3NH0A

Crystal structure of rnase t in complex with a non-preferred ssdna (aac)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 64
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh0A00
1WSIA 2Z1GA 3FFIA 1VSMA 3QEXA 3TWHA 3OYEA 4QOZB 4E0DA 1RNHA 4DQQA 3SQ0A 2G8WA 4FJKA 3HVTA 3CFOA 1HPZA 4J2AA 4QCLA 1F21A 1VRUA 2R7YA 4ELUA 3C6TA 4I9LA 4C8NA 5D3GA 1RTHA 4FW1A 4OKJA 3NF7A 1UWBA 5HBMA 1BHLA 3ZT1A 1LV5A 2KW4A 1C6VA 3OYDA 2JLEA 3LP1A 4NCBA 3SZ2A 4LSLA 2I5JA 3IG1A 4FYDA 3RMCA 3AO1A 2HMIA 2X78A 4FK2A 1HYSA 3OYCA 4CJSA 5FDLA 3OJUA 4FLTA 1U4BA 4FJMA 4CF9A 3D0PA 2OA8A 4ELVA 1HYZA 1S9EA 1VRTA 4ID5A 2HVIA 2A1RA 2Z1IA 3VQ6A 1X9SA 4H8KA 3VQ4A 3RRHA 2PYLA 3SQ1A 4ZTJA 1J54A 2DFFA 4EZ6A 2E4LA 3SYZA 2DTUA 1TAQA 3IS9A 4O5BA 4CJUA 1S6QA 1KSPA 3HXMA 1SKRA 4IDKA 1ASUA 1TV6A 4CGDA 3HJFA 4J2BA 1Z26A 4FJLA 4ZTFA 1SV5A 3B6PA 3OS0A 4DU3A 4JS5A 1BIUA 1RTDA 3AA5X 4DMNA 1N6QA 2WONA 1TKXA 3I8DA 3EYZA 4E7KA 4XIUA 3RWUA 4M3YA 4KB1A 3L2RA 3LWMA 4DF4A 2KFZA 3U3YA 5I3UA 2QXFA 4DTUA 3NCIA 1X1PA 2NUBA 1D8YA 3M8RA 4C8KA 1D9FA 4B9UA 1WNSA 1XC9A 1RDCA 5C25A 2FBXA 3OYMA 1Q9XA 4Z4GA 3RR7A 4FLVA 3TAGA 1SUQA 4EP4A 1KVAA 5CYQA 3VN5A 3ZSVA 4FLWA 1SL1A 3DRRA 4DQIA 2DFEA 4KREA 2JGUA 4KV8A 2QKKA 4E1NA 3L2WA 1QQCA 2HHQA 1TVRA 5KI6A 1RT4A 4CJPA 4ID1A 3OY9A 4E7LA 4CJFA 3TI0A 4KHSA 1C0UA 2ITGA 4FM2A 3NGYA 4CJQA 1VK0A 2F96A 4IFYA 2DFHA 4AHSA 4PA1A 4OLBA 5JS1A 4CE9A 1T7PA 4M3XA 4DG1A 3SUOA 4F3TA 4CEAA 2KZZA 4DFJA 1YT3A 1ITGA 5KRSA 3OS2A 4KTZA 1CXQA 2AJQA 2O4GA 1HNIA 5HRNA 2BE2A 1WAFA 4FM0A 4H4OA 4CGGA 4NCAA 3DM2A 4OPJA 4Q0BA 1EP4A 2YHBA 1D5AA 3KKRA 2QKBA 1RILA 4DLGA 5DK5A 1B92A 1EX4A 3ZT3A 1HMVA 1RT6A 4NCGA 4CIEA 4O0JA 3QEPA 2YV0X 4O4GA 3LP3A 4NYFA 2HVHA 1FKOA 3KK1A 4B9LA 4PUOA 3NF9A 4CHZA 5HRPA 3QESA 1IKVA 4LD0A 3EZ5A 2RF2A 3SCXA 1X9MA 3TAPA 1NKBA 1A5VA 3S3MA 1U49A 3ZSRA 4DFKA 1WSFA 4RG8A 4CERA 1J53A 1QHTA 4KHUA 4CGJA 1ZBHA 3UIQA 2IOCA 2OYQA 5KTQA 3P5JA 1Q8IA 1RTIA 3DLRA 4OGCA 3V9ZA 3I0RA 4CEBA 4HUGA 2VWKA 4C8LA 3OYIA 3L2VA 1NK7A 3ZSZA 4FJIA 2B5JA 4B9VA 3QINA 4PQUA 1CXUA 2GUIA 1REVA 1BQNA 3V1OA 1RTJA 3T1AA 4FLUA 3G0ZA 3L2UA 3RRGA 4M3RA 4BDZA 1VSHA 2XO7A 1IKXA 4M3UA 1C1BA 4B9MA 2ZE2A 3OYGA 4F4KA 5EU7A 4KPYA 3MEDA 1RBSA 5HROA 4PY5A 4Z4HA 1KRPA 1LAWA 1IKWA 4RW7A 2G8FA 4CJ5A 3V9UA 1FK9A 1U45A 1YTAA 3AO5A 3T3FA 2G8HA 2EHGA 4J2EA 3K58A 3OYBA 5HLFA 4W5RA 4CEEA 4CK1A 1VSEA 3ZT0A 3AA4A 3KD5E 3DRPA 3HPGA 1UA1A 3ZSQA 5KGXA 4OLAA 3NH1A 3LALA 4DLEA 4B8CA 1ZBFA 4ZHRA 4DS4A 4O0IA 1U04A 3KD1E 1NJWA 1O1WA 2YNIA 4FW2A 4I2QA 5KRTA 5DMRA 3L3VA 3LANA 1NOYA 1A5XA 3CM5A 3V1RA 4E19A 1ZBLA 3HP6A 1TL3A 3LP0A 3KLEA 3RMBA 1XWLA 3WNHA 4CF1A 4KI4A 1HQUA 4UQGA 1KTQA 1BIZA 3QETA 4ICLA 1UAXA 3TABA 4MQ3A 2ETJA 1QE1A 3V6DA 1NK5A 1BI4A 2YNHA 2G8IA 1U48A 1N5YA 2D0BA 4FZXC 1BCOA 4FZYA 3V1QA 1TKZA 3ISNC 4WE1A 3QO9A 2FC0A 4FJXA 1IKYA 3WNEA 4FXDA 1HJRA 3AVHA 3SPYA 1NJYA 4EZ9A 1JLAA 3P1GA 4GVMA 3KLIA 4N41A 3K2PA 1NKCA 2KFNA 4IBNA 4CEDA 3U6FA 1J5OA 4N5SA 3AO3A 1WSEA 3QEWA 4CHOA 3RMDA 3SJJA 1T8EA 2XY8A 3ZCMA 3ZSXA 3ZSOA 3MECA 3KK3A 4FM1A 3QEVA 1L3VA 4B9TA 1FXXA 2ZD1A 4DTSA 1NK9A 1WSHA 4CEFA 3PV8A 2WOMA 1NK6A 4GMJB 4FJ5A 4M3WA 2DY4A 1JLGA 3SI6A 4CJ4A 2A1SA 1T05A 2VG6A 4CF2A 4E7JA 4FJHA 4FZZA 3TANA 1BI4B 3DMJA 1I39A 4I2PA 4LH5A 4HVJA 4M3ZA 2VG5A 3LWLA 1C1CA 1JLCA 2OPSA 4MFBA 4TSXA 4AH9A 4RW6A 4KTWA 3AA3A 4EP5A 4HUEA 3VQ5A 2IS3A 3TAQA 2XY5A 4Q5VA 4FJNA 3K59A 3L8BA 3JYTA 4C8OA 1BCMA 2OPRA 1RT2A 3OS1A 3MAQA 3HK2A 4E7IA 4DSEA 3ZT2A 2YNFA 4C8MA 4CESA 4W5OA 3DRSA 1DLOA 2X74A 4I7FA 4W5QA 1WLJA 2BANA 4HCBA 2HHTA 1W9HA 3OYNA 2GBZA 3V9SA 4IKFA 2Y1IA 2HHWA 2X6SA 2IDOA 3KK2A 4CJ3A 4DSFA 3IRXA 1CLQA 3LAMA 3VQ8A 4B3OA 3LZIA 5KGWA 1LW2A 3S9HA 1I3AA 3VQCA 3VQ9A 5FRMA 3NBPA 3ITHA 1WAJA 4AHUA 4KRFA 3HVRA 3AVBA 3HM9A 3TAEA 3NH0A 2YHAA 1JLEA 1IO2A 4BDPA 4H4MA 4DWIA 1TAUA 3I0SA 4CHQA 4QAGA 1DTTA 5FRNA 4FJ7A 4DTRA 3ASMA 3MXIA 1W0HA 3K5OA 4CGIA 3V81A 3V9XA 3AVAA 3OYJA 1C1AA 1KLMA 3AVKA 1J9AA 3HT3A 4Z4EA 2FBTA 3DLBA 4RW8A 3KIOA 1RDDA 1Q9YA 1JLFA 1KFDA 1S9GA 4AILC 4GW6A 3TARA 2FBVA 1L3TA 3VQPA 3WNGA 1BL3A 3AVJA 4KHWA 2RN2A 3PUFA 1NK8A 3BGRA 2OZSA 1L3UA 3E01A 1JLQA 2B6AA 3LPTA 3CQ8A 3C94A 1RT3A 5K14A 1TK5A 1B9FA 3B6OA 3LP2A 4CF8A 3KLHA 1HQEA 3HPOA 1TKDA 1R0AA 2W42A 5T7BA 2E6LA 4YFUA 3MXMA 1LAVA 2HNYA 3RR8A 1YTUA 4M45A 3HSTB 1TK8A 2YKMA 2P5OA 3KJVA 1T03A 3EY1A 2HHSA 1GOAA 4CEOA 4CK2A 3G10A 4DTPA 4I9QA 4HCCA 4KB0A 3SUNA 4KHYA 3M8SA 3SPZA 3DLEA 3OYLA 1JXBA 3MXJA 3AVMA 3NH2A 2IAJA 3M8PA 1BGXT 2D0CA 2Y1JA 3OYFA 3P83D 3OVNA 4CJVA 4KAZA 4CHYA 3CFRA 3RMAA 1KVCA 4DFPA 2IC3A 3O3HA 4F2SA 3QIOA 1JL1A 4L8RB 3PO5A 1C0TA 1RBUA 4OPKA 2EX3A 4N47A 1GOCA 3DOKA 4BWMA 1QS4A 4BDYA 3LZJA 4LY7A 2HB5A 4CFAA 3AVNA 3VA0A 2HHUA 4DSKA 2OPQA 4JRPA 1JKHA 1TL1A 4JLHA 1WN7A 4N56A 1KFSA 4FJJA 4FJ9A 1VSDA 3AVIA 4Y1DA 4RW9A 1RDAA 3QNNA 4B9SA 1GOBA 1JXEA 5SZTA 1HYVA 4CJEA 1UOCA 3AA2A 2YKNA 1S1VA 1SL2A 4KHNA 1RDBA 3CYMA 5CYMA 4CFCA 2XY6A 1LWCA 4W5TA 3QLHA 4FLZA 2XRIA 3AVGA 4Z4CA 2P5GA 4CFBA 4F3OA 2P51A 1VSJA 1ZBUA 2FBYA 4DTMA 4AHRA 3ALYA 4NYNA 2VWJA 3SUPA 4DSLA 2HNZA 4B8AB 1QSYA 4BACA 1TKTA 3HYFA 3MEGA 4FCYA 1QTMA 1S1XA 2BGGA 1UA0A 4DQPA 4CGHA 4J2DA 5CY4A 3F9KA 3VQDA 3M8QA 1VSKA 2P1JA 1KVBA 4OJRA 1NK0A 5J2PA 3K57A 1FKPA 3LDSA 3JSMA 3IAYA 3NGIA 2B4JA 3DLKA 4OVLA 3DOLA 2RPIA 3S3NA 4AHVA 1RBVA 3K5MA 1EETA 4KTQA 4DQSA 2PY5A 3SUQA 4KI6A 4OKKA 1L5UA 3KKSA 1SKWA 4CECA 4ELTA 4FVMA 4F8RA 4BE1A 4FLXA 4G1QA 4FK0A 3AVLA 4IG3A 4DU1A 1TGOA 3TAFA 2G8VA 2GV9A 4OKEA 4CCHA 2ATQA 1S5JA 1Z25A 3PX6A 4E89A 4W5NA 3MEEA 3CFPA 4JS4A 1CZ9A 1WSJA 2KZMA 3PY8A 4IFVA 3NE6A 4DF8A 4CK3A 3NGZA 3NHGA 1NJXA 4M41A 3SV4A 3VQBA 3VQEA 5J2NA 1X9WA 1JL2A 1RBRA 4K8ZA 4O44A 3AVCA 2RKIA 1ASVA 1EKEA 1D9DA 4BWJA 1XI1A 4OGEA 1ZBIA 1IG9A 3C95A 2E6MA 1RT7A 2YNGA 3O3FA 3CG7A 4R5PA 3CM6A 1BQMA 3HPHA 3NF6A 3V4IA 3NAEA 1JLBA 5CZ1A 3OJSA 4AHTA 1KCFA 3O4QA 4CIFA 3F73A 5SWMA 1S1WA 1MU2A 3L3UA 3AV9A 4M3TA 4CFDA 3KLGA 2F8SA 3VQAA 2XY7A 3ZT4A 4LH4A 1C0MA 2HNDA 3NFAA 3QIPA 4CJTA 4YNQA 3KTQA 1BISA 3O3GA 1S1UA 3DLGA 1RT1A 2OPPA 3D45A 5HRRA 3SQ4A 1HRHA 3VA3A 4DFMA 3PX0A 4BE0A 4E3SA 3LPUA 3AVFA 3T19A 3OYKA 3A2FA 4DS5A 5E41A 1KLNA 4N76A 4O55A 3RTVA 3L2QA 4IG0A 2Z1JA 3HL8A 5HP1A 2PYJA 4CIGA 5J2MA 4KO0A 4CGFA 1B9DA 1XHXA 4CJWA 4DSIA 4FK4A 4B9NA 4Z0UA 1RT5A 4CEZA 1QSSA 1G15A 1SKSA 1S1TA 4E1MA 4FLYA 3QERA 1ASWA 3HO1A 5CZ2A 2KQ2A 4DTXA 4KFBA 1L3SA 2OZMA 2HHVA 1RCHA 3QEIA 5I42A 4DTJA 1LW0A 1Y97A 3ZSWA 3OYHA 2HHXA 4CJRA 3THVA 3SV3A 2G8KA 3V9WA 3DI6A 4KKOA 4PWDA 4KHQA 4FJ8A 2X6NA 3PO4A 4CJKA 1LWFA 4DU4A 3PX4A 1IH7A 4HUFA 3VQQA 4CHNA 3SQ2A 3K5LA 4HHTA 4HTUA 4DTOA 3HP9A 3U3GA 1YVUA 1VSIA 4FJGA 1HNVA 1S6PA 4CJLA 1NJZA 1XHZA 1A5WA 3H08A 1ZYQA 1WSGA 4F2RA 4DTNA 4K8XA 4B08A 2BDPA 3WNFA 2PZSA 2Z1HA 2O4IA 4CF0A 1VSFA 1K6YA 3ZSYA 2D5RA 4Y1CA 3AO4A 2ZQBA 1RBTA 2HW3A 3LAKA 3OYAA 3TAMA 2VG7A 4JRQA 5FROA 5JS2A 1DTQA 4E7HA 3K5NA 3ULDA 4DSJA 3KLFA 2KTQA 1VSLA 2IGIA 4LSNA 3NF8A 3DLHA 4M42A 1CZBA 2G8UA 2XHBA 4Z4IA 2F8TA 2D0AA 3O4NA 3C6UA 3BDPA 5C24A 2Q3SA 5J2QA 3SNNA 1NKEA 3AO2A 3S3OA 1U47A 1SL0A 1TK0A 1QSLA 2QK9A 1LWEA 3TR8A 3NDKA 1NK4A 4RW4A 4AHCA 5HRSA 4Z4FA 3DYAA 1EXQA 2LSNA 3VQ7A 4CHPA 3QNOA 4DQRA 4CEQA 5C42A 5J1EA 1NOZA 4BE2A
chains in the Genus database with same CATH superfamily
3FFIA 3QEXA 3L0QA 3OYEA 5GIOA 4FJKA 4DQQA 3CFOA 1GLFO 3EZWA 4ELUA 3EN9A 1RTHA 4CZJA 4JNEA 1BHLA 3OYDA 1C6VA 2Q31A 3ZETA 3OW2M 3H3NO 3RMCA 5EXWA 2HMIA 1U4BA 4ELVA 3RRHA 2PYLA 3VEOA 3SQ1A 2DFFA 1JCGA 1T3VA 2W40A 1S3XA 1ASUA 1TV6A 4CGDA 2O8DB 3CJAA 4JS5A 3R8EA 5HL7L 3AA5X 3CCQN 2WONA 3I8DA 2HSTA 3L2RA 3LWMA 2KFZA 5I3UA 4O8KA 1IBLK 4O8UA 4Z4GA 3R6MA 2ASOA 5C25A 1XC9A 1WBDA 3RR7A 4FPBA 5CYQA 3ZSVA 2A42A 4FLWA 2DFEA 3DXKA 3L2WA 1VQMN 1RT4A 4ID1A 3OY9A 3QFPA 4KHSA 5GINA 1VK0A 3TSUA 4CZFA 5AQOA 4DG1A 1YJ9N 2KZZA 3CJBA 1YT3A 1ITGA 2GTDA 3OA9A 2BE2A 4Q0BA 4H4OA 4CGGA 4JHDA 2E2PA 4DLGA 5DK5A 4IEEA 3WXMB 3ZT3A 1RT6A 4CIEA 1XUPO 4O4GA 2IIRA 4A62A 3NMUA 2HMPA 4B9LA 4PUOA 4B1WB 3TSQA 4LD0A 5AQLA 2FXUA 1N8RO 3VF2A 1NKBA 1U49A 4K0KK 1RDUA 2A6AA 4JKEA 4DFKA 4CERA 3UIQA 1DGKN 2IOCA 2NRHA 1RTIA 5B8HA 3PLAA 4C8LA 2VWKA 1X3MA 3OYIA 1NK7A 5EOYA 4B9VA 3QINA 3M5RA 1RTJA 2NRWA 3L2UA 3RRGA 5C12A 4BDZA 1C1BA 4B9MA 1QQMA 2ZJQL 4JI5K 1NM1A 1LAWA 1IKWA 2G8FA 5BPNA 1FK9A 3CD6N 1VQ7N 3DRPA 2QM1A 3HPGA 3ZSQA 4OLAA 3NH1A 1ZC6A 3A5OC 1ZBFA 4J8FA 4DS4A 4C1NK 3RSEB 4O0IA 1U6ZA 1NJWA 4FW2A 5AQNA 1A5XA 4JI6K 3RMBA 2V51B 3WNHA 4CF1A 4DQ8A 1HQUA 2ZJRL 1KTQA 2J4RA 3THXA 3ULEB 4FZXC 3V1QA 3AVHA 1NJYA 3SPYA 3O9UA 3C0BA 3K2PA 5AQMA 3CHWA 1TYQA 1J5OA 4N5SA 2QXLA 4H5VA 2VYPA 4CHOA 3QEWA 3TU5A 3SJJA 4LF8K 3ZSXA 1L3VA 3QEVA 4WFAL 1NGFA 3PV8A 3VEZA 3CMAN 3E9LA 2A1SA 4L3QA 2P9IA 4CF2A 1T05A 3TANA 3DMJA 4I2PA 4M3ZA 2VG5A 4CI6A 4AH9A 4NXNK 3O4WA 1R59O 4MO5A 1W2BM 5AQRA 4FJNA 4BRQA 3MAQA 4E7IA 3ZT2A 2YNFA 1T6DA 4DUZK 1NWKA 1NLVA 5EVZA 1WLJA 4HCBA 2AA4A 1MWKA 3VEWA 3UKRA 2IDOA 4CJ3A 3C65A 1J6ZA 3Q7BA 3BF3A 1LW2A 2CH5A 3AAPA 1KD1O 4WFBL 1HKBA 3M1FA 3TAEA 3MN5A 4K25A 4JK7A 1HKGA 4WQ5C 4QAGA 3UKUB 4NLCA 1N34K 3K5OA 1YF5L 3HT3A 3THWA 4Z4EA 2FBTA 4RW8A 3KIOA 2E20A 1RDDA 3D2EB 1JLFA 4WCEL 2RN2A 3PUFA 3MDQA 3E01A 2B6AA 3CQ8A 3C94A 1TKDA 4B3MK 2UXDK 4YFUA 1QHAA 1LAVA 1TK8A 2P5OA 2HHSA 3AGRA 3FZHA 3SUNA 3DLEA 1JXBA 3AVMA 4BR5A 3M8PA 3P83D 2P9KA 4RTFD 4CHYA 4CBUA 2QWQA 3C7NB 3O3HA 4DUYK 4L8RB 1VQNN 4N47A 2Q2RA 4BWMA 1QS4A 4BDYA 4CFAA 3AVNA 4DSKA 4JRPA 4FJJA 2W6KA 4CBWA 4OPAA 1GOBA 2E88A 4EFHA 3QLHA 4BC2A 2P5GA 3DXMB 4CFBA 4JKCA 2UU9K 2P51A 4BC5A 4M7YA 4DTMA 5M1KA 2HNZA 4PKHA 1S1XA 2BGGA 4J2DA 5CY4A 3F9KA 3WXIA 1KVBA 3SK3A 5J2PA 3W3DA 4ILGB 3I33A 3C6AA 3CI5A 3DOLA 2RPIA 3QBXA 3K5MA 4KI6A 4OKKA 3A5LC 5C2FA 5FPEA 3DLLL 4F8RA 4BE1A 3EKSA 1XNQK 1WSJA 1BA0A 4CK3A 3NHGA 2O8BB 5AZIB 4M41A 3VQBA 4WF9L 1EKEA 1D9DA 1VQKN 3D7EO 4FWQA 3VETA 3CG7A 3U4LA 1SS6A 3HPHA 4R5PA 3J8AA 3O4QA 4CIFA 3BP8A 5SWMA 1S1WA 4KH5A 5BRHA 2NRTA 3KLGA 4Z94A 2XY7A 1EWRA 2HNDA 1HPMA 5HRRA 5CR4A 3PX0A 3VA3A 4DFMA 2YCHA 4E3SA 3AVFA 3OYKA 3A2FA 4N76A 4FWOA 4DHYA 2W41A 5J2MA 1XHXA 4B9NA 3BZCA 1QSSA 3EL2A 3H46O 1S1TA 3QICA 2OZMA 2HHVA 4KFBA 3VGLA 3DI6A 4LF6K 3CXCM 1V4TA 3VQQA 3GDQA 2IVNA 3K5LA 4HHTA 2O8FA 2FSNA 4XH1A 2HOEA 3QB0A 1QZ6A 4DV4K 1HNVA 4FJGA 1A5WA 4BG8A 3E1YA 3CPEA 4B08A 1Q18A 4DV2K 3CC7N 1NMNA 2PZSA 4CF0A 4JHDB 3ZSYA 5AQFA 4JKGA 5KQ8A 5DM6L 3HBTA 4CZKA 2HW3A 4CJ7A 2VG7A 4E7HA 3ULDA 4DSJA 3KLFA 5AQTA 1C0GA 4BRLA 4BQZA 4M42A 1ATNA 1CZBA 2P9PA 3VESA 5LMUK 3FFKB 1HR0K 3C6UA 2E5LK 2Q3SA 3FZMA 4YOTA 5J2QA 2GWJA 1SL0A 1VQ9N 1LWEA 1VQ8N 3NDKA 4RW4A 4IWVA 4Z4FA 3M6GA 3IKMA 4CHPA 3QNOA 1ATRA 3PSFA 1WSIA 1BWFO 4CW7B 4E0DA 2G8WA 2Q36A 4QCLA 4I9LA 5AQZA 4C8NA 1T6CA 4OKJA 4DR1K 1UWBA 2YI1A 4BG9A 1E4GT 3ZT1A 4NB4A 1J5EK 2P9LA 2I5JA 4FYDA 1HYSA 3OYCA 4CJSA 4FJMA 3D0PA 4ID5A 3VF6A 2HVIA 4BRDA 2Z1IA 1N36K 1ATSA 1VQ6N 4ZTJA 4EZ6A 4UY8O 5FPNA 4CJUA 4IDKA 2EWSA 5LL6Z 1Z26A 4FJLA 1SV5A 3N4PA 4BRFA 4DU3A 3IFRA 5EX5A 1N6QA 4M3YA 3G4SN 3L6QA 4E7KA 4JI8K 2HBKA 5AJ3K 3U3YA 4DTUA 4LF9K 2NUBA 4H0VB 3M8RA 1GLCG 1WNSA 1Q9XA 3THYA 5F1XA 5BR8K 5E26A 3TAGA 2ITMA 4EP4A 1KVAA 1SL1A 2P9SA 4DQIA 2JGUA 4B1UB 1OVYA 2HHQA 1TVRA 4CJPA 4FWPA 4CJFA 1C0UA 2ITGA 1KXPA 4PA1A 4CE9A 4M3XA 4FSVA 2QWPA 4F3TA 1VQ5N 1CXQA 3CERA 2AJQA 1HNIA 1WAFA 3EO3A 4BRIA 2YHBA 5LJVA 1FW6A 2ZM6K 1OH6A 3KKRA 4JI4K 3BZKA 4K43A 4K42A 1HMVA 4NCGA 3QEPA 2YV0X 4NYFA 3NF9A 4H0XB 2ZGZA 2RF2A 3TAPA 3SBTA 4GV3A 3ZSRA 1WSFA 4DV3K 4KHUA 4CGJA 2OYQA 4YDUA 1Q8IA 2O8CB 1Z05A 1WUAA 2NRXA 3L2VA 1HUXA 2B5JA 4PQUA 2QWMA 2GUIA 4A5AA 1BQNA 1VSHA 1IKXA 1H1VA 3O08A 3CIPA 2WTUA 2ZE2A 3OYGA 5EU7A 1DEJA 4KPYA 4GV9A 1RBSA 4GVEA 5C15A 4RW7A 2NRVA 3O9QA 4CJ5A 1U45A 1YTAA 3AO5A 3T3FA 2EHGA 4J2EA 2H3GX 5KPRA 2W6LA 4MO4A 4EIAA 3J7AP 4W5RA 3J7ZO 4F9OA 3MX2A 3ZT0A 3KD5E 5IWAK 5IT9O 3KD1E 2YNIA 5DMRA 3L3VA 3LANA 4WFNL 1NOYA 1ZBLA 1TL3A 4KI4A 1NGDA 4BRNA 4ICLA 1UAXA 3HOSA 3VTHA 1QE1A 3HOTA 1BI4A 5DM7L 1U48A 1XMOK 2HF4A 3L4QA 3E9OA 2P9KB 3CCVN 1TKZA 3QO9A 4FJXA 3CCJN 3VTIA 4FXDA 1HJRA 4EZ9A 1JLAA 4GVMA 4WYBA 4FWSA 2KFNA 4IBNA 4CEDA 3U6FA 1U2VA 4V19S 3LDQA 3TTFA 3O8MA 3VERA 3MECA 3KK3A 4I6MB 1NK9A 2WBNA 1WSHA 1NK6A 2WOMA 4GMJB 4FJ5A 2DY4A 4IZ9A 2F9TA 3A8YA 4FZZA 4LH5A 3L4IA 1C1CA 1JLCA 1P8ZA 4TSXA 3WQTA 2E2OA 4DR7K 3O9RA 3AA3A 4JK9A 5ADXH 4HUEA 2V7ZA 3VQ5A 2IS3A 3R1XA 3TAQA 2XY5A 4Q5VA 1YITN 1TUYA 3JYTA 1MA9B 1BCMA 2OPRA 3OS1A 2O8EA 3HK2A 3I8BA 4CBXA 2A40A 4CESA 4W5OA 1VQPN 3BY5A 1DLOA 4I7FA 4W5QA 3D2FB 2BANA 3EEQA 2HHTA 3OBYA 3V9SA 2HHWA 3CF5L 2YJFA 3IRXA 1CLQA 4U7BA 3LAMA 1YI2N 4DV5K 5KGWA 1NBWA 3O1WA 3WXJA 1NNEA 3NBPA 3ITHA 4PKIA 3WEEA 3AVBA 3D6RA 3TTDA 3HM9A 1JLEA 1IO2A 3ZYYX 4H4MA 4DWIA 1ESVA 4JV5K 3FE1A 4ISGA 4CGIA 3F5TA 1BU6O 3OYJA 3R3LA 4YOVA 2QWRA 3DLBA 4IJNA 4NO7A 2HBLA 3GBTA 4GW6A 3TARA 3VQPA 3AVJA 1EO1A 1TK5A 1JLQA 3H45C 4RCHA 5K14A 2QWNA 1HQEA 4WQ4C 3O1BA 3HPOA 5T7BA 2E6LA 3MWPA 3RR8A 2YKMA 2QI2A 3KJVA 1T03A 4AM6A 1M1KO 4CK2A 3G10A 4DTPA 3FZKA 4KHYA 3SPZA 2YHYA 4Y0WA 3OYLA 5C2DA 3CETA 1BGXT 2D0CA 4AM7A 2VGNA 3O9SA 2OTLN 3PO5A 1RBUA 2EX3A 2E2QA 4XEIA 4LFBK 5F0XA 4IOCL 2HB5A 2CGLA 3T1YK 2HHUA 4FWKA 4JKAA 1IBKK 3QBWA 1RGIA 1JKHA 4JLHA 1QQOA 4N56A 4G9ZA 3CC4N 2O8FB 1VSDA 3QNNA 4B9SA 3HTVA 2YKNA 4KHNA 1RDBA 4CFCA 3LM9A 4IOAL 4FLZA 2XRIA 4Z4CA 4F3OA 4B1VA 1VSJA 2NRRA 3DWLA 3SUPA 4DSLA 2QWLA 3W0LA 3NVKA 4B8AB 3OHRA 3HYFA 2P9PB 4X65K 1O13A 1VQLN 1VSKA 1XQSC 2P1JA 4B1YB 3B8AX 3G25A 1Q81O 3S41A 4BRCA 3S3NA 1IG8A 4AHVA 1RBVA 4HTLA 1L5UA 4CECA 4ELTA 1NGEA 1OVQA 3AVLA 2G8VA 1TGOA 4CCHA 3A0IX 3I55N 1Z25A 1CZ9A 4DR3K 4DF8A 3RVCA 5J2NA 3KK7A 3WQUA 4BROA 3BEXA 4OGEA 4U67L 2E6MA 1RT7A 4WQ5A 3O3FA 1BQMA 3P39A 3NF6A 3V4IA 3NAEA 1JLBA 5CZ1A 4XH5A 2FF3B 1MU2A 2P9NB 2BH1A 4CFDA 2F8SA 3VQAA 3MX5A 3KTQA 1YAGA 1BISA 3O3GA 1RT1A 2OPPA 3D45A 3J7YP 3L2QA 2Z1JA 3ID8A 5HP1A 4KO0A 4CJWA 4DSIA 1XC3A 2D1KA 4CEZA 1G15A 3HRGA 1SKSA 1QVFM 4JI3K 2V52B 4FWRA 3IUCA 1Z6RA 3ZLJA 4X62K 3QEIA 4DB3A 5I42A 3ZSWA 5BR9A 2HHXA 3LL3A 3V9WA 4KKOA 4PWDA 4CD1A 4CJKA 1YJNN 1LWFA 4NLBA 1IH7A 1Y64A 2WFBA 1YVUA 1S6PA 1NJZA 3H08A 3HSCA 1NMDA 4DTNA 4PHTX 4R79A 2Z1HA 2O4IA 1VSFA 2ZWHA 5AQGA 4YOYA 1W97L 3AO4A 4DV7K 3QFUA 3TAMA 1DTQA 2KTQA 1VSLA 4JD2B 2CH6A 3DLHA 3U9ZA 1GLBG 3CJ9A 5AQIA 4Z4IA 4BC3A 2F8TA 2D0AA 5C24A 4LF5K 3SNNA 1KAXA 3S3OA 1U47A 2E1ZA 3VPZA 2QK9A 3Q7CA 4O5FA 1J9AA 1NOZA 2Z1GA 4IDHA 1VSMA 3TWHA 1RNHA 4FWMA 3HVTA 5AFUH 5AQYA 1F21A 2O8DA 2JWKA 4DCHA 3ENBA 1K8KB 5D3GA 3G6EN 5HBMA 3ENOA 2KW4A 4LSLA 3VEXA 1K9MO 5AQJA 3AO1A 4FK2A 4FLTA 3O9TA 1VRTA 3ID6A 4H8KA 3VQ4A 2F7TA 5JLHA 2QTDA 1J54A 1M90O 1TAQA 4BR7A 1S6QA 3HXMA 3HJFA 1S72N 4J2BA 3B6PA 2F9WA 3OS0A 4OPHA 5BREA 4OX9K 4DMNA 1TKXA 3LDLA 4KB1A 3MMVA 4DF4A 1I94K 4YOUA 1X3NA 3ZETB 2RHKA 1X1PA 5E84A 1D8YA 4C8KA 4NCBA 1D9FA 3OYMA 4FO0A 4FLVA 1SUQA 1SQKA 2QEXN 1Q86O 3CPWM 4E1NA 4E7LA 4JK8A 5M1FA 3TI0A 4GKJK 4FM2A 4CJQA 4FWNA 2F96A 4BGAA 4OLBA 5JS1A 1T7PA 5JVGL 1Q82O 4DFJA 2ZGYA 5KRSA 3OS2A 4KTZA 3UE5A 2O4GA 5HRNA 1W7AA 2A41A 3DM2A 4OPJA 1EP4A 4H0PA 3K0SA 2QKBA 1RILA 1B92A 1EX4A 3HI0A 4O0JA 3DXKB 5FPDA 2O8EB 1FKOA 5I9EB 4M63C 3CCSN 1IKVA 1NGBA 3E66A 3EZ5A 3C6HA 1A5VA 3S3MA 5C0YA 4RG8A 4IXCA 1GLJO 2KHOA 5KTQA 3DLRA 1P90A 3EE8A 4CEBA 4DR2K 5JICA 4FJIA 3MK6A 1CXUA 5ELZA 1REVA 3RSEA 4BVPA 3CCRN 1WBBA 3WXLA 3T1AA 4FLUA 2XO7A 5BPLA 3CCUN 1S22A 3KVGA 3IMXA 3MEDA 3MCAB 1KRPA 2G8HA 1EQYA 3ULEA 3OYBA 1HLUA 5EY4A 1WB9A 4CEEA 1HX1A 4CK1A 3AA4A 2HBJA 5H1SQ 4CZMA 3LALA 4DLEA 1DKGD 1D4XA 1U04A 3CQYA 1O1WA 1YIJN 5KRTA 1C0FA 2V7YA 4E19A 3KLEA 1XWLA 4UQGA 4JI2K 3TSPA 1BIZA 4KH6A 1HNWK 5AZJA 2YNHA 3GE1A 3SLCA 2D0BA 4FZYA 1RDWX 3ZX0A 2FC0A 1IKYA 3ZEUA 4BY9C 4N41A 1NKCA 4JEPA 4FPAA 1WSEA 1T8EA 4QS7A 2BTFA 4B9TA 1G99A 1FXXA 4A5BA 4BVOA 3VGMA 4CEFA 1JLGA 4CJ4A 3THXB 3O6WA 2VG6A 4BR4A 4E7JA 4FJHA 1K8AO 4HVJA 1IJJA 3LWLA 4MFBA 4LFAK 4BRMA 5BRFA 3O5BA 4BRPA 2IVOA 1TYQB 4C8OA 5GAHP 4YHHK 4LF4K 4DSEA 3KZBA 4C8MA 3LM2A 3DRSA 3UKUA 1JCEA 1OH7A 3TPQA 4GV6A 4CZGA 3WXKA 1W9HA 3FGUA 2Y1IA 2X6SA 3KK2A 1BUPA 2P9IB 1HKCA 2Q0RA 3SAHA 4B3OA 3HZ6A 3LDOA 2D0PA 1I3AA 3FZFA 3VQCA 1GLLO 2UXBK 1VHXA 1WAJA 5C10A 3R9PA 2YHAA 4BDPA 2UUAK 5BN9A 5TKYA 3VEYA 4CHQA 1LCUA 1GLDG 4DTRA 2FLOA 2CGJA 3MXIA 3AGKA 1BOTO 5GIPA 3LDNA 3V9XA 2QWOA 3AVAA 3WUHA 3UKRB 3CMEN 1K73O 3C7NA 4B3RK 1GLAG 1S9GA 1L3TA 4B9QA 4AILC 2FBVA 3WNGA 5KPZA 1KQSM 4MDBA 3BGRA 2OZSA 3NVMA 1RT3A 3B6OA 2W42A 4RWTA 1HNXK 1YTUA 4B3TK 5ADXA 4CEOA 3SBGA 4HCCA 1QVGM 3VGKA 3THWB 3OYFA 4CJVA 3DXMA 4KAZA 3CFRA 3RMAA 1KVCA 2IC3A 4PKGA 1BDGA 5LMNK 2IVPA 5AQXA 3WT0A 4YDUC 1Q7YO 3CQXA 4AQYK 4E1JA 4FJ9A 4DKWA 5AQKA 1WN7A 5AQQA 1KFSA 4JN4A 4BRKA 4FOEA 4B1ZA 5SZTA 4CJEA 1UOCA 3AA2A 1NGJA 1S1VA 5AQHA 1SL2A 3CYMA 3H3OB 2XY6A 4W5TA 2UYTA 3AVGA 4H03B 2HF3A 1ZBUA 3U8XA 3SJHA 3FLCO 4NYNA 1BG3A 3OBWA 4AHRA 2VWJA 1QSYA 3SMSA 1TKTA 4FWLA 4FCYA 1QTMA 3P4IA 2O8BA 5AZIA 2ZF5O 4YY3K 4OJRA 3P31A 3K57A 4B1XB 1T44A 3JSMA 5M1OA 3NGIA 2B4JA 3DLKA 4OVLA 1EETA 4KTQA 4DQSA 2PY5A 1VAZA 3K9JA 2GWKA 3GG4A 4BR0A 4H5TA 4FLXA 4IG3A 4DU1A 2GV9A 4OKEA 5CE3A 2ATQA 3CCMN 1S5JA 3PX6A 4CVNE 5GAGP 2KZMA 3SV4A 1JL2A 1RBRA 3AVCA 1ASVA 1HJOA 1XI1A 2YNGA 5JVHL 1NU0A 3CM6A 3F73A 3L3UA 3AV9A 2QA4N 4M3TA 4CZIA 2NRZA 4LH4A 3NFAA 3QIPA 4YNQA 1S1UA 2BUPA 1HRHA 1EWQA 3LPUA 3T19A 4DS5A 3T7ZA 4WQ4A 4BR2A 4OO1J 4CZEA 2PYJA 1B9DA 3KHYA 4FK4A 2VGMA 5F2RA 1RT5A 2QW9A 4A2BA 5HOOA 3HO1A 2KQ2A 1OKJA 1RCHA 4IOXA 4DTJA 1LW0A 2OTJN 3OYHA 3ATVA 3SV3A 2Q1NA 2G8KA 4KHQA 4KH4A 3PO4A 2E8AA 4DR6K 4HTUA 4A57A 1KAZA 3T1HK 1IBMK 4YORA 4M7XA 1XHZA 2D0OA 2UUCK 1WSGA 4YOWA 4F2RA 4AF1A 5CHIA 5AR0A 2BDPA 3WNFA 1ILYA 5MLCQ 2ZQBA 1RBTA 3OYAA 4JRQA 5JS2A 3GOIA 3K5NA 4A59A 4H5WA 3A5NC 2IGIA 4LSNA 2G8UA 2XHBA 1YVNA 5LJWA 3O4NA 2VQFK 1NKEA 1XMQK 1TK0A 1QSLA 3TR8A 5HRSA 4AHCA 1VQ4N 3VENA 2LSNA 3VQ7A 1V4SA 4PL7A 5LY3A 4DQRA 1ZBSA 4FVUA 3EKUA 2GX9A 4YOXA 4QOZB 3SQ0A 2FSKA 4JKGB 1HPZA 3JXUA 2Q0UA 4A2AA 4BRAA 4J2AA 1VRUA 2R7YA 3H6EA 3C6TA 4H5NA 4QS9A 4FW1A 3NF7A 1GLEG 4JAXA 2P9UA 1LV5A 4BREA 2JLEA 3LP1A 3FZLA 3SZ2A 4CD3A 2KKZA 3IG1A 1NGIA 2X78A 3OJUA 5FDLA 4CF9A 2OA8A 1HYZA 1S9EA 2A1RA 5AQSA 4H5RA 3VQ6A 5AQPA 4BR9A 1X9SA 1SZ2A 2E1YA 1NGGA 2E4LA 3SYZA 2DTUA 3IS9A 4O5BA 1KSPA 1SKRA 4ZTFA 1QZ5A 1LOTB 4KHPK 1BIUA 1RTDA 3VEVA 3BF1A 3RWUA 3EYZA 4XIUA 1SAZA 2P9LB 5AZJB 2PAVA 2QXFA 4CZHA 3NCIA 5AQVA 4B9UA 1RDCA 4IO8A 2FBXA 3DJCA 3T69A 3ZEUB 4KREA 3VN5A 3DRRA 4KV8A 3CC2N 2QKKA 1QQCA 3P38A 5KI6A 3NGYA 4IFYA 2DFHA 2AP1A 4AHSA 4C23A 5GAEP 5AFUA 3SUOA 4CEAA 3AAQA 4JI1K 2KLAA 2HBMA 2HHHK 2O8CA 3AARA 4FM0A 4NCAA 1JCFA 3THYB 4NXMK 1D5AA 4ILHA 3LDPA 2P9SB 2E2NA 3LP3A 2HVHA 3A5MC 3KK1A 4CHZA 3KWGA 5HRPA 5KQDA 3QESA 3SCXA 1X9MA 4FOIA 2UXCK 4BRGA 1J53A 1QHTA 1ZBHA 3P5JA 4H0OA 4ILJA 2F4VK 4OGCA 4IEIA 3V9ZA 5KPTA 3I0RA 4HUGA 3ZSZA 3CCLN 3I56N 3UB5A 3V1OA 3G0ZA 4M3UA 4M3RA 1VQON 2NZTA 4JI0K 4F4KA 2RE2A 2WC9A 5HROA 4PY5A 3KWIA 4Z4HA 3O80A 5AQWA 2DPNA 3V9UA 3QDKA 3K58A 3SAGA 4GY2B 1YHQN 2Q97A 4A61A 5HLFA 2A5XA 1VSEA 4EAHD 1UA1A 5KGXA 1OH5A 5A2QO 4B8CA 4ZHRA 1NGCA 3QMLA 3PIPL 4I2QA 4IFEA 4I6MA 3CM5A 3V1RA 5JMVA 3HP6A 3LP0A 1YJWN 2YHXA 1ZXOA 3QETA 2GUPA 1TUUA 3TABA 1NGAA 4MQ3A 2ETJA 3F9MA 3V6DA 1NK5A 2G8IA 1N5YA 4ISFA 4K41A 1BCOA 3ISNC 4WE1A 2I7PA 3WNEA 4MLHA 1NG9A 3P1GA 3KLIA 4DR4K 3ZX3A 3MN6A 3AO3A 2YHWA 4JYAK 3RMDA 2XY8A 3ZCMA 3ZSOA 4FM1A 3D2FA 3HM8A 2ZD1A 4DTSA 3E9PA 3F2KA 2WUSA 4M3WA 3SI6A 4JI7K 4IJAA 1BI4B 2PBDA 1I39A 4GKKK 2OPSA 3JAMO 4RW6A 4KTWA 4EP5A 1JJ2M 1KAYA 3K59A 3L8BA 1RT2A 1U2VB 2OCEA 4FL9A 4MDAA 3VMFB 2X74A 2FF6A 4LFCK 3OYNA 2GBZA 4IKFA 4DSFA 3VQ8A 3LZIA 3AY9A 3S9HA 1IV0A 3MWTA 3VQ9A 5BN8A 5FRMA 4AHUA 4KRFA 3HVRA 3CJ7A 3NH0A 1TAUA 2PFUA 2NLXA 3I0SA 3TTCA 1QQNA 1DTTA 5FRNA 4FJ7A 4H0YB 3ASMA 5M1QA 3N4QA 4IO9L 1W0HA 3V81A 5FLXO 1N32K 4DR5K 1C1AA 1KLMA 3AVKA 3GL1A 1YXQA 1X9JA 5M1NA 4DV6K 4LF7K 5BPMA 1Q9YA 2JWLA 1KFDA 1BL3A 3ZX2A 4KHWA 1NK8A 1E4FT 1L3UA 3LPTA 4JKDA 1B9FA 3LP2A 2ASPA 3WEEB 4CF8A 4CZLA 3KLHA 1R0AA 2OANA 3OTOK 3MXMA 2HNYA 2ZJPL 4M45A 3HSTB 4ISEA 3EY1A 1GOAA 1BA1A 4I9QA 4KB0A 1BO5O 3M8SA 3MXJA 3NH2A 3PIOL 2IAJA 2Y1JA 3IDHA 3OVNA 1E3MA 4DFPA 4F2SA 3QIOA 1JL1A 3VOVA 1C0TA 4OPKA 1GOCA 3DOKA 3LZJA 4LY7A 3DAWA 5TKWA 3VA0A 2OPQA 5AQUA 3SAFA 1TL1A 3AVIA 4Y1DA 4RW9A 1RDAA 1JXEA 1HYVA 3EE9A 5CYMA 1YUWA 1LWCA 1N33K 4HWIA 2FBYA 4BRHA 3ALYA 1MWMA 4PL8A 4BACA 3MEGA 4KBOA 2I7NA 2UUBK 1CZAN 1UA0A 1WOQA 4CGHA 4DQPA 3VQDA 3M8QA 1NK0A 1FKPA 2YX6A 3LDSA 4QS8A 3H1QA 3IAYA 4DV1K 2CGKA 3CJ1A 3SUQA 3KKSA 1SKWA 4EHTA 4FVMA 2P9NA 2GELA 3JS6A 4G1QA 4X66K 4FK0A 3TAFA 1MDUB 4W5NA 4E89A 3MEEA 3CFPA 4JS4A 3PY8A 4B3SK 4IFVA 3NE6A 2VQEK 2P9UB 5GADP 1FJGK 3NGZA 1NJXA 3VQEA 1XNRK 1X9WA 4K8ZA 2NNWA 4O44A 2RKIA 1ZBIA 4BWJA 1IG9A 4X64K 3MCPA 3C95A 3J81O 3D2EA 2GEMA 3OJSA 5BRDA 4AHTA 1KCFA 3MN7A 4BGBA 2FSJA 3ZT4A 3U9DA 1C0MA 3K9KA 4CJTA 3DLGA 3SQ4A 4BE0A 5M1PA 1KLNA 5E41A 2ASMA 1RFQA 4O55A 3RTVA 3CJCA 4MLEA 5J1EA 4IG0A 3HL8A 4C1NI 1NGHA 2A3ZA 4CIGA 4CGFA 3VF4A 4Z0UA 3H1VX 3J80O 4H0TB 4E1MA 2D4WA 4FLYA 3QERA 1ASWA 5CZ2A 4JKFA 4DTXA 1L3SA 4BC4A 1Y97A 3PSIA 1KC8O 4CJRA 3THVA 3M3ZA 4JD2A 4FJ8A 2X6NA 4GNIA 4DU4A 3PX4A 3SQ2A 4HUFA 4CHNA 1DT9A 4EHUA 4XH4A 4DTOA 3HP9A 3U3GA 1VSIA 5FPMA 4CJLA 1HNZK 1NJIO 1ZYQA 3G71N 4K8XA 2YJEA 1K6YA 2D5RA 3ATUA 4Y1CA 4JKBA 3LAKA 5FROA 5JLFA 4DV0K 1K8KA 3NF8A 3FR0A 3MN9A 3SMPA 3CCEN 4JKHA 3BDPA 3AO2A 2VWBA 1OH8A 1NK4A 3DYAA 1EXQA 3BUZB 4BQLA 2VCPA 3ENHA 4CEQA 5C42A 4LC9B 4BE2A
chains in the Genus database with same CATH topology
1WSIA 2Z1GA 3FFIA 1VSMA 3QEXA 3TWHA 3OYEA 4QOZB 4E0DA 1RNHA 4DQQA 3SQ0A 2G8WA 4FJKA 3HVTA 3CFOA 1HPZA 4J2AA 4QCLA 1F21A 1VRUA 2R7YA 4ELUA 3C6TA 4I9LA 4C8NA 5D3GA 1RTHA 4FW1A 4OKJA 3NF7A 1UWBA 5HBMA 1BHLA 3ZT1A 1LV5A 2KW4A 1C6VA 3OYDA 2JLEA 3LP1A 4NCBA 3SZ2A 4LSLA 2I5JA 3IG1A 4FYDA 3RMCA 3AO1A 2HMIA 2X78A 4FK2A 1HYSA 3OYCA 4CJSA 5FDLA 3OJUA 4FLTA 1U4BA 4FJMA 4CF9A 3D0PA 2OA8A 4ELVA 1HYZA 1S9EA 1VRTA 4ID5A 2HVIA 2A1RA 2Z1IA 3VQ6A 1X9SA 4H8KA 3VQ4A 3RRHA 2PYLA 3SQ1A 4ZTJA 1J54A 2DFFA 4EZ6A 2E4LA 3SYZA 2DTUA 1TAQA 3IS9A 4O5BA 4CJUA 1S6QA 1KSPA 3HXMA 1SKRA 4IDKA 1ASUA 1TV6A 4CGDA 3HJFA 4J2BA 1Z26A 4FJLA 4ZTFA 1SV5A 3B6PA 3OS0A 4DU3A 4JS5A 1BIUA 1RTDA 3AA5X 4DMNA 1N6QA 2WONA 1TKXA 3I8DA 3EYZA 4E7KA 4XIUA 3RWUA 4M3YA 4KB1A 3L2RA 3LWMA 4DF4A 2KFZA 3U3YA 5I3UA 2QXFA 4DTUA 3NCIA 1X1PA 2NUBA 1D8YA 3M8RA 4C8KA 1D9FA 4B9UA 1WNSA 1XC9A 1RDCA 5C25A 2FBXA 3OYMA 1Q9XA 4Z4GA 3RR7A 4FLVA 3TAGA 1SUQA 4EP4A 1KVAA 5CYQA 3VN5A 3ZSVA 4FLWA 1SL1A 3DRRA 4DQIA 2DFEA 4KREA 2JGUA 4KV8A 2QKKA 4E1NA 3L2WA 1QQCA 2HHQA 1TVRA 5KI6A 1RT4A 4CJPA 4ID1A 3OY9A 4E7LA 4CJFA 3TI0A 4KHSA 1C0UA 2ITGA 4FM2A 3NGYA 4CJQA 1VK0A 2F96A 4IFYA 2DFHA 4AHSA 4PA1A 4OLBA 5JS1A 4CE9A 1T7PA 4M3XA 4DG1A 3SUOA 4F3TA 4CEAA 2KZZA 4DFJA 1YT3A 1ITGA 5KRSA 3OS2A 4KTZA 1CXQA 2AJQA 2O4GA 1HNIA 5HRNA 2BE2A 1WAFA 4FM0A 4H4OA 4CGGA 4NCAA 3DM2A 4OPJA 4Q0BA 1EP4A 2YHBA 1D5AA 3KKRA 2QKBA 1RILA 4DLGA 5DK5A 1B92A 1EX4A 3ZT3A 1HMVA 1RT6A 4NCGA 4CIEA 4O0JA 3QEPA 2YV0X 4O4GA 3LP3A 4NYFA 2HVHA 1FKOA 3KK1A 4B9LA 4PUOA 3NF9A 4CHZA 5HRPA 3QESA 1IKVA 4LD0A 3EZ5A 2RF2A 3SCXA 1X9MA 3TAPA 1NKBA 1A5VA 3S3MA 1U49A 3ZSRA 4DFKA 1WSFA 4RG8A 4CERA 1J53A 1QHTA 4KHUA 4CGJA 1ZBHA 3UIQA 2IOCA 2OYQA 5KTQA 3P5JA 1Q8IA 1RTIA 3DLRA 4OGCA 3V9ZA 3I0RA 4CEBA 4HUGA 2VWKA 4C8LA 3OYIA 3L2VA 1NK7A 3ZSZA 4FJIA 2B5JA 4B9VA 3QINA 4PQUA 1CXUA 2GUIA 1REVA 1BQNA 3V1OA 1RTJA 3T1AA 4FLUA 3G0ZA 3L2UA 3RRGA 4M3RA 4BDZA 1VSHA 2XO7A 1IKXA 4M3UA 1C1BA 4B9MA 2ZE2A 3OYGA 4F4KA 5EU7A 4KPYA 3MEDA 1RBSA 5HROA 4PY5A 4Z4HA 1KRPA 1LAWA 1IKWA 4RW7A 2G8FA 4CJ5A 3V9UA 1FK9A 1U45A 1YTAA 3AO5A 3T3FA 2G8HA 2EHGA 4J2EA 3K58A 3OYBA 5HLFA 4W5RA 4CEEA 4CK1A 1VSEA 3ZT0A 3AA4A 3KD5E 3DRPA 3HPGA 1UA1A 3ZSQA 5KGXA 4OLAA 3NH1A 3LALA 4DLEA 4B8CA 1ZBFA 4ZHRA 4DS4A 4O0IA 1U04A 3KD1E 1NJWA 1O1WA 2YNIA 4FW2A 4I2QA 5KRTA 5DMRA 3L3VA 3LANA 1NOYA 1A5XA 3CM5A 3V1RA 4E19A 1ZBLA 3HP6A 1TL3A 3LP0A 3KLEA 3RMBA 1XWLA 3WNHA 4CF1A 4KI4A 1HQUA 4UQGA 1KTQA 1BIZA 3QETA 4ICLA 1UAXA 3TABA 4MQ3A 2ETJA 1QE1A 3V6DA 1NK5A 1BI4A 2YNHA 2G8IA 1U48A 1N5YA 2D0BA 4FZXC 1BCOA 4FZYA 3V1QA 1TKZA 3ISNC 4WE1A 3QO9A 2FC0A 4FJXA 1IKYA 3WNEA 4FXDA 1HJRA 3AVHA 3SPYA 1NJYA 4EZ9A 1JLAA 3P1GA 4GVMA 3KLIA 4N41A 3K2PA 1NKCA 2KFNA 4IBNA 4CEDA 3U6FA 1J5OA 4N5SA 3AO3A 1WSEA 3QEWA 4CHOA 3RMDA 3SJJA 1T8EA 2XY8A 3ZCMA 3ZSXA 3ZSOA 3MECA 3KK3A 4FM1A 3QEVA 1L3VA 4B9TA 1FXXA 2ZD1A 4DTSA 1NK9A 1WSHA 4CEFA 3PV8A 2WOMA 1NK6A 4GMJB 4FJ5A 4M3WA 2DY4A 1JLGA 3SI6A 4CJ4A 2A1SA 1T05A 2VG6A 4CF2A 4E7JA 4FJHA 4FZZA 3TANA 1BI4B 3DMJA 1I39A 4I2PA 4LH5A 4HVJA 4M3ZA 2VG5A 3LWLA 1C1CA 1JLCA 2OPSA 4MFBA 4TSXA 4AH9A 4RW6A 4KTWA 3AA3A 4EP5A 4HUEA 3VQ5A 2IS3A 3TAQA 2XY5A 4Q5VA 4FJNA 3K59A 3L8BA 3JYTA 4C8OA 1BCMA 2OPRA 1RT2A 3OS1A 3MAQA 3HK2A 4E7IA 4DSEA 3ZT2A 2YNFA 4C8MA 4CESA 4W5OA 3DRSA 1DLOA 2X74A 4I7FA 4W5QA 1WLJA 2BANA 4HCBA 2HHTA 1W9HA 3OYNA 2GBZA 3V9SA 4IKFA 2Y1IA 2HHWA 2X6SA 2IDOA 3KK2A 4CJ3A 4DSFA 3IRXA 1CLQA 3LAMA 3VQ8A 4B3OA 3LZIA 5KGWA 1LW2A 3S9HA 1I3AA 3VQCA 3VQ9A 5FRMA 3NBPA 3ITHA 1WAJA 4AHUA 4KRFA 3HVRA 3AVBA 3HM9A 3TAEA 3NH0A 2YHAA 1JLEA 1IO2A 4BDPA 4H4MA 4DWIA 1TAUA 3I0SA 4CHQA 4QAGA 1DTTA 5FRNA 4FJ7A 4DTRA 3ASMA 3MXIA 1W0HA 3K5OA 4CGIA 3V81A 3V9XA 3AVAA 3OYJA 1C1AA 1KLMA 3AVKA 1J9AA 3HT3A 4Z4EA 2FBTA 3DLBA 4RW8A 3KIOA 1RDDA 1Q9YA 1JLFA 1KFDA 1S9GA 4AILC 4GW6A 3TARA 2FBVA 1L3TA 3VQPA 3WNGA 1BL3A 3AVJA 4KHWA 2RN2A 3PUFA 1NK8A 3BGRA 2OZSA 1L3UA 3E01A 1JLQA 2B6AA 3LPTA 3CQ8A 3C94A 1RT3A 5K14A 1TK5A 1B9FA 3B6OA 3LP2A 4CF8A 3KLHA 1HQEA 3HPOA 1TKDA 1R0AA 2W42A 5T7BA 2E6LA 4YFUA 3MXMA 1LAVA 2HNYA 3RR8A 1YTUA 4M45A 3HSTB 1TK8A 2YKMA 2P5OA 3KJVA 1T03A 3EY1A 2HHSA 1GOAA 4CEOA 4CK2A 3G10A 4DTPA 4I9QA 4HCCA 4KB0A 3SUNA 4KHYA 3M8SA 3SPZA 3DLEA 3OYLA 1JXBA 3MXJA 3AVMA 3NH2A 2IAJA 3M8PA 1BGXT 2D0CA 2Y1JA 3OYFA 3P83D 3OVNA 4CJVA 4KAZA 4CHYA 3CFRA 3RMAA 1KVCA 4DFPA 2IC3A 3O3HA 4F2SA 3QIOA 1JL1A 4L8RB 3PO5A 1C0TA 1RBUA 4OPKA 2EX3A 4N47A 1GOCA 3DOKA 4BWMA 1QS4A 4BDYA 3LZJA 4LY7A 2HB5A 4CFAA 3AVNA 3VA0A 2HHUA 4DSKA 2OPQA 4JRPA 1JKHA 1TL1A 4JLHA 1WN7A 4N56A 1KFSA 4FJJA 4FJ9A 1VSDA 3AVIA 4Y1DA 4RW9A 1RDAA 3QNNA 4B9SA 1GOBA 1JXEA 5SZTA 1HYVA 4CJEA 1UOCA 3AA2A 2YKNA 1S1VA 1SL2A 4KHNA 1RDBA 3CYMA 5CYMA 4CFCA 2XY6A 1LWCA 4W5TA 3QLHA 4FLZA 2XRIA 3AVGA 4Z4CA 2P5GA 4CFBA 4F3OA 2P51A 1VSJA 1ZBUA 2FBYA 4DTMA 4AHRA 3ALYA 4NYNA 2VWJA 3SUPA 4DSLA 2HNZA 4B8AB 1QSYA 4BACA 1TKTA 3HYFA 3MEGA 4FCYA 1QTMA 1S1XA 2BGGA 1UA0A 4DQPA 4CGHA 4J2DA 5CY4A 3F9KA 3VQDA 3M8QA 1VSKA 2P1JA 1KVBA 4OJRA 1NK0A 5J2PA 3K57A 1FKPA 3LDSA 3JSMA 3IAYA 3NGIA 2B4JA 3DLKA 4OVLA 3DOLA 2RPIA 3S3NA 4AHVA 1RBVA 3K5MA 1EETA 4KTQA 4DQSA 2PY5A 3SUQA 4KI6A 4OKKA 1L5UA 3KKSA 1SKWA 4CECA 4ELTA 4FVMA 4F8RA 4BE1A 4FLXA 4G1QA 4FK0A 3AVLA 4IG3A 4DU1A 1TGOA 3TAFA 2G8VA 2GV9A 4OKEA 4CCHA 2ATQA 1S5JA 1Z25A 3PX6A 4E89A 4W5NA 3MEEA 3CFPA 4JS4A 1CZ9A 1WSJA 2KZMA 3PY8A 4IFVA 3NE6A 4DF8A 4CK3A 3NGZA 3NHGA 1NJXA 4M41A 3SV4A 3VQBA 3VQEA 5J2NA 1X9WA 1JL2A 1RBRA 4K8ZA 4O44A 3AVCA 2RKIA 1ASVA 1EKEA 1D9DA 4BWJA 1XI1A 4OGEA 1ZBIA 1IG9A 3C95A 2E6MA 1RT7A 2YNGA 3O3FA 3CG7A 4R5PA 3CM6A 1BQMA 3HPHA 3NF6A 3V4IA 3NAEA 1JLBA 5CZ1A 3OJSA 4AHTA 1KCFA 3O4QA 4CIFA 3F73A 5SWMA 1S1WA 1MU2A 3L3UA 3AV9A 4M3TA 4CFDA 3KLGA 2F8SA 3VQAA 2XY7A 3ZT4A 4LH4A 1C0MA 2HNDA 3NFAA 3QIPA 4CJTA 4YNQA 3KTQA 1BISA 3O3GA 1S1UA 3DLGA 1RT1A 2OPPA 3D45A 5HRRA 3SQ4A 1HRHA 3VA3A 4DFMA 3PX0A 4BE0A 4E3SA 3LPUA 3AVFA 3T19A 3OYKA 3A2FA 4DS5A 5E41A 1KLNA 4N76A 4O55A 3RTVA 3L2QA 4IG0A 2Z1JA 3HL8A 5HP1A 2PYJA 4CIGA 5J2MA 4KO0A 4CGFA 1B9DA 1XHXA 4CJWA 4DSIA 4FK4A 4B9NA 4Z0UA 1RT5A 4CEZA 1QSSA 1G15A 1SKSA 1S1TA 4E1MA 4FLYA 3QERA 1ASWA 3HO1A 5CZ2A 2KQ2A 4DTXA 4KFBA 1L3SA 2OZMA 2HHVA 1RCHA 3QEIA 5I42A 4DTJA 1LW0A 1Y97A 3ZSWA 3OYHA 2HHXA 4CJRA 3THVA 3SV3A 2G8KA 3V9WA 3DI6A 4KKOA 4PWDA 4KHQA 4FJ8A 2X6NA 3PO4A 4CJKA 1LWFA 4DU4A 3PX4A 1IH7A 4HUFA 3VQQA 4CHNA 3SQ2A 3K5LA 4HHTA 4HTUA 4DTOA 3HP9A 3U3GA 1YVUA 1VSIA 4FJGA 1HNVA 1S6PA 4CJLA 1NJZA 1XHZA 1A5WA 3H08A 1ZYQA 1WSGA 4F2RA 4DTNA 4K8XA 4B08A 2BDPA 3WNFA 2PZSA 2Z1HA 2O4IA 4CF0A 1VSFA 1K6YA 3ZSYA 2D5RA 4Y1CA 3AO4A 2ZQBA 1RBTA 2HW3A 3LAKA 3OYAA 3TAMA 2VG7A 4JRQA 5FROA 5JS2A 1DTQA 4E7HA 3K5NA 3ULDA 4DSJA 3KLFA 2KTQA 1VSLA 2IGIA 4LSNA 3NF8A 3DLHA 4M42A 1CZBA 2G8UA 2XHBA 4Z4IA 2F8TA 2D0AA 3O4NA 3C6UA 3BDPA 5C24A 2Q3SA 5J2QA 3SNNA 1NKEA 3AO2A 3S3OA 1U47A 1SL0A 1TK0A 1QSLA 2QK9A 1LWEA 3TR8A 3NDKA 1NK4A 4RW4A 4AHCA 5HRSA 4Z4FA 3DYAA 1EXQA 2LSNA 3VQ7A 4CHPA 3QNOA 4DQRA 4CEQA 5C42A 5J1EA 1NOZA 4BE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSI A;  2Z1G A;  3FFI A;  1VSM A;  3QEX A;  3TWH A;  3OYE A;  4QOZ B;  4E0D A;  1RNH A;  4DQQ A;  3SQ0 A;  2G8W A;  4FJK A;  3HVT A;  3CFO A;  1HPZ A;  4J2A A;  4QCL A;  1F21 A;  1VRU A;  2R7Y A;  4ELU A;  3C6T A;  4I9L A;  4C8N A;  5D3G A;  1RTH A;  4FW1 A;  4OKJ A;  3NF7 A;  1UWB A;  5HBM A;  1BHL A;  3ZT1 A;  1LV5 A;  2KW4 A;  1C6V A;  3OYD A;  2JLE A;  3LP1 A;  4NCB A;  3SZ2 A;  4LSL A;  2I5J A;  3IG1 A;  4FYD A;  3RMC A;  3AO1 A;  2HMI A;  2X78 A;  4FK2 A;  1HYS A;  3OYC A;  4CJS A;  5FDL A;  3OJU A;  4FLT A;  1U4B A;  4FJM A;  4CF9 A;  3D0P A;  2OA8 A;  4ELV A;  1HYZ A;  1S9E A;  1VRT A;  4ID5 A;  2HVI A;  2A1R A;  2Z1I A;  3VQ6 A;  1X9S A;  4H8K A;  3VQ4 A;  3RRH A;  2PYL A;  3SQ1 A;  4ZTJ A;  1J54 A;  2DFF A;  4EZ6 A;  2E4L A;  3SYZ A;  2DTU A;  1TAQ A;  3IS9 A;  4O5B A;  4CJU A;  1S6Q A;  1KSP A;  3HXM A;  1SKR A;  4IDK A;  1ASU A;  1TV6 A;  4CGD A;  3HJF A;  4J2B A;  1Z26 A;  4FJL A;  4ZTF A;  1SV5 A;  3B6P A;  3OS0 A;  4DU3 A;  4JS5 A;  1BIU A;  1RTD A;  3AA5 X;  4DMN A;  1N6Q A;  2WON A;  1TKX A;  3I8D A;  3EYZ A;  4E7K A;  4XIU A;  3RWU A;  4M3Y A;  4KB1 A;  3L2R A;  3LWM A;  4DF4 A;  2KFZ A;  3U3Y A;  5I3U A;  2QXF A;  4DTU A;  3NCI A;  1X1P A;  2NUB A;  1D8Y A;  3M8R A;  4C8K A;  1D9F A;  4B9U A;  1WNS A;  1XC9 A;  1RDC A;  5C25 A;  2FBX A;  3OYM A;  1Q9X A;  4Z4G A;  3RR7 A;  4FLV A;  3TAG A;  1SUQ A;  4EP4 A;  1KVA A;  5CYQ A;  3VN5 A;  3ZSV A;  4FLW A;  1SL1 A;  3DRR A;  4DQI A;  2DFE A;  4KRE A;  2JGU A;  4KV8 A;  2QKK A;  4E1N A;  3L2W A;  1QQC A;  2HHQ A;  1TVR A;  5KI6 A;  1RT4 A;  4CJP A;  4ID1 A;  3OY9 A;  4E7L A;  4CJF A;  3TI0 A;  4KHS A;  1C0U A;  2ITG A;  4FM2 A;  3NGY A;  4CJQ A;  1VK0 A;  2F96 A;  4IFY A;  2DFH A;  4AHS A;  4PA1 A;  4OLB A;  5JS1 A;  4CE9 A;  1T7P A;  4M3X A;  4DG1 A;  3SUO A;  4F3T A;  4CEA A;  2KZZ A;  4DFJ A;  1YT3 A;  1ITG A;  5KRS A;  3OS2 A;  4KTZ A;  1CXQ A;  2AJQ A;  2O4G A;  1HNI A;  5HRN A;  2BE2 A;  1WAF A;  4FM0 A;  4H4O A;  4CGG A;  4NCA A;  3DM2 A;  4OPJ A;  4Q0B A;  1EP4 A;  2YHB A;  1D5A A;  3KKR A;  2QKB A;  1RIL A;  4DLG A;  5DK5 A;  1B92 A;  1EX4 A;  3ZT3 A;  1HMV A;  1RT6 A;  4NCG A;  4CIE A;  4O0J A;  3QEP A;  2YV0 X;  4O4G A;  3LP3 A;  4NYF A;  2HVH A;  1FKO A;  3KK1 A;  4B9L A;  4PUO A;  3NF9 A;  4CHZ A;  5HRP A;  3QES A;  1IKV A;  4LD0 A;  3EZ5 A;  2RF2 A;  3SCX A;  1X9M A;  3TAP A;  1NKB A;  1A5V A;  3S3M A;  1U49 A;  3ZSR A;  4DFK A;  1WSF A;  4RG8 A;  4CER A;  1J53 A;  1QHT A;  4KHU A;  4CGJ A;  1ZBH A;  3UIQ A;  2IOC A;  2OYQ A;  5KTQ A;  3P5J A;  1Q8I A;  1RTI A;  3DLR A;  4OGC A;  3V9Z A;  3I0R A;  4CEB A;  4HUG A;  2VWK A;  4C8L A;  3OYI A;  3L2V A;  1NK7 A;  3ZSZ A;  4FJI A;  2B5J A;  4B9V A;  3QIN A;  4PQU A;  1CXU A;  2GUI A;  1REV A;  1BQN A;  3V1O A;  1RTJ A;  3T1A A;  4FLU A;  3G0Z A;  3L2U A;  3RRG A;  4M3R A;  4BDZ A;  1VSH A;  2XO7 A;  1IKX A;  4M3U A;  1C1B A;  4B9M A;  2ZE2 A;  3OYG A;  4F4K A;  5EU7 A;  4KPY A;  3MED A;  1RBS A;  5HRO A;  4PY5 A;  4Z4H A;  1KRP A;  1LAW A;  1IKW A;  4RW7 A;  2G8F A;  4CJ5 A;  3V9U A;  1FK9 A;  1U45 A;  1YTA A;  3AO5 A;  3T3F A;  2G8H A;  2EHG A;  4J2E A;  3K58 A;  3OYB A;  5HLF A;  4W5R A;  4CEE A;  4CK1 A;  1VSE A;  3ZT0 A;  3AA4 A;  3KD5 E;  3DRP A;  3HPG A;  1UA1 A;  3ZSQ A;  5KGX A;  4OLA A;  3NH1 A;  3LAL A;  4DLE A;  4B8C A;  1ZBF A;  4ZHR A;  4DS4 A;  4O0I A;  1U04 A;  3KD1 E;  1NJW A;  1O1W A;  2YNI A;  4FW2 A;  4I2Q A;  5KRT A;  5DMR A;  3L3V A;  3LAN A;  1NOY A;  1A5X A;  3CM5 A;  3V1R A;  4E19 A;  1ZBL A;  3HP6 A;  1TL3 A;  3LP0 A;  3KLE A;  3RMB A;  1XWL A;  3WNH A;  4CF1 A;  4KI4 A;  1HQU A;  4UQG A;  1KTQ A;  1BIZ A;  3QET A;  4ICL A;  1UAX A;  3TAB A;  4MQ3 A;  2ETJ A;  1QE1 A;  3V6D A;  1NK5 A;  1BI4 A;  2YNH A;  2G8I A;  1U48 A;  1N5Y A;  2D0B A;  4FZX C;  1BCO A;  4FZY A;  3V1Q A;  1TKZ A;  3ISN C;  4WE1 A;  3QO9 A;  2FC0 A;  4FJX A;  1IKY A;  3WNE A;  4FXD A;  1HJR A;  3AVH A;  3SPY A;  1NJY A;  4EZ9 A;  1JLA A;  3P1G A;  4GVM A;  3KLI A;  4N41 A;  3K2P A;  1NKC A;  2KFN A;  4IBN A;  4CED A;  3U6F A;  1J5O A;  4N5S A;  3AO3 A;  1WSE A;  3QEW A;  4CHO A;  3RMD A;  3SJJ A;  1T8E A;  2XY8 A;  3ZCM A;  3ZSX A;  3ZSO A;  3MEC A;  3KK3 A;  4FM1 A;  3QEV A;  1L3V A;  4B9T A;  1FXX A;  2ZD1 A;  4DTS A;  1NK9 A;  1WSH A;  4CEF A;  3PV8 A;  2WOM A;  1NK6 A;  4GMJ B;  4FJ5 A;  4M3W A;  2DY4 A;  1JLG A;  3SI6 A;  4CJ4 A;  2A1S A;  1T05 A;  2VG6 A;  4CF2 A;  4E7J A;  4FJH A;  4FZZ A;  3TAN A;  1BI4 B;  3DMJ A;  1I39 A;  4I2P A;  4LH5 A;  4HVJ A;  4M3Z A;  2VG5 A;  3LWL A;  1C1C A;  1JLC A;  2OPS A;  4MFB A;  4TSX A;  4AH9 A;  4RW6 A;  4KTW A;  3AA3 A;  4EP5 A;  4HUE A;  3VQ5 A;  2IS3 A;  3TAQ A;  2XY5 A;  4Q5V A;  4FJN A;  3K59 A;  3L8B A;  3JYT A;  4C8O A;  1BCM A;  2OPR A;  1RT2 A;  3OS1 A;  3MAQ A;  3HK2 A;  4E7I A;  4DSE A;  3ZT2 A;  2YNF A;  4C8M A;  4CES A;  4W5O A;  3DRS A;  1DLO A;  2X74 A;  4I7F A;  4W5Q A;  1WLJ A;  2BAN A;  4HCB A;  2HHT A;  1W9H A;  3OYN A;  2GBZ A;  3V9S A;  4IKF A;  2Y1I A;  2HHW A;  2X6S A;  2IDO A;  3KK2 A;  4CJ3 A;  4DSF A;  3IRX A;  1CLQ A;  3LAM A;  3VQ8 A;  4B3O A;  3LZI A;  5KGW A;  1LW2 A;  3S9H A;  1I3A A;  3VQC A;  3VQ9 A;  5FRM A;  3NBP A;  3ITH A;  1WAJ A;  4AHU A;  4KRF A;  3HVR A;  3AVB A;  3HM9 A;  3TAE A;  3NH0 A;  2YHA A;  1JLE A;  1IO2 A;  4BDP A;  4H4M A;  4DWI A;  1TAU A;  3I0S A;  4CHQ A;  4QAG A;  1DTT A;  5FRN A;  4FJ7 A;  4DTR A;  3ASM A;  3MXI A;  1W0H A;  3K5O A;  4CGI A;  3V81 A;  3V9X A;  3AVA A;  3OYJ A;  1C1A A;  1KLM A;  3AVK A;  1J9A A;  3HT3 A;  4Z4E A;  2FBT A;  3DLB A;  4RW8 A;  3KIO A;  1RDD A;  1Q9Y A;  1JLF A;  1KFD A;  1S9G A;  4AIL C;  4GW6 A;  3TAR A;  2FBV A;  1L3T A;  3VQP A;  3WNG A;  1BL3 A;  3AVJ A;  4KHW A;  2RN2 A;  3PUF A;  1NK8 A;  3BGR A;  2OZS A;  1L3U A;  3E01 A;  1JLQ A;  2B6A A;  3LPT A;  3CQ8 A;  3C94 A;  1RT3 A;  5K14 A;  1TK5 A;  1B9F A;  3B6O A;  3LP2 A;  4CF8 A;  3KLH A;  1HQE A;  3HPO A;  1TKD A;  1R0A A;  2W42 A;  5T7B A;  2E6L A;  4YFU A;  3MXM A;  1LAV A;  2HNY A;  3RR8 A;  1YTU A;  4M45 A;  3HST B;  1TK8 A;  2YKM A;  2P5O A;  3KJV A;  1T03 A;  3EY1 A;  2HHS A;  1GOA A;  4CEO A;  4CK2 A;  3G10 A;  4DTP A;  4I9Q A;  4HCC A;  4KB0 A;  3SUN A;  4KHY A;  3M8S A;  3SPZ A;  3DLE A;  3OYL A;  1JXB A;  3MXJ A;  3AVM A;  3NH2 A;  2IAJ A;  3M8P A;  1BGX T;  2D0C A;  2Y1J A;  3OYF A;  3P83 D;  3OVN A;  4CJV A;  4KAZ A;  4CHY A;  3CFR A;  3RMA A;  1KVC A;  4DFP A;  2IC3 A;  3O3H A;  4F2S A;  3QIO A;  1JL1 A;  4L8R B;  3PO5 A;  1C0T A;  1RBU A;  4OPK A;  2EX3 A;  4N47 A;  1GOC A;  3DOK A;  4BWM A;  1QS4 A;  4BDY A;  3LZJ A;  4LY7 A;  2HB5 A;  4CFA A;  3AVN A;  3VA0 A;  2HHU A;  4DSK A;  2OPQ A;  4JRP A;  1JKH A;  1TL1 A;  4JLH A;  1WN7 A;  4N56 A;  1KFS A;  4FJJ A;  4FJ9 A;  1VSD A;  3AVI A;  4Y1D A;  4RW9 A;  1RDA A;  3QNN A;  4B9S A;  1GOB A;  1JXE A;  5SZT A;  1HYV A;  4CJE A;  1UOC A;  3AA2 A;  2YKN A;  1S1V A;  1SL2 A;  4KHN A;  1RDB A;  3CYM A;  5CYM A;  4CFC A;  2XY6 A;  1LWC A;  4W5T A;  3QLH A;  4FLZ A;  2XRI A;  3AVG A;  4Z4C A;  2P5G A;  4CFB A;  4F3O A;  2P51 A;  1VSJ A;  1ZBU A;  2FBY A;  4DTM A;  4AHR A;  3ALY A;  4NYN A;  2VWJ A;  3SUP A;  4DSL A;  2HNZ A;  4B8A B;  1QSY A;  4BAC A;  1TKT A;  3HYF A;  3MEG A;  4FCY A;  1QTM A;  1S1X A;  2BGG A;  1UA0 A;  4DQP A;  4CGH A;  4J2D A;  5CY4 A;  3F9K A;  3VQD A;  3M8Q A;  1VSK A;  2P1J A;  1KVB A;  4OJR A;  1NK0 A;  5J2P A;  3K57 A;  1FKP A;  3LDS A;  3JSM A;  3IAY A;  3NGI A;  2B4J A;  3DLK A;  4OVL A;  3DOL A;  2RPI A;  3S3N A;  4AHV A;  1RBV A;  3K5M A;  1EET A;  4KTQ A;  4DQS A;  2PY5 A;  3SUQ A;  4KI6 A;  4OKK A;  1L5U A;  3KKS A;  1SKW A;  4CEC A;  4ELT A;  4FVM A;  4F8R A;  4BE1 A;  4FLX A;  4G1Q A;  4FK0 A;  3AVL A;  4IG3 A;  4DU1 A;  1TGO A;  3TAF A;  2G8V A;  2GV9 A;  4OKE A;  4CCH A;  2ATQ A;  1S5J A;  1Z25 A;  3PX6 A;  4E89 A;  4W5N A;  3MEE A;  3CFP A;  4JS4 A;  1CZ9 A;  1WSJ A;  2KZM A;  3PY8 A;  4IFV A;  3NE6 A;  4DF8 A;  4CK3 A;  3NGZ A;  3NHG A;  1NJX A;  4M41 A;  3SV4 A;  3VQB A;  3VQE A;  5J2N A;  1X9W A;  1JL2 A;  1RBR A;  4K8Z A;  4O44 A;  3AVC A;  2RKI A;  1ASV A;  1EKE A;  1D9D A;  4BWJ A;  1XI1 A;  4OGE A;  1ZBI A;  1IG9 A;  3C95 A;  2E6M A;  1RT7 A;  2YNG A;  3O3F A;  3CG7 A;  4R5P A;  3CM6 A;  1BQM A;  3HPH A;  3NF6 A;  3V4I A;  3NAE A;  1JLB A;  5CZ1 A;  3OJS A;  4AHT A;  1KCF A;  3O4Q A;  4CIF A;  3F73 A;  5SWM A;  1S1W A;  1MU2 A;  3L3U A;  3AV9 A;  4M3T A;  4CFD A;  3KLG A;  2F8S A;  3VQA A;  2XY7 A;  3ZT4 A;  4LH4 A;  1C0M A;  2HND A;  3NFA A;  3QIP A;  4CJT A;  4YNQ A;  3KTQ A;  1BIS A;  3O3G A;  1S1U A;  3DLG A;  1RT1 A;  2OPP A;  3D45 A;  5HRR A;  3SQ4 A;  1HRH A;  3VA3 A;  4DFM A;  3PX0 A;  4BE0 A;  4E3S A;  3LPU A;  3AVF A;  3T19 A;  3OYK A;  3A2F A;  4DS5 A;  5E41 A;  1KLN A;  4N76 A;  4O55 A;  3RTV A;  3L2Q A;  4IG0 A;  2Z1J A;  3HL8 A;  5HP1 A;  2PYJ A;  4CIG A;  5J2M A;  4KO0 A;  4CGF A;  1B9D A;  1XHX A;  4CJW A;  4DSI A;  4FK4 A;  4B9N A;  4Z0U A;  1RT5 A;  4CEZ A;  1QSS A;  1G15 A;  1SKS A;  1S1T A;  4E1M A;  4FLY A;  3QER A;  1ASW A;  3HO1 A;  5CZ2 A;  2KQ2 A;  4DTX A;  4KFB A;  1L3S A;  2OZM A;  2HHV A;  1RCH A;  3QEI A;  5I42 A;  4DTJ A;  1LW0 A;  1Y97 A;  3ZSW A;  3OYH A;  2HHX A;  4CJR A;  3THV A;  3SV3 A;  2G8K A;  3V9W A;  3DI6 A;  4KKO A;  4PWD A;  4KHQ A;  4FJ8 A;  2X6N A;  3PO4 A;  4CJK A;  1LWF A;  4DU4 A;  3PX4 A;  1IH7 A;  4HUF A;  3VQQ A;  4CHN A;  3SQ2 A;  3K5L A;  4HHT A;  4HTU A;  4DTO A;  3HP9 A;  3U3G A;  1YVU A;  1VSI A;  4FJG A;  1HNV A;  1S6P A;  4CJL A;  1NJZ A;  1XHZ A;  1A5W A;  3H08 A;  1ZYQ A;  1WSG A;  4F2R A;  4DTN A;  4K8X A;  4B08 A;  2BDP A;  3WNF A;  2PZS A;  2Z1H A;  2O4I A;  4CF0 A;  1VSF A;  1K6Y A;  3ZSY A;  2D5R A;  4Y1C A;  3AO4 A;  2ZQB A;  1RBT A;  2HW3 A;  3LAK A;  3OYA A;  3TAM A;  2VG7 A;  4JRQ A;  5FRO A;  5JS2 A;  1DTQ A;  4E7H A;  3K5N A;  3ULD A;  4DSJ A;  3KLF A;  2KTQ A;  1VSL A;  2IGI A;  4LSN A;  3NF8 A;  3DLH A;  4M42 A;  1CZB A;  2G8U A;  2XHB A;  4Z4I A;  2F8T A;  2D0A A;  3O4N A;  3C6U A;  3BDP A;  5C24 A;  2Q3S A;  5J2Q A;  3SNN A;  1NKE A;  3AO2 A;  3S3O A;  1U47 A;  1SL0 A;  1TK0 A;  1QSL A;  2QK9 A;  1LWE A;  3TR8 A;  3NDK A;  1NK4 A;  4RW4 A;  4AHC A;  5HRS A;  4Z4F A;  3DYA A;  1EXQ A;  2LSN A;  3VQ7 A;  4CHP A;  3QNO A;  4DQR A;  4CEQ A;  5C42 A;  5J1E A;  1NOZ A;  4BE2 A; 
#chains in the Genus database with same CATH topology
 3FFI A;  3QEX A;  3L0Q A;  3OYE A;  5GIO A;  4FJK A;  4DQQ A;  3CFO A;  1GLF O;  3EZW A;  4ELU A;  3EN9 A;  1RTH A;  4CZJ A;  4JNE A;  1BHL A;  3OYD A;  1C6V A;  2Q31 A;  3ZET A;  3OW2 M;  3H3N O;  3RMC A;  5EXW A;  2HMI A;  1U4B A;  4ELV A;  3RRH A;  2PYL A;  3VEO A;  3SQ1 A;  2DFF A;  1JCG A;  1T3V A;  2W40 A;  1S3X A;  1ASU A;  1TV6 A;  4CGD A;  2O8D B;  3CJA A;  4JS5 A;  3R8E A;  5HL7 L;  3AA5 X;  3CCQ N;  2WON A;  3I8D A;  2HST A;  3L2R A;  3LWM A;  2KFZ A;  5I3U A;  4O8K A;  1IBL K;  4O8U A;  4Z4G A;  3R6M A;  2ASO A;  5C25 A;  1XC9 A;  1WBD A;  3RR7 A;  4FPB A;  5CYQ A;  3ZSV A;  2A42 A;  4FLW A;  2DFE A;  3DXK A;  3L2W A;  1VQM N;  1RT4 A;  4ID1 A;  3OY9 A;  3QFP A;  4KHS A;  5GIN A;  1VK0 A;  3TSU A;  4CZF A;  5AQO A;  4DG1 A;  1YJ9 N;  2KZZ A;  3CJB A;  1YT3 A;  1ITG A;  2GTD A;  3OA9 A;  2BE2 A;  4Q0B A;  4H4O A;  4CGG A;  4JHD A;  2E2P A;  4DLG A;  5DK5 A;  4IEE A;  3WXM B;  3ZT3 A;  1RT6 A;  4CIE A;  1XUP O;  4O4G A;  2IIR A;  4A62 A;  3NMU A;  2HMP A;  4B9L A;  4PUO A;  4B1W B;  3TSQ A;  4LD0 A;  5AQL A;  2FXU A;  1N8R O;  3VF2 A;  1NKB A;  1U49 A;  4K0K K;  1RDU A;  2A6A A;  4JKE A;  4DFK A;  4CER A;  3UIQ A;  1DGK N;  2IOC A;  2NRH A;  1RTI A;  5B8H A;  3PLA A;  4C8L A;  2VWK A;  1X3M A;  3OYI A;  1NK7 A;  5EOY A;  4B9V A;  3QIN A;  3M5R A;  1RTJ A;  2NRW A;  3L2U A;  3RRG A;  5C12 A;  4BDZ A;  1C1B A;  4B9M A;  1QQM A;  2ZJQ L;  4JI5 K;  1NM1 A;  1LAW A;  1IKW A;  2G8F A;  5BPN A;  1FK9 A;  3CD6 N;  1VQ7 N;  3DRP A;  2QM1 A;  3HPG A;  3ZSQ A;  4OLA A;  3NH1 A;  1ZC6 A;  3A5O C;  1ZBF A;  4J8F A;  4DS4 A;  4C1N K;  3RSE B;  4O0I A;  1U6Z A;  1NJW A;  4FW2 A;  5AQN A;  1A5X A;  4JI6 K;  3RMB A;  2V51 B;  3WNH A;  4CF1 A;  4DQ8 A;  1HQU A;  2ZJR L;  1KTQ A;  2J4R A;  3THX A;  3ULE B;  4FZX C;  3V1Q A;  3AVH A;  1NJY A;  3SPY A;  3O9U A;  3C0B A;  3K2P A;  5AQM A;  3CHW A;  1TYQ A;  1J5O A;  4N5S A;  2QXL A;  4H5V A;  2VYP A;  4CHO A;  3QEW A;  3TU5 A;  3SJJ A;  4LF8 K;  3ZSX A;  1L3V A;  3QEV A;  4WFA L;  1NGF A;  3PV8 A;  3VEZ A;  3CMA N;  3E9L A;  2A1S A;  4L3Q A;  2P9I A;  4CF2 A;  1T05 A;  3TAN A;  3DMJ A;  4I2P A;  4M3Z A;  2VG5 A;  4CI6 A;  4AH9 A;  4NXN K;  3O4W A;  1R59 O;  4MO5 A;  1W2B M;  5AQR A;  4FJN A;  4BRQ A;  3MAQ A;  4E7I A;  3ZT2 A;  2YNF A;  1T6D A;  4DUZ K;  1NWK A;  1NLV A;  5EVZ A;  1WLJ A;  4HCB A;  2AA4 A;  1MWK A;  3VEW A;  3UKR A;  2IDO A;  4CJ3 A;  3C65 A;  1J6Z A;  3Q7B A;  3BF3 A;  1LW2 A;  2CH5 A;  3AAP A;  1KD1 O;  4WFB L;  1HKB A;  3M1F A;  3TAE A;  3MN5 A;  4K25 A;  4JK7 A;  1HKG A;  4WQ5 C;  4QAG A;  3UKU B;  4NLC A;  1N34 K;  3K5O A;  1YF5 L;  3HT3 A;  3THW A;  4Z4E A;  2FBT A;  4RW8 A;  3KIO A;  2E20 A;  1RDD A;  3D2E B;  1JLF A;  4WCE L;  2RN2 A;  3PUF A;  3MDQ A;  3E01 A;  2B6A A;  3CQ8 A;  3C94 A;  1TKD A;  4B3M K;  2UXD K;  4YFU A;  1QHA A;  1LAV A;  1TK8 A;  2P5O A;  2HHS A;  3AGR A;  3FZH A;  3SUN A;  3DLE A;  1JXB A;  3AVM A;  4BR5 A;  3M8P A;  3P83 D;  2P9K A;  4RTF D;  4CHY A;  4CBU A;  2QWQ A;  3C7N B;  3O3H A;  4DUY K;  4L8R B;  1VQN N;  4N47 A;  2Q2R A;  4BWM A;  1QS4 A;  4BDY A;  4CFA A;  3AVN A;  4DSK A;  4JRP A;  4FJJ A;  2W6K A;  4CBW A;  4OPA A;  1GOB A;  2E88 A;  4EFH A;  3QLH A;  4BC2 A;  2P5G A;  3DXM B;  4CFB A;  4JKC A;  2UU9 K;  2P51 A;  4BC5 A;  4M7Y A;  4DTM A;  5M1K A;  2HNZ A;  4PKH A;  1S1X A;  2BGG A;  4J2D A;  5CY4 A;  3F9K A;  3WXI A;  1KVB A;  3SK3 A;  5J2P A;  3W3D A;  4ILG B;  3I33 A;  3C6A A;  3CI5 A;  3DOL A;  2RPI A;  3QBX A;  3K5M A;  4KI6 A;  4OKK A;  3A5L C;  5C2F A;  5FPE A;  3DLL L;  4F8R A;  4BE1 A;  3EKS A;  1XNQ K;  1WSJ A;  1BA0 A;  4CK3 A;  3NHG A;  2O8B B;  5AZI B;  4M41 A;  3VQB A;  4WF9 L;  1EKE A;  1D9D A;  1VQK N;  3D7E O;  4FWQ A;  3VET A;  3CG7 A;  3U4L A;  1SS6 A;  3HPH A;  4R5P A;  3J8A A;  3O4Q A;  4CIF A;  3BP8 A;  5SWM A;  1S1W A;  4KH5 A;  5BRH A;  2NRT A;  3KLG A;  4Z94 A;  2XY7 A;  1EWR A;  2HND A;  1HPM A;  5HRR A;  5CR4 A;  3PX0 A;  3VA3 A;  4DFM A;  2YCH A;  4E3S A;  3AVF A;  3OYK A;  3A2F A;  4N76 A;  4FWO A;  4DHY A;  2W41 A;  5J2M A;  1XHX A;  4B9N A;  3BZC A;  1QSS A;  3EL2 A;  3H46 O;  1S1T A;  3QIC A;  2OZM A;  2HHV A;  4KFB A;  3VGL A;  3DI6 A;  4LF6 K;  3CXC M;  1V4T A;  3VQQ A;  3GDQ A;  2IVN A;  3K5L A;  4HHT A;  2O8F A;  2FSN A;  4XH1 A;  2HOE A;  3QB0 A;  1QZ6 A;  4DV4 K;  1HNV A;  4FJG A;  1A5W A;  4BG8 A;  3E1Y A;  3CPE A;  4B08 A;  1Q18 A;  4DV2 K;  3CC7 N;  1NMN A;  2PZS A;  4CF0 A;  4JHD B;  3ZSY A;  5AQF A;  4JKG A;  5KQ8 A;  5DM6 L;  3HBT A;  4CZK A;  2HW3 A;  4CJ7 A;  2VG7 A;  4E7H A;  3ULD A;  4DSJ A;  3KLF A;  5AQT A;  1C0G A;  4BRL A;  4BQZ A;  4M42 A;  1ATN A;  1CZB A;  2P9P A;  3VES A;  5LMU K;  3FFK B;  1HR0 K;  3C6U A;  2E5L K;  2Q3S A;  3FZM A;  4YOT A;  5J2Q A;  2GWJ A;  1SL0 A;  1VQ9 N;  1LWE A;  1VQ8 N;  3NDK A;  4RW4 A;  4IWV A;  4Z4F A;  3M6G A;  3IKM A;  4CHP A;  3QNO A;  1ATR A;  3PSF A;  1WSI A;  1BWF O;  4CW7 B;  4E0D A;  2G8W A;  2Q36 A;  4QCL A;  4I9L A;  5AQZ A;  4C8N A;  1T6C A;  4OKJ A;  4DR1 K;  1UWB A;  2YI1 A;  4BG9 A;  1E4G T;  3ZT1 A;  4NB4 A;  1J5E K;  2P9L A;  2I5J A;  4FYD A;  1HYS A;  3OYC A;  4CJS A;  4FJM A;  3D0P A;  4ID5 A;  3VF6 A;  2HVI A;  4BRD A;  2Z1I A;  1N36 K;  1ATS A;  1VQ6 N;  4ZTJ A;  4EZ6 A;  4UY8 O;  5FPN A;  4CJU A;  4IDK A;  2EWS A;  5LL6 Z;  1Z26 A;  4FJL A;  1SV5 A;  3N4P A;  4BRF A;  4DU3 A;  3IFR A;  5EX5 A;  1N6Q A;  4M3Y A;  3G4S N;  3L6Q A;  4E7K A;  4JI8 K;  2HBK A;  5AJ3 K;  3U3Y A;  4DTU A;  4LF9 K;  2NUB A;  4H0V B;  3M8R A;  1GLC G;  1WNS A;  1Q9X A;  3THY A;  5F1X A;  5BR8 K;  5E26 A;  3TAG A;  2ITM A;  4EP4 A;  1KVA A;  1SL1 A;  2P9S A;  4DQI A;  2JGU A;  4B1U B;  1OVY A;  2HHQ A;  1TVR A;  4CJP A;  4FWP A;  4CJF A;  1C0U A;  2ITG A;  1KXP A;  4PA1 A;  4CE9 A;  4M3X A;  4FSV A;  2QWP A;  4F3T A;  1VQ5 N;  1CXQ A;  3CER A;  2AJQ A;  1HNI A;  1WAF A;  3EO3 A;  4BRI A;  2YHB A;  5LJV A;  1FW6 A;  2ZM6 K;  1OH6 A;  3KKR A;  4JI4 K;  3BZK A;  4K43 A;  4K42 A;  1HMV A;  4NCG A;  3QEP A;  2YV0 X;  4NYF A;  3NF9 A;  4H0X B;  2ZGZ A;  2RF2 A;  3TAP A;  3SBT A;  4GV3 A;  3ZSR A;  1WSF A;  4DV3 K;  4KHU A;  4CGJ A;  2OYQ A;  4YDU A;  1Q8I A;  2O8C B;  1Z05 A;  1WUA A;  2NRX A;  3L2V A;  1HUX A;  2B5J A;  4PQU A;  2QWM A;  2GUI A;  4A5A A;  1BQN A;  1VSH A;  1IKX A;  1H1V A;  3O08 A;  3CIP A;  2WTU A;  2ZE2 A;  3OYG A;  5EU7 A;  1DEJ A;  4KPY A;  4GV9 A;  1RBS A;  4GVE A;  5C15 A;  4RW7 A;  2NRV A;  3O9Q A;  4CJ5 A;  1U45 A;  1YTA A;  3AO5 A;  3T3F A;  2EHG A;  4J2E A;  2H3G X;  5KPR A;  2W6L A;  4MO4 A;  4EIA A;  3J7A P;  4W5R A;  3J7Z O;  4F9O A;  3MX2 A;  3ZT0 A;  3KD5 E;  5IWA K;  5IT9 O;  3KD1 E;  2YNI A;  5DMR A;  3L3V A;  3LAN A;  4WFN L;  1NOY A;  1ZBL A;  1TL3 A;  4KI4 A;  1NGD A;  4BRN A;  4ICL A;  1UAX A;  3HOS A;  3VTH A;  1QE1 A;  3HOT A;  1BI4 A;  5DM7 L;  1U48 A;  1XMO K;  2HF4 A;  3L4Q A;  3E9O A;  2P9K B;  3CCV N;  1TKZ A;  3QO9 A;  4FJX A;  3CCJ N;  3VTI A;  4FXD A;  1HJR A;  4EZ9 A;  1JLA A;  4GVM A;  4WYB A;  4FWS A;  2KFN A;  4IBN A;  4CED A;  3U6F A;  1U2V A;  4V19 S;  3LDQ A;  3TTF A;  3O8M A;  3VER A;  3MEC A;  3KK3 A;  4I6M B;  1NK9 A;  2WBN A;  1WSH A;  1NK6 A;  2WOM A;  4GMJ B;  4FJ5 A;  2DY4 A;  4IZ9 A;  2F9T A;  3A8Y A;  4FZZ A;  4LH5 A;  3L4I A;  1C1C A;  1JLC A;  1P8Z A;  4TSX A;  3WQT A;  2E2O A;  4DR7 K;  3O9R A;  3AA3 A;  4JK9 A;  5ADX H;  4HUE A;  2V7Z A;  3VQ5 A;  2IS3 A;  3R1X A;  3TAQ A;  2XY5 A;  4Q5V A;  1YIT N;  1TUY A;  3JYT A;  1MA9 B;  1BCM A;  2OPR A;  3OS1 A;  2O8E A;  3HK2 A;  3I8B A;  4CBX A;  2A40 A;  4CES A;  4W5O A;  1VQP N;  3BY5 A;  1DLO A;  4I7F A;  4W5Q A;  3D2F B;  2BAN A;  3EEQ A;  2HHT A;  3OBY A;  3V9S A;  2HHW A;  3CF5 L;  2YJF A;  3IRX A;  1CLQ A;  4U7B A;  3LAM A;  1YI2 N;  4DV5 K;  5KGW A;  1NBW A;  3O1W A;  3WXJ A;  1NNE A;  3NBP A;  3ITH A;  4PKI A;  3WEE A;  3AVB A;  3D6R A;  3TTD A;  3HM9 A;  1JLE A;  1IO2 A;  3ZYY X;  4H4M A;  4DWI A;  1ESV A;  4JV5 K;  3FE1 A;  4ISG A;  4CGI A;  3F5T A;  1BU6 O;  3OYJ A;  3R3L A;  4YOV A;  2QWR A;  3DLB A;  4IJN A;  4NO7 A;  2HBL A;  3GBT A;  4GW6 A;  3TAR A;  3VQP A;  3AVJ A;  1EO1 A;  1TK5 A;  1JLQ A;  3H45 C;  4RCH A;  5K14 A;  2QWN A;  1HQE A;  4WQ4 C;  3O1B A;  3HPO A;  5T7B A;  2E6L A;  3MWP A;  3RR8 A;  2YKM A;  2QI2 A;  3KJV A;  1T03 A;  4AM6 A;  1M1K O;  4CK2 A;  3G10 A;  4DTP A;  3FZK A;  4KHY A;  3SPZ A;  2YHY A;  4Y0W A;  3OYL A;  5C2D A;  3CET A;  1BGX T;  2D0C A;  4AM7 A;  2VGN A;  3O9S A;  2OTL N;  3PO5 A;  1RBU A;  2EX3 A;  2E2Q A;  4XEI A;  4LFB K;  5F0X A;  4IOC L;  2HB5 A;  2CGL A;  3T1Y K;  2HHU A;  4FWK A;  4JKA A;  1IBK K;  3QBW A;  1RGI A;  1JKH A;  4JLH A;  1QQO A;  4N56 A;  4G9Z A;  3CC4 N;  2O8F B;  1VSD A;  3QNN A;  4B9S A;  3HTV A;  2YKN A;  4KHN A;  1RDB A;  4CFC A;  3LM9 A;  4IOA L;  4FLZ A;  2XRI A;  4Z4C A;  4F3O A;  4B1V A;  1VSJ A;  2NRR A;  3DWL A;  3SUP A;  4DSL A;  2QWL A;  3W0L A;  3NVK A;  4B8A B;  3OHR A;  3HYF A;  2P9P B;  4X65 K;  1O13 A;  1VQL N;  1VSK A;  1XQS C;  2P1J A;  4B1Y B;  3B8A X;  3G25 A;  1Q81 O;  3S41 A;  4BRC A;  3S3N A;  1IG8 A;  4AHV A;  1RBV A;  4HTL A;  1L5U A;  4CEC A;  4ELT A;  1NGE A;  1OVQ A;  3AVL A;  2G8V A;  1TGO A;  4CCH A;  3A0I X;  3I55 N;  1Z25 A;  1CZ9 A;  4DR3 K;  4DF8 A;  3RVC A;  5J2N A;  3KK7 A;  3WQU A;  4BRO A;  3BEX A;  4OGE A;  4U67 L;  2E6M A;  1RT7 A;  4WQ5 A;  3O3F A;  1BQM A;  3P39 A;  3NF6 A;  3V4I A;  3NAE A;  1JLB A;  5CZ1 A;  4XH5 A;  2FF3 B;  1MU2 A;  2P9N B;  2BH1 A;  4CFD A;  2F8S A;  3VQA A;  3MX5 A;  3KTQ A;  1YAG A;  1BIS A;  3O3G A;  1RT1 A;  2OPP A;  3D45 A;  3J7Y P;  3L2Q A;  2Z1J A;  3ID8 A;  5HP1 A;  4KO0 A;  4CJW A;  4DSI A;  1XC3 A;  2D1K A;  4CEZ A;  1G15 A;  3HRG A;  1SKS A;  1QVF M;  4JI3 K;  2V52 B;  4FWR A;  3IUC A;  1Z6R A;  3ZLJ A;  4X62 K;  3QEI A;  4DB3 A;  5I42 A;  3ZSW A;  5BR9 A;  2HHX A;  3LL3 A;  3V9W A;  4KKO A;  4PWD A;  4CD1 A;  4CJK A;  1YJN N;  1LWF A;  4NLB A;  1IH7 A;  1Y64 A;  2WFB A;  1YVU A;  1S6P A;  1NJZ A;  3H08 A;  3HSC A;  1NMD A;  4DTN A;  4PHT X;  4R79 A;  2Z1H A;  2O4I A;  1VSF A;  2ZWH A;  5AQG A;  4YOY A;  1W97 L;  3AO4 A;  4DV7 K;  3QFU A;  3TAM A;  1DTQ A;  2KTQ A;  1VSL A;  4JD2 B;  2CH6 A;  3DLH A;  3U9Z A;  1GLB G;  3CJ9 A;  5AQI A;  4Z4I A;  4BC3 A;  2F8T A;  2D0A A;  5C24 A;  4LF5 K;  3SNN A;  1KAX A;  3S3O A;  1U47 A;  2E1Z A;  3VPZ A;  2QK9 A;  3Q7C A;  4O5F A;  1J9A A;  1NOZ A;  2Z1G A;  4IDH A;  1VSM A;  3TWH A;  1RNH A;  4FWM A;  3HVT A;  5AFU H;  5AQY A;  1F21 A;  2O8D A;  2JWK A;  4DCH A;  3ENB A;  1K8K B;  5D3G A;  3G6E N;  5HBM A;  3ENO A;  2KW4 A;  4LSL A;  3VEX A;  1K9M O;  5AQJ A;  3AO1 A;  4FK2 A;  4FLT A;  3O9T A;  1VRT A;  3ID6 A;  4H8K A;  3VQ4 A;  2F7T A;  5JLH A;  2QTD A;  1J54 A;  1M90 O;  1TAQ A;  4BR7 A;  1S6Q A;  3HXM A;  3HJF A;  1S72 N;  4J2B A;  3B6P A;  2F9W A;  3OS0 A;  4OPH A;  5BRE A;  4OX9 K;  4DMN A;  1TKX A;  3LDL A;  4KB1 A;  3MMV A;  4DF4 A;  1I94 K;  4YOU A;  1X3N A;  3ZET B;  2RHK A;  1X1P A;  5E84 A;  1D8Y A;  4C8K A;  4NCB A;  1D9F A;  3OYM A;  4FO0 A;  4FLV A;  1SUQ A;  1SQK A;  2QEX N;  1Q86 O;  3CPW M;  4E1N A;  4E7L A;  4JK8 A;  5M1F A;  3TI0 A;  4GKJ K;  4FM2 A;  4CJQ A;  4FWN A;  2F96 A;  4BGA A;  4OLB A;  5JS1 A;  1T7P A;  5JVG L;  1Q82 O;  4DFJ A;  2ZGY A;  5KRS A;  3OS2 A;  4KTZ A;  3UE5 A;  2O4G A;  5HRN A;  1W7A A;  2A41 A;  3DM2 A;  4OPJ A;  1EP4 A;  4H0P A;  3K0S A;  2QKB A;  1RIL A;  1B92 A;  1EX4 A;  3HI0 A;  4O0J A;  3DXK B;  5FPD A;  2O8E B;  1FKO A;  5I9E B;  4M63 C;  3CCS N;  1IKV A;  1NGB A;  3E66 A;  3EZ5 A;  3C6H A;  1A5V A;  3S3M A;  5C0Y A;  4RG8 A;  4IXC A;  1GLJ O;  2KHO A;  5KTQ A;  3DLR A;  1P90 A;  3EE8 A;  4CEB A;  4DR2 K;  5JIC A;  4FJI A;  3MK6 A;  1CXU A;  5ELZ A;  1REV A;  3RSE A;  4BVP A;  3CCR N;  1WBB A;  3WXL A;  3T1A A;  4FLU A;  2XO7 A;  5BPL A;  3CCU N;  1S22 A;  3KVG A;  3IMX A;  3MED A;  3MCA B;  1KRP A;  2G8H A;  1EQY A;  3ULE A;  3OYB A;  1HLU A;  5EY4 A;  1WB9 A;  4CEE A;  1HX1 A;  4CK1 A;  3AA4 A;  2HBJ A;  5H1S Q;  4CZM A;  3LAL A;  4DLE A;  1DKG D;  1D4X A;  1U04 A;  3CQY A;  1O1W A;  1YIJ N;  5KRT A;  1C0F A;  2V7Y A;  4E19 A;  3KLE A;  1XWL A;  4UQG A;  4JI2 K;  3TSP A;  1BIZ A;  4KH6 A;  1HNW K;  5AZJ A;  2YNH A;  3GE1 A;  3SLC A;  2D0B A;  4FZY A;  1RDW X;  3ZX0 A;  2FC0 A;  1IKY A;  3ZEU A;  4BY9 C;  4N41 A;  1NKC A;  4JEP A;  4FPA A;  1WSE A;  1T8E A;  4QS7 A;  2BTF A;  4B9T A;  1G99 A;  1FXX A;  4A5B A;  4BVO A;  3VGM A;  4CEF A;  1JLG A;  4CJ4 A;  3THX B;  3O6W A;  2VG6 A;  4BR4 A;  4E7J A;  4FJH A;  1K8A O;  4HVJ A;  1IJJ A;  3LWL A;  4MFB A;  4LFA K;  4BRM A;  5BRF A;  3O5B A;  4BRP A;  2IVO A;  1TYQ B;  4C8O A;  5GAH P;  4YHH K;  4LF4 K;  4DSE A;  3KZB A;  4C8M A;  3LM2 A;  3DRS A;  3UKU A;  1JCE A;  1OH7 A;  3TPQ A;  4GV6 A;  4CZG A;  3WXK A;  1W9H A;  3FGU A;  2Y1I A;  2X6S A;  3KK2 A;  1BUP A;  2P9I B;  1HKC A;  2Q0R A;  3SAH A;  4B3O A;  3HZ6 A;  3LDO A;  2D0P A;  1I3A A;  3FZF A;  3VQC A;  1GLL O;  2UXB K;  1VHX A;  1WAJ A;  5C10 A;  3R9P A;  2YHA A;  4BDP A;  2UUA K;  5BN9 A;  5TKY A;  3VEY A;  4CHQ A;  1LCU A;  1GLD G;  4DTR A;  2FLO A;  2CGJ A;  3MXI A;  3AGK A;  1BOT O;  5GIP A;  3LDN A;  3V9X A;  2QWO A;  3AVA A;  3WUH A;  3UKR B;  3CME N;  1K73 O;  3C7N A;  4B3R K;  1GLA G;  1S9G A;  1L3T A;  4B9Q A;  4AIL C;  2FBV A;  3WNG A;  5KPZ A;  1KQS M;  4MDB A;  3BGR A;  2OZS A;  3NVM A;  1RT3 A;  3B6O A;  2W42 A;  4RWT A;  1HNX K;  1YTU A;  4B3T K;  5ADX A;  4CEO A;  3SBG A;  4HCC A;  1QVG M;  3VGK A;  3THW B;  3OYF A;  4CJV A;  3DXM A;  4KAZ A;  3CFR A;  3RMA A;  1KVC A;  2IC3 A;  4PKG A;  1BDG A;  5LMN K;  2IVP A;  5AQX A;  3WT0 A;  4YDU C;  1Q7Y O;  3CQX A;  4AQY K;  4E1J A;  4FJ9 A;  4DKW A;  5AQK A;  1WN7 A;  5AQQ A;  1KFS A;  4JN4 A;  4BRK A;  4FOE A;  4B1Z A;  5SZT A;  4CJE A;  1UOC A;  3AA2 A;  1NGJ A;  1S1V A;  5AQH A;  1SL2 A;  3CYM A;  3H3O B;  2XY6 A;  4W5T A;  2UYT A;  3AVG A;  4H03 B;  2HF3 A;  1ZBU A;  3U8X A;  3SJH A;  3FLC O;  4NYN A;  1BG3 A;  3OBW A;  4AHR A;  2VWJ A;  1QSY A;  3SMS A;  1TKT A;  4FWL A;  4FCY A;  1QTM A;  3P4I A;  2O8B A;  5AZI A;  2ZF5 O;  4YY3 K;  4OJR A;  3P31 A;  3K57 A;  4B1X B;  1T44 A;  3JSM A;  5M1O A;  3NGI A;  2B4J A;  3DLK A;  4OVL A;  1EET A;  4KTQ A;  4DQS A;  2PY5 A;  1VAZ A;  3K9J A;  2GWK A;  3GG4 A;  4BR0 A;  4H5T A;  4FLX A;  4IG3 A;  4DU1 A;  2GV9 A;  4OKE A;  5CE3 A;  2ATQ A;  3CCM N;  1S5J A;  3PX6 A;  4CVN E;  5GAG P;  2KZM A;  3SV4 A;  1JL2 A;  1RBR A;  3AVC A;  1ASV A;  1HJO A;  1XI1 A;  2YNG A;  5JVH L;  1NU0 A;  3CM6 A;  3F73 A;  3L3U A;  3AV9 A;  2QA4 N;  4M3T A;  4CZI A;  2NRZ A;  4LH4 A;  3NFA A;  3QIP A;  4YNQ A;  1S1U A;  2BUP A;  1HRH A;  1EWQ A;  3LPU A;  3T19 A;  4DS5 A;  3T7Z A;  4WQ4 A;  4BR2 A;  4OO1 J;  4CZE A;  2PYJ A;  1B9D A;  3KHY A;  4FK4 A;  2VGM A;  5F2R A;  1RT5 A;  2QW9 A;  4A2B A;  5HOO A;  3HO1 A;  2KQ2 A;  1OKJ A;  1RCH A;  4IOX A;  4DTJ A;  1LW0 A;  2OTJ N;  3OYH A;  3ATV A;  3SV3 A;  2Q1N A;  2G8K A;  4KHQ A;  4KH4 A;  3PO4 A;  2E8A A;  4DR6 K;  4HTU A;  4A57 A;  1KAZ A;  3T1H K;  1IBM K;  4YOR A;  4M7X A;  1XHZ A;  2D0O A;  2UUC K;  1WSG A;  4YOW A;  4F2R A;  4AF1 A;  5CHI A;  5AR0 A;  2BDP A;  3WNF A;  1ILY A;  5MLC Q;  2ZQB A;  1RBT A;  3OYA A;  4JRQ A;  5JS2 A;  3GOI A;  3K5N A;  4A59 A;  4H5W A;  3A5N C;  2IGI A;  4LSN A;  2G8U A;  2XHB A;  1YVN A;  5LJW A;  3O4N A;  2VQF K;  1NKE A;  1XMQ K;  1TK0 A;  1QSL A;  3TR8 A;  5HRS A;  4AHC A;  1VQ4 N;  3VEN A;  2LSN A;  3VQ7 A;  1V4S A;  4PL7 A;  5LY3 A;  4DQR A;  1ZBS A;  4FVU A;  3EKU A;  2GX9 A;  4YOX A;  4QOZ B;  3SQ0 A;  2FSK A;  4JKG B;  1HPZ A;  3JXU A;  2Q0U A;  4A2A A;  4BRA A;  4J2A A;  1VRU A;  2R7Y A;  3H6E A;  3C6T A;  4H5N A;  4QS9 A;  4FW1 A;  3NF7 A;  1GLE G;  4JAX A;  2P9U A;  1LV5 A;  4BRE A;  2JLE A;  3LP1 A;  3FZL A;  3SZ2 A;  4CD3 A;  2KKZ A;  3IG1 A;  1NGI A;  2X78 A;  3OJU A;  5FDL A;  4CF9 A;  2OA8 A;  1HYZ A;  1S9E A;  2A1R A;  5AQS A;  4H5R A;  3VQ6 A;  5AQP A;  4BR9 A;  1X9S A;  1SZ2 A;  2E1Y A;  1NGG A;  2E4L A;  3SYZ A;  2DTU A;  3IS9 A;  4O5B A;  1KSP A;  1SKR A;  4ZTF A;  1QZ5 A;  1LOT B;  4KHP K;  1BIU A;  1RTD A;  3VEV A;  3BF1 A;  3RWU A;  3EYZ A;  4XIU A;  1SAZ A;  2P9L B;  5AZJ B;  2PAV A;  2QXF A;  4CZH A;  3NCI A;  5AQV A;  4B9U A;  1RDC A;  4IO8 A;  2FBX A;  3DJC A;  3T69 A;  3ZEU B;  4KRE A;  3VN5 A;  3DRR A;  4KV8 A;  3CC2 N;  2QKK A;  1QQC A;  3P38 A;  5KI6 A;  3NGY A;  4IFY A;  2DFH A;  2AP1 A;  4AHS A;  4C23 A;  5GAE P;  5AFU A;  3SUO A;  4CEA A;  3AAQ A;  4JI1 K;  2KLA A;  2HBM A;  2HHH K;  2O8C A;  3AAR A;  4FM0 A;  4NCA A;  1JCF A;  3THY B;  4NXM K;  1D5A A;  4ILH A;  3LDP A;  2P9S B;  2E2N A;  3LP3 A;  2HVH A;  3A5M C;  3KK1 A;  4CHZ A;  3KWG A;  5HRP A;  5KQD A;  3QES A;  3SCX A;  1X9M A;  4FOI A;  2UXC K;  4BRG A;  1J53 A;  1QHT A;  1ZBH A;  3P5J A;  4H0O A;  4ILJ A;  2F4V K;  4OGC A;  4IEI A;  3V9Z A;  5KPT A;  3I0R A;  4HUG A;  3ZSZ A;  3CCL N;  3I56 N;  3UB5 A;  3V1O A;  3G0Z A;  4M3U A;  4M3R A;  1VQO N;  2NZT A;  4JI0 K;  4F4K A;  2RE2 A;  2WC9 A;  5HRO A;  4PY5 A;  3KWI A;  4Z4H A;  3O80 A;  5AQW A;  2DPN A;  3V9U A;  3QDK A;  3K58 A;  3SAG A;  4GY2 B;  1YHQ N;  2Q97 A;  4A61 A;  5HLF A;  2A5X A;  1VSE A;  4EAH D;  1UA1 A;  5KGX A;  1OH5 A;  5A2Q O;  4B8C A;  4ZHR A;  1NGC A;  3QML A;  3PIP L;  4I2Q A;  4IFE A;  4I6M A;  3CM5 A;  3V1R A;  5JMV A;  3HP6 A;  3LP0 A;  1YJW N;  2YHX A;  1ZXO A;  3QET A;  2GUP A;  1TUU A;  3TAB A;  1NGA A;  4MQ3 A;  2ETJ A;  3F9M A;  3V6D A;  1NK5 A;  2G8I A;  1N5Y A;  4ISF A;  4K41 A;  1BCO A;  3ISN C;  4WE1 A;  2I7P A;  3WNE A;  4MLH A;  1NG9 A;  3P1G A;  3KLI A;  4DR4 K;  3ZX3 A;  3MN6 A;  3AO3 A;  2YHW A;  4JYA K;  3RMD A;  2XY8 A;  3ZCM A;  3ZSO A;  4FM1 A;  3D2F A;  3HM8 A;  2ZD1 A;  4DTS A;  3E9P A;  3F2K A;  2WUS A;  4M3W A;  3SI6 A;  4JI7 K;  4IJA A;  1BI4 B;  2PBD A;  1I39 A;  4GKK K;  2OPS A;  3JAM O;  4RW6 A;  4KTW A;  4EP5 A;  1JJ2 M;  1KAY A;  3K59 A;  3L8B A;  1RT2 A;  1U2V B;  2OCE A;  4FL9 A;  4MDA A;  3VMF B;  2X74 A;  2FF6 A;  4LFC K;  3OYN A;  2GBZ A;  4IKF A;  4DSF A;  3VQ8 A;  3LZI A;  3AY9 A;  3S9H A;  1IV0 A;  3MWT A;  3VQ9 A;  5BN8 A;  5FRM A;  4AHU A;  4KRF A;  3HVR A;  3CJ7 A;  3NH0 A;  1TAU A;  2PFU A;  2NLX A;  3I0S A;  3TTC A;  1QQN A;  1DTT A;  5FRN A;  4FJ7 A;  4H0Y B;  3ASM A;  5M1Q A;  3N4Q A;  4IO9 L;  1W0H A;  3V81 A;  5FLX O;  1N32 K;  4DR5 K;  1C1A A;  1KLM A;  3AVK A;  3GL1 A;  1YXQ A;  1X9J A;  5M1N A;  4DV6 K;  4LF7 K;  5BPM A;  1Q9Y A;  2JWL A;  1KFD A;  1BL3 A;  3ZX2 A;  4KHW A;  1NK8 A;  1E4F T;  1L3U A;  3LPT A;  4JKD A;  1B9F A;  3LP2 A;  2ASP A;  3WEE B;  4CF8 A;  4CZL A;  3KLH A;  1R0A A;  2OAN A;  3OTO K;  3MXM A;  2HNY A;  2ZJP L;  4M45 A;  3HST B;  4ISE A;  3EY1 A;  1GOA A;  1BA1 A;  4I9Q A;  4KB0 A;  1BO5 O;  3M8S A;  3MXJ A;  3NH2 A;  3PIO L;  2IAJ A;  2Y1J A;  3IDH A;  3OVN A;  1E3M A;  4DFP A;  4F2S A;  3QIO A;  1JL1 A;  3VOV A;  1C0T A;  4OPK A;  1GOC A;  3DOK A;  3LZJ A;  4LY7 A;  3DAW A;  5TKW A;  3VA0 A;  2OPQ A;  5AQU A;  3SAF A;  1TL1 A;  3AVI A;  4Y1D A;  4RW9 A;  1RDA A;  1JXE A;  1HYV A;  3EE9 A;  5CYM A;  1YUW A;  1LWC A;  1N33 K;  4HWI A;  2FBY A;  4BRH A;  3ALY A;  1MWM A;  4PL8 A;  4BAC A;  3MEG A;  4KBO A;  2I7N A;  2UUB K;  1CZA N;  1UA0 A;  1WOQ A;  4CGH A;  4DQP A;  3VQD A;  3M8Q A;  1NK0 A;  1FKP A;  2YX6 A;  3LDS A;  4QS8 A;  3H1Q A;  3IAY A;  4DV1 K;  2CGK A;  3CJ1 A;  3SUQ A;  3KKS A;  1SKW A;  4EHT A;  4FVM A;  2P9N A;  2GEL A;  3JS6 A;  4G1Q A;  4X66 K;  4FK0 A;  3TAF A;  1MDU B;  4W5N A;  4E89 A;  3MEE A;  3CFP A;  4JS4 A;  3PY8 A;  4B3S K;  4IFV A;  3NE6 A;  2VQE K;  2P9U B;  5GAD P;  1FJG K;  3NGZ A;  1NJX A;  3VQE A;  1XNR K;  1X9W A;  4K8Z A;  2NNW A;  4O44 A;  2RKI A;  1ZBI A;  4BWJ A;  1IG9 A;  4X64 K;  3MCP A;  3C95 A;  3J81 O;  3D2E A;  2GEM A;  3OJS A;  5BRD A;  4AHT A;  1KCF A;  3MN7 A;  4BGB A;  2FSJ A;  3ZT4 A;  3U9D A;  1C0M A;  3K9K A;  4CJT A;  3DLG A;  3SQ4 A;  4BE0 A;  5M1P A;  1KLN A;  5E41 A;  2ASM A;  1RFQ A;  4O55 A;  3RTV A;  3CJC A;  4MLE A;  5J1E A;  4IG0 A;  3HL8 A;  4C1N I;  1NGH A;  2A3Z A;  4CIG A;  4CGF A;  3VF4 A;  4Z0U A;  3H1V X;  3J80 O;  4H0T B;  4E1M A;  2D4W A;  4FLY A;  3QER A;  1ASW A;  5CZ2 A;  4JKF A;  4DTX A;  1L3S A;  4BC4 A;  1Y97 A;  3PSI A;  1KC8 O;  4CJR A;  3THV A;  3M3Z A;  4JD2 A;  4FJ8 A;  2X6N A;  4GNI A;  4DU4 A;  3PX4 A;  3SQ2 A;  4HUF A;  4CHN A;  1DT9 A;  4EHU A;  4XH4 A;  4DTO A;  3HP9 A;  3U3G A;  1VSI A;  5FPM A;  4CJL A;  1HNZ K;  1NJI O;  1ZYQ A;  3G71 N;  4K8X A;  2YJE A;  1K6Y A;  2D5R A;  3ATU A;  4Y1C A;  4JKB A;  3LAK A;  5FRO A;  5JLF A;  4DV0 K;  1K8K A;  3NF8 A;  3FR0 A;  3MN9 A;  3SMP A;  3CCE N;  4JKH A;  3BDP A;  3AO2 A;  2VWB A;  1OH8 A;  1NK4 A;  3DYA A;  1EXQ A;  3BUZ B;  4BQL A;  2VCP A;  3ENH A;  4CEQ A;  5C42 A;  4LC9 B;  4BE2 A; 
#chains in the Genus database with same CATH homology
 1WSI A;  2Z1G A;  3FFI A;  1VSM A;  3QEX A;  3TWH A;  3OYE A;  4QOZ B;  4E0D A;  1RNH A;  4DQQ A;  3SQ0 A;  2G8W A;  4FJK A;  3HVT A;  3CFO A;  1HPZ A;  4J2A A;  4QCL A;  1F21 A;  1VRU A;  2R7Y A;  4ELU A;  3C6T A;  4I9L A;  4C8N A;  5D3G A;  1RTH A;  4FW1 A;  4OKJ A;  3NF7 A;  1UWB A;  5HBM A;  1BHL A;  3ZT1 A;  1LV5 A;  2KW4 A;  1C6V A;  3OYD A;  2JLE A;  3LP1 A;  4NCB A;  3SZ2 A;  4LSL A;  2I5J A;  3IG1 A;  4FYD A;  3RMC A;  3AO1 A;  2HMI A;  2X78 A;  4FK2 A;  1HYS A;  3OYC A;  4CJS A;  5FDL A;  3OJU A;  4FLT A;  1U4B A;  4FJM A;  4CF9 A;  3D0P A;  2OA8 A;  4ELV A;  1HYZ A;  1S9E A;  1VRT A;  4ID5 A;  2HVI A;  2A1R A;  2Z1I A;  3VQ6 A;  1X9S A;  4H8K A;  3VQ4 A;  3RRH A;  2PYL A;  3SQ1 A;  4ZTJ A;  1J54 A;  2DFF A;  4EZ6 A;  2E4L A;  3SYZ A;  2DTU A;  1TAQ A;  3IS9 A;  4O5B A;  4CJU A;  1S6Q A;  1KSP A;  3HXM A;  1SKR A;  4IDK A;  1ASU A;  1TV6 A;  4CGD A;  3HJF A;  4J2B A;  1Z26 A;  4FJL A;  4ZTF A;  1SV5 A;  3B6P A;  3OS0 A;  4DU3 A;  4JS5 A;  1BIU A;  1RTD A;  3AA5 X;  4DMN A;  1N6Q A;  2WON A;  1TKX A;  3I8D A;  3EYZ A;  4E7K A;  4XIU A;  3RWU A;  4M3Y A;  4KB1 A;  3L2R A;  3LWM A;  4DF4 A;  2KFZ A;  3U3Y A;  5I3U A;  2QXF A;  4DTU A;  3NCI A;  1X1P A;  2NUB A;  1D8Y A;  3M8R A;  4C8K A;  1D9F A;  4B9U A;  1WNS A;  1XC9 A;  1RDC A;  5C25 A;  2FBX A;  3OYM A;  1Q9X A;  4Z4G A;  3RR7 A;  4FLV A;  3TAG A;  1SUQ A;  4EP4 A;  1KVA A;  5CYQ A;  3VN5 A;  3ZSV A;  4FLW A;  1SL1 A;  3DRR A;  4DQI A;  2DFE A;  4KRE A;  2JGU A;  4KV8 A;  2QKK A;  4E1N A;  3L2W A;  1QQC A;  2HHQ A;  1TVR A;  5KI6 A;  1RT4 A;  4CJP A;  4ID1 A;  3OY9 A;  4E7L A;  4CJF A;  3TI0 A;  4KHS A;  1C0U A;  2ITG A;  4FM2 A;  3NGY A;  4CJQ A;  1VK0 A;  2F96 A;  4IFY A;  2DFH A;  4AHS A;  4PA1 A;  4OLB A;  5JS1 A;  4CE9 A;  1T7P A;  4M3X A;  4DG1 A;  3SUO A;  4F3T A;  4CEA A;  2KZZ A;  4DFJ A;  1YT3 A;  1ITG A;  5KRS A;  3OS2 A;  4KTZ A;  1CXQ A;  2AJQ A;  2O4G A;  1HNI A;  5HRN A;  2BE2 A;  1WAF A;  4FM0 A;  4H4O A;  4CGG A;  4NCA A;  3DM2 A;  4OPJ A;  4Q0B A;  1EP4 A;  2YHB A;  1D5A A;  3KKR A;  2QKB A;  1RIL A;  4DLG A;  5DK5 A;  1B92 A;  1EX4 A;  3ZT3 A;  1HMV A;  1RT6 A;  4NCG A;  4CIE A;  4O0J A;  3QEP A;  2YV0 X;  4O4G A;  3LP3 A;  4NYF A;  2HVH A;  1FKO A;  3KK1 A;  4B9L A;  4PUO A;  3NF9 A;  4CHZ A;  5HRP A;  3QES A;  1IKV A;  4LD0 A;  3EZ5 A;  2RF2 A;  3SCX A;  1X9M A;  3TAP A;  1NKB A;  1A5V A;  3S3M A;  1U49 A;  3ZSR A;  4DFK A;  1WSF A;  4RG8 A;  4CER A;  1J53 A;  1QHT A;  4KHU A;  4CGJ A;  1ZBH A;  3UIQ A;  2IOC A;  2OYQ A;  5KTQ A;  3P5J A;  1Q8I A;  1RTI A;  3DLR A;  4OGC A;  3V9Z A;  3I0R A;  4CEB A;  4HUG A;  2VWK A;  4C8L A;  3OYI A;  3L2V A;  1NK7 A;  3ZSZ A;  4FJI A;  2B5J A;  4B9V A;  3QIN A;  4PQU A;  1CXU A;  2GUI A;  1REV A;  1BQN A;  3V1O A;  1RTJ A;  3T1A A;  4FLU A;  3G0Z A;  3L2U A;  3RRG A;  4M3R A;  4BDZ A;  1VSH A;  2XO7 A;  1IKX A;  4M3U A;  1C1B A;  4B9M A;  2ZE2 A;  3OYG A;  4F4K A;  5EU7 A;  4KPY A;  3MED A;  1RBS A;  5HRO A;  4PY5 A;  4Z4H A;  1KRP A;  1LAW A;  1IKW A;  4RW7 A;  2G8F A;  4CJ5 A;  3V9U A;  1FK9 A;  1U45 A;  1YTA A;  3AO5 A;  3T3F A;  2G8H A;  2EHG A;  4J2E A;  3K58 A;  3OYB A;  5HLF A;  4W5R A;  4CEE A;  4CK1 A;  1VSE A;  3ZT0 A;  3AA4 A;  3KD5 E;  3DRP A;  3HPG A;  1UA1 A;  3ZSQ A;  5KGX A;  4OLA A;  3NH1 A;  3LAL A;  4DLE A;  4B8C A;  1ZBF A;  4ZHR A;  4DS4 A;  4O0I A;  1U04 A;  3KD1 E;  1NJW A;  1O1W A;  2YNI A;  4FW2 A;  4I2Q A;  5KRT A;  5DMR A;  3L3V A;  3LAN A;  1NOY A;  1A5X A;  3CM5 A;  3V1R A;  4E19 A;  1ZBL A;  3HP6 A;  1TL3 A;  3LP0 A;  3KLE A;  3RMB A;  1XWL A;  3WNH A;  4CF1 A;  4KI4 A;  1HQU A;  4UQG A;  1KTQ A;  1BIZ A;  3QET A;  4ICL A;  1UAX A;  3TAB A;  4MQ3 A;  2ETJ A;  1QE1 A;  3V6D A;  1NK5 A;  1BI4 A;  2YNH A;  2G8I A;  1U48 A;  1N5Y A;  2D0B A;  4FZX C;  1BCO A;  4FZY A;  3V1Q A;  1TKZ A;  3ISN C;  4WE1 A;  3QO9 A;  2FC0 A;  4FJX A;  1IKY A;  3WNE A;  4FXD A;  1HJR A;  3AVH A;  3SPY A;  1NJY A;  4EZ9 A;  1JLA A;  3P1G A;  4GVM A;  3KLI A;  4N41 A;  3K2P A;  1NKC A;  2KFN A;  4IBN A;  4CED A;  3U6F A;  1J5O A;  4N5S A;  3AO3 A;  1WSE A;  3QEW A;  4CHO A;  3RMD A;  3SJJ A;  1T8E A;  2XY8 A;  3ZCM A;  3ZSX A;  3ZSO A;  3MEC A;  3KK3 A;  4FM1 A;  3QEV A;  1L3V A;  4B9T A;  1FXX A;  2ZD1 A;  4DTS A;  1NK9 A;  1WSH A;  4CEF A;  3PV8 A;  2WOM A;  1NK6 A;  4GMJ B;  4FJ5 A;  4M3W A;  2DY4 A;  1JLG A;  3SI6 A;  4CJ4 A;  2A1S A;  1T05 A;  2VG6 A;  4CF2 A;  4E7J A;  4FJH A;  4FZZ A;  3TAN A;  1BI4 B;  3DMJ A;  1I39 A;  4I2P A;  4LH5 A;  4HVJ A;  4M3Z A;  2VG5 A;  3LWL A;  1C1C A;  1JLC A;  2OPS A;  4MFB A;  4TSX A;  4AH9 A;  4RW6 A;  4KTW A;  3AA3 A;  4EP5 A;  4HUE A;  3VQ5 A;  2IS3 A;  3TAQ A;  2XY5 A;  4Q5V A;  4FJN A;  3K59 A;  3L8B A;  3JYT A;  4C8O A;  1BCM A;  2OPR A;  1RT2 A;  3OS1 A;  3MAQ A;  3HK2 A;  4E7I A;  4DSE A;  3ZT2 A;  2YNF A;  4C8M A;  4CES A;  4W5O A;  3DRS A;  1DLO A;  2X74 A;  4I7F A;  4W5Q A;  1WLJ A;  2BAN A;  4HCB A;  2HHT A;  1W9H A;  3OYN A;  2GBZ A;  3V9S A;  4IKF A;  2Y1I A;  2HHW A;  2X6S A;  2IDO A;  3KK2 A;  4CJ3 A;  4DSF A;  3IRX A;  1CLQ A;  3LAM A;  3VQ8 A;  4B3O A;  3LZI A;  5KGW A;  1LW2 A;  3S9H A;  1I3A A;  3VQC A;  3VQ9 A;  5FRM A;  3NBP A;  3ITH A;  1WAJ A;  4AHU A;  4KRF A;  3HVR A;  3AVB A;  3HM9 A;  3TAE A;  3NH0 A;  2YHA A;  1JLE A;  1IO2 A;  4BDP A;  4H4M A;  4DWI A;  1TAU A;  3I0S A;  4CHQ A;  4QAG A;  1DTT A;  5FRN A;  4FJ7 A;  4DTR A;  3ASM A;  3MXI A;  1W0H A;  3K5O A;  4CGI A;  3V81 A;  3V9X A;  3AVA A;  3OYJ A;  1C1A A;  1KLM A;  3AVK A;  1J9A A;  3HT3 A;  4Z4E A;  2FBT A;  3DLB A;  4RW8 A;  3KIO A;  1RDD A;  1Q9Y A;  1JLF A;  1KFD A;  1S9G A;  4AIL C;  4GW6 A;  3TAR A;  2FBV A;  1L3T A;  3VQP A;  3WNG A;  1BL3 A;  3AVJ A;  4KHW A;  2RN2 A;  3PUF A;  1NK8 A;  3BGR A;  2OZS A;  1L3U A;  3E01 A;  1JLQ A;  2B6A A;  3LPT A;  3CQ8 A;  3C94 A;  1RT3 A;  5K14 A;  1TK5 A;  1B9F A;  3B6O A;  3LP2 A;  4CF8 A;  3KLH A;  1HQE A;  3HPO A;  1TKD A;  1R0A A;  2W42 A;  5T7B A;  2E6L A;  4YFU A;  3MXM A;  1LAV A;  2HNY A;  3RR8 A;  1YTU A;  4M45 A;  3HST B;  1TK8 A;  2YKM A;  2P5O A;  3KJV A;  1T03 A;  3EY1 A;  2HHS A;  1GOA A;  4CEO A;  4CK2 A;  3G10 A;  4DTP A;  4I9Q A;  4HCC A;  4KB0 A;  3SUN A;  4KHY A;  3M8S A;  3SPZ A;  3DLE A;  3OYL A;  1JXB A;  3MXJ A;  3AVM A;  3NH2 A;  2IAJ A;  3M8P A;  1BGX T;  2D0C A;  2Y1J A;  3OYF A;  3P83 D;  3OVN A;  4CJV A;  4KAZ A;  4CHY A;  3CFR A;  3RMA A;  1KVC A;  4DFP A;  2IC3 A;  3O3H A;  4F2S A;  3QIO A;  1JL1 A;  4L8R B;  3PO5 A;  1C0T A;  1RBU A;  4OPK A;  2EX3 A;  4N47 A;  1GOC A;  3DOK A;  4BWM A;  1QS4 A;  4BDY A;  3LZJ A;  4LY7 A;  2HB5 A;  4CFA A;  3AVN A;  3VA0 A;  2HHU A;  4DSK A;  2OPQ A;  4JRP A;  1JKH A;  1TL1 A;  4JLH A;  1WN7 A;  4N56 A;  1KFS A;  4FJJ A;  4FJ9 A;  1VSD A;  3AVI A;  4Y1D A;  4RW9 A;  1RDA A;  3QNN A;  4B9S A;  1GOB A;  1JXE A;  5SZT A;  1HYV A;  4CJE A;  1UOC A;  3AA2 A;  2YKN A;  1S1V A;  1SL2 A;  4KHN A;  1RDB A;  3CYM A;  5CYM A;  4CFC A;  2XY6 A;  1LWC A;  4W5T A;  3QLH A;  4FLZ A;  2XRI A;  3AVG A;  4Z4C A;  2P5G A;  4CFB A;  4F3O A;  2P51 A;  1VSJ A;  1ZBU A;  2FBY A;  4DTM A;  4AHR A;  3ALY A;  4NYN A;  2VWJ A;  3SUP A;  4DSL A;  2HNZ A;  4B8A B;  1QSY A;  4BAC A;  1TKT A;  3HYF A;  3MEG A;  4FCY A;  1QTM A;  1S1X A;  2BGG A;  1UA0 A;  4DQP A;  4CGH A;  4J2D A;  5CY4 A;  3F9K A;  3VQD A;  3M8Q A;  1VSK A;  2P1J A;  1KVB A;  4OJR A;  1NK0 A;  5J2P A;  3K57 A;  1FKP A;  3LDS A;  3JSM A;  3IAY A;  3NGI A;  2B4J A;  3DLK A;  4OVL A;  3DOL A;  2RPI A;  3S3N A;  4AHV A;  1RBV A;  3K5M A;  1EET A;  4KTQ A;  4DQS A;  2PY5 A;  3SUQ A;  4KI6 A;  4OKK A;  1L5U A;  3KKS A;  1SKW A;  4CEC A;  4ELT A;  4FVM A;  4F8R A;  4BE1 A;  4FLX A;  4G1Q A;  4FK0 A;  3AVL A;  4IG3 A;  4DU1 A;  1TGO A;  3TAF A;  2G8V A;  2GV9 A;  4OKE A;  4CCH A;  2ATQ A;  1S5J A;  1Z25 A;  3PX6 A;  4E89 A;  4W5N A;  3MEE A;  3CFP A;  4JS4 A;  1CZ9 A;  1WSJ A;  2KZM A;  3PY8 A;  4IFV A;  3NE6 A;  4DF8 A;  4CK3 A;  3NGZ A;  3NHG A;  1NJX A;  4M41 A;  3SV4 A;  3VQB A;  3VQE A;  5J2N A;  1X9W A;  1JL2 A;  1RBR A;  4K8Z A;  4O44 A;  3AVC A;  2RKI A;  1ASV A;  1EKE A;  1D9D A;  4BWJ A;  1XI1 A;  4OGE A;  1ZBI A;  1IG9 A;  3C95 A;  2E6M A;  1RT7 A;  2YNG A;  3O3F A;  3CG7 A;  4R5P A;  3CM6 A;  1BQM A;  3HPH A;  3NF6 A;  3V4I A;  3NAE A;  1JLB A;  5CZ1 A;  3OJS A;  4AHT A;  1KCF A;  3O4Q A;  4CIF A;  3F73 A;  5SWM A;  1S1W A;  1MU2 A;  3L3U A;  3AV9 A;  4M3T A;  4CFD A;  3KLG A;  2F8S A;  3VQA A;  2XY7 A;  3ZT4 A;  4LH4 A;  1C0M A;  2HND A;  3NFA A;  3QIP A;  4CJT A;  4YNQ A;  3KTQ A;  1BIS A;  3O3G A;  1S1U A;  3DLG A;  1RT1 A;  2OPP A;  3D45 A;  5HRR A;  3SQ4 A;  1HRH A;  3VA3 A;  4DFM A;  3PX0 A;  4BE0 A;  4E3S A;  3LPU A;  3AVF A;  3T19 A;  3OYK A;  3A2F A;  4DS5 A;  5E41 A;  1KLN A;  4N76 A;  4O55 A;  3RTV A;  3L2Q A;  4IG0 A;  2Z1J A;  3HL8 A;  5HP1 A;  2PYJ A;  4CIG A;  5J2M A;  4KO0 A;  4CGF A;  1B9D A;  1XHX A;  4CJW A;  4DSI A;  4FK4 A;  4B9N A;  4Z0U A;  1RT5 A;  4CEZ A;  1QSS A;  1G15 A;  1SKS A;  1S1T A;  4E1M A;  4FLY A;  3QER A;  1ASW A;  3HO1 A;  5CZ2 A;  2KQ2 A;  4DTX A;  4KFB A;  1L3S A;  2OZM A;  2HHV A;  1RCH A;  3QEI A;  5I42 A;  4DTJ A;  1LW0 A;  1Y97 A;  3ZSW A;  3OYH A;  2HHX A;  4CJR A;  3THV A;  3SV3 A;  2G8K A;  3V9W A;  3DI6 A;  4KKO A;  4PWD A;  4KHQ A;  4FJ8 A;  2X6N A;  3PO4 A;  4CJK A;  1LWF A;  4DU4 A;  3PX4 A;  1IH7 A;  4HUF A;  3VQQ A;  4CHN A;  3SQ2 A;  3K5L A;  4HHT A;  4HTU A;  4DTO A;  3HP9 A;  3U3G A;  1YVU A;  1VSI A;  4FJG A;  1HNV A;  1S6P A;  4CJL A;  1NJZ A;  1XHZ A;  1A5W A;  3H08 A;  1ZYQ A;  1WSG A;  4F2R A;  4DTN A;  4K8X A;  4B08 A;  2BDP A;  3WNF A;  2PZS A;  2Z1H A;  2O4I A;  4CF0 A;  1VSF A;  1K6Y A;  3ZSY A;  2D5R A;  4Y1C A;  3AO4 A;  2ZQB A;  1RBT A;  2HW3 A;  3LAK A;  3OYA A;  3TAM A;  2VG7 A;  4JRQ A;  5FRO A;  5JS2 A;  1DTQ A;  4E7H A;  3K5N A;  3ULD A;  4DSJ A;  3KLF A;  2KTQ A;  1VSL A;  2IGI A;  4LSN A;  3NF8 A;  3DLH A;  4M42 A;  1CZB A;  2G8U A;  2XHB A;  4Z4I A;  2F8T A;  2D0A A;  3O4N A;  3C6U A;  3BDP A;  5C24 A;  2Q3S A;  5J2Q A;  3SNN A;  1NKE A;  3AO2 A;  3S3O A;  1U47 A;  1SL0 A;  1TK0 A;  1QSL A;  2QK9 A;  1LWE A;  3TR8 A;  3NDK A;  1NK4 A;  4RW4 A;  4AHC A;  5HRS A;  4Z4F A;  3DYA A;  1EXQ A;  2LSN A;  3VQ7 A;  4CHP A;  3QNO A;  4DQR A;  4CEQ A;  5C42 A;  5J1E A;  1NOZ A;  4BE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...