3NGZA

Crystal structure of rnase t in complex with a non-preferred ssdna (gc) with one mg in the active site
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ngzA00
4DU3A 3CFOA 1VSDA 3C6TA 4AH9A 1XHZA 3K2PA 4WE1A 1RILA 2OYQA 1S9GA 1QQCA 3CM5A 3NE6A 4ID5A 3TR8A 3QLHA 4JRPA 5CYQA 3QEIA 4CGGA 4OPJA 3V81A 4CEAA 4DTNA 2B5JA 3VQEA 1BIUA 1TVRA 4BWMA 3SJJA 1SL2A 1EP4A 3LAKA 4ELVA 1WAFA 4O4GA 1D8YA 2DFFA 4CJUA 3KLEA 3RRHA 3OS0A 3CFPA 4KTQA 2RPIA 1XI1A 3SUQA 3NBPA 1RTHA 1BQMA 3RWUA 3SQ2A 2DY4A 1KSPA 2RF2A 3JSMA 1LWEA 4CJTA 3NDKA 1HNVA 2VWKA 3KK1A 1C1AA 5JS1A 4CJFA 1JLCA 3NFAA 4I7FA 1WLJA 1R0AA 1IKWA 4FM0A 4IDKA 4BE0A 1RTJA 4CHNA 2VWJA 1NJWA 1WSIA 1SKWA 2VG6A 3SUPA 1SL0A 3KLHA 1NK6A 3M8SA 1N5YA 1HPZA 1VRUA 1NK5A 4IG3A 3VA3A 4DSEA 4CHQA 4GW6A 3HK2A 2E4LA 2OPQA 3RMAA 3ALYA 3SV4A 2A1RA 3IG1A 4Z0UA 4FM2A 4KPYA 1FKOA 5CY4A 4CESA 1LW0A 4CJSA 3SYZA 4NCBA 2XY5A 4DTUA 1HYVA 3TARA 2HVIA 2E6MA 2QXFA 2KFZA 4NCGA 5EU7A 1UWBA 3O3HA 4N41A 2HVHA 2XHBA 4GVMA 3VQ8A 1K6YA 3QINA 3LZJA 3P83D 4DF4A 2G8FA 1RT1A 4DS4A 3DYAA 3LZIA 3SNNA 1QSSA 2ATQA 4FVMA 3T1AA 4K8XA 1RT3A 1ZBHA 3I0RA 1B9DA 2A1SA 3KIOA 4DFMA 3KD5E 3F73A 2Q3SA 3L3VA 4M45A 3HVRA 2G8WA 3ZT2A 3SPYA 3IRXA 2HHTA 3WNFA 4BDYA 1Q9YA 1BQNA 5T7BA 4KHWA 4O44A 1KCFA 2ZD1A 3OYFA 2XO7A 4CJRA 4K8ZA 1T03A 4DQIA 2O4IA 1QE1A 4JS5A 3S3NA 2Z1GA 4LD0A 1BI4A 4E7HA 4HCBA 1S1WA 2D0CA 4RW8A 4Y1CA 5FROA 1S1UA 3I8DA 1TV6A 5J2PA 1TKDA 3QEWA 2BDPA 4NYNA 4B8CA 2YHAA 2HNZA 2Y1JA 3I0SA 4CK3A 2YKMA 4M3RA 3PX0A 5HROA 3M8QA 3MAQA 1S6PA 3NH2A 4W5TA 3S9HA 4RG8A 1NK7A 1HYSA 1B9FA 1TK0A 2HW3A 1YTAA 2HHVA 1CXQA 3ISNC 3NF7A 2X78A 4FJGA 1NKCA 4F2SA 4DG1A 2OZMA 4IKFA 4DTRA 5HLFA 1HMVA 1RDBA 1UAXA 3CQ8A 1CZ9A 1Y97A 1CZBA 3OYLA 4O0IA 2IOCA 3G0ZA 4LSNA 4MQ3A 4HUFA 1VK0A 3DOLA 3AVCA 1IH7A 4C8MA 3NF8A 4CJKA 1WSJA 1HQUA 3LPUA 4HCCA 3AVBA 1HJRA 3HPHA 1NK9A 3PX4A 3OYCA 4IFYA 3AO5A 2P1JA 1ZBIA 1TAUA 3HJFA 4DFPA 2KQ2A 4EZ6A 4CJ4A 4IG0A 3LWLA 1I39A 4IBNA 1QS4A 1L3UA 1VRTA 3C6UA 1RT2A 1A5VA 1C1BA 4KHNA 1X1PA 2E6LA 2YV0X 2P51A 3SZ2A 4KO0A 4C8OA 4CEDA 1QSYA 2G8UA 3BDPA 2HNYA 4ICLA 1EX4A 3QEVA 1MU2A 3QEPA 1TK5A 3TAEA 1D9DA 2Z1IA 3DOKA 3MEEA 4Q0BA 3HL8A 4OKEA 5HRRA 4FZZA 4G1QA 3TAPA 3L2VA 3S3OA 4KHSA 4DSFA 4PUOA 3VQAA 3VQ9A 1C0TA 3KK3A 5KGWA 1KLNA 3KKRA 2HNDA 3NF6A 4LSLA 1T7PA 2GUIA 4ELTA 2BGGA 3AVIA 4DWIA 4I9QA 1VSMA 3VA0A 4BE2A 4HUEA 2EHGA 3P1GA 4AHTA 3HSTB 2KZMA 5HBMA 1JLEA 3PX6A 4GMJB 3ZT3A 3KJVA 4XIUA 3TAFA 3HPGA 2YNHA 5I42A 3MXMA 4B9LA 1WAJA 2ZE2A 2QKBA 3L2QA 2HHWA 3TWHA 4DQQA 4DS5A 4KAZA 4FYDA 1A5WA 4AHRA 2FBTA 4FJMA 4Z4FA 1ASWA 4E1NA 2R7YA 1WNSA 4DFKA 4QOZB 1BCMA 3NCIA 2YNFA 4N47A 1KLMA 4FLXA 1S1VA 1SL1A 1ASVA 4FW1A 3HT3A 1KVBA 1KVAA 2QK9A 3SQ1A 4PWDA 5E41A 3OYMA 2XY7A 5K14A 4CFBA 1UA1A 1JKHA 3SQ0A 1S6QA 5FRMA 4PY5A 3KD1E 3TI0A 1SUQA 4CJ5A 4DQRA 3KTQA 3OYAA 2OPPA 3SQ4A 1L3VA 2D0AA 4DLEA 3KLIA 3NGIA 3VQQA 3NGZA 4E7IA 4M3TA 1YTUA 4CFAA 3ASMA 2WONA 1RDCA 3KKSA 1REVA 2X6NA 1RT4A 3WNHA 4E19A 4CIFA 3NH0A 4CEOA 3ZSZA 3LWMA 4CK1A 1LAVA 1Z26A 4BWJA 4AHVA 2X74A 3B6PA 4LY7A 4HVJA 1T05A 3V1QA 3OYNA 1C1CA 5CZ1A 3LP0A 4Y1DA 4B8AB 3L2UA 1S9EA 4OVLA 1RTIA 1NK0A 2HMIA 4CIEA 4CF2A 4KI4A 4CF9A 3V9ZA 4CFDA 4KFBA 4OJRA 3AVJA 4QAGA 2LSNA 3HYFA 2KTQA 1JLBA 3ZT0A 1SKSA 4FJKA 3DLGA 3RMDA 3OYKA 1FXXA 4LH5A 2FC0A 4EP4A 4H8KA 1G15A 4FLVA 4DFJA 4B9NA 5HRNA 3QO9A 3TAMA 3LDSA 1ASUA 1JL1A 3WNEA 1NOZA 3HVTA 1TGOA 4BACA 3V9WA 1TK8A 1WSFA 2XY8A 4N56A 1NJYA 1RBVA 4B08A 3DMJA 4JLHA 3NF9A 5J2MA 2G8VA 1Q8IA 5C24A 5HP1A 1U48A 4F8RA 3LPTA 4CERA 2G8KA 2PYJA 1FKPA 3EYZA 3SUNA 4KREA 3O4QA 2DFEA 4CJPA 3SI6A 1L3SA 3DLHA 3HPOA 3SV3A 3K5OA 3EZ5A 1J54A 3PO5A 4FJNA 3ITHA 1A5XA 3PUFA 2F8SA 1U4BA 1BI4B 1W0HA 3AO2A 4E89A 1VSKA 2XY6A 1JLAA 3DLRA 2Y1IA 3VQ7A 4YNQA 3AA4A 1F21A 3DI6A 3QERA 3LAMA 1FK9A 3PO4A 4DQSA 3V9XA 1NKEA 5KI6A 5D3GA 4DU1A 1TKTA 4CF0A 1KVCA 3M8PA 2FBYA 4EP5A 3SUOA 4J2DA 3O3GA 1XWLA 1Q9XA 4PQUA 5FRNA 3IS9A 2KZZA 2KW4A 2Z1JA 1EETA 3BGRA 4Q5VA 1X9WA 4O0JA 2IDOA 3AVHA 1GOAA 3VQCA 5JS2A 3AVGA 4FJHA 2IC3A 4OGCA 4KHYA 1CLQA 3RTVA 2G8HA 2P5OA 1NJZA 4FK2A 1XC9A 4DF8A 4F4KA 4AILC 4H4MA 3MEGA 1IKYA 4AHCA 2VG7A 5KRSA 3AVMA 4IFVA 1VSEA 2B4JA 3RMBA 3TAQA 1EKEA 4RW4A 4NYFA 4E0DA 4FJ7A 3V6DA 1LWCA 1O1WA 1RBRA 1W9HA 1NOYA 3VQ5A 2PZSA 5C42A 3ZSVA 1RDDA 3DLBA 3CG7A 4F3TA 4FJJA 4RW6A 2OZSA 4L8RB 3LP3A 1KFSA 4MFBA 4B9SA 3NGYA 3U3YA 1ZBLA 2ZQBA 4M41A 3NH1A 3V9SA 1DLOA 1TL1A 4B9TA 4N5SA 2Z1HA 3RR8A 4FJXA 3HP6A 1RNHA 4DQPA 4KHUA 3O4NA 2PYLA 3L2RA 1NKBA 3H08A 4DTSA 4KKOA 3AV9A 1WSHA 3OVNA 4W5RA 4FLUA 3ZSOA 2AJQA 1D9FA 4FZYA 3VQPA 4RW7A 3OY9A 4CHPA 4FJ5A 1TKXA 4FLZA 2FBXA 4NCAA 3VQBA 1BL3A 3DM2A 2NUBA 1S5JA 3KLFA 1U04A 3VN5A 3SCXA 4FXDA 1NK4A 3ULDA 3B6OA 2P5GA 1X9SA 4KHQA 1VSIA 1JXBA 3OS1A 3PV8A 3RMCA 3DRPA 3OS2A 1UOCA 1Z25A 1VSHA 4LH4A 4ZTJA 1RT7A 4CJ3A 1BGXT 3OJSA 4FLYA 4J2AA 1L5UA 3LP2A 1CXUA 1IO2A 1BCOA 3AA5X 3NHGA 2QKKA 4CF8A 1RT6A 2GBZA 2PY5A 3TANA 4CJWA 3CFRA 4E7KA 4CHOA 1IKVA 3C94A 2YKNA 3AO1A 4CGIA 2X6SA 4OKKA 2JGUA 2XRIA 3ZSXA 4CJEA 3HO1A 1JL2A 1YT3A 4CEZA 1HQEA 4PA1A 5KGXA 4Z4IA 4Z4EA 4FK0A 4BDZA 3EY1A 4YFUA 3RRGA 3DLEA 3K5MA 2YHBA 4W5QA 3LANA 4CEEA 2EX3A 3HXMA 1C6VA 2YNGA 4ZTFA 1ZBUA 4DTXA 2IAJA 4KB1A 4FK4A 4CE9A 3U3GA 5KTQA 4N76A 3HM9A 3S3MA 4FJ9A 1YVUA 3V4IA 3F9KA 5DMRA 1LV5A 2RN2A 2VG5A 1L3TA 4Z4GA 4CJQA 4CJLA 5CZ2A 2RKIA 1RTDA 3LALA 3QEXA 3T3FA 3AVAA 4Z4CA 1SV5A 4FZXC 4FLWA 2I5JA 3D0PA 3SPZA 4KTWA 2W42A 2BANA 4H4OA 3TABA 3PY8A 1J9AA 5J1EA 3MXIA 3CYMA 1WSEA 2ITGA 2JLEA 4DTPA 1U47A 4DSLA 2HHQA 3VQ4A 4CGJA 4E7LA 5I3UA 4TSXA 3U6FA 1SKRA 1KRPA 2HHXA 2YNIA 3AVLA 3OYHA 3K5LA 4FJIA 4J2EA 1TKZA 3AO4A 3K59A 1WN7A 3ZSRA 3ZT1A 2ETJA 3ZT4A 4W5OA 3QNOA 4BDPA 3TAGA 1ZBFA 1QHTA 4KB0A 1T8EA 1C0MA 3OYDA 3M8RA 4DLGA 1J5OA 3CM6A 3IAYA 4O55A 4HUGA 3MXJA 4B9VA 4OLBA 1ITGA 4AHUA 3P5JA 4FJ8A 1HNIA 4J2BA 3AVKA 4AHSA 4M3WA 3KLGA 4M3XA 2F8TA 4OLAA 2DTUA 4B9UA 4B9MA 4O5BA 4CGDA 3DRRA 4KI6A 1HRHA 5SZTA 4HHTA 5J2QA 3UIQA 4KTZA 3QETA 1NK8A 1XHXA 1S1TA 2DFHA 4DMNA 1D5AA 4CFCA 5C25A 2FBVA 4E7JA 1QTMA 1U49A 1RBTA 2D5RA 3DLKA 3DRSA 3ZSYA 3V9UA 1KTQA 3THVA 2KFNA 1ZYQA 4OGEA 4CCHA 1EXQA 2F96A 3K58A 4DSJA 4FLTA 3JYTA 4FJLA 4HTUA 4ELUA 2IS3A 3A2FA 3C95A 3OYGA 4F3OA 4QCLA 2HHUA 3V1OA 1RCHA 4M42A 4CIGA 1IG9A 4I2PA 4CEQA 1RBUA 1U45A 1S1XA 4CECA 4DTMA 1JLGA 1TL3A 4RW9A 1JLFA 3MECA 3T19A 5CYMA 2O4GA 4OPKA 2BE2A 3ZCMA 4DSKA 3V1RA 3VQDA 1UA0A 1QSLA 4E1MA 1GOBA 3HP9A 3AA3A 3WNGA 4DU4A 4I2QA 3VQ6A 3ZSQA 4Z4HA 5SWMA 1X9MA 1DTQA 4M3YA 3G10A 4CJVA 4CEFA 3OYJA 3AVNA 3OYBA 1GOCA 2D0BA 2OPSA 1LWFA 2HB5A 4R5PA 4DSIA 2GV9A 3OYEA 4F2RA 2G8IA 5DK5A 2OA8A 4I9LA 3RR7A 1BISA 4B3OA 3QIPA 4M3ZA 3AA2A 5J2NA 3AVFA 1LW2A 1VSFA 1BHLA 1VSLA 2WOMA 5KRTA 3QESA 1RDAA 1RT5A 4OKJA 4M3UA 3FFIA 3L3UA 3L2WA 1JXEA 4C8LA 4CF1A 3KK2A 1B92A 3NAEA 3K5NA 4CGHA 1VSJA 1HYZA 3QIOA 1C0UA 4UQGA 4C8KA 5HRSA 4E3SA 4DTJA 3AO3A 4JS4A 3D45A 1TAQA 4CEBA 1IKXA 4DTOA 3E01A 3OYIA 4EZ9A 3OJUA 3LP1A 4CHZA 4CK2A 4ZHRA 3O3FA 3QNNA 4KRFA 1WSGA 3MEDA 5FDLA 1JLQA 1DTTA 1N6QA 4KV8A 3K57A 2OPRA 4ID1A 1KFDA 4C8NA 3L8BA 3ZSWA 1J53A 2B6AA 4FW2A 5HRPA 4JRQA 4BE1A 4FCYA 1NJXA 2HHSA 1I3AA 4FM1A 1RBSA 1BIZA 4CGFA 1LAWA 4CHYA 2IGIA 4W5NA
chains in the Genus database with same CATH superfamily
3CFOA 4AH9A 4ISGA 1S9GA 1QQCA 3NE6A 1VQPN 5BRHA 1NGGA 2E2QA 4FSVA 2HVIA 4DTNA 1SL2A 1TVRA 3LAKA 1MWKA 5AQLA 2QWNA 4O4GA 3KLEA 1IJJA 3SMSA 3CJ1A 3VF4A 3A5NC 3KK1A 1C1AA 5AZJA 1IKWA 3FZMA 4CHNA 2OANA 3H46O 3KLHA 4DSEA 2AP1A 2VQEK 3SV4A 2A1RA 5CY4A 1LW0A 4IO8A 3G4SN 1XNQK 3OBWA 4DTUA 3TARA 2QXFA 5EU7A 4GVMA 3QINA 3LZJA 4AQYK 3VESA 4AM7A 5GAGP 1ZBHA 1GLAG 3O9TA 3QICA 3VENA 3H3NO 5C2DA 2Q3SA 4M45A 1Q7YO 2G8WA 1V4TA 4H0PA 4GV3A 3IRXA 5AR0A 2GUPA 3WNFA 1Q9YA 3OYFA 2XO7A 2ZD1A 4GV6A 4RTFD 4CJRA 4DR4K 1T03A 4DQIA 4JS5A 3O8MA 3T1HK 2J4RA 4CZIA 1TKDA 3CCVN 1TYQB 1HJOA 2ASOA 2Y1JA 3RSEA 2FF3B 4W5TA 4JI4K 4BR5A 5FLXO 1B9FA 4BRIA 1TK0A 4FOEA 3Q7CA 2HHVA 3NF7A 2X78A 2OZMA 3P39A 2O8BB 1CZ9A 1Y97A 3OYLA 2BTFA 3AVCA 1IH7A 2P9KA 4E1JA 1WSJA 3LPUA 5DM7L 1JCEA 3PX4A 3OYCA 5LL6Z 3BF3A 4BGBA 2UXCK 5M1NA 2P1JA 1KC8O 2O8EB 1VQ8N 3TSPA 3I33A 1L3UA 1VRTA 2W6KA 2KLAA 3BP8A 3P38A 2P9PB 4A61A 1X9JA 3QEPA 5JVHL 3CERA 2Z1IA 3SLCA 3HL8A 5HRRA 4FZZA 3TAPA 3S3OA 1HNXK 4JAXA 3KK3A 3TTDA 1KLNA 1QQNA 4ELTA 2BGGA 3DXMA 4I9QA 3KJVA 3TAFA 5I42A 3VGKA 3QBWA 3MN9A 2ZE2A 4K41A 4K25A 2QKBA 2HHWA 2F9WA 4FYDA 1RFQA 3DLLL 4Z4FA 3BUZB 1NGEA 1WNSA 2R7YA 3NCIA 2NRRA 5F0XA 1KLMA 5AQZA 1SL1A 4FW1A 3GE1A 2QK9A 4PWDA 1YVNA 3E1YA 3O9UA 3N4PA 3SQ0A 3CXCM 5FRMA 3KD1E 3VOVA 1SUQA 2P9IA 2OPPA 5EVZA 2E20A 4DLEA 4M3TA 3NGZA 2NRTA 1YTUA 3TTCA 3CCLN 4CEOA 3ZSZA 5B8HA 1OVYA 5GIPA 2O8FA 3VGLA 3FLCO 5AZJB 4IOAL 2X74A 3LDOA 4LY7A 4HVJA 3MCPA 3V1QA 1T44A 3AGRA 5LJVA 2V7YA 1NK0A 4CFDA 3I56N 2VYPA 3D2EA 5AZIA 1FXXA 3DJCA 4FWKA 4LH5A 4EP4A 4H8KA 4B9NA 3R9PA 3QO9A 3TAMA 5GINA 4BRKA 1RBVA 4K43A 5E26A 2CGJA 1Q8IA 4H0XB 2PYJA 1KAZA 3EYZA 2YHYA 3WQUA 3J8AA 5LY3A 2F7TA 2KKZA 3SK3A 5AQFA 4FJNA 1A5XA 2HBLA 3L4IA 3DLRA 3VQ7A 1NMNA 1NMDA 3LAMA 1FK9A 3RSEB 2GELA 2JWKA 2NZTA 4DQSA 1NKEA 1BUPA 5D3GA 1TKTA 2GX9A 3O1WA 1JJ2M 1KVCA 2E5LK 3J7ZO 3SUOA 4J2DA 2KW4A 2Z1JA 3CQYA 4Q5VA 2IDOA 3IKMA 1J5EK 3RTVA 4FK2A 3IDHA 5BPMA 5AFUA 2A6AA 1XC9A 2P9KB 1BWFO 3JXUA 1WOQA 4AHCA 5KRSA 3ZYYX 3FZKA 4OX9K 1OH5A 3TAQA 1EKEA 1O1WA 3PIPL 2P9NA 3NVKA 2PZSA 3TSUA 2W6LA 3O5BA 4F3TA 4CBXA 4DV0K 4L8RB 2FF6A 3LL3A 2YJEA 1KFSA 4BG9A 2ZQBA 3CCMN 4LF7K 3V9SA 3RR8A 4CD3A 4N5SA 3HP6A 1NGIA 4DQPA 2UUBK 3O4NA 4IJNA 4FLUA 3UKRA 4HWIA 1OH8A 3ZLJA 2NUBA 1BOTO 3VN5A 1NK4A 4H5VA 4KHQA 3DXMB 1VSIA 3OS1A 1Z25A 4UY8O 5AQVA 4CJ3A 2ZF5O 3H1VX 2QWPA 1BCOA 3AA5X 2YI1A 4BR4A 3HI0A 3C7NA 4GVEA 2YKNA 2JGUA 1Q81O 5KGXA 3CQXA 2YX6A 3LDQA 4YFUA 1Q82O 2YHBA 2GEMA 2YNGA 4ZTFA 1ZBUA 4X65K 2NRXA 1YJWN 4CE9A 2P9IB 3U3GA 3S3MA 1YVUA 3V4IA 5DMRA 1LV5A 1NLVA 2RN2A 1L3TA 3AVAA 1SV5A 2O8FB 2I5JA 3ULEA 4H5NA 4KTWA 2W42A 2VGNA 3I55N 1J9AA 4OPAA 1WSEA 2ITGA 2HHQA 1MDUB 4DR7K 4CGJA 4TSXA 3QNOA 4KB0A 2O8DB 1ZBFA 5FPNA 3D2EB 5C0YA 5AZIB 1J5OA 4DV4K 4EHTA 3P5JA 4FJ8A 3KLGA 4B9UA 3LDLA 3ENHA 4HHTA 4KTZA 4NXMK 4DHYA 3QETA 1S1TA 5TKWA 5C25A 1QTMA 2FBVA 4CBWA 1RBTA 4RCHA 4CVNE 1W2BM 1GLJO 4DSJA 4FLTA 1YJ9N 4HTUA 4ELUA 3A2FA 4H03B 5AQUA 2HHUA 1IBKK 3O9QA 4DTMA 3MECA 5CYMA 4WCEL 3IFRA 3ZCMA 5BPNA 1LOTB 1QSLA 4FPBA 3HP9A 3WNGA 3K0SA 1DTQA 2ZWHA 4QS7A 1ZBSA 3QDKA 3AVNA 3HM8A 1EWRA 4R5PA 2GV9A 2Q0UA 4I9LA 1BISA 1EO1A 4WFNL 1VSLA 3QESA 3THYA 3L3UA 3SAHA 3KK2A 4B1UB 4CGHA 1C0UA 2P9NB 4UQGA 2QWRA 1VQ7N 3AARA 3CPWM 5M1QA 1IKXA 4DTOA 3OYIA 4EZ9A 4ZHRA 1JLQA 4ID1A 1KFDA 4MO5A 3AY9A 5HRPA 4FCYA 4DQ8A 2UYTA 1NJXA 1I3AA 4CGFA 4BRDA 4FWRA 4NLBA 2QWLA 4CHYA 4A2BA 3UKRB 2OYQA 3BEXA 1XMOK 3QEIA 3E9OA 5CR4A 3RVCA 1NBWA 4CGGA 4OPJA 4BRAA 5TKYA 4BWMA 4AF1A 1NGHA 1VQ9N 2DFFA 3RRHA 3OS0A 4KTQA 1XI1A 3NBPA 1DGKN 3RWUA 2DY4A 3G71N 3ENOA 1KSPA 3NDKA 3ZX3A 4BRGA 1HNVA 2A40A 3DWLA 3C7NB 1WLJA 1R0AA 4IDKA 3R6MA 4BE0A 1SKWA 3D2FA 2CH5A 1VRUA 4R79A 1NK5A 2E8AA 4CHQA 4GW6A 2E4LA 2OPQA 1K9MO 3ALYA 4NCBA 4CESA 3CJAA 3EE8A 3CC4N 1HYVA 1QQOA 2E6MA 2HVHA 3O3HA 2QTDA 1K6YA 1IG8A 3P83D 4FWLA 4A5BA 2G8FA 4DS4A 3SNNA 1QSSA 4FVMA 3T1AA 3I0RA 2Q31A 1B9DA 2A1SA 4DFMA 3ULEB 1S72N 4KHPK 1DKGD 1HKGA 1RDWX 1BQNA 5T7BA 3IMXA 5H1SQ 3HOTA 1QE1A 2Z1GA 4LD0A 1S22A 2D0CA 3P4IA 5J2PA 3I8DA 1S1UA 3SAGA 4B8CA 1U6ZA 2HNZA 5HROA 3I0SA 3PX0A 2YKMA 2YHWA 4JKAA 4O8UA 1S6PA 3NH2A 3S9HA 4RG8A 2Q1NA 4CZHA 1NK7A 4IZ9A 1YTAA 4HTLA 1CXQA 3ISNC 4F2SA 4DG1A 4JI6K 3NMUA 3H1QA 1Z05A 2ZJRL 2IOCA 3G0ZA 4HUFA 1VK0A 4H0TB 3CJBA 2NRWA 4HCCA 3AVBA 4KBOA 3AO5A 2JWLA 4A57A 4B1ZA 1ZBIA 4EZ6A 3CHWA 3VEZA 4IG0A 3LWLA 2AA4A 1RT2A 1BU6O 1HX1A 4BR9A 4NLCA 5C2FA 4C8OA 1NGFA 4ICLA 3QEVA 4YOVA 1TK5A 2GTDA 4CZFA 4XEIA 4JD2A 3WXMB 4Q0BA 3MEEA 3THYB 1J6ZA 2UXDK 3L2VA 1YIJN 2A42A 2QWOA 3KKRA 4LSLA 1O13A 4JK8A 3VA0A 1VQMN 1RDUA 4HUEA 4BE2A 3HSTB 4DKWA 5HBMA 4GMJB 3HPGA 4B9LA 3AGKA 3L2QA 3TWHA 2ZM6K 4IFEA 2FBTA 2BH1A 1NNEA 4DV3K 1VQ4N 4N47A 4FLXA 1S1VA 3HT3A 5E41A 3OYMA 4IOXA 1S6QA 4K0KK 4JK9A 4M7XA 3UE5A 3KLIA 2WONA 2NRHA 4FWSA 4AM6A 4PUOA 1NU0A 4BRPA 2ITMA 3LP0A 4Y1DA 3D2FB 3U9DA 4OVLA 4KI4A 3AAQA 1ATRA 4BRLA 2WUSA 4OJRA 2HBJA 4H0YB 3AVJA 4QAGA 3HYFA 2KTQA 1BA0A 3ZT0A 3DLGA 2QA4N 1G15A 3A8YA 3H6EA 3LDSA 1ASUA 1QHAA 3WNEA 1TGOA 1TK8A 1C0GA 1NJYA 3A0IX 1SZ2A 4O5FA 2G8VA 5HL7L 2UUAK 1GLFO 4IEEA 4KREA 5AFUH 2P9SA 5I9EB 4IO9L 1L3SA 3DLHA 1XQSC 4BRCA 3EKUA 4DR5K 3EZ5A 1J54A 4BC3A 3PUFA 4MO4A 1U4BA 3HRGA 3AO2A 1TUUA 3Q7BA 2HF4A 4V19S 3HOSA 4YNQA 1F21A 3DI6A 5KPZA 4BQZA 3QERA 3PO4A 3V9XA 4QS9A 5AQRA 1N36K 2VQFK 4EP5A 1XWLA 4FWOA 2YJFA 3VTIA 1EETA 3BGRA 2F9TA 3AVHA 1GOAA 5JS2A 2VCPA 2G8HA 4FOIA 2P5OA 1NJZA 5M1FA 3MX2A 4F4KA 3CETA 4A62A 4H4MA 3MEGA 1IKYA 3SJHA 3U8XA 3M3ZA 2B4JA 3RMBA 4MDAA 4H5RA 4RW4A 4NYFA 3V6DA 1LWCA 3VQ5A 4DV5K 5C42A 3ZSVA 1RDDA 3CG7A 4XH5A 4FJJA 4JI7K 2HSTA 3LP3A 4B9SA 3LDNA 3NGYA 1ZBLA 4M41A 4FJXA 5F1XA 5C15A 4BG8A 4KHUA 2E1ZA 3VERA 4YOYA 5GAHP 4DTSA 4B3MK 2HBMA 3CCEN 3ZSOA 1D9FA 4FZYA 4JD2B 2FBXA 1BL3A 4FXDA 3ULDA 3R3LA 3PV8A 5BRDA 3SBGA 3OA9A 3BY5A 1VSHA 4ILGB 3OJSA 1H1VA 1IO2A 1T6DA 2YCHA 4LFAK 3EN9A 3HZ6A 2PBDA 1RT6A 5ELZA 3CFRA 1IKVA 4CGIA 2W41A 3F5TA 4OKKA 5CE3A 5MLCQ 3ZSXA 1YT3A 2W40A 4CEZA 1HQEA 4PA1A 4BDZA 2IIRA 3H45C 2ASPA 4CEEA 2EX3A 3KWGA 1HNWK 1C6VA 1NGBA 4OPHA 2IAJA 1X3MA 3C6HA 4O8KA 3HM9A 3CF5L 2VG5A 2O8DA 4JKHA 4YHHK 2WFBA 3T3FA 3U9ZA 1VQKN 1RGIA 1ZXOA 3D0PA 3SPZA 3PY8A 3MXIA 4DTPA 2JLEA 4DSLA 3VQ4A 4E7LA 5I3UA 1XUPO 5BR8K 2HHXA 3K5LA 3AO4A 3ZT4A 1VHXA 4GNIA 1DT9A 1T8EA 1C0MA 3QFPA 3CM6A 3TPQA 1ITGA 1V4SA 4AHUA 4EFHA 4M3WA 4M3XA 4OLAA 3THWA 3L0QA 4O5BA 4CGDA 4KI6A 1HRHA 4PL8A 5SZTA 2QM1A 3JS6A 2DFHA 3O9SA 4DMNA 1D5AA 4E7JA 1U49A 3V9UA 3THVA 2P9SB 3C6AA 4H0VB 1D4XA 4FPAA 4QCLA 2IS3A 3OYGA 4F3OA 2H3GX 5GAEP 4WYBA 1NG9A 1RCHA 5F2RA 5JLFA 1IG9A 4DB3A 2E2OA 5C10A 3FZLA 4WFAL 1JLFA 3K9JA 1ATNA 3WXIA 4OPKA 2BE2A 4DSKA 4DR6K 3V1RA 3TTFA 2VWBA 4H5TA 1X9MA 3AA3A 5C12A 3FR0A 3G25A 3O4WA 4M3YA 4CZLA 4F9OA 3G10A 4CJVA 4EIAA 3OYJA 1MA9B 1GOCA 4IJAA 4F2RA 1YXQA 2OA8A 4B3OA 4M3ZA 3AA2A 3AVFA 1LW2A 1VSFA 2WOMA 5FPDA 4JI0K 3R1XA 1KXPA 1RT5A 4M3UA 3L2WA 3CCUN 2E88A 1JXEA 4CF1A 4CW7B 4LF4K 3KHYA 2DPNA 4YOXA 4DTJA 2HHHK 3OBYA 4NO7A 1ILYA 3LP1A 3JAMO 1N6QA 1DTTA 4JEPA 2OPRA 4C8NA 2B6AA 1XMQK 4B3RK 2HHSA 1RBSA 3EO3A 4JNEA 3DXKA 2IGIA 4W5NA 1HPMA 2QXLA 1VSDA 4WE1A 1RILA 4ID5A 3TR8A 3MWPA 4CEAA 2B5JA 3VQEA 1BIUA 3SJJA 1EP4A 3AAPA 4ELVA 1D8YA 4PKIA 2NRVA 5JVGL 3A5MC 3CFPA 2RPIA 1WBBA 1BQMA 4FWMA 3SQ2A 4BR0A 1QZ6A 2RF2A 4JN4A 5GADP 2P9LA 3JSMA 1LWEA 4FVUA 2D0PA 2VWKA 3EEQA 5CHIA 5JS1A 4I7FA 5AQHA 4BY9C 4FM0A 2VWJA 1NJWA 1WSIA 4MLEA 1SL0A 3W0LA 1NK6A 3M8SA 1HPZA 4IG3A 3VA3A 2BUPA 2A5XA 2A3ZA 3HK2A 3RMAA 4FM2A 1FKOA 4CJSA 3SYZA 1NGAA 2KFZA 4M63C 4N41A 2HBKA 4BGAA 2XHBA 4GKJK 4DF4A 4CZJA 1RT1A 3DYAA 4JKFA 1LCUA 1RT3A 3MN5A 3VEWA 3A5OC 3KD5E 3F73A 2GWKA 3HVRA 3L3VA 5M1KA 3SPYA 4JK7A 2HHTA 4NB4A 1X3NA 4O44A 1KCFA 3S3NA 1S1WA 5FROA 4NYNA 4CZKA 3KWIA 4CK3A 4M3RA 2OTJN 4YORA 3VEYA 4MLHA 3M8QA 3THWB 2YHXA 4YOWA 3CJ7A 2HW3A 2Q0RA 4FJGA 4DTRA 5HLFA 1HMVA 1RDBA 4FWQA 2IVPA 1CZBA 4O0IA 3GL1A 4LSNA 4JHDA 5LJWA 3L6QA 4CJKA 2QWMA 3NF8A 1EWQA 4WQ5A 5IWAK 1HJRA 1NK9A 1GLCG 2I7NA 4IFYA 4ILJA 2UUCK 1K8KA 3HJFA 3PLAA 2KQ2A 4BQLA 2ZJQL 4LF9K 1P90A 3C0BA 1A5VA 2E6LA 2YV0X 2P51A 2WTUA 3SZ2A 1HNZK 4CEDA 3BDPA 1HR0K 2HNYA 1EX4A 4YDUA 1MU2A 1BA1A 3DOKA 5AQOA 4OKEA 4G1QA 4QS8A 4DSFA 3CCQN 5KGWA 2HNDA 4JKCA 1SS6A 3CCRN 2EHGA 2NLXA 3P1GA 4DCHA 2KZMA 3ATUA 2HOEA 3CPEA 1JLEA 3PX6A 1N34K 4XIUA 2YNHA 1IV0A 2KHOA 1U2VA 4DQQA 4DS5A 4KAZA 2ZGZA 4FJMA 3VMFB 1ASWA 3DXKB 3WXKA 4L3QA 3VPZA 4QOZB 2YNFA 3D7EO 4CZEA 1KVBA 1KVAA 3SQ1A 5M1OA 1YUWA 4CFBA 3IUCA 4LF6K 1UA1A 1JKHA 1T6CA 3GDQA 3TI0A 3MDQA 2FXUA 4NXNK 3OYAA 3SQ4A 1L3VA 4JI8K 2D0AA 4CFAA 3ASMA 4E3SA 1RDCA 4E19A 1RT4A 3NH0A 2P9LB 3LWMA 4CK1A 1LAVA 3SBTA 3B6PA 1VQON 5CZ1A 4B8AB 3L2UA 1RTIA 5JLHA 2FSJA 2HMIA 4CF2A 1E4FT 4GKKK 4CJ7A 4KFBA 3EZWA 5AQYA 2OCEA 1JLBA 4FJKA 4FWNA 1YJNN 3VF2A 4WQ5C 4FLVA 5HRNA 4B3SK 1JL1A 3QFUA 1NOZA 4J8FA 4DV2K 4B3TK 3V9WA 1WSFA 4N56A 2Q2RA 5BPLA 3DMJA 3NF9A 5J2MA 5C24A 3LPTA 3O08A 4CZMA 5ADXA 2G8KA 3SUNA 3O4QA 2DFEA 3SI6A 5AQIA 3EL2A 4WF9L 3K5OA 3SV3A 2O8CA 3PO5A 4LC9B 3L4QA 3VEVA 1HUXA 1P8ZA 4YDUC 1VSKA 5AQGA 4A59A 3B8AX 4Y0WA 4CZGA 3M8PA 5EXWA 1Z6RA 1Q9XA 5FRNA 2KZZA 3UB5A 3VQCA 2NNWA 4KHYA 1CLQA 4B1VA 3EKSA 2FLOA 3QMLA 4JHDB 4DF8A 1N32K 4DV7K 2VG7A 4YOUA 3AVMA 4IFVA 1BG3A 5AQMA 3VF6A 3QBXA 4FJ7A 3LM9A 1W9HA 1ESVA 1K8KB 3DLBA 3ENBA 4BROA 3KK7A 1DLOA 5LMNK 4ILHA 3ZETA 2V7ZA 3J7YP 2IVOA 3L2RA 3M1FA 3H08A 4KKOA 3AV9A 3PIOL 1WSHA 3OVNA 1QQMA 2AJQA 4PKGA 3VQPA 4JKDA 3O6WA 4CHPA 4FJ5A 1TKXA 5AQTA 4NCAA 3G6EN 3F2KA 1S5JA 3KLFA 5AQWA 1U04A 3SCXA 2P5GA 3CC7N 3TU5A 1JXBA 3LDPA 3ZEUB 4H0OA 3DRPA 3RMCA 1UOCA 1KD1O 3MWTA 4KH4A 4LH4A 4JI3K 4J2AA 4X64K 1U2VB 3THXA 2D0OA 2PY5A 3TANA 4CJWA 4E7KA 3C94A 3CIPA 2HMPA 4CJEA 1JL2A 3FE1A 4Z4IA 4Z4EA 4X62K 3RRGA 3DLEA 3K5MA 5A2QO 4PHTX 3M6GA 4IWVA 4DTXA 4KB1A 5KTQA 4N76A 4YOTA 4FJ9A 2WC9A 3F9KA 4Z4GA 2F4VK 1WUAA 2RKIA 1OH7A 3LALA 5BR9A 4Z4CA 4FZXC 3HSCA 3TABA 1M1KO 1U47A 4A5AA 1GLEG 1SKRA 5AQQA 3U6FA 1HLUA 1ZC6A 3AVLA 3OYHA 4PL7A 3K59A 1WN7A 3ZT1A 1QHTA 4C1NK 1FJGK 3M8RA 3IAYA 3MXJA 4B9VA 1HNIA 4J2BA 3AVKA 4AHSA 4B9MA 1K73O 5J2QA 3O1BA 1YAGA 1XHXA 5KPTA 3H3OB 4CFCA 4I6MA 3DLKA 1NGJA 3DRSA 1SAZA 4RWTA 1KTQA 2KFNA 4PKHA 1G99A 4OGEA 4CCHA 3K58A 3TSQA 3JYTA 4FJLA 3T7ZA 1IBMK 2O8CB 3C95A 3VEXA 5FPEA 2P9UA 3MK6A 4BC2A 4CIGA 4I2PA 1RBUA 1S1XA 4CECA 1TL3A 4RW9A 3N4QA 4K42A 3T19A 3VQDA 5FPMA 4E1MA 3BF1A 4I2QA 3ZSQA 5SWMA 4CEFA 2NRZA 3OYBA 2D0BA 2OPSA 3CI5A 1LWFA 2HB5A 3MMVA 3OYEA 5DK5A 2CGKA 3RR7A 1VQNN 3QIPA 5BN8A 3GOIA 5J2NA 1BHLA 1RDAA 3WXLA 2RHKA 1HYZA 3QIOA 5HRSA 4BR7A 3AO3A 4JS4A 3HTVA 1TAQA 1GLBG 4CEBA 3E66A 3E01A 3QNNA 4CHZA 4CK2A 3O3FA 3T69A 3MEDA 3MX5A 4KV8A 3K57A 4DUYK 4JKGA 1J53A 5KQDA 4JRQA 4G9ZA 3ZETB 5EY4A 1E3MA 4FM1A 5M1PA 3VETA 1LAWA 3CJCA 4M7YA 4DU3A 1K8AO 3C6TA 1XHZA 4XH1A 3K2PA 2UXBK 2HF3A 3CM5A 3QLHA 4JRPA 5CYQA 4BRQA 1VAZA 3A5LC 3V81A 5BN9A 1WAFA 4CJUA 1GLLO 2CGLA 3HBTA 3SUQA 4DR2K 1RTHA 2UU9K 2V52B 1YITN 4CJTA 4BRNA 4CJFA 1JLCA 3NFAA 3THXB 1RTJA 2EWSA 3MN6A 4BR2A 3CCSN 2VG6A 3SUPA 1N5YA 4FWPA 3FZFA 1Q86O 5HOOA 1HKCA 2PAVA 3IG1A 4Z0UA 4KPYA 1C0FA 2ZJPL 2XY5A 1T3VA 4DUZK 4IOCL 4NCGA 1UWBA 3VQ8A 4WFBL 3LZIA 2ATQA 3PSIA 4K8XA 2QWQA 3KIOA 2ASMA 3P31A 3J80O 3BZCA 3ZT2A 4BDYA 4KHWA 3MCAB 3OTOK 4K8ZA 4KH5A 2O4IA 1OVQA 4E7HA 3O9RA 1BI4A 2E1YA 4HCBA 4RW8A 4Y1CA 2BDPA 1TV6A 3UKUA 3QEWA 1KQSM 2YHAA 3MAQA 3F9MA 3FGUA 1HYSA 4DV6K 4B1WB 3WXJA 3CD6N 1NKCA 4B1YB 4IKFA 4LF5K 1XNRK 4I6MB 1UAXA 3CQ8A 3KVGA 4MQ3A 3DOLA 2RE2A 4C8MA 1HQUA 1VQ6N 2P9UB 4BRMA 3HPHA 1YI2N 1TAUA 4X66K 4DFPA 3ID8A 4CBUA 4CJ4A 1I39A 4IBNA 4OO1J 1QS4A 3C6UA 1NWKA 3CMEN 1C1BA 4KHNA 3OW2M 1X1PA 4MDBA 1HKBA 4DV1K 4KO0A 5AQKA 1QSYA 2G8UA 3M5RA 5IT9O 3TAEA 1D9DA 2FSKA 4JYAK 4EHUA 4KHSA 3VQAA 3VQ9A 1C0TA 3NF6A 1T7PA 2GUIA 3AVIA 4DWIA 1VSMA 4AHTA 3ZT3A 3MXMA 4DR1K 1WAJA 4LFCK 4C23A 4JKGB 3GG4A 1KAYA 1A5WA 4AHRA 3E9PA 1TUYA 3CJ9A 3E9LA 3SAFA 4E1NA 4DFKA 1BCMA 1ASVA 2XY7A 5K14A 5AQPA 1ATSA 4PY5A 2VGMA 4H5WA 4CJ5A 4DQRA 3KTQA 4BVPA 3NGIA 3VQQA 4E7IA 3VTHA 3KKSA 2IVNA 1REVA 1YF5L 2X6NA 3KZBA 3WNHA 4BVOA 5ADXH 4CIFA 4XH4A 4ISFA 3T1YK 1Z26A 4BWJA 4AHVA 1T05A 1CZAN 1C1CA 3OYNA 1N8RO 1S9EA 2QEXN 4CIEA 4KH6A 4CF9A 3V9ZA 2LSNA 1SKSA 3RMDA 3OYKA 3EE9A 2PFUA 2FC0A 4A2AA 4DFJA 3LM2A 1Y64A 4BACA 3HVTA 5KQ8A 2XY8A 3OHRA 4B08A 3CC2N 1N33K 4JLHA 1VQLN 1OKJA 5HP1A 1U48A 2CH6A 4F8RA 4CERA 1FKPA 1SQKA 4IDHA 4CJPA 4CD1A 3J7AP 3HPOA 3WUHA 2E2NA 2Q36A 5E84A 5LMUK 4BRHA 3ITHA 2F8SA 4CI6A 1BI4B 1W0HA 4E89A 2XY6A 3VGMA 1JLAA 3UKUB 2Y1IA 3O80A 4WQ4A 3AA4A 1MWMA 5KI6A 4JI5K 4DU1A 4CF0A 4BC5A 2FBYA 3WT0A 3O3GA 4PQUA 4U7BA 3IS9A 1X9WA 4O0JA 2OTLN 3AVGA 4FJHA 2IC3A 4OGCA 5KPRA 3FFKB 3D6RA 3DAWA 4AILC 2ZGYA 1VSEA 5BRFA 4E0DA 1RBRA 1NOYA 2I7PA 1QVGM 3BZKA 4RW6A 3R8EA 2OZSA 4MFBA 3U3YA 3NH1A 1BDGA 1TL1A 4B9TA 2Z1HA 3WEEA 1RNHA 2PYLA 4BRFA 1BO5O 1NKBA 4B9QA 3ZEUA 4W5RA 3QB0A 4GY2B 4RW7A 3OY9A 4FLZA 3VQBA 3DM2A 4DR3K 3B6OA 1X9SA 1NM1A 3MN7A 2D4WA 3OS2A 1EQYA 4ZTJA 4BC4A 1W7AA 1RT7A 5EX5A 1BGXT 4FLYA 1L5UA 3LP2A 1CXUA 3NHGA 2QKKA 4CF8A 3PSFA 4U67L 2GBZA 3ATVA 4JI2K 4CHOA 3AO1A 2X6SA 3FZHA 2XRIA 3ZX2A 3HO1A 4FK0A 3EY1A 5AQSA 4W5QA 3LANA 1E4GT 3HXMA 5AQXA 1S3XA 4FK4A 5GIOA 3ID6A 4WQ4C 4CJQA 4CJLA 5CZ2A 1RTDA 3QEXA 4JV5K 4FLWA 3J81O 2D1KA 2BANA 4H4OA 5AJ3K 5J1EA 3CYMA 1KRPA 4IXCA 2YNIA 4FJIA 4J2EA 1TKZA 4W5OA 3ZSRA 4BDPA 2ETJA 3TAGA 4LF8K 1XC3A 4IEIA 2QW9A 3OYDA 4DLGA 1TYQA 4O55A 4HUGA 1WB9A 4OLBA 1QZ5A 2DTUA 3I8BA 2F8TA 2E2PA 1I94K 3DRRA 3NVMA 3UIQA 4Z94A 5DM6L 1NK8A 3CMAN 1NGDA 2O8BA 2D5RA 3ZSYA 3SMPA 1ZYQA 3VEOA 1EXQA 2F96A 4ISEA 1JCGA 1FW6A 1NGCA 4EAHD 2FSNA 2Q97A 1KAXA 3V1OA 4C1NI 3CCJN 4M42A 4JKEA 4CEQA 2A41A 1U45A 1JLGA 2O8EA 2WBNA 3S41A 5AQNA 2O4GA 1R59O 1W97L 5JICA 1UA0A 1NJIO 1YHQN 3WQTA 1GOBA 4DU4A 4Z4HA 3VQ6A 2V51B 2P9PA 4DSIA 2G8IA 1WBDA 4LFBK 1QVFM 3K9KA 1JCFA 2GWJA 1M90O 1Q18A 1GLDG 5KRTA 3ZX0A 4OKJA 1OH6A 3FFIA 4JKBA 3U4LA 4C8LA 1B92A 3NAEA 3K5NA 1VSJA 3W3DA 5BREA 4C8KA 5JMVA 3D45A 4JI1K 4B1XB 3C65A 1IBLK 1DEJA 4KRFA 3OJUA 5EOYA 1WSGA 5FDLA 4FO0A 3L8BA 3GBTA 3ZSWA 3WEEB 4FW2A 4BE1A 4GV9A 1VQ5N 1BIZA 5AQJA 4BREA 4FL9A 2QI2A 4YY3K
chains in the Genus database with same CATH topology
4DU3A 3CFOA 1VSDA 3C6TA 4AH9A 1XHZA 3K2PA 4WE1A 1RILA 2OYQA 1S9GA 1QQCA 3CM5A 3NE6A 4ID5A 3TR8A 3QLHA 4JRPA 5CYQA 3QEIA 4CGGA 4OPJA 3V81A 4CEAA 4DTNA 2B5JA 3VQEA 1BIUA 1TVRA 4BWMA 3SJJA 1SL2A 1EP4A 3LAKA 4ELVA 1WAFA 4O4GA 1D8YA 2DFFA 4CJUA 3KLEA 3RRHA 3OS0A 3CFPA 4KTQA 2RPIA 1XI1A 3SUQA 3NBPA 1RTHA 1BQMA 3RWUA 3SQ2A 2DY4A 1KSPA 2RF2A 3JSMA 1LWEA 4CJTA 3NDKA 1HNVA 2VWKA 3KK1A 1C1AA 5JS1A 4CJFA 1JLCA 3NFAA 4I7FA 1WLJA 1R0AA 1IKWA 4FM0A 4IDKA 4BE0A 1RTJA 4CHNA 2VWJA 1NJWA 1WSIA 1SKWA 2VG6A 3SUPA 1SL0A 3KLHA 1NK6A 3M8SA 1N5YA 1HPZA 1VRUA 1NK5A 4IG3A 3VA3A 4DSEA 4CHQA 4GW6A 3HK2A 2E4LA 2OPQA 3RMAA 3ALYA 3SV4A 2A1RA 3IG1A 4Z0UA 4FM2A 4KPYA 1FKOA 5CY4A 4CESA 1LW0A 4CJSA 3SYZA 4NCBA 2XY5A 4DTUA 1HYVA 3TARA 2HVIA 2E6MA 2QXFA 2KFZA 4NCGA 5EU7A 1UWBA 3O3HA 4N41A 2HVHA 2XHBA 4GVMA 3VQ8A 1K6YA 3QINA 3LZJA 3P83D 4DF4A 2G8FA 1RT1A 4DS4A 3DYAA 3LZIA 3SNNA 1QSSA 2ATQA 4FVMA 3T1AA 4K8XA 1RT3A 1ZBHA 3I0RA 1B9DA 2A1SA 3KIOA 4DFMA 3KD5E 3F73A 2Q3SA 3L3VA 4M45A 3HVRA 2G8WA 3ZT2A 3SPYA 3IRXA 2HHTA 3WNFA 4BDYA 1Q9YA 1BQNA 5T7BA 4KHWA 4O44A 1KCFA 2ZD1A 3OYFA 2XO7A 4CJRA 4K8ZA 1T03A 4DQIA 2O4IA 1QE1A 4JS5A 3S3NA 2Z1GA 4LD0A 1BI4A 4E7HA 4HCBA 1S1WA 2D0CA 4RW8A 4Y1CA 5FROA 1S1UA 3I8DA 1TV6A 5J2PA 1TKDA 3QEWA 2BDPA 4NYNA 4B8CA 2YHAA 2HNZA 2Y1JA 3I0SA 4CK3A 2YKMA 4M3RA 3PX0A 5HROA 3M8QA 3MAQA 1S6PA 3NH2A 4W5TA 3S9HA 4RG8A 1NK7A 1HYSA 1B9FA 1TK0A 2HW3A 1YTAA 2HHVA 1CXQA 3ISNC 3NF7A 2X78A 4FJGA 1NKCA 4F2SA 4DG1A 2OZMA 4IKFA 4DTRA 5HLFA 1HMVA 1RDBA 1UAXA 3CQ8A 1CZ9A 1Y97A 1CZBA 3OYLA 4O0IA 2IOCA 3G0ZA 4LSNA 4MQ3A 4HUFA 1VK0A 3DOLA 3AVCA 1IH7A 4C8MA 3NF8A 4CJKA 1WSJA 1HQUA 3LPUA 4HCCA 3AVBA 1HJRA 3HPHA 1NK9A 3PX4A 3OYCA 4IFYA 3AO5A 2P1JA 1ZBIA 1TAUA 3HJFA 4DFPA 2KQ2A 4EZ6A 4CJ4A 4IG0A 3LWLA 1I39A 4IBNA 1QS4A 1L3UA 1VRTA 3C6UA 1RT2A 1A5VA 1C1BA 4KHNA 1X1PA 2E6LA 2YV0X 2P51A 3SZ2A 4KO0A 4C8OA 4CEDA 1QSYA 2G8UA 3BDPA 2HNYA 4ICLA 1EX4A 3QEVA 1MU2A 3QEPA 1TK5A 3TAEA 1D9DA 2Z1IA 3DOKA 3MEEA 4Q0BA 3HL8A 4OKEA 5HRRA 4FZZA 4G1QA 3TAPA 3L2VA 3S3OA 4KHSA 4DSFA 4PUOA 3VQAA 3VQ9A 1C0TA 3KK3A 5KGWA 1KLNA 3KKRA 2HNDA 3NF6A 4LSLA 1T7PA 2GUIA 4ELTA 2BGGA 3AVIA 4DWIA 4I9QA 1VSMA 3VA0A 4BE2A 4HUEA 2EHGA 3P1GA 4AHTA 3HSTB 2KZMA 5HBMA 1JLEA 3PX6A 4GMJB 3ZT3A 3KJVA 4XIUA 3TAFA 3HPGA 2YNHA 5I42A 3MXMA 4B9LA 1WAJA 2ZE2A 2QKBA 3L2QA 2HHWA 3TWHA 4DQQA 4DS5A 4KAZA 4FYDA 1A5WA 4AHRA 2FBTA 4FJMA 4Z4FA 1ASWA 4E1NA 2R7YA 1WNSA 4DFKA 4QOZB 1BCMA 3NCIA 2YNFA 4N47A 1KLMA 4FLXA 1S1VA 1SL1A 1ASVA 4FW1A 3HT3A 1KVBA 1KVAA 2QK9A 3SQ1A 4PWDA 5E41A 3OYMA 2XY7A 5K14A 4CFBA 1UA1A 1JKHA 3SQ0A 1S6QA 5FRMA 4PY5A 3KD1E 3TI0A 1SUQA 4CJ5A 4DQRA 3KTQA 3OYAA 2OPPA 3SQ4A 1L3VA 2D0AA 4DLEA 3KLIA 3NGIA 3VQQA 3NGZA 4E7IA 4M3TA 1YTUA 4CFAA 3ASMA 2WONA 1RDCA 3KKSA 1REVA 2X6NA 1RT4A 3WNHA 4E19A 4CIFA 3NH0A 4CEOA 3ZSZA 3LWMA 4CK1A 1LAVA 1Z26A 4BWJA 4AHVA 2X74A 3B6PA 4LY7A 4HVJA 1T05A 3V1QA 3OYNA 1C1CA 5CZ1A 3LP0A 4Y1DA 4B8AB 3L2UA 1S9EA 4OVLA 1RTIA 1NK0A 2HMIA 4CIEA 4CF2A 4KI4A 4CF9A 3V9ZA 4CFDA 4KFBA 4OJRA 3AVJA 4QAGA 2LSNA 3HYFA 2KTQA 1JLBA 3ZT0A 1SKSA 4FJKA 3DLGA 3RMDA 3OYKA 1FXXA 4LH5A 2FC0A 4EP4A 4H8KA 1G15A 4FLVA 4DFJA 4B9NA 5HRNA 3QO9A 3TAMA 3LDSA 1ASUA 1JL1A 3WNEA 1NOZA 3HVTA 1TGOA 4BACA 3V9WA 1TK8A 1WSFA 2XY8A 4N56A 1NJYA 1RBVA 4B08A 3DMJA 4JLHA 3NF9A 5J2MA 2G8VA 1Q8IA 5C24A 5HP1A 1U48A 4F8RA 3LPTA 4CERA 2G8KA 2PYJA 1FKPA 3EYZA 3SUNA 4KREA 3O4QA 2DFEA 4CJPA 3SI6A 1L3SA 3DLHA 3HPOA 3SV3A 3K5OA 3EZ5A 1J54A 3PO5A 4FJNA 3ITHA 1A5XA 3PUFA 2F8SA 1U4BA 1BI4B 1W0HA 3AO2A 4E89A 1VSKA 2XY6A 1JLAA 3DLRA 2Y1IA 3VQ7A 4YNQA 3AA4A 1F21A 3DI6A 3QERA 3LAMA 1FK9A 3PO4A 4DQSA 3V9XA 1NKEA 5KI6A 5D3GA 4DU1A 1TKTA 4CF0A 1KVCA 3M8PA 2FBYA 4EP5A 3SUOA 4J2DA 3O3GA 1XWLA 1Q9XA 4PQUA 5FRNA 3IS9A 2KZZA 2KW4A 2Z1JA 1EETA 3BGRA 4Q5VA 1X9WA 4O0JA 2IDOA 3AVHA 1GOAA 3VQCA 5JS2A 3AVGA 4FJHA 2IC3A 4OGCA 4KHYA 1CLQA 3RTVA 2G8HA 2P5OA 1NJZA 4FK2A 1XC9A 4DF8A 4F4KA 4AILC 4H4MA 3MEGA 1IKYA 4AHCA 2VG7A 5KRSA 3AVMA 4IFVA 1VSEA 2B4JA 3RMBA 3TAQA 1EKEA 4RW4A 4NYFA 4E0DA 4FJ7A 3V6DA 1LWCA 1O1WA 1RBRA 1W9HA 1NOYA 3VQ5A 2PZSA 5C42A 3ZSVA 1RDDA 3DLBA 3CG7A 4F3TA 4FJJA 4RW6A 2OZSA 4L8RB 3LP3A 1KFSA 4MFBA 4B9SA 3NGYA 3U3YA 1ZBLA 2ZQBA 4M41A 3NH1A 3V9SA 1DLOA 1TL1A 4B9TA 4N5SA 2Z1HA 3RR8A 4FJXA 3HP6A 1RNHA 4DQPA 4KHUA 3O4NA 2PYLA 3L2RA 1NKBA 3H08A 4DTSA 4KKOA 3AV9A 1WSHA 3OVNA 4W5RA 4FLUA 3ZSOA 2AJQA 1D9FA 4FZYA 3VQPA 4RW7A 3OY9A 4CHPA 4FJ5A 1TKXA 4FLZA 2FBXA 4NCAA 3VQBA 1BL3A 3DM2A 2NUBA 1S5JA 3KLFA 1U04A 3VN5A 3SCXA 4FXDA 1NK4A 3ULDA 3B6OA 2P5GA 1X9SA 4KHQA 1VSIA 1JXBA 3OS1A 3PV8A 3RMCA 3DRPA 3OS2A 1UOCA 1Z25A 1VSHA 4LH4A 4ZTJA 1RT7A 4CJ3A 1BGXT 3OJSA 4FLYA 4J2AA 1L5UA 3LP2A 1CXUA 1IO2A 1BCOA 3AA5X 3NHGA 2QKKA 4CF8A 1RT6A 2GBZA 2PY5A 3TANA 4CJWA 3CFRA 4E7KA 4CHOA 1IKVA 3C94A 2YKNA 3AO1A 4CGIA 2X6SA 4OKKA 2JGUA 2XRIA 3ZSXA 4CJEA 3HO1A 1JL2A 1YT3A 4CEZA 1HQEA 4PA1A 5KGXA 4Z4IA 4Z4EA 4FK0A 4BDZA 3EY1A 4YFUA 3RRGA 3DLEA 3K5MA 2YHBA 4W5QA 3LANA 4CEEA 2EX3A 3HXMA 1C6VA 2YNGA 4ZTFA 1ZBUA 4DTXA 2IAJA 4KB1A 4FK4A 4CE9A 3U3GA 5KTQA 4N76A 3HM9A 3S3MA 4FJ9A 1YVUA 3V4IA 3F9KA 5DMRA 1LV5A 2RN2A 2VG5A 1L3TA 4Z4GA 4CJQA 4CJLA 5CZ2A 2RKIA 1RTDA 3LALA 3QEXA 3T3FA 3AVAA 4Z4CA 1SV5A 4FZXC 4FLWA 2I5JA 3D0PA 3SPZA 4KTWA 2W42A 2BANA 4H4OA 3TABA 3PY8A 1J9AA 5J1EA 3MXIA 3CYMA 1WSEA 2ITGA 2JLEA 4DTPA 1U47A 4DSLA 2HHQA 3VQ4A 4CGJA 4E7LA 5I3UA 4TSXA 3U6FA 1SKRA 1KRPA 2HHXA 2YNIA 3AVLA 3OYHA 3K5LA 4FJIA 4J2EA 1TKZA 3AO4A 3K59A 1WN7A 3ZSRA 3ZT1A 2ETJA 3ZT4A 4W5OA 3QNOA 4BDPA 3TAGA 1ZBFA 1QHTA 4KB0A 1T8EA 1C0MA 3OYDA 3M8RA 4DLGA 1J5OA 3CM6A 3IAYA 4O55A 4HUGA 3MXJA 4B9VA 4OLBA 1ITGA 4AHUA 3P5JA 4FJ8A 1HNIA 4J2BA 3AVKA 4AHSA 4M3WA 3KLGA 4M3XA 2F8TA 4OLAA 2DTUA 4B9UA 4B9MA 4O5BA 4CGDA 3DRRA 4KI6A 1HRHA 5SZTA 4HHTA 5J2QA 3UIQA 4KTZA 3QETA 1NK8A 1XHXA 1S1TA 2DFHA 4DMNA 1D5AA 4CFCA 5C25A 2FBVA 4E7JA 1QTMA 1U49A 1RBTA 2D5RA 3DLKA 3DRSA 3ZSYA 3V9UA 1KTQA 3THVA 2KFNA 1ZYQA 4OGEA 4CCHA 1EXQA 2F96A 3K58A 4DSJA 4FLTA 3JYTA 4FJLA 4HTUA 4ELUA 2IS3A 3A2FA 3C95A 3OYGA 4F3OA 4QCLA 2HHUA 3V1OA 1RCHA 4M42A 4CIGA 1IG9A 4I2PA 4CEQA 1RBUA 1U45A 1S1XA 4CECA 4DTMA 1JLGA 1TL3A 4RW9A 1JLFA 3MECA 3T19A 5CYMA 2O4GA 4OPKA 2BE2A 3ZCMA 4DSKA 3V1RA 3VQDA 1UA0A 1QSLA 4E1MA 1GOBA 3HP9A 3AA3A 3WNGA 4DU4A 4I2QA 3VQ6A 3ZSQA 4Z4HA 5SWMA 1X9MA 1DTQA 4M3YA 3G10A 4CJVA 4CEFA 3OYJA 3AVNA 3OYBA 1GOCA 2D0BA 2OPSA 1LWFA 2HB5A 4R5PA 4DSIA 2GV9A 3OYEA 4F2RA 2G8IA 5DK5A 2OA8A 4I9LA 3RR7A 1BISA 4B3OA 3QIPA 4M3ZA 3AA2A 5J2NA 3AVFA 1LW2A 1VSFA 1BHLA 1VSLA 2WOMA 5KRTA 3QESA 1RDAA 1RT5A 4OKJA 4M3UA 3FFIA 3L3UA 3L2WA 1JXEA 4C8LA 4CF1A 3KK2A 1B92A 3NAEA 3K5NA 4CGHA 1VSJA 1HYZA 3QIOA 1C0UA 4UQGA 4C8KA 5HRSA 4E3SA 4DTJA 3AO3A 4JS4A 3D45A 1TAQA 4CEBA 1IKXA 4DTOA 3E01A 3OYIA 4EZ9A 3OJUA 3LP1A 4CHZA 4CK2A 4ZHRA 3O3FA 3QNNA 4KRFA 1WSGA 3MEDA 5FDLA 1JLQA 1DTTA 1N6QA 4KV8A 3K57A 2OPRA 4ID1A 1KFDA 4C8NA 3L8BA 3ZSWA 1J53A 2B6AA 4FW2A 5HRPA 4JRQA 4BE1A 4FCYA 1NJXA 2HHSA 1I3AA 4FM1A 1RBSA 1BIZA 4CGFA 1LAWA 4CHYA 2IGIA 4W5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU3 A;  3CFO A;  1VSD A;  3C6T A;  4AH9 A;  1XHZ A;  3K2P A;  4WE1 A;  1RIL A;  2OYQ A;  1S9G A;  1QQC A;  3CM5 A;  3NE6 A;  4ID5 A;  3TR8 A;  3QLH A;  4JRP A;  5CYQ A;  3QEI A;  4CGG A;  4OPJ A;  3V81 A;  4CEA A;  4DTN A;  2B5J A;  3VQE A;  1BIU A;  1TVR A;  4BWM A;  3SJJ A;  1SL2 A;  1EP4 A;  3LAK A;  4ELV A;  1WAF A;  4O4G A;  1D8Y A;  2DFF A;  4CJU A;  3KLE A;  3RRH A;  3OS0 A;  3CFP A;  4KTQ A;  2RPI A;  1XI1 A;  3SUQ A;  3NBP A;  1RTH A;  1BQM A;  3RWU A;  3SQ2 A;  2DY4 A;  1KSP A;  2RF2 A;  3JSM A;  1LWE A;  4CJT A;  3NDK A;  1HNV A;  2VWK A;  3KK1 A;  1C1A A;  5JS1 A;  4CJF A;  1JLC A;  3NFA A;  4I7F A;  1WLJ A;  1R0A A;  1IKW A;  4FM0 A;  4IDK A;  4BE0 A;  1RTJ A;  4CHN A;  2VWJ A;  1NJW A;  1WSI A;  1SKW A;  2VG6 A;  3SUP A;  1SL0 A;  3KLH A;  1NK6 A;  3M8S A;  1N5Y A;  1HPZ A;  1VRU A;  1NK5 A;  4IG3 A;  3VA3 A;  4DSE A;  4CHQ A;  4GW6 A;  3HK2 A;  2E4L A;  2OPQ A;  3RMA A;  3ALY A;  3SV4 A;  2A1R A;  3IG1 A;  4Z0U A;  4FM2 A;  4KPY A;  1FKO A;  5CY4 A;  4CES A;  1LW0 A;  4CJS A;  3SYZ A;  4NCB A;  2XY5 A;  4DTU A;  1HYV A;  3TAR A;  2HVI A;  2E6M A;  2QXF A;  2KFZ A;  4NCG A;  5EU7 A;  1UWB A;  3O3H A;  4N41 A;  2HVH A;  2XHB A;  4GVM A;  3VQ8 A;  1K6Y A;  3QIN A;  3LZJ A;  3P83 D;  4DF4 A;  2G8F A;  1RT1 A;  4DS4 A;  3DYA A;  3LZI A;  3SNN A;  1QSS A;  2ATQ A;  4FVM A;  3T1A A;  4K8X A;  1RT3 A;  1ZBH A;  3I0R A;  1B9D A;  2A1S A;  3KIO A;  4DFM A;  3KD5 E;  3F73 A;  2Q3S A;  3L3V A;  4M45 A;  3HVR A;  2G8W A;  3ZT2 A;  3SPY A;  3IRX A;  2HHT A;  3WNF A;  4BDY A;  1Q9Y A;  1BQN A;  5T7B A;  4KHW A;  4O44 A;  1KCF A;  2ZD1 A;  3OYF A;  2XO7 A;  4CJR A;  4K8Z A;  1T03 A;  4DQI A;  2O4I A;  1QE1 A;  4JS5 A;  3S3N A;  2Z1G A;  4LD0 A;  1BI4 A;  4E7H A;  4HCB A;  1S1W A;  2D0C A;  4RW8 A;  4Y1C A;  5FRO A;  1S1U A;  3I8D A;  1TV6 A;  5J2P A;  1TKD A;  3QEW A;  2BDP A;  4NYN A;  4B8C A;  2YHA A;  2HNZ A;  2Y1J A;  3I0S A;  4CK3 A;  2YKM A;  4M3R A;  3PX0 A;  5HRO A;  3M8Q A;  3MAQ A;  1S6P A;  3NH2 A;  4W5T A;  3S9H A;  4RG8 A;  1NK7 A;  1HYS A;  1B9F A;  1TK0 A;  2HW3 A;  1YTA A;  2HHV A;  1CXQ A;  3ISN C;  3NF7 A;  2X78 A;  4FJG A;  1NKC A;  4F2S A;  4DG1 A;  2OZM A;  4IKF A;  4DTR A;  5HLF A;  1HMV A;  1RDB A;  1UAX A;  3CQ8 A;  1CZ9 A;  1Y97 A;  1CZB A;  3OYL A;  4O0I A;  2IOC A;  3G0Z A;  4LSN A;  4MQ3 A;  4HUF A;  1VK0 A;  3DOL A;  3AVC A;  1IH7 A;  4C8M A;  3NF8 A;  4CJK A;  1WSJ A;  1HQU A;  3LPU A;  4HCC A;  3AVB A;  1HJR A;  3HPH A;  1NK9 A;  3PX4 A;  3OYC A;  4IFY A;  3AO5 A;  2P1J A;  1ZBI A;  1TAU A;  3HJF A;  4DFP A;  2KQ2 A;  4EZ6 A;  4CJ4 A;  4IG0 A;  3LWL A;  1I39 A;  4IBN A;  1QS4 A;  1L3U A;  1VRT A;  3C6U A;  1RT2 A;  1A5V A;  1C1B A;  4KHN A;  1X1P A;  2E6L A;  2YV0 X;  2P51 A;  3SZ2 A;  4KO0 A;  4C8O A;  4CED A;  1QSY A;  2G8U A;  3BDP A;  2HNY A;  4ICL A;  1EX4 A;  3QEV A;  1MU2 A;  3QEP A;  1TK5 A;  3TAE A;  1D9D A;  2Z1I A;  3DOK A;  3MEE A;  4Q0B A;  3HL8 A;  4OKE A;  5HRR A;  4FZZ A;  4G1Q A;  3TAP A;  3L2V A;  3S3O A;  4KHS A;  4DSF A;  4PUO A;  3VQA A;  3VQ9 A;  1C0T A;  3KK3 A;  5KGW A;  1KLN A;  3KKR A;  2HND A;  3NF6 A;  4LSL A;  1T7P A;  2GUI A;  4ELT A;  2BGG A;  3AVI A;  4DWI A;  4I9Q A;  1VSM A;  3VA0 A;  4BE2 A;  4HUE A;  2EHG A;  3P1G A;  4AHT A;  3HST B;  2KZM A;  5HBM A;  1JLE A;  3PX6 A;  4GMJ B;  3ZT3 A;  3KJV A;  4XIU A;  3TAF A;  3HPG A;  2YNH A;  5I42 A;  3MXM A;  4B9L A;  1WAJ A;  2ZE2 A;  2QKB A;  3L2Q A;  2HHW A;  3TWH A;  4DQQ A;  4DS5 A;  4KAZ A;  4FYD A;  1A5W A;  4AHR A;  2FBT A;  4FJM A;  4Z4F A;  1ASW A;  4E1N A;  2R7Y A;  1WNS A;  4DFK A;  4QOZ B;  1BCM A;  3NCI A;  2YNF A;  4N47 A;  1KLM A;  4FLX A;  1S1V A;  1SL1 A;  1ASV A;  4FW1 A;  3HT3 A;  1KVB A;  1KVA A;  2QK9 A;  3SQ1 A;  4PWD A;  5E41 A;  3OYM A;  2XY7 A;  5K14 A;  4CFB A;  1UA1 A;  1JKH A;  3SQ0 A;  1S6Q A;  5FRM A;  4PY5 A;  3KD1 E;  3TI0 A;  1SUQ A;  4CJ5 A;  4DQR A;  3KTQ A;  3OYA A;  2OPP A;  3SQ4 A;  1L3V A;  2D0A A;  4DLE A;  3KLI A;  3NGI A;  3VQQ A;  3NGZ A;  4E7I A;  4M3T A;  1YTU A;  4CFA A;  3ASM A;  2WON A;  1RDC A;  3KKS A;  1REV A;  2X6N A;  1RT4 A;  3WNH A;  4E19 A;  4CIF A;  3NH0 A;  4CEO A;  3ZSZ A;  3LWM A;  4CK1 A;  1LAV A;  1Z26 A;  4BWJ A;  4AHV A;  2X74 A;  3B6P A;  4LY7 A;  4HVJ A;  1T05 A;  3V1Q A;  3OYN A;  1C1C A;  5CZ1 A;  3LP0 A;  4Y1D A;  4B8A B;  3L2U A;  1S9E A;  4OVL A;  1RTI A;  1NK0 A;  2HMI A;  4CIE A;  4CF2 A;  4KI4 A;  4CF9 A;  3V9Z A;  4CFD A;  4KFB A;  4OJR A;  3AVJ A;  4QAG A;  2LSN A;  3HYF A;  2KTQ A;  1JLB A;  3ZT0 A;  1SKS A;  4FJK A;  3DLG A;  3RMD A;  3OYK A;  1FXX A;  4LH5 A;  2FC0 A;  4EP4 A;  4H8K A;  1G15 A;  4FLV A;  4DFJ A;  4B9N A;  5HRN A;  3QO9 A;  3TAM A;  3LDS A;  1ASU A;  1JL1 A;  3WNE A;  1NOZ A;  3HVT A;  1TGO A;  4BAC A;  3V9W A;  1TK8 A;  1WSF A;  2XY8 A;  4N56 A;  1NJY A;  1RBV A;  4B08 A;  3DMJ A;  4JLH A;  3NF9 A;  5J2M A;  2G8V A;  1Q8I A;  5C24 A;  5HP1 A;  1U48 A;  4F8R A;  3LPT A;  4CER A;  2G8K A;  2PYJ A;  1FKP A;  3EYZ A;  3SUN A;  4KRE A;  3O4Q A;  2DFE A;  4CJP A;  3SI6 A;  1L3S A;  3DLH A;  3HPO A;  3SV3 A;  3K5O A;  3EZ5 A;  1J54 A;  3PO5 A;  4FJN A;  3ITH A;  1A5X A;  3PUF A;  2F8S A;  1U4B A;  1BI4 B;  1W0H A;  3AO2 A;  4E89 A;  1VSK A;  2XY6 A;  1JLA A;  3DLR A;  2Y1I A;  3VQ7 A;  4YNQ A;  3AA4 A;  1F21 A;  3DI6 A;  3QER A;  3LAM A;  1FK9 A;  3PO4 A;  4DQS A;  3V9X A;  1NKE A;  5KI6 A;  5D3G A;  4DU1 A;  1TKT A;  4CF0 A;  1KVC A;  3M8P A;  2FBY A;  4EP5 A;  3SUO A;  4J2D A;  3O3G A;  1XWL A;  1Q9X A;  4PQU A;  5FRN A;  3IS9 A;  2KZZ A;  2KW4 A;  2Z1J A;  1EET A;  3BGR A;  4Q5V A;  1X9W A;  4O0J A;  2IDO A;  3AVH A;  1GOA A;  3VQC A;  5JS2 A;  3AVG A;  4FJH A;  2IC3 A;  4OGC A;  4KHY A;  1CLQ A;  3RTV A;  2G8H A;  2P5O A;  1NJZ A;  4FK2 A;  1XC9 A;  4DF8 A;  4F4K A;  4AIL C;  4H4M A;  3MEG A;  1IKY A;  4AHC A;  2VG7 A;  5KRS A;  3AVM A;  4IFV A;  1VSE A;  2B4J A;  3RMB A;  3TAQ A;  1EKE A;  4RW4 A;  4NYF A;  4E0D A;  4FJ7 A;  3V6D A;  1LWC A;  1O1W A;  1RBR A;  1W9H A;  1NOY A;  3VQ5 A;  2PZS A;  5C42 A;  3ZSV A;  1RDD A;  3DLB A;  3CG7 A;  4F3T A;  4FJJ A;  4RW6 A;  2OZS A;  4L8R B;  3LP3 A;  1KFS A;  4MFB A;  4B9S A;  3NGY A;  3U3Y A;  1ZBL A;  2ZQB A;  4M41 A;  3NH1 A;  3V9S A;  1DLO A;  1TL1 A;  4B9T A;  4N5S A;  2Z1H A;  3RR8 A;  4FJX A;  3HP6 A;  1RNH A;  4DQP A;  4KHU A;  3O4N A;  2PYL A;  3L2R A;  1NKB A;  3H08 A;  4DTS A;  4KKO A;  3AV9 A;  1WSH A;  3OVN A;  4W5R A;  4FLU A;  3ZSO A;  2AJQ A;  1D9F A;  4FZY A;  3VQP A;  4RW7 A;  3OY9 A;  4CHP A;  4FJ5 A;  1TKX A;  4FLZ A;  2FBX A;  4NCA A;  3VQB A;  1BL3 A;  3DM2 A;  2NUB A;  1S5J A;  3KLF A;  1U04 A;  3VN5 A;  3SCX A;  4FXD A;  1NK4 A;  3ULD A;  3B6O A;  2P5G A;  1X9S A;  4KHQ A;  1VSI A;  1JXB A;  3OS1 A;  3PV8 A;  3RMC A;  3DRP A;  3OS2 A;  1UOC A;  1Z25 A;  1VSH A;  4LH4 A;  4ZTJ A;  1RT7 A;  4CJ3 A;  1BGX T;  3OJS A;  4FLY A;  4J2A A;  1L5U A;  3LP2 A;  1CXU A;  1IO2 A;  1BCO A;  3AA5 X;  3NHG A;  2QKK A;  4CF8 A;  1RT6 A;  2GBZ A;  2PY5 A;  3TAN A;  4CJW A;  3CFR A;  4E7K A;  4CHO A;  1IKV A;  3C94 A;  2YKN A;  3AO1 A;  4CGI A;  2X6S A;  4OKK A;  2JGU A;  2XRI A;  3ZSX A;  4CJE A;  3HO1 A;  1JL2 A;  1YT3 A;  4CEZ A;  1HQE A;  4PA1 A;  5KGX A;  4Z4I A;  4Z4E A;  4FK0 A;  4BDZ A;  3EY1 A;  4YFU A;  3RRG A;  3DLE A;  3K5M A;  2YHB A;  4W5Q A;  3LAN A;  4CEE A;  2EX3 A;  3HXM A;  1C6V A;  2YNG A;  4ZTF A;  1ZBU A;  4DTX A;  2IAJ A;  4KB1 A;  4FK4 A;  4CE9 A;  3U3G A;  5KTQ A;  4N76 A;  3HM9 A;  3S3M A;  4FJ9 A;  1YVU A;  3V4I A;  3F9K A;  5DMR A;  1LV5 A;  2RN2 A;  2VG5 A;  1L3T A;  4Z4G A;  4CJQ A;  4CJL A;  5CZ2 A;  2RKI A;  1RTD A;  3LAL A;  3QEX A;  3T3F A;  3AVA A;  4Z4C A;  1SV5 A;  4FZX C;  4FLW A;  2I5J A;  3D0P A;  3SPZ A;  4KTW A;  2W42 A;  2BAN A;  4H4O A;  3TAB A;  3PY8 A;  1J9A A;  5J1E A;  3MXI A;  3CYM A;  1WSE A;  2ITG A;  2JLE A;  4DTP A;  1U47 A;  4DSL A;  2HHQ A;  3VQ4 A;  4CGJ A;  4E7L A;  5I3U A;  4TSX A;  3U6F A;  1SKR A;  1KRP A;  2HHX A;  2YNI A;  3AVL A;  3OYH A;  3K5L A;  4FJI A;  4J2E A;  1TKZ A;  3AO4 A;  3K59 A;  1WN7 A;  3ZSR A;  3ZT1 A;  2ETJ A;  3ZT4 A;  4W5O A;  3QNO A;  4BDP A;  3TAG A;  1ZBF A;  1QHT A;  4KB0 A;  1T8E A;  1C0M A;  3OYD A;  3M8R A;  4DLG A;  1J5O A;  3CM6 A;  3IAY A;  4O55 A;  4HUG A;  3MXJ A;  4B9V A;  4OLB A;  1ITG A;  4AHU A;  3P5J A;  4FJ8 A;  1HNI A;  4J2B A;  3AVK A;  4AHS A;  4M3W A;  3KLG A;  4M3X A;  2F8T A;  4OLA A;  2DTU A;  4B9U A;  4B9M A;  4O5B A;  4CGD A;  3DRR A;  4KI6 A;  1HRH A;  5SZT A;  4HHT A;  5J2Q A;  3UIQ A;  4KTZ A;  3QET A;  1NK8 A;  1XHX A;  1S1T A;  2DFH A;  4DMN A;  1D5A A;  4CFC A;  5C25 A;  2FBV A;  4E7J A;  1QTM A;  1U49 A;  1RBT A;  2D5R A;  3DLK A;  3DRS A;  3ZSY A;  3V9U A;  1KTQ A;  3THV A;  2KFN A;  1ZYQ A;  4OGE A;  4CCH A;  1EXQ A;  2F96 A;  3K58 A;  4DSJ A;  4FLT A;  3JYT A;  4FJL A;  4HTU A;  4ELU A;  2IS3 A;  3A2F A;  3C95 A;  3OYG A;  4F3O A;  4QCL A;  2HHU A;  3V1O A;  1RCH A;  4M42 A;  4CIG A;  1IG9 A;  4I2P A;  4CEQ A;  1RBU A;  1U45 A;  1S1X A;  4CEC A;  4DTM A;  1JLG A;  1TL3 A;  4RW9 A;  1JLF A;  3MEC A;  3T19 A;  5CYM A;  2O4G A;  4OPK A;  2BE2 A;  3ZCM A;  4DSK A;  3V1R A;  3VQD A;  1UA0 A;  1QSL A;  4E1M A;  1GOB A;  3HP9 A;  3AA3 A;  3WNG A;  4DU4 A;  4I2Q A;  3VQ6 A;  3ZSQ A;  4Z4H A;  5SWM A;  1X9M A;  1DTQ A;  4M3Y A;  3G10 A;  4CJV A;  4CEF A;  3OYJ A;  3AVN A;  3OYB A;  1GOC A;  2D0B A;  2OPS A;  1LWF A;  2HB5 A;  4R5P A;  4DSI A;  2GV9 A;  3OYE A;  4F2R A;  2G8I A;  5DK5 A;  2OA8 A;  4I9L A;  3RR7 A;  1BIS A;  4B3O A;  3QIP A;  4M3Z A;  3AA2 A;  5J2N A;  3AVF A;  1LW2 A;  1VSF A;  1BHL A;  1VSL A;  2WOM A;  5KRT A;  3QES A;  1RDA A;  1RT5 A;  4OKJ A;  4M3U A;  3FFI A;  3L3U A;  3L2W A;  1JXE A;  4C8L A;  4CF1 A;  3KK2 A;  1B92 A;  3NAE A;  3K5N A;  4CGH A;  1VSJ A;  1HYZ A;  3QIO A;  1C0U A;  4UQG A;  4C8K A;  5HRS A;  4E3S A;  4DTJ A;  3AO3 A;  4JS4 A;  3D45 A;  1TAQ A;  4CEB A;  1IKX A;  4DTO A;  3E01 A;  3OYI A;  4EZ9 A;  3OJU A;  3LP1 A;  4CHZ A;  4CK2 A;  4ZHR A;  3O3F A;  3QNN A;  4KRF A;  1WSG A;  3MED A;  5FDL A;  1JLQ A;  1DTT A;  1N6Q A;  4KV8 A;  3K57 A;  2OPR A;  4ID1 A;  1KFD A;  4C8N A;  3L8B A;  3ZSW A;  1J53 A;  2B6A A;  4FW2 A;  5HRP A;  4JRQ A;  4BE1 A;  4FCY A;  1NJX A;  2HHS A;  1I3A A;  4FM1 A;  1RBS A;  1BIZ A;  4CGF A;  1LAW A;  4CHY A;  2IGI A;  4W5N A; 
#chains in the Genus database with same CATH topology
 3CFO A;  4AH9 A;  4ISG A;  1S9G A;  1QQC A;  3NE6 A;  1VQP N;  5BRH A;  1NGG A;  2E2Q A;  4FSV A;  2HVI A;  4DTN A;  1SL2 A;  1TVR A;  3LAK A;  1MWK A;  5AQL A;  2QWN A;  4O4G A;  3KLE A;  1IJJ A;  3SMS A;  3CJ1 A;  3VF4 A;  3A5N C;  3KK1 A;  1C1A A;  5AZJ A;  1IKW A;  3FZM A;  4CHN A;  2OAN A;  3H46 O;  3KLH A;  4DSE A;  2AP1 A;  2VQE K;  3SV4 A;  2A1R A;  5CY4 A;  1LW0 A;  4IO8 A;  3G4S N;  1XNQ K;  3OBW A;  4DTU A;  3TAR A;  2QXF A;  5EU7 A;  4GVM A;  3QIN A;  3LZJ A;  4AQY K;  3VES A;  4AM7 A;  5GAG P;  1ZBH A;  1GLA G;  3O9T A;  3QIC A;  3VEN A;  3H3N O;  5C2D A;  2Q3S A;  4M45 A;  1Q7Y O;  2G8W A;  1V4T A;  4H0P A;  4GV3 A;  3IRX A;  5AR0 A;  2GUP A;  3WNF A;  1Q9Y A;  3OYF A;  2XO7 A;  2ZD1 A;  4GV6 A;  4RTF D;  4CJR A;  4DR4 K;  1T03 A;  4DQI A;  4JS5 A;  3O8M A;  3T1H K;  2J4R A;  4CZI A;  1TKD A;  3CCV N;  1TYQ B;  1HJO A;  2ASO A;  2Y1J A;  3RSE A;  2FF3 B;  4W5T A;  4JI4 K;  4BR5 A;  5FLX O;  1B9F A;  4BRI A;  1TK0 A;  4FOE A;  3Q7C A;  2HHV A;  3NF7 A;  2X78 A;  2OZM A;  3P39 A;  2O8B B;  1CZ9 A;  1Y97 A;  3OYL A;  2BTF A;  3AVC A;  1IH7 A;  2P9K A;  4E1J A;  1WSJ A;  3LPU A;  5DM7 L;  1JCE A;  3PX4 A;  3OYC A;  5LL6 Z;  3BF3 A;  4BGB A;  2UXC K;  5M1N A;  2P1J A;  1KC8 O;  2O8E B;  1VQ8 N;  3TSP A;  3I33 A;  1L3U A;  1VRT A;  2W6K A;  2KLA A;  3BP8 A;  3P38 A;  2P9P B;  4A61 A;  1X9J A;  3QEP A;  5JVH L;  3CER A;  2Z1I A;  3SLC A;  3HL8 A;  5HRR A;  4FZZ A;  3TAP A;  3S3O A;  1HNX K;  4JAX A;  3KK3 A;  3TTD A;  1KLN A;  1QQN A;  4ELT A;  2BGG A;  3DXM A;  4I9Q A;  3KJV A;  3TAF A;  5I42 A;  3VGK A;  3QBW A;  3MN9 A;  2ZE2 A;  4K41 A;  4K25 A;  2QKB A;  2HHW A;  2F9W A;  4FYD A;  1RFQ A;  3DLL L;  4Z4F A;  3BUZ B;  1NGE A;  1WNS A;  2R7Y A;  3NCI A;  2NRR A;  5F0X A;  1KLM A;  5AQZ A;  1SL1 A;  4FW1 A;  3GE1 A;  2QK9 A;  4PWD A;  1YVN A;  3E1Y A;  3O9U A;  3N4P A;  3SQ0 A;  3CXC M;  5FRM A;  3KD1 E;  3VOV A;  1SUQ A;  2P9I A;  2OPP A;  5EVZ A;  2E20 A;  4DLE A;  4M3T A;  3NGZ A;  2NRT A;  1YTU A;  3TTC A;  3CCL N;  4CEO A;  3ZSZ A;  5B8H A;  1OVY A;  5GIP A;  2O8F A;  3VGL A;  3FLC O;  5AZJ B;  4IOA L;  2X74 A;  3LDO A;  4LY7 A;  4HVJ A;  3MCP A;  3V1Q A;  1T44 A;  3AGR A;  5LJV A;  2V7Y A;  1NK0 A;  4CFD A;  3I56 N;  2VYP A;  3D2E A;  5AZI A;  1FXX A;  3DJC A;  4FWK A;  4LH5 A;  4EP4 A;  4H8K A;  4B9N A;  3R9P A;  3QO9 A;  3TAM A;  5GIN A;  4BRK A;  1RBV A;  4K43 A;  5E26 A;  2CGJ A;  1Q8I A;  4H0X B;  2PYJ A;  1KAZ A;  3EYZ A;  2YHY A;  3WQU A;  3J8A A;  5LY3 A;  2F7T A;  2KKZ A;  3SK3 A;  5AQF A;  4FJN A;  1A5X A;  2HBL A;  3L4I A;  3DLR A;  3VQ7 A;  1NMN A;  1NMD A;  3LAM A;  1FK9 A;  3RSE B;  2GEL A;  2JWK A;  2NZT A;  4DQS A;  1NKE A;  1BUP A;  5D3G A;  1TKT A;  2GX9 A;  3O1W A;  1JJ2 M;  1KVC A;  2E5L K;  3J7Z O;  3SUO A;  4J2D A;  2KW4 A;  2Z1J A;  3CQY A;  4Q5V A;  2IDO A;  3IKM A;  1J5E K;  3RTV A;  4FK2 A;  3IDH A;  5BPM A;  5AFU A;  2A6A A;  1XC9 A;  2P9K B;  1BWF O;  3JXU A;  1WOQ A;  4AHC A;  5KRS A;  3ZYY X;  3FZK A;  4OX9 K;  1OH5 A;  3TAQ A;  1EKE A;  1O1W A;  3PIP L;  2P9N A;  3NVK A;  2PZS A;  3TSU A;  2W6L A;  3O5B A;  4F3T A;  4CBX A;  4DV0 K;  4L8R B;  2FF6 A;  3LL3 A;  2YJE A;  1KFS A;  4BG9 A;  2ZQB A;  3CCM N;  4LF7 K;  3V9S A;  3RR8 A;  4CD3 A;  4N5S A;  3HP6 A;  1NGI A;  4DQP A;  2UUB K;  3O4N A;  4IJN A;  4FLU A;  3UKR A;  4HWI A;  1OH8 A;  3ZLJ A;  2NUB A;  1BOT O;  3VN5 A;  1NK4 A;  4H5V A;  4KHQ A;  3DXM B;  1VSI A;  3OS1 A;  1Z25 A;  4UY8 O;  5AQV A;  4CJ3 A;  2ZF5 O;  3H1V X;  2QWP A;  1BCO A;  3AA5 X;  2YI1 A;  4BR4 A;  3HI0 A;  3C7N A;  4GVE A;  2YKN A;  2JGU A;  1Q81 O;  5KGX A;  3CQX A;  2YX6 A;  3LDQ A;  4YFU A;  1Q82 O;  2YHB A;  2GEM A;  2YNG A;  4ZTF A;  1ZBU A;  4X65 K;  2NRX A;  1YJW N;  4CE9 A;  2P9I B;  3U3G A;  3S3M A;  1YVU A;  3V4I A;  5DMR A;  1LV5 A;  1NLV A;  2RN2 A;  1L3T A;  3AVA A;  1SV5 A;  2O8F B;  2I5J A;  3ULE A;  4H5N A;  4KTW A;  2W42 A;  2VGN A;  3I55 N;  1J9A A;  4OPA A;  1WSE A;  2ITG A;  2HHQ A;  1MDU B;  4DR7 K;  4CGJ A;  4TSX A;  3QNO A;  4KB0 A;  2O8D B;  1ZBF A;  5FPN A;  3D2E B;  5C0Y A;  5AZI B;  1J5O A;  4DV4 K;  4EHT A;  3P5J A;  4FJ8 A;  3KLG A;  4B9U A;  3LDL A;  3ENH A;  4HHT A;  4KTZ A;  4NXM K;  4DHY A;  3QET A;  1S1T A;  5TKW A;  5C25 A;  1QTM A;  2FBV A;  4CBW A;  1RBT A;  4RCH A;  4CVN E;  1W2B M;  1GLJ O;  4DSJ A;  4FLT A;  1YJ9 N;  4HTU A;  4ELU A;  3A2F A;  4H03 B;  5AQU A;  2HHU A;  1IBK K;  3O9Q A;  4DTM A;  3MEC A;  5CYM A;  4WCE L;  3IFR A;  3ZCM A;  5BPN A;  1LOT B;  1QSL A;  4FPB A;  3HP9 A;  3WNG A;  3K0S A;  1DTQ A;  2ZWH A;  4QS7 A;  1ZBS A;  3QDK A;  3AVN A;  3HM8 A;  1EWR A;  4R5P A;  2GV9 A;  2Q0U A;  4I9L A;  1BIS A;  1EO1 A;  4WFN L;  1VSL A;  3QES A;  3THY A;  3L3U A;  3SAH A;  3KK2 A;  4B1U B;  4CGH A;  1C0U A;  2P9N B;  4UQG A;  2QWR A;  1VQ7 N;  3AAR A;  3CPW M;  5M1Q A;  1IKX A;  4DTO A;  3OYI A;  4EZ9 A;  4ZHR A;  1JLQ A;  4ID1 A;  1KFD A;  4MO5 A;  3AY9 A;  5HRP A;  4FCY A;  4DQ8 A;  2UYT A;  1NJX A;  1I3A A;  4CGF A;  4BRD A;  4FWR A;  4NLB A;  2QWL A;  4CHY A;  4A2B A;  3UKR B;  2OYQ A;  3BEX A;  1XMO K;  3QEI A;  3E9O A;  5CR4 A;  3RVC A;  1NBW A;  4CGG A;  4OPJ A;  4BRA A;  5TKY A;  4BWM A;  4AF1 A;  1NGH A;  1VQ9 N;  2DFF A;  3RRH A;  3OS0 A;  4KTQ A;  1XI1 A;  3NBP A;  1DGK N;  3RWU A;  2DY4 A;  3G71 N;  3ENO A;  1KSP A;  3NDK A;  3ZX3 A;  4BRG A;  1HNV A;  2A40 A;  3DWL A;  3C7N B;  1WLJ A;  1R0A A;  4IDK A;  3R6M A;  4BE0 A;  1SKW A;  3D2F A;  2CH5 A;  1VRU A;  4R79 A;  1NK5 A;  2E8A A;  4CHQ A;  4GW6 A;  2E4L A;  2OPQ A;  1K9M O;  3ALY A;  4NCB A;  4CES A;  3CJA A;  3EE8 A;  3CC4 N;  1HYV A;  1QQO A;  2E6M A;  2HVH A;  3O3H A;  2QTD A;  1K6Y A;  1IG8 A;  3P83 D;  4FWL A;  4A5B A;  2G8F A;  4DS4 A;  3SNN A;  1QSS A;  4FVM A;  3T1A A;  3I0R A;  2Q31 A;  1B9D A;  2A1S A;  4DFM A;  3ULE B;  1S72 N;  4KHP K;  1DKG D;  1HKG A;  1RDW X;  1BQN A;  5T7B A;  3IMX A;  5H1S Q;  3HOT A;  1QE1 A;  2Z1G A;  4LD0 A;  1S22 A;  2D0C A;  3P4I A;  5J2P A;  3I8D A;  1S1U A;  3SAG A;  4B8C A;  1U6Z A;  2HNZ A;  5HRO A;  3I0S A;  3PX0 A;  2YKM A;  2YHW A;  4JKA A;  4O8U A;  1S6P A;  3NH2 A;  3S9H A;  4RG8 A;  2Q1N A;  4CZH A;  1NK7 A;  4IZ9 A;  1YTA A;  4HTL A;  1CXQ A;  3ISN C;  4F2S A;  4DG1 A;  4JI6 K;  3NMU A;  3H1Q A;  1Z05 A;  2ZJR L;  2IOC A;  3G0Z A;  4HUF A;  1VK0 A;  4H0T B;  3CJB A;  2NRW A;  4HCC A;  3AVB A;  4KBO A;  3AO5 A;  2JWL A;  4A57 A;  4B1Z A;  1ZBI A;  4EZ6 A;  3CHW A;  3VEZ A;  4IG0 A;  3LWL A;  2AA4 A;  1RT2 A;  1BU6 O;  1HX1 A;  4BR9 A;  4NLC A;  5C2F A;  4C8O A;  1NGF A;  4ICL A;  3QEV A;  4YOV A;  1TK5 A;  2GTD A;  4CZF A;  4XEI A;  4JD2 A;  3WXM B;  4Q0B A;  3MEE A;  3THY B;  1J6Z A;  2UXD K;  3L2V A;  1YIJ N;  2A42 A;  2QWO A;  3KKR A;  4LSL A;  1O13 A;  4JK8 A;  3VA0 A;  1VQM N;  1RDU A;  4HUE A;  4BE2 A;  3HST B;  4DKW A;  5HBM A;  4GMJ B;  3HPG A;  4B9L A;  3AGK A;  3L2Q A;  3TWH A;  2ZM6 K;  4IFE A;  2FBT A;  2BH1 A;  1NNE A;  4DV3 K;  1VQ4 N;  4N47 A;  4FLX A;  1S1V A;  3HT3 A;  5E41 A;  3OYM A;  4IOX A;  1S6Q A;  4K0K K;  4JK9 A;  4M7X A;  3UE5 A;  3KLI A;  2WON A;  2NRH A;  4FWS A;  4AM6 A;  4PUO A;  1NU0 A;  4BRP A;  2ITM A;  3LP0 A;  4Y1D A;  3D2F B;  3U9D A;  4OVL A;  4KI4 A;  3AAQ A;  1ATR A;  4BRL A;  2WUS A;  4OJR A;  2HBJ A;  4H0Y B;  3AVJ A;  4QAG A;  3HYF A;  2KTQ A;  1BA0 A;  3ZT0 A;  3DLG A;  2QA4 N;  1G15 A;  3A8Y A;  3H6E A;  3LDS A;  1ASU A;  1QHA A;  3WNE A;  1TGO A;  1TK8 A;  1C0G A;  1NJY A;  3A0I X;  1SZ2 A;  4O5F A;  2G8V A;  5HL7 L;  2UUA K;  1GLF O;  4IEE A;  4KRE A;  5AFU H;  2P9S A;  5I9E B;  4IO9 L;  1L3S A;  3DLH A;  1XQS C;  4BRC A;  3EKU A;  4DR5 K;  3EZ5 A;  1J54 A;  4BC3 A;  3PUF A;  4MO4 A;  1U4B A;  3HRG A;  3AO2 A;  1TUU A;  3Q7B A;  2HF4 A;  4V19 S;  3HOS A;  4YNQ A;  1F21 A;  3DI6 A;  5KPZ A;  4BQZ A;  3QER A;  3PO4 A;  3V9X A;  4QS9 A;  5AQR A;  1N36 K;  2VQF K;  4EP5 A;  1XWL A;  4FWO A;  2YJF A;  3VTI A;  1EET A;  3BGR A;  2F9T A;  3AVH A;  1GOA A;  5JS2 A;  2VCP A;  2G8H A;  4FOI A;  2P5O A;  1NJZ A;  5M1F A;  3MX2 A;  4F4K A;  3CET A;  4A62 A;  4H4M A;  3MEG A;  1IKY A;  3SJH A;  3U8X A;  3M3Z A;  2B4J A;  3RMB A;  4MDA A;  4H5R A;  4RW4 A;  4NYF A;  3V6D A;  1LWC A;  3VQ5 A;  4DV5 K;  5C42 A;  3ZSV A;  1RDD A;  3CG7 A;  4XH5 A;  4FJJ A;  4JI7 K;  2HST A;  3LP3 A;  4B9S A;  3LDN A;  3NGY A;  1ZBL A;  4M41 A;  4FJX A;  5F1X A;  5C15 A;  4BG8 A;  4KHU A;  2E1Z A;  3VER A;  4YOY A;  5GAH P;  4DTS A;  4B3M K;  2HBM A;  3CCE N;  3ZSO A;  1D9F A;  4FZY A;  4JD2 B;  2FBX A;  1BL3 A;  4FXD A;  3ULD A;  3R3L A;  3PV8 A;  5BRD A;  3SBG A;  3OA9 A;  3BY5 A;  1VSH A;  4ILG B;  3OJS A;  1H1V A;  1IO2 A;  1T6D A;  2YCH A;  4LFA K;  3EN9 A;  3HZ6 A;  2PBD A;  1RT6 A;  5ELZ A;  3CFR A;  1IKV A;  4CGI A;  2W41 A;  3F5T A;  4OKK A;  5CE3 A;  5MLC Q;  3ZSX A;  1YT3 A;  2W40 A;  4CEZ A;  1HQE A;  4PA1 A;  4BDZ A;  2IIR A;  3H45 C;  2ASP A;  4CEE A;  2EX3 A;  3KWG A;  1HNW K;  1C6V A;  1NGB A;  4OPH A;  2IAJ A;  1X3M A;  3C6H A;  4O8K A;  3HM9 A;  3CF5 L;  2VG5 A;  2O8D A;  4JKH A;  4YHH K;  2WFB A;  3T3F A;  3U9Z A;  1VQK N;  1RGI A;  1ZXO A;  3D0P A;  3SPZ A;  3PY8 A;  3MXI A;  4DTP A;  2JLE A;  4DSL A;  3VQ4 A;  4E7L A;  5I3U A;  1XUP O;  5BR8 K;  2HHX A;  3K5L A;  3AO4 A;  3ZT4 A;  1VHX A;  4GNI A;  1DT9 A;  1T8E A;  1C0M A;  3QFP A;  3CM6 A;  3TPQ A;  1ITG A;  1V4S A;  4AHU A;  4EFH A;  4M3W A;  4M3X A;  4OLA A;  3THW A;  3L0Q A;  4O5B A;  4CGD A;  4KI6 A;  1HRH A;  4PL8 A;  5SZT A;  2QM1 A;  3JS6 A;  2DFH A;  3O9S A;  4DMN A;  1D5A A;  4E7J A;  1U49 A;  3V9U A;  3THV A;  2P9S B;  3C6A A;  4H0V B;  1D4X A;  4FPA A;  4QCL A;  2IS3 A;  3OYG A;  4F3O A;  2H3G X;  5GAE P;  4WYB A;  1NG9 A;  1RCH A;  5F2R A;  5JLF A;  1IG9 A;  4DB3 A;  2E2O A;  5C10 A;  3FZL A;  4WFA L;  1JLF A;  3K9J A;  1ATN A;  3WXI A;  4OPK A;  2BE2 A;  4DSK A;  4DR6 K;  3V1R A;  3TTF A;  2VWB A;  4H5T A;  1X9M A;  3AA3 A;  5C12 A;  3FR0 A;  3G25 A;  3O4W A;  4M3Y A;  4CZL A;  4F9O A;  3G10 A;  4CJV A;  4EIA A;  3OYJ A;  1MA9 B;  1GOC A;  4IJA A;  4F2R A;  1YXQ A;  2OA8 A;  4B3O A;  4M3Z A;  3AA2 A;  3AVF A;  1LW2 A;  1VSF A;  2WOM A;  5FPD A;  4JI0 K;  3R1X A;  1KXP A;  1RT5 A;  4M3U A;  3L2W A;  3CCU N;  2E88 A;  1JXE A;  4CF1 A;  4CW7 B;  4LF4 K;  3KHY A;  2DPN A;  4YOX A;  4DTJ A;  2HHH K;  3OBY A;  4NO7 A;  1ILY A;  3LP1 A;  3JAM O;  1N6Q A;  1DTT A;  4JEP A;  2OPR A;  4C8N A;  2B6A A;  1XMQ K;  4B3R K;  2HHS A;  1RBS A;  3EO3 A;  4JNE A;  3DXK A;  2IGI A;  4W5N A;  1HPM A;  2QXL A;  1VSD A;  4WE1 A;  1RIL A;  4ID5 A;  3TR8 A;  3MWP A;  4CEA A;  2B5J A;  3VQE A;  1BIU A;  3SJJ A;  1EP4 A;  3AAP A;  4ELV A;  1D8Y A;  4PKI A;  2NRV A;  5JVG L;  3A5M C;  3CFP A;  2RPI A;  1WBB A;  1BQM A;  4FWM A;  3SQ2 A;  4BR0 A;  1QZ6 A;  2RF2 A;  4JN4 A;  5GAD P;  2P9L A;  3JSM A;  1LWE A;  4FVU A;  2D0P A;  2VWK A;  3EEQ A;  5CHI A;  5JS1 A;  4I7F A;  5AQH A;  4BY9 C;  4FM0 A;  2VWJ A;  1NJW A;  1WSI A;  4MLE A;  1SL0 A;  3W0L A;  1NK6 A;  3M8S A;  1HPZ A;  4IG3 A;  3VA3 A;  2BUP A;  2A5X A;  2A3Z A;  3HK2 A;  3RMA A;  4FM2 A;  1FKO A;  4CJS A;  3SYZ A;  1NGA A;  2KFZ A;  4M63 C;  4N41 A;  2HBK A;  4BGA A;  2XHB A;  4GKJ K;  4DF4 A;  4CZJ A;  1RT1 A;  3DYA A;  4JKF A;  1LCU A;  1RT3 A;  3MN5 A;  3VEW A;  3A5O C;  3KD5 E;  3F73 A;  2GWK A;  3HVR A;  3L3V A;  5M1K A;  3SPY A;  4JK7 A;  2HHT A;  4NB4 A;  1X3N A;  4O44 A;  1KCF A;  3S3N A;  1S1W A;  5FRO A;  4NYN A;  4CZK A;  3KWI A;  4CK3 A;  4M3R A;  2OTJ N;  4YOR A;  3VEY A;  4MLH A;  3M8Q A;  3THW B;  2YHX A;  4YOW A;  3CJ7 A;  2HW3 A;  2Q0R A;  4FJG A;  4DTR A;  5HLF A;  1HMV A;  1RDB A;  4FWQ A;  2IVP A;  1CZB A;  4O0I A;  3GL1 A;  4LSN A;  4JHD A;  5LJW A;  3L6Q A;  4CJK A;  2QWM A;  3NF8 A;  1EWQ A;  4WQ5 A;  5IWA K;  1HJR A;  1NK9 A;  1GLC G;  2I7N A;  4IFY A;  4ILJ A;  2UUC K;  1K8K A;  3HJF A;  3PLA A;  2KQ2 A;  4BQL A;  2ZJQ L;  4LF9 K;  1P90 A;  3C0B A;  1A5V A;  2E6L A;  2YV0 X;  2P51 A;  2WTU A;  3SZ2 A;  1HNZ K;  4CED A;  3BDP A;  1HR0 K;  2HNY A;  1EX4 A;  4YDU A;  1MU2 A;  1BA1 A;  3DOK A;  5AQO A;  4OKE A;  4G1Q A;  4QS8 A;  4DSF A;  3CCQ N;  5KGW A;  2HND A;  4JKC A;  1SS6 A;  3CCR N;  2EHG A;  2NLX A;  3P1G A;  4DCH A;  2KZM A;  3ATU A;  2HOE A;  3CPE A;  1JLE A;  3PX6 A;  1N34 K;  4XIU A;  2YNH A;  1IV0 A;  2KHO A;  1U2V A;  4DQQ A;  4DS5 A;  4KAZ A;  2ZGZ A;  4FJM A;  3VMF B;  1ASW A;  3DXK B;  3WXK A;  4L3Q A;  3VPZ A;  4QOZ B;  2YNF A;  3D7E O;  4CZE A;  1KVB A;  1KVA A;  3SQ1 A;  5M1O A;  1YUW A;  4CFB A;  3IUC A;  4LF6 K;  1UA1 A;  1JKH A;  1T6C A;  3GDQ A;  3TI0 A;  3MDQ A;  2FXU A;  4NXN K;  3OYA A;  3SQ4 A;  1L3V A;  4JI8 K;  2D0A A;  4CFA A;  3ASM A;  4E3S A;  1RDC A;  4E19 A;  1RT4 A;  3NH0 A;  2P9L B;  3LWM A;  4CK1 A;  1LAV A;  3SBT A;  3B6P A;  1VQO N;  5CZ1 A;  4B8A B;  3L2U A;  1RTI A;  5JLH A;  2FSJ A;  2HMI A;  4CF2 A;  1E4F T;  4GKK K;  4CJ7 A;  4KFB A;  3EZW A;  5AQY A;  2OCE A;  1JLB A;  4FJK A;  4FWN A;  1YJN N;  3VF2 A;  4WQ5 C;  4FLV A;  5HRN A;  4B3S K;  1JL1 A;  3QFU A;  1NOZ A;  4J8F A;  4DV2 K;  4B3T K;  3V9W A;  1WSF A;  4N56 A;  2Q2R A;  5BPL A;  3DMJ A;  3NF9 A;  5J2M A;  5C24 A;  3LPT A;  3O08 A;  4CZM A;  5ADX A;  2G8K A;  3SUN A;  3O4Q A;  2DFE A;  3SI6 A;  5AQI A;  3EL2 A;  4WF9 L;  3K5O A;  3SV3 A;  2O8C A;  3PO5 A;  4LC9 B;  3L4Q A;  3VEV A;  1HUX A;  1P8Z A;  4YDU C;  1VSK A;  5AQG A;  4A59 A;  3B8A X;  4Y0W A;  4CZG A;  3M8P A;  5EXW A;  1Z6R A;  1Q9X A;  5FRN A;  2KZZ A;  3UB5 A;  3VQC A;  2NNW A;  4KHY A;  1CLQ A;  4B1V A;  3EKS A;  2FLO A;  3QML A;  4JHD B;  4DF8 A;  1N32 K;  4DV7 K;  2VG7 A;  4YOU A;  3AVM A;  4IFV A;  1BG3 A;  5AQM A;  3VF6 A;  3QBX A;  4FJ7 A;  3LM9 A;  1W9H A;  1ESV A;  1K8K B;  3DLB A;  3ENB A;  4BRO A;  3KK7 A;  1DLO A;  5LMN K;  4ILH A;  3ZET A;  2V7Z A;  3J7Y P;  2IVO A;  3L2R A;  3M1F A;  3H08 A;  4KKO A;  3AV9 A;  3PIO L;  1WSH A;  3OVN A;  1QQM A;  2AJQ A;  4PKG A;  3VQP A;  4JKD A;  3O6W A;  4CHP A;  4FJ5 A;  1TKX A;  5AQT A;  4NCA A;  3G6E N;  3F2K A;  1S5J A;  3KLF A;  5AQW A;  1U04 A;  3SCX A;  2P5G A;  3CC7 N;  3TU5 A;  1JXB A;  3LDP A;  3ZEU B;  4H0O A;  3DRP A;  3RMC A;  1UOC A;  1KD1 O;  3MWT A;  4KH4 A;  4LH4 A;  4JI3 K;  4J2A A;  4X64 K;  1U2V B;  3THX A;  2D0O A;  2PY5 A;  3TAN A;  4CJW A;  4E7K A;  3C94 A;  3CIP A;  2HMP A;  4CJE A;  1JL2 A;  3FE1 A;  4Z4I A;  4Z4E A;  4X62 K;  3RRG A;  3DLE A;  3K5M A;  5A2Q O;  4PHT X;  3M6G A;  4IWV A;  4DTX A;  4KB1 A;  5KTQ A;  4N76 A;  4YOT A;  4FJ9 A;  2WC9 A;  3F9K A;  4Z4G A;  2F4V K;  1WUA A;  2RKI A;  1OH7 A;  3LAL A;  5BR9 A;  4Z4C A;  4FZX C;  3HSC A;  3TAB A;  1M1K O;  1U47 A;  4A5A A;  1GLE G;  1SKR A;  5AQQ A;  3U6F A;  1HLU A;  1ZC6 A;  3AVL A;  3OYH A;  4PL7 A;  3K59 A;  1WN7 A;  3ZT1 A;  1QHT A;  4C1N K;  1FJG K;  3M8R A;  3IAY A;  3MXJ A;  4B9V A;  1HNI A;  4J2B A;  3AVK A;  4AHS A;  4B9M A;  1K73 O;  5J2Q A;  3O1B A;  1YAG A;  1XHX A;  5KPT A;  3H3O B;  4CFC A;  4I6M A;  3DLK A;  1NGJ A;  3DRS A;  1SAZ A;  4RWT A;  1KTQ A;  2KFN A;  4PKH A;  1G99 A;  4OGE A;  4CCH A;  3K58 A;  3TSQ A;  3JYT A;  4FJL A;  3T7Z A;  1IBM K;  2O8C B;  3C95 A;  3VEX A;  5FPE A;  2P9U A;  3MK6 A;  4BC2 A;  4CIG A;  4I2P A;  1RBU A;  1S1X A;  4CEC A;  1TL3 A;  4RW9 A;  3N4Q A;  4K42 A;  3T19 A;  3VQD A;  5FPM A;  4E1M A;  3BF1 A;  4I2Q A;  3ZSQ A;  5SWM A;  4CEF A;  2NRZ A;  3OYB A;  2D0B A;  2OPS A;  3CI5 A;  1LWF A;  2HB5 A;  3MMV A;  3OYE A;  5DK5 A;  2CGK A;  3RR7 A;  1VQN N;  3QIP A;  5BN8 A;  3GOI A;  5J2N A;  1BHL A;  1RDA A;  3WXL A;  2RHK A;  1HYZ A;  3QIO A;  5HRS A;  4BR7 A;  3AO3 A;  4JS4 A;  3HTV A;  1TAQ A;  1GLB G;  4CEB A;  3E66 A;  3E01 A;  3QNN A;  4CHZ A;  4CK2 A;  3O3F A;  3T69 A;  3MED A;  3MX5 A;  4KV8 A;  3K57 A;  4DUY K;  4JKG A;  1J53 A;  5KQD A;  4JRQ A;  4G9Z A;  3ZET B;  5EY4 A;  1E3M A;  4FM1 A;  5M1P A;  3VET A;  1LAW A;  3CJC A;  4M7Y A;  4DU3 A;  1K8A O;  3C6T A;  1XHZ A;  4XH1 A;  3K2P A;  2UXB K;  2HF3 A;  3CM5 A;  3QLH A;  4JRP A;  5CYQ A;  4BRQ A;  1VAZ A;  3A5L C;  3V81 A;  5BN9 A;  1WAF A;  4CJU A;  1GLL O;  2CGL A;  3HBT A;  3SUQ A;  4DR2 K;  1RTH A;  2UU9 K;  2V52 B;  1YIT N;  4CJT A;  4BRN A;  4CJF A;  1JLC A;  3NFA A;  3THX B;  1RTJ A;  2EWS A;  3MN6 A;  4BR2 A;  3CCS N;  2VG6 A;  3SUP A;  1N5Y A;  4FWP A;  3FZF A;  1Q86 O;  5HOO A;  1HKC A;  2PAV A;  3IG1 A;  4Z0U A;  4KPY A;  1C0F A;  2ZJP L;  2XY5 A;  1T3V A;  4DUZ K;  4IOC L;  4NCG A;  1UWB A;  3VQ8 A;  4WFB L;  3LZI A;  2ATQ A;  3PSI A;  4K8X A;  2QWQ A;  3KIO A;  2ASM A;  3P31 A;  3J80 O;  3BZC A;  3ZT2 A;  4BDY A;  4KHW A;  3MCA B;  3OTO K;  4K8Z A;  4KH5 A;  2O4I A;  1OVQ A;  4E7H A;  3O9R A;  1BI4 A;  2E1Y A;  4HCB A;  4RW8 A;  4Y1C A;  2BDP A;  1TV6 A;  3UKU A;  3QEW A;  1KQS M;  2YHA A;  3MAQ A;  3F9M A;  3FGU A;  1HYS A;  4DV6 K;  4B1W B;  3WXJ A;  3CD6 N;  1NKC A;  4B1Y B;  4IKF A;  4LF5 K;  1XNR K;  4I6M B;  1UAX A;  3CQ8 A;  3KVG A;  4MQ3 A;  3DOL A;  2RE2 A;  4C8M A;  1HQU A;  1VQ6 N;  2P9U B;  4BRM A;  3HPH A;  1YI2 N;  1TAU A;  4X66 K;  4DFP A;  3ID8 A;  4CBU A;  4CJ4 A;  1I39 A;  4IBN A;  4OO1 J;  1QS4 A;  3C6U A;  1NWK A;  3CME N;  1C1B A;  4KHN A;  3OW2 M;  1X1P A;  4MDB A;  1HKB A;  4DV1 K;  4KO0 A;  5AQK A;  1QSY A;  2G8U A;  3M5R A;  5IT9 O;  3TAE A;  1D9D A;  2FSK A;  4JYA K;  4EHU A;  4KHS A;  3VQA A;  3VQ9 A;  1C0T A;  3NF6 A;  1T7P A;  2GUI A;  3AVI A;  4DWI A;  1VSM A;  4AHT A;  3ZT3 A;  3MXM A;  4DR1 K;  1WAJ A;  4LFC K;  4C23 A;  4JKG B;  3GG4 A;  1KAY A;  1A5W A;  4AHR A;  3E9P A;  1TUY A;  3CJ9 A;  3E9L A;  3SAF A;  4E1N A;  4DFK A;  1BCM A;  1ASV A;  2XY7 A;  5K14 A;  5AQP A;  1ATS A;  4PY5 A;  2VGM A;  4H5W A;  4CJ5 A;  4DQR A;  3KTQ A;  4BVP A;  3NGI A;  3VQQ A;  4E7I A;  3VTH A;  3KKS A;  2IVN A;  1REV A;  1YF5 L;  2X6N A;  3KZB A;  3WNH A;  4BVO A;  5ADX H;  4CIF A;  4XH4 A;  4ISF A;  3T1Y K;  1Z26 A;  4BWJ A;  4AHV A;  1T05 A;  1CZA N;  1C1C A;  3OYN A;  1N8R O;  1S9E A;  2QEX N;  4CIE A;  4KH6 A;  4CF9 A;  3V9Z A;  2LSN A;  1SKS A;  3RMD A;  3OYK A;  3EE9 A;  2PFU A;  2FC0 A;  4A2A A;  4DFJ A;  3LM2 A;  1Y64 A;  4BAC A;  3HVT A;  5KQ8 A;  2XY8 A;  3OHR A;  4B08 A;  3CC2 N;  1N33 K;  4JLH A;  1VQL N;  1OKJ A;  5HP1 A;  1U48 A;  2CH6 A;  4F8R A;  4CER A;  1FKP A;  1SQK A;  4IDH A;  4CJP A;  4CD1 A;  3J7A P;  3HPO A;  3WUH A;  2E2N A;  2Q36 A;  5E84 A;  5LMU K;  4BRH A;  3ITH A;  2F8S A;  4CI6 A;  1BI4 B;  1W0H A;  4E89 A;  2XY6 A;  3VGM A;  1JLA A;  3UKU B;  2Y1I A;  3O80 A;  4WQ4 A;  3AA4 A;  1MWM A;  5KI6 A;  4JI5 K;  4DU1 A;  4CF0 A;  4BC5 A;  2FBY A;  3WT0 A;  3O3G A;  4PQU A;  4U7B A;  3IS9 A;  1X9W A;  4O0J A;  2OTL N;  3AVG A;  4FJH A;  2IC3 A;  4OGC A;  5KPR A;  3FFK B;  3D6R A;  3DAW A;  4AIL C;  2ZGY A;  1VSE A;  5BRF A;  4E0D A;  1RBR A;  1NOY A;  2I7P A;  1QVG M;  3BZK A;  4RW6 A;  3R8E A;  2OZS A;  4MFB A;  3U3Y A;  3NH1 A;  1BDG A;  1TL1 A;  4B9T A;  2Z1H A;  3WEE A;  1RNH A;  2PYL A;  4BRF A;  1BO5 O;  1NKB A;  4B9Q A;  3ZEU A;  4W5R A;  3QB0 A;  4GY2 B;  4RW7 A;  3OY9 A;  4FLZ A;  3VQB A;  3DM2 A;  4DR3 K;  3B6O A;  1X9S A;  1NM1 A;  3MN7 A;  2D4W A;  3OS2 A;  1EQY A;  4ZTJ A;  4BC4 A;  1W7A A;  1RT7 A;  5EX5 A;  1BGX T;  4FLY A;  1L5U A;  3LP2 A;  1CXU A;  3NHG A;  2QKK A;  4CF8 A;  3PSF A;  4U67 L;  2GBZ A;  3ATV A;  4JI2 K;  4CHO A;  3AO1 A;  2X6S A;  3FZH A;  2XRI A;  3ZX2 A;  3HO1 A;  4FK0 A;  3EY1 A;  5AQS A;  4W5Q A;  3LAN A;  1E4G T;  3HXM A;  5AQX A;  1S3X A;  4FK4 A;  5GIO A;  3ID6 A;  4WQ4 C;  4CJQ A;  4CJL A;  5CZ2 A;  1RTD A;  3QEX A;  4JV5 K;  4FLW A;  3J81 O;  2D1K A;  2BAN A;  4H4O A;  5AJ3 K;  5J1E A;  3CYM A;  1KRP A;  4IXC A;  2YNI A;  4FJI A;  4J2E A;  1TKZ A;  4W5O A;  3ZSR A;  4BDP A;  2ETJ A;  3TAG A;  4LF8 K;  1XC3 A;  4IEI A;  2QW9 A;  3OYD A;  4DLG A;  1TYQ A;  4O55 A;  4HUG A;  1WB9 A;  4OLB A;  1QZ5 A;  2DTU A;  3I8B A;  2F8T A;  2E2P A;  1I94 K;  3DRR A;  3NVM A;  3UIQ A;  4Z94 A;  5DM6 L;  1NK8 A;  3CMA N;  1NGD A;  2O8B A;  2D5R A;  3ZSY A;  3SMP A;  1ZYQ A;  3VEO A;  1EXQ A;  2F96 A;  4ISE A;  1JCG A;  1FW6 A;  1NGC A;  4EAH D;  2FSN A;  2Q97 A;  1KAX A;  3V1O A;  4C1N I;  3CCJ N;  4M42 A;  4JKE A;  4CEQ A;  2A41 A;  1U45 A;  1JLG A;  2O8E A;  2WBN A;  3S41 A;  5AQN A;  2O4G A;  1R59 O;  1W97 L;  5JIC A;  1UA0 A;  1NJI O;  1YHQ N;  3WQT A;  1GOB A;  4DU4 A;  4Z4H A;  3VQ6 A;  2V51 B;  2P9P A;  4DSI A;  2G8I A;  1WBD A;  4LFB K;  1QVF M;  3K9K A;  1JCF A;  2GWJ A;  1M90 O;  1Q18 A;  1GLD G;  5KRT A;  3ZX0 A;  4OKJ A;  1OH6 A;  3FFI A;  4JKB A;  3U4L A;  4C8L A;  1B92 A;  3NAE A;  3K5N A;  1VSJ A;  3W3D A;  5BRE A;  4C8K A;  5JMV A;  3D45 A;  4JI1 K;  4B1X B;  3C65 A;  1IBL K;  1DEJ A;  4KRF A;  3OJU A;  5EOY A;  1WSG A;  5FDL A;  4FO0 A;  3L8B A;  3GBT A;  3ZSW A;  3WEE B;  4FW2 A;  4BE1 A;  4GV9 A;  1VQ5 N;  1BIZ A;  5AQJ A;  4BRE A;  4FL9 A;  2QI2 A;  4YY3 K; 
#chains in the Genus database with same CATH homology
 4DU3 A;  3CFO A;  1VSD A;  3C6T A;  4AH9 A;  1XHZ A;  3K2P A;  4WE1 A;  1RIL A;  2OYQ A;  1S9G A;  1QQC A;  3CM5 A;  3NE6 A;  4ID5 A;  3TR8 A;  3QLH A;  4JRP A;  5CYQ A;  3QEI A;  4CGG A;  4OPJ A;  3V81 A;  4CEA A;  4DTN A;  2B5J A;  3VQE A;  1BIU A;  1TVR A;  4BWM A;  3SJJ A;  1SL2 A;  1EP4 A;  3LAK A;  4ELV A;  1WAF A;  4O4G A;  1D8Y A;  2DFF A;  4CJU A;  3KLE A;  3RRH A;  3OS0 A;  3CFP A;  4KTQ A;  2RPI A;  1XI1 A;  3SUQ A;  3NBP A;  1RTH A;  1BQM A;  3RWU A;  3SQ2 A;  2DY4 A;  1KSP A;  2RF2 A;  3JSM A;  1LWE A;  4CJT A;  3NDK A;  1HNV A;  2VWK A;  3KK1 A;  1C1A A;  5JS1 A;  4CJF A;  1JLC A;  3NFA A;  4I7F A;  1WLJ A;  1R0A A;  1IKW A;  4FM0 A;  4IDK A;  4BE0 A;  1RTJ A;  4CHN A;  2VWJ A;  1NJW A;  1WSI A;  1SKW A;  2VG6 A;  3SUP A;  1SL0 A;  3KLH A;  1NK6 A;  3M8S A;  1N5Y A;  1HPZ A;  1VRU A;  1NK5 A;  4IG3 A;  3VA3 A;  4DSE A;  4CHQ A;  4GW6 A;  3HK2 A;  2E4L A;  2OPQ A;  3RMA A;  3ALY A;  3SV4 A;  2A1R A;  3IG1 A;  4Z0U A;  4FM2 A;  4KPY A;  1FKO A;  5CY4 A;  4CES A;  1LW0 A;  4CJS A;  3SYZ A;  4NCB A;  2XY5 A;  4DTU A;  1HYV A;  3TAR A;  2HVI A;  2E6M A;  2QXF A;  2KFZ A;  4NCG A;  5EU7 A;  1UWB A;  3O3H A;  4N41 A;  2HVH A;  2XHB A;  4GVM A;  3VQ8 A;  1K6Y A;  3QIN A;  3LZJ A;  3P83 D;  4DF4 A;  2G8F A;  1RT1 A;  4DS4 A;  3DYA A;  3LZI A;  3SNN A;  1QSS A;  2ATQ A;  4FVM A;  3T1A A;  4K8X A;  1RT3 A;  1ZBH A;  3I0R A;  1B9D A;  2A1S A;  3KIO A;  4DFM A;  3KD5 E;  3F73 A;  2Q3S A;  3L3V A;  4M45 A;  3HVR A;  2G8W A;  3ZT2 A;  3SPY A;  3IRX A;  2HHT A;  3WNF A;  4BDY A;  1Q9Y A;  1BQN A;  5T7B A;  4KHW A;  4O44 A;  1KCF A;  2ZD1 A;  3OYF A;  2XO7 A;  4CJR A;  4K8Z A;  1T03 A;  4DQI A;  2O4I A;  1QE1 A;  4JS5 A;  3S3N A;  2Z1G A;  4LD0 A;  1BI4 A;  4E7H A;  4HCB A;  1S1W A;  2D0C A;  4RW8 A;  4Y1C A;  5FRO A;  1S1U A;  3I8D A;  1TV6 A;  5J2P A;  1TKD A;  3QEW A;  2BDP A;  4NYN A;  4B8C A;  2YHA A;  2HNZ A;  2Y1J A;  3I0S A;  4CK3 A;  2YKM A;  4M3R A;  3PX0 A;  5HRO A;  3M8Q A;  3MAQ A;  1S6P A;  3NH2 A;  4W5T A;  3S9H A;  4RG8 A;  1NK7 A;  1HYS A;  1B9F A;  1TK0 A;  2HW3 A;  1YTA A;  2HHV A;  1CXQ A;  3ISN C;  3NF7 A;  2X78 A;  4FJG A;  1NKC A;  4F2S A;  4DG1 A;  2OZM A;  4IKF A;  4DTR A;  5HLF A;  1HMV A;  1RDB A;  1UAX A;  3CQ8 A;  1CZ9 A;  1Y97 A;  1CZB A;  3OYL A;  4O0I A;  2IOC A;  3G0Z A;  4LSN A;  4MQ3 A;  4HUF A;  1VK0 A;  3DOL A;  3AVC A;  1IH7 A;  4C8M A;  3NF8 A;  4CJK A;  1WSJ A;  1HQU A;  3LPU A;  4HCC A;  3AVB A;  1HJR A;  3HPH A;  1NK9 A;  3PX4 A;  3OYC A;  4IFY A;  3AO5 A;  2P1J A;  1ZBI A;  1TAU A;  3HJF A;  4DFP A;  2KQ2 A;  4EZ6 A;  4CJ4 A;  4IG0 A;  3LWL A;  1I39 A;  4IBN A;  1QS4 A;  1L3U A;  1VRT A;  3C6U A;  1RT2 A;  1A5V A;  1C1B A;  4KHN A;  1X1P A;  2E6L A;  2YV0 X;  2P51 A;  3SZ2 A;  4KO0 A;  4C8O A;  4CED A;  1QSY A;  2G8U A;  3BDP A;  2HNY A;  4ICL A;  1EX4 A;  3QEV A;  1MU2 A;  3QEP A;  1TK5 A;  3TAE A;  1D9D A;  2Z1I A;  3DOK A;  3MEE A;  4Q0B A;  3HL8 A;  4OKE A;  5HRR A;  4FZZ A;  4G1Q A;  3TAP A;  3L2V A;  3S3O A;  4KHS A;  4DSF A;  4PUO A;  3VQA A;  3VQ9 A;  1C0T A;  3KK3 A;  5KGW A;  1KLN A;  3KKR A;  2HND A;  3NF6 A;  4LSL A;  1T7P A;  2GUI A;  4ELT A;  2BGG A;  3AVI A;  4DWI A;  4I9Q A;  1VSM A;  3VA0 A;  4BE2 A;  4HUE A;  2EHG A;  3P1G A;  4AHT A;  3HST B;  2KZM A;  5HBM A;  1JLE A;  3PX6 A;  4GMJ B;  3ZT3 A;  3KJV A;  4XIU A;  3TAF A;  3HPG A;  2YNH A;  5I42 A;  3MXM A;  4B9L A;  1WAJ A;  2ZE2 A;  2QKB A;  3L2Q A;  2HHW A;  3TWH A;  4DQQ A;  4DS5 A;  4KAZ A;  4FYD A;  1A5W A;  4AHR A;  2FBT A;  4FJM A;  4Z4F A;  1ASW A;  4E1N A;  2R7Y A;  1WNS A;  4DFK A;  4QOZ B;  1BCM A;  3NCI A;  2YNF A;  4N47 A;  1KLM A;  4FLX A;  1S1V A;  1SL1 A;  1ASV A;  4FW1 A;  3HT3 A;  1KVB A;  1KVA A;  2QK9 A;  3SQ1 A;  4PWD A;  5E41 A;  3OYM A;  2XY7 A;  5K14 A;  4CFB A;  1UA1 A;  1JKH A;  3SQ0 A;  1S6Q A;  5FRM A;  4PY5 A;  3KD1 E;  3TI0 A;  1SUQ A;  4CJ5 A;  4DQR A;  3KTQ A;  3OYA A;  2OPP A;  3SQ4 A;  1L3V A;  2D0A A;  4DLE A;  3KLI A;  3NGI A;  3VQQ A;  3NGZ A;  4E7I A;  4M3T A;  1YTU A;  4CFA A;  3ASM A;  2WON A;  1RDC A;  3KKS A;  1REV A;  2X6N A;  1RT4 A;  3WNH A;  4E19 A;  4CIF A;  3NH0 A;  4CEO A;  3ZSZ A;  3LWM A;  4CK1 A;  1LAV A;  1Z26 A;  4BWJ A;  4AHV A;  2X74 A;  3B6P A;  4LY7 A;  4HVJ A;  1T05 A;  3V1Q A;  3OYN A;  1C1C A;  5CZ1 A;  3LP0 A;  4Y1D A;  4B8A B;  3L2U A;  1S9E A;  4OVL A;  1RTI A;  1NK0 A;  2HMI A;  4CIE A;  4CF2 A;  4KI4 A;  4CF9 A;  3V9Z A;  4CFD A;  4KFB A;  4OJR A;  3AVJ A;  4QAG A;  2LSN A;  3HYF A;  2KTQ A;  1JLB A;  3ZT0 A;  1SKS A;  4FJK A;  3DLG A;  3RMD A;  3OYK A;  1FXX A;  4LH5 A;  2FC0 A;  4EP4 A;  4H8K A;  1G15 A;  4FLV A;  4DFJ A;  4B9N A;  5HRN A;  3QO9 A;  3TAM A;  3LDS A;  1ASU A;  1JL1 A;  3WNE A;  1NOZ A;  3HVT A;  1TGO A;  4BAC A;  3V9W A;  1TK8 A;  1WSF A;  2XY8 A;  4N56 A;  1NJY A;  1RBV A;  4B08 A;  3DMJ A;  4JLH A;  3NF9 A;  5J2M A;  2G8V A;  1Q8I A;  5C24 A;  5HP1 A;  1U48 A;  4F8R A;  3LPT A;  4CER A;  2G8K A;  2PYJ A;  1FKP A;  3EYZ A;  3SUN A;  4KRE A;  3O4Q A;  2DFE A;  4CJP A;  3SI6 A;  1L3S A;  3DLH A;  3HPO A;  3SV3 A;  3K5O A;  3EZ5 A;  1J54 A;  3PO5 A;  4FJN A;  3ITH A;  1A5X A;  3PUF A;  2F8S A;  1U4B A;  1BI4 B;  1W0H A;  3AO2 A;  4E89 A;  1VSK A;  2XY6 A;  1JLA A;  3DLR A;  2Y1I A;  3VQ7 A;  4YNQ A;  3AA4 A;  1F21 A;  3DI6 A;  3QER A;  3LAM A;  1FK9 A;  3PO4 A;  4DQS A;  3V9X A;  1NKE A;  5KI6 A;  5D3G A;  4DU1 A;  1TKT A;  4CF0 A;  1KVC A;  3M8P A;  2FBY A;  4EP5 A;  3SUO A;  4J2D A;  3O3G A;  1XWL A;  1Q9X A;  4PQU A;  5FRN A;  3IS9 A;  2KZZ A;  2KW4 A;  2Z1J A;  1EET A;  3BGR A;  4Q5V A;  1X9W A;  4O0J A;  2IDO A;  3AVH A;  1GOA A;  3VQC A;  5JS2 A;  3AVG A;  4FJH A;  2IC3 A;  4OGC A;  4KHY A;  1CLQ A;  3RTV A;  2G8H A;  2P5O A;  1NJZ A;  4FK2 A;  1XC9 A;  4DF8 A;  4F4K A;  4AIL C;  4H4M A;  3MEG A;  1IKY A;  4AHC A;  2VG7 A;  5KRS A;  3AVM A;  4IFV A;  1VSE A;  2B4J A;  3RMB A;  3TAQ A;  1EKE A;  4RW4 A;  4NYF A;  4E0D A;  4FJ7 A;  3V6D A;  1LWC A;  1O1W A;  1RBR A;  1W9H A;  1NOY A;  3VQ5 A;  2PZS A;  5C42 A;  3ZSV A;  1RDD A;  3DLB A;  3CG7 A;  4F3T A;  4FJJ A;  4RW6 A;  2OZS A;  4L8R B;  3LP3 A;  1KFS A;  4MFB A;  4B9S A;  3NGY A;  3U3Y A;  1ZBL A;  2ZQB A;  4M41 A;  3NH1 A;  3V9S A;  1DLO A;  1TL1 A;  4B9T A;  4N5S A;  2Z1H A;  3RR8 A;  4FJX A;  3HP6 A;  1RNH A;  4DQP A;  4KHU A;  3O4N A;  2PYL A;  3L2R A;  1NKB A;  3H08 A;  4DTS A;  4KKO A;  3AV9 A;  1WSH A;  3OVN A;  4W5R A;  4FLU A;  3ZSO A;  2AJQ A;  1D9F A;  4FZY A;  3VQP A;  4RW7 A;  3OY9 A;  4CHP A;  4FJ5 A;  1TKX A;  4FLZ A;  2FBX A;  4NCA A;  3VQB A;  1BL3 A;  3DM2 A;  2NUB A;  1S5J A;  3KLF A;  1U04 A;  3VN5 A;  3SCX A;  4FXD A;  1NK4 A;  3ULD A;  3B6O A;  2P5G A;  1X9S A;  4KHQ A;  1VSI A;  1JXB A;  3OS1 A;  3PV8 A;  3RMC A;  3DRP A;  3OS2 A;  1UOC A;  1Z25 A;  1VSH A;  4LH4 A;  4ZTJ A;  1RT7 A;  4CJ3 A;  1BGX T;  3OJS A;  4FLY A;  4J2A A;  1L5U A;  3LP2 A;  1CXU A;  1IO2 A;  1BCO A;  3AA5 X;  3NHG A;  2QKK A;  4CF8 A;  1RT6 A;  2GBZ A;  2PY5 A;  3TAN A;  4CJW A;  3CFR A;  4E7K A;  4CHO A;  1IKV A;  3C94 A;  2YKN A;  3AO1 A;  4CGI A;  2X6S A;  4OKK A;  2JGU A;  2XRI A;  3ZSX A;  4CJE A;  3HO1 A;  1JL2 A;  1YT3 A;  4CEZ A;  1HQE A;  4PA1 A;  5KGX A;  4Z4I A;  4Z4E A;  4FK0 A;  4BDZ A;  3EY1 A;  4YFU A;  3RRG A;  3DLE A;  3K5M A;  2YHB A;  4W5Q A;  3LAN A;  4CEE A;  2EX3 A;  3HXM A;  1C6V A;  2YNG A;  4ZTF A;  1ZBU A;  4DTX A;  2IAJ A;  4KB1 A;  4FK4 A;  4CE9 A;  3U3G A;  5KTQ A;  4N76 A;  3HM9 A;  3S3M A;  4FJ9 A;  1YVU A;  3V4I A;  3F9K A;  5DMR A;  1LV5 A;  2RN2 A;  2VG5 A;  1L3T A;  4Z4G A;  4CJQ A;  4CJL A;  5CZ2 A;  2RKI A;  1RTD A;  3LAL A;  3QEX A;  3T3F A;  3AVA A;  4Z4C A;  1SV5 A;  4FZX C;  4FLW A;  2I5J A;  3D0P A;  3SPZ A;  4KTW A;  2W42 A;  2BAN A;  4H4O A;  3TAB A;  3PY8 A;  1J9A A;  5J1E A;  3MXI A;  3CYM A;  1WSE A;  2ITG A;  2JLE A;  4DTP A;  1U47 A;  4DSL A;  2HHQ A;  3VQ4 A;  4CGJ A;  4E7L A;  5I3U A;  4TSX A;  3U6F A;  1SKR A;  1KRP A;  2HHX A;  2YNI A;  3AVL A;  3OYH A;  3K5L A;  4FJI A;  4J2E A;  1TKZ A;  3AO4 A;  3K59 A;  1WN7 A;  3ZSR A;  3ZT1 A;  2ETJ A;  3ZT4 A;  4W5O A;  3QNO A;  4BDP A;  3TAG A;  1ZBF A;  1QHT A;  4KB0 A;  1T8E A;  1C0M A;  3OYD A;  3M8R A;  4DLG A;  1J5O A;  3CM6 A;  3IAY A;  4O55 A;  4HUG A;  3MXJ A;  4B9V A;  4OLB A;  1ITG A;  4AHU A;  3P5J A;  4FJ8 A;  1HNI A;  4J2B A;  3AVK A;  4AHS A;  4M3W A;  3KLG A;  4M3X A;  2F8T A;  4OLA A;  2DTU A;  4B9U A;  4B9M A;  4O5B A;  4CGD A;  3DRR A;  4KI6 A;  1HRH A;  5SZT A;  4HHT A;  5J2Q A;  3UIQ A;  4KTZ A;  3QET A;  1NK8 A;  1XHX A;  1S1T A;  2DFH A;  4DMN A;  1D5A A;  4CFC A;  5C25 A;  2FBV A;  4E7J A;  1QTM A;  1U49 A;  1RBT A;  2D5R A;  3DLK A;  3DRS A;  3ZSY A;  3V9U A;  1KTQ A;  3THV A;  2KFN A;  1ZYQ A;  4OGE A;  4CCH A;  1EXQ A;  2F96 A;  3K58 A;  4DSJ A;  4FLT A;  3JYT A;  4FJL A;  4HTU A;  4ELU A;  2IS3 A;  3A2F A;  3C95 A;  3OYG A;  4F3O A;  4QCL A;  2HHU A;  3V1O A;  1RCH A;  4M42 A;  4CIG A;  1IG9 A;  4I2P A;  4CEQ A;  1RBU A;  1U45 A;  1S1X A;  4CEC A;  4DTM A;  1JLG A;  1TL3 A;  4RW9 A;  1JLF A;  3MEC A;  3T19 A;  5CYM A;  2O4G A;  4OPK A;  2BE2 A;  3ZCM A;  4DSK A;  3V1R A;  3VQD A;  1UA0 A;  1QSL A;  4E1M A;  1GOB A;  3HP9 A;  3AA3 A;  3WNG A;  4DU4 A;  4I2Q A;  3VQ6 A;  3ZSQ A;  4Z4H A;  5SWM A;  1X9M A;  1DTQ A;  4M3Y A;  3G10 A;  4CJV A;  4CEF A;  3OYJ A;  3AVN A;  3OYB A;  1GOC A;  2D0B A;  2OPS A;  1LWF A;  2HB5 A;  4R5P A;  4DSI A;  2GV9 A;  3OYE A;  4F2R A;  2G8I A;  5DK5 A;  2OA8 A;  4I9L A;  3RR7 A;  1BIS A;  4B3O A;  3QIP A;  4M3Z A;  3AA2 A;  5J2N A;  3AVF A;  1LW2 A;  1VSF A;  1BHL A;  1VSL A;  2WOM A;  5KRT A;  3QES A;  1RDA A;  1RT5 A;  4OKJ A;  4M3U A;  3FFI A;  3L3U A;  3L2W A;  1JXE A;  4C8L A;  4CF1 A;  3KK2 A;  1B92 A;  3NAE A;  3K5N A;  4CGH A;  1VSJ A;  1HYZ A;  3QIO A;  1C0U A;  4UQG A;  4C8K A;  5HRS A;  4E3S A;  4DTJ A;  3AO3 A;  4JS4 A;  3D45 A;  1TAQ A;  4CEB A;  1IKX A;  4DTO A;  3E01 A;  3OYI A;  4EZ9 A;  3OJU A;  3LP1 A;  4CHZ A;  4CK2 A;  4ZHR A;  3O3F A;  3QNN A;  4KRF A;  1WSG A;  3MED A;  5FDL A;  1JLQ A;  1DTT A;  1N6Q A;  4KV8 A;  3K57 A;  2OPR A;  4ID1 A;  1KFD A;  4C8N A;  3L8B A;  3ZSW A;  1J53 A;  2B6A A;  4FW2 A;  5HRP A;  4JRQ A;  4BE1 A;  4FCY A;  1NJX A;  2HHS A;  1I3A A;  4FM1 A;  1RBS A;  1BIZ A;  4CGF A;  1LAW A;  4CHY A;  2IGI A;  4W5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...