 A;  2CQ1 A;  4OI6 A;  2DYA A;  5A8W B;  1PBU A;  3T9N A;  3TA0 A;  3R27 A;  2MQL A;  4OZ1 A;  3TRG A;  5DG8 A;  2KG0 A;  4K4S A;  2GC8 A;  2NSC A;  1F0X A;  3O6Q A;  3RRH A;  3OSP A;  1FHT A;  1K8A T;  1FJ7 A;  1JXV A;  1FWL A;  5F8H A;  2P2C B;  4Z7Y A;  4I4B A;  1IKY B;  5D4L A;  5LL6 d;  3HMJ G;  2HBZ B;  4FYW B;  4PAB A;  1AT1 B;  3UFC X;  5HQ8 A;  4CDI A;  4EFA C;  4DUZ J;  4X65 F;  2BRK A;  1S97 A;  2YKA A;  2UVR A;  4DV4 J;  1U1M A;  2DEJ A;  1NSP A;  2ZH2 A; 
#chains in the Genus database with same CATH homology
 4ANE A;  3FBF A;  3EVM A;  3B54 A;  3L7U A;  5C7P A;  3NGT A;  2BEF A;  4HR2 A;  5IOL A;  3Q8Y A;  1NSQ A;  2NCK L;  1S57 A;  1W7W A;  2HVD A;  1S59 A;  1UCN A;  3R9L A;  3VGS A;  1B99 A;  2B8Q A;  4AND A;  2HVE A;  1F6T A;  3FBE A;  4FKX A;  3EVO A;  3B6B A;  1BHN A;  2DXE A;  3VGU A;  1BE4 A;  1WKJ A;  1PAE X;  1MN7 A;  1K44 A;  3JS9 A;  1B4S A;  2B8P A;  4KPC A;  3BBF A;  5CAA A;  3ZTR A;  2VU5 A;  3PJ9 A;  3FBC A;  1NDL A;  3ENA A;  2DY9 A;  2AZ3 A;  5CAB A;  3Q83 A;  3ETM A;  1HLW A;  3PRV A;  3ZTO A;  3MPD A;  2CWK A;  1MN9 A;  3EVW A;  3DKD A;  3ELH A;  4S0M A;  3EMT A;  3FC9 A;  3VVT A;  3NGR A;  1EHW A;  5BXI A;  1U8W A;  2BX6 A;  3GP9 A;  3VGV A;  3ZTS A;  4ANC A;  3DDI A;  3FBB A;  4ENO A;  1NDK A;  4UOF A;  3NGU A;  3FCV A;  3BH7 B;  4CP5 A;  3BH6 B;  3EIC A;  4DUT A;  1ZS6 A;  3BBB A;  3G2X A;  3Q86 A;  1NDC A;  2DXF A;  1LEO A;  1KDN A;  3Q89 A;  1NHK L;  4UOH A;  4WBF A;  1NDP A;  1NB2 A;  1BUX A;  3EJM A;  4FKY A;  3BBC A;  1NUE A;  1NCL A;  1F3F A;  3FKB A;  1HHQ A;  3GPA A;  3ZTQ A;  1LWX A;  1XIQ A;  2HUR A;  3WX8 A;  2ZUA A;  4W98 A;  1NSK L;  3EM1 A;  2DXD A;  3VVU A;  4F36 A;  1NLK L;  1S5Z A;  1WKK A;  4O0N A;  2AZ1 A;  3FCW A;  1PKU A;  4C6A A;  1HIY A;  1VYA A;  3VGT A;  2DYA A;  1WKL A;  1XQI A;  4DZ6 A;  4F4A A;  1JXV A;  3EE3 A;  3Q8V A;  4EK2 A;  4DI6 A;  3NGS A;  3Q8U A;  3ZTP A;  4UOG A;  1NSP A;  1NPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...