3NH0A

Crystal structure of rnase t in complex with a non-preferred ssdna (aac)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 64
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh0A00
3ZCMA 5CY4A 3WNGA 1BQNA 3ITHA 4GVMA 4W5OA 1YTAA 1U49A 1UA0A 3NHGA 3VQ4A 3V6DA 3K5OA 5C24A 2HVIA 4BE2A 1JLQA 3JSMA 4DQSA 3QEWA 3LPTA 1LWEA 2D0BA 1TV6A 1VK0A 4M3YA 1REVA 4B9SA 3ZT1A 3KTQA 4HUFA 4DF4A 4QAGA 1VSLA 1SL2A 4CJRA 2E4LA 2HHSA 4PWDA 3RMBA 1QE1A 1BL3A 1RBRA 3T3FA 3M8PA 5J1EA 1SKWA 1C6VA 2JGUA 5HRRA 2W42A 4Z4HA 4DWIA 3B6PA 4DTSA 1EX4A 4M45A 4IDKA 3WNHA 4PUOA 2B4JA 1S9EA 4O0JA 1GOAA 1G15A 3SQ0A 3DOKA 1U48A 4DG1A 1ZYQA 4FJIA 3DLGA 3IRXA 1A5XA 3HO1A 4CJKA 4KI4A 2Z1HA 3L2WA 1IKWA 3ZT3A 4AHCA 3S3NA 1S1WA 5CZ1A 3OYJA 2G8HA 4KB1A 3AVIA 1YTUA 3AA4A 3QESA 1KCFA 3L3UA 3CQ8A 3QERA 3SNNA 4GW6A 3RR8A 3CM6A 1I3AA 5I3UA 4DQRA 1S1UA 5CYMA 1J54A 3KLEA 4CJVA 4DFMA 1D9FA 4HHTA 1LAWA 4F3OA 3L2UA 5JS2A 3V9SA 3ZSOA 2G8KA 1JLCA 4C8LA 3BDPA 3TAMA 3AVJA 3ZT2A 1NK5A 4IKFA 4FK2A 3LZJA 4BACA 4CGHA 4CJ3A 2Z1IA 1BI4B 5EU7A 3AVLA 3TAQA 1JL2A 3NDKA 3NFAA 2HNZA 3HVRA 3LP0A 1B9FA 2A1SA 3E01A 4AHUA 4FLWA 2YHBA 3MEGA 3AVKA 1RT4A 1JLGA 1TK0A 4ZTFA 1KRPA 4OLBA 3HPHA 3HM9A 4NYFA 2XY5A 2DTUA 2BE2A 3DI6A 4H8KA 3OS2A 3V4IA 3SUQA 3F9KA 4KTZA 1R0AA 1HPZA 2KQ2A 1JLBA 2ITGA 4OKJA 1FKPA 4Z4GA 4RW7A 4N41A 1RTIA 3AA2A 2P1JA 4CGJA 4W5QA 1NJZA 1YVUA 4CF9A 4QCLA 1RBVA 2HHTA 4CJUA 1CXUA 4DTJA 1RBSA 1CZBA 3KK3A 1U45A 4I2QA 4CJ4A 1QS4A 4CJLA 3DRPA 3MEEA 3AO3A 4OKKA 3O4NA 4DF8A 3AV9A 3VQ5A 4CEDA 4DQQA 1JLEA 3AA3A 2Z1JA 4HUEA 2BGGA 4OJRA 3OYIA 5DK5A 1ZBHA 3VQEA 3QIPA 3MECA 3M8SA 4DSFA 1RT2A 3P1GA 5KTQA 1EKEA 4H4OA 3TI0A 4RW9A 1HRHA 1C1CA 3SUPA 3OYHA 4KV8A 3VN5A 5CYQA 3SQ2A 4QOZB 4RG8A 4CJFA 4GMJB 1ZBFA 4CF0A 4N47A 1L5UA 3DLEA 4IG0A 3NH1A 3QEPA 4DFPA 4ZTJA 3SPYA 5FROA 1U47A 1BHLA 2ZQBA 3NGYA 4CJWA 4FJGA 4W5RA 4PA1A 4FZXC 3T1AA 4KHUA 2DFFA 3V9ZA 2KFNA 4CFAA 1C0TA 1NK8A 2EX3A 1A5VA 3B6OA 4RW8A 3ALYA 4CEFA 4BE1A 1L3SA 1EETA 3KD5E 4EZ6A 4Z0UA 4FJXA 3K2PA 4B08A 3FFIA 4DQIA 1UAXA 1Q9XA 1NKCA 1TGOA 4N5SA 4LY7A 3BGRA 2B6AA 3RMDA 1QQCA 3S3MA 4FJ7A 2O4IA 3AVGA 2BDPA 2KTQA 4MFBA 4Z4CA 1LWFA 4AILC 2O4GA 2FBYA 4CGFA 3RWUA 2ZD1A 3DMJA 3DRRA 4FM2A 4DSEA 1LWCA 2OPRA 4E1NA 4CFDA 4E7HA 1ZBIA 3KLFA 3HVTA 1RT3A 4EZ9A 1WAFA 3LAMA 3SQ4A 3PX6A 1Q8IA 1NK4A 1RT5A 1IKXA 4DLGA 4DTUA 4B9LA 4KB0A 3ZSQA 3OS1A 3TARA 4ZHRA 4EP4A 3PY8A 4YFUA 5C42A 4C8OA 4KTWA 3CM5A 4KO0A 4KRFA 4AHTA 4FM0A 2KFZA 4CJQA 3V9UA 4DU1A 1W9HA 3KJVA 1T03A 4ICLA 3VA3A 3DLRA 1J5OA 5HROA 1VSJA 4E7IA 1FK9A 2X78A 1NOZA 3KLIA 5J2MA 2G8VA 2QXFA 4KI6A 3SQ1A 1IG9A 3LWMA 4KHSA 1RCHA 1S9GA 1X1PA 3G10A 4DTRA 4FJNA 2X6SA 4FXDA 4OKEA 5KGXA 5FRMA 4O4GA 2HNYA 1B92A 5FRNA 5C25A 1WAJA 3QNOA 1TKZA 1SL0A 4Z4IA 4FJ8A 3AVMA 2KZZA 1RILA 1HNVA 4I9QA 2X6NA 2ATQA 4FLUA 3V81A 3ZSVA 1S1VA 1QSYA 4DQPA 3OY9A 4FYDA 5J2NA 3VQAA 1NKBA 4I9LA 1QHTA 4IG3A 1F21A 5I42A 3QINA 1IKVA 4PQUA 3QEIA 1JLAA 3DYAA 1Z26A 4C8KA 4CIGA 4FLTA 1HQUA 1J9AA 4J2BA 1HYZA 1FKOA 2VG5A 3L3VA 1RNHA 4CK2A 1RDDA 4JRQA 1RT6A 2E6MA 1VSKA 4DSLA 1D9DA 4XIUA 2KW4A 2HVHA 4CEOA 3PO5A 1BISA 3AO5A 4CCHA 1A5WA 3ZT4A 3OYLA 3TAPA 1CLQA 4PY5A 1QSSA 3H08A 2XRIA 4DS5A 4E0DA 4UQGA 3RR7A 4O55A 1RT1A 1QSLA 3HPOA 1S5JA 3V1QA 1CZ9A 2F96A 1VSDA 3VQCA 3LP1A 3KLGA 2D0AA 3S3OA 4CIFA 3ZSXA 3KD1E 4CHZA 5CZ2A 4B3OA 4N76A 3HXMA 3OYGA 1TAQA 4E7LA 2OPQA 4C8NA 1JLFA 3OYBA 2PYLA 3SCXA 4KTQA 4M3XA 3KK2A 3SJJA 2G8UA 4Z4EA 4YNQA 1S1TA 2HNDA 3KKSA 1WN7A 3C95A 4KKOA 3TAFA 2QKBA 3QIOA 1NJYA 1HYVA 3OYKA 1ZBLA 3CFPA 3S9HA 4E7KA 5HRPA 3V9WA 2X74A 1WLJA 1Q9YA 3OYMA 3C6TA 3M8RA 3IS9A 4E19A 1VSIA 3D45A 3PUFA 5D3GA 4DLEA 2OYQA 4OPJA 3K5NA 2B5JA 2A1RA 3NF7A 2IDOA 2WOMA 3RTVA 4ELTA 2HHQA 4CK3A 1JXBA 3V9XA 4TSXA 3SUOA 1HNIA 4G1QA 4I2PA 4J2DA 1BCMA 4NCBA 4FW1A 1X9WA 2XHBA 3M8QA 1RDBA 1X9MA 1S6QA 4O44A 4CFBA 1X9SA 3OYNA 4KAZA 4FJ9A 3VQPA 2HHWA 1C0UA 3NBPA 4CHPA 1J53A 3L2RA 1NK7A 4KHNA 3UIQA 3I0RA 3EZ5A 3QEXA 4F4KA 3CFOA 3ZSYA 3PO4A 2BANA 1VSFA 3MXIA 1T7PA 1WSJA 1TVRA 4ID5A 4AHSA 4NYNA 4DSKA 2YV0X 4KHQA 3DRSA 4B9MA 3THVA 1HYSA 4CJPA 3CG7A 3RMCA 4CEQA 3LALA 5KRTA 2YNGA 1TL3A 3QNNA 1JL1A 2VG6A 4CK1A 1SKRA 4CGGA 3NH0A 2YKNA 2RN2A 3O3GA 2DY4A 3OS0A 4JLHA 1FXXA 2P5GA 2GBZA 4Q5VA 3K5MA 2HMIA 4CHOA 4M3UA 4IFYA 1VRTA 4CF1A 4CJ5A 2OA8A 4NCAA 4KHYA 2F8TA 1O1WA 4I7FA 1U4BA 4KFBA 4DU4A 1C1AA 4CHNA 2EHGA 4M3ZA 3DLBA 3MXMA 3VQ7A 3HJFA 4IFVA 3K58A 4OGEA 3KLHA 3KK1A 1BIZA 3SV4A 1MU2A 3MEDA 4DTMA 4FJ5A 5FDLA 1GOCA 3AVNA 2I5JA 2XY8A 4BDZA 3DM2A 1WSFA 4FJKA 3L2VA 3ZSZA 1RT7A 3PV8A 1ASVA 3OYEA 1WSHA 3AO4A 1TKDA 1U04A 4O0IA 2D0CA 4CERA 4HUGA 4F2SA 3V1OA 3HP9A 3U6FA 2G8FA 4FLVA 1SL1A 4FJLA 5HP1A 3TAGA 4DS4A 4OGCA 2IOCA 3SV3A 1LW0A 4DTPA 1DTQA 3QEVA 1XI1A 1IO2A 4F8RA 4F2RA 3QLHA 3LAKA 5KRSA 4HTUA 3AVCA 4O5BA 4B9UA 1SV5A 4CECA 2PY5A 1KLMA 4WE1A 4IBNA 4LH5A 1GOBA 4M3RA 3HT3A 4BWMA 1BQMA 1RBTA 3EY1A 4FJMA 3U3GA 2RF2A 4BDPA 1L3TA 1ZBUA 2ZE2A 3HP6A 2OZMA 3T19A 1EP4A 1EXQA 1XHZA 4FLZA 2YNFA 3OYDA 3LDSA 4MQ3A 4DFKA 3G0ZA 1KVBA 3OVNA 3SPZA 5DMRA 2HHVA 1HQEA 3DLKA 3IG1A 1TKXA 1LV5A 3TR8A 1KLNA 1VSEA 2XY7A 1QTMA 2YNIA 3AVAA 4CFCA 1ITGA 4LSNA 3O3FA 3PX4A 3DOLA 4DFJA 2NUBA 4LH4A 5KI6A 4CJSA 3F73A 4CESA 3ISNC 2IS3A 4FVMA 3LPUA 2VWJA 2XY6A 2GUIA 2Y1JA 1WSGA 4FW2A 4JRPA 3AA5X 3NF9A 3LP3A 3OYCA 4B9NA 3LWLA 1TAUA 3NGZA 3IAYA 4FK0A 2HW3A 3SYZA 3KKRA 4E3SA 1NK0A 4LSLA 2DFHA 4FZYA 5JS1A 4ELUA 4HCCA 2RKIA 1K6YA 1T8EA 4DTOA 4HVJA 4CHQA 1JKHA 3VQ9A 1RTJA 3QO9A 1YT3A 2HB5A 3MAQA 4FM1A 3HSTB 4B9TA 4ELVA 4M3WA 1Z25A 3MXJA 4AHVA 1UWBA 1VSMA 1KFSA 2QKKA 4KHWA 1NK6A 1I39A 1S1XA 1SKSA 1KFDA 5HRNA 5J2PA 1TK8A 1LAVA 1XWLA 4E1MA 3U3YA 3SUNA 1KSPA 2HHUA 3SZ2A 4B9VA 2RPIA 3RRGA 2OPSA 3TANA 1BGXT 1IH7A 3I8DA 3VA0A 3P83D 3C94A 1VSHA 4RW6A 3DLHA 3HYFA 4KPYA 1JXEA 4L8RB 4FJHA 4C8MA 5J2QA 2Y1IA 1BI4A 4BDYA 4CIEA 4Q0BA 2XO7A 5SZTA 4E89A 2R7YA 4DTNA 2YKMA 4Y1CA 4ID1A 3QETA 1ASWA 1BCOA 1KTQA 1KVCA 3AVHA 3NAEA 1N5YA 1TK5A 1KVAA 2G8WA 4DSJA 2OPPA 1C0MA 1D5AA 2GV9A 4DTXA 1D8YA 4KREA 3SI6A 4OLAA 1BIUA 2IAJA 3AVBA 1CXQA 4CEEA 4JS4A 1T05A 1S6PA 3K59A 4M41A 3V1RA 2G8IA 3TWHA 2AJQA 2P51A 4H4MA 3NCIA 1VRUA 4DU3A 4DMNA 4FLYA 4M42A 4FJJA 3KIOA 1RBUA 3A2FA 1WSEA 2IC3A 3WNEA 4CEZA 2OZSA 1RDAA 1NJXA 1Y97A 2HHXA 3K57A 3ZSRA 3ZSWA 1XC9A 2YNHA 3AO2A 1L3VA 1N6QA 1WNSA 1TKTA 2Z1GA 4B8AB 3PX0A 2FBVA 5E41A 4W5TA 4AHRA 3TAEA 1NK9A 4M3TA 4E7JA 5HLFA 3RMAA 2PZSA 1IKYA 3O4QA 5T7BA 4NCGA 2P5OA 3D0PA 3CFRA 2D5RA 4FZZA 3AVFA 1NKEA 3ZT0A 4CEBA 1L3UA 3L2QA 4Y1DA 4J2EA 4OVLA 1HJRA 1ASUA 3ASMA 3VQQA 1SUQA 3NH2A 1C1BA 1WSIA 2FBTA 2YHAA 2WONA 2DFEA 4R5PA 3TABA 2F8SA 3LANA 5SWMA 3ULDA 1TL1A 4CHYA 4JS5A 2PYJA 2LSNA 4BWJA 4CJTA 2ETJA 4OPKA 1UA1A 3VQ8A 4FK4A 4LD0A 3JYTA 3I0SA 2VWKA 4HCBA 4CE9A 4DSIA 2FBXA 3LP2A 4K8ZA 5HRSA 3NE6A 4FCYA 3WNFA 1LW2A 1RTDA 3OYAA 4K8XA 1DLOA 3OYFA 4W5NA 1B9DA 4CGIA 5HBMA 2KZMA 1RDCA 2FC0A 3VQDA 3L8BA 4EP5A 3VQBA 1NJWA 4CF8A 4Z4FA 4J2AA 4B8CA 2QK9A 1HMVA 1UOCA 2E6LA 1NOYA 3HPGA 3VQ6A 4FLXA 1DTTA 3EYZA 5K14A 3NF6A 3P5JA 3O3HA 4RW4A 4N56A 4CEAA 2Q3SA 4CF2A 1W0HA 2JLEA 3AO1A 4CGDA 3HL8A 3OJUA 3OJSA 3K5LA 3NGIA 1RTHA 4CJEA 4AH9A 4F3TA 3NF8A 3C6UA 3LZIA 1XHXA 2VG7A 3RRHA 2IGIA 5KGWA 3HK2A 3CYMA 4BE0A
chains in the Genus database with same CATH superfamily
3AY9A 3L4QA 3VGKA 3ID8A 1JLQA 3QEWA 1TV6A 1VK0A 2VQEK 3O08A 3ZT1A 4B9SA 4DF4A 4QAGA 1VSLA 1SL2A 2CGLA 1KAXA 3CF5L 2ITMA 3RMBA 1HJOA 1RBRA 2W42A 3T1HK 4GKJK 3G25A 1TUYA 3HM8A 4JHDB 3WNHA 1G15A 3SQ0A 3DOKA 2E2NA 3DLGA 3IRXA 4M7XA 3J7YP 4V19S 4CJKA 3CJCA 4WFAL 3OYJA 1YTUA 4DHYA 5AQJA 4DV4K 3QESA 3L3UA 3CQ8A 1QVGM 5I3UA 3L0QA 5CYMA 4BR2A 4RCHA 4DFMA 3CJBA 4F3OA 5KPRA 3CCMN 5JS2A 4DV7K 1NGEA 3CJAA 3ZT2A 4IKFA 4FK2A 3LZJA 4CGHA 3H3NO 5EU7A 4PKIA 3AVLA 3TAQA 5LL6Z 4HTLA 4OPAA 3HVRA 2AA4A 5AQNA 3KWGA 1X9JA 4AHUA 1JLGA 4FWOA 1KRPA 2ASOA 1HR0K 4CZKA 3OS2A 4Z4GA 4BRHA 1RTIA 2P1JA 1NJZA 4BRKA 3P4IA 4DCHA 2IVOA 1CXUA 1RBSA 1CZBA 3KK3A 4CJ4A 1QS4A 4IOCL 2P9NA 1XMQK 2O8BB 5BN8A 3VQ5A 3E9LA 3AA3A 2BGGA 1ZBHA 3C7NB 3QBWA 3VQEA 2W6KA 4LF7K 1IBMK 1RT2A 3P1GA 3C6AA 2WC9A 3UKUB 2UUBK 1E3MA 4AM6A 2IIRA 1BA0A 3T1YK 3SQ2A 4QOZB 4GMJB 1ZBFA 4CF0A 3NH1A 5AQFA 5FROA 1IBLK 4W5RA 4PA1A 4BRDA 2QEXN 4PKGA 1BA1A 4CJ7A 2QI2A 4BE1A 3AAPA 1SZ2A 4PL7A 1VQON 3RMDA 4FJ7A 1XUPO 3AVGA 4BRAA 1K8AO 2BDPA 3EN9A 2ZD1A 2V7YA 3QDKA 2OPRA 3D2EA 4CFDA 4E7HA 4CW7B 3SAHA 3LAMA 3SQ4A 1VQMN 1BO5O 3AARA 4EP4A 3D2FB 5C42A 4YFUA 3CM5A 3KHYA 3M1FA 3M3ZA 3KJVA 4ICLA 3PO4A 4E7IA 4KI6A 4DKWA 2G8VA 2QXFA 3SQ1A 3TSUA 3G10A 2HSTA 3E9PA 3WXMB 4O4GA 2JWKA 2KZZA 1WAJA 2HBJA 4FJ8A 3AVMA 1RILA 2VGNA 1HNVA 4U67L 4RWTA 1RFQA 1QSYA 3SK3A 3VERA 5BREA 3CHWA 4FYDA 3VQAA 3PLAA 5I42A 1NGHA 3QEIA 1JLAA 4C8KA 1Z26A 4J2BA 4CK2A 1HYZA 3L3VA 3AGKA 2QWLA 1D9DA 3PO5A 3GG4A 4CCHA 3ZT4A 3K9KA 1W2BM 1CLQA 4E0DA 4CZMA 2QWRA 3RR7A 5C15A 1QSLA 2F96A 5EXWA 2D0AA 3ZSXA 5CZ2A 1Q81O 4N76A 1S22A 4FO0A 3WT0A 4C8NA 1JLFA 3OHRA 4NXMK 4KTQA 4M3XA 4GV6A 2HNDA 3KKSA 4IO8A 1WBBA 2NNWA 4MDAA 1NJYA 2P9KA 4BRMA 1GLEG 1Q9YA 5DM7L 4DLEA 3HSCA 2OYQA 5D3GA 1TYQA 2B5JA 4PHTX 1MWMA 5HOOA 3NF7A 2A1RA 3FZMA 3RTVA 4XH5A 3V9XA 4TSXA 3ZYYX 4JI8K 4FW1A 4CVNE 3M8QA 1U2VA 4A2AA 2F7TA 4CFBA 3OTOK 5M1NA 3EE9A 3AAQA 5EVZA 3SMSA 1NNEA 2BANA 1T7PA 4ID5A 4EAHD 4A61A 3QICA 4B9MA 3RMCA 3LALA 5KRTA 3GDQA 1YXQA 1TL3A 4CK1A 2YKNA 3O3GA 5KPTA 3HOTA 2GBZA 2HMIA 2V7ZA 4WYBA 3O8MA 4IFYA 4CJ5A 4KHYA 2F8TA 1C1AA 4CHNA 3HJFA 1NGBA 4WFNL 5EX5A 1GOCA 2QWMA 4WQ4A 2I5JA 3DM2A 1KQSM 3THWA 3PV8A 1ASVA 4AM7A 4GVEA 2D0CA 3BEXA 4F2SA 3V1OA 3U6FA 2G8FA 2QM1A 3CPWM 1SL1A 5HP1A 3TAGA 3SV3A 1LW0A 1YITN 1XI1A 1VAZA 4F2RA 3BZKA 1X3NA 3OW2M 1QHAA 4B9UA 2PY5A 4WE1A 4FPBA 3CCQN 4FWLA 1GOBA 4LH5A 5FPEA 3U3GA 2FSKA 2RF2A 4BDPA 1L3TA 1P8ZA 4BREA 4B1YB 5DMRA 1TKXA 4DQ8A 1ATSA 1NLVA 4JI5K 3PX4A 3DOLA 2NUBA 4LH4A 4CJSA 1SQKA 5C2FA 3ISNC 2IS3A 3K0SA 3LPUA 2GUIA 3ZEUB 2E5LK 3U4LA 3OYCA 3LWLA 3CC4N 4FK0A 4JI1K 3SYZA 4E3SA 4BG9A 2DFHA 4FZYA 5JS1A 1BWFO 4ELUA 4HCCA 2RKIA 4H0OA 3BY5A 4IJNA 3VQ9A 4FM1A 3GOIA 1Z25A 4AHVA 1KFSA 4KHWA 3CQYA 4U7BA 5HRNA 1LAVA 3W0LA 4E1MA 4EHUA 1KSPA 4B9VA 2RPIA 3FGUA 2UXBK 1BGXT 1Z05A 3P83D 4YOXA 1JXEA 3IKMA 3PIOL 1GLBG 5J2QA 4FJHA 5SZTA 4E89A 3J7ZO 1OVYA 4ID1A 4OPHA 1KTQA 5C0YA 5AZIA 4DSJA 3SI6A 4OLAA 4CEEA 3N4QA 3TTDA 4DUZK 3VOVA 3NCIA 5AQPA 5M1PA 4DU3A 3ZLJA 4FLYA 4FJJA 2OZSA 2H3GX 1WSEA 1M90O 1Y97A 4DR2K 1RGIA 5JVGL 1TKTA 4BC5A 4B8AB 2QW9A 3DXMA 4BRFA 4BRLA 4E7JA 2NRXA 1K73O 5ADXA 5BRFA 2P5OA 4RTFD 4BC3A 3J81O 3ZT0A 4CEBA 2V52B 3PSIA 1QQNA 5I9EB 1HJRA 3VQQA 1SUQA 1MDUB 1C1BA 4R5PA 3TABA 1NG9A 1C0FA 3LANA 5SWMA 3U8XA 2PYJA 1EWQA 1N8RO 3I56N 4OPKA 1UA1A 4B1UB 1XC3A 5AQSA 4DSIA 3THYA 3CD6N 5HRSA 3NE6A 4FCYA 4LFAK 1BUPA 3OYAA 5GIOA 4JI0K 2E8AA 2FC0A 4EP5A 5LJVA 2QWQA 4YHHK 4Z4FA 4J2AA 2VCPA 2P9NB 1UOCA 1GLCG 1HMVA 3U9DA 3HPGA 2O8BA 3VQ6A 3R8EA 4JKFA 4RW4A 1W0HA 3C7NA 3NGIA 4LF9K 4AH9A 3C6UA 4FWRA 5KGWA 3O6WA 2Q31A 4EFHA 2ZJPL 5TKYA 3HTVA 4BE0A 3ITHA 4GVMA 3K5OA 4BRIA 2ZGYA 4KHPK 2D0BA 1VQ8N 1REVA 2E2OA 4CJRA 2QWOA 2E4LA 1NBWA 5AQLA 1QE1A 1BL3A 1XNRK 3M8PA 5J1EA 2JGUA 2FSJA 5HRRA 4Z4HA 3LDLA 3P39A 2W41A 4PUOA 1GOAA 5AQGA 4WQ5A 1ZYQA 1T44A 4ISGA 3HO1A 4K0KK 1ZBSA 4AHCA 5CZ1A 2DPNA 3QERA 4GW6A 3RR8A 3CM6A 2JWLA 1J54A 4CD1A 3ZSOA 1JLCA 3TAMA 3WEEA 2UUCK 1NK5A 4BACA 5GINA 5FLXO 1QZ6A 1JL2A 3QFPA 2P9PB 5GAHP 3E01A 1RT4A 1TK0A 3B8AX 4OLBA 3HPHA 4WQ4C 4JI3K 2DTUA 2BE2A 3WUHA 4BRNA 4EHTA 1HPZA 2KQ2A 4K43A 3QB0A 4JKHA 1YVUA 3WXJA 4QCLA 4A5BA 4CJUA 1DGKN 4DTJA 4B1XB 3EEQA 4LF8K 3DRPA 4OKKA 2P9LB 1BU6O 2RE2A 4HUEA 3BF1A 4B3MK 4DSFA 4BQLA 2ZM6K 2P9IA 1HRHA 1C1CA 3VN5A 1NMDA 1NGIA 1L5UA 3DLEA 4IG0A 3QEPA 1U47A 3NGYA 2ZQBA 5LY3A 3T1AA 1ZXOA 3MMVA 3KD5E 5AQHA 4RW8A 1EETA 4Z0UA 3K2PA 1T3VA 4DV0K 1KC8O 1UAXA 4JKEA 4N5SA 3BGRA 2B6AA 5BPLA 4BC2A 4H0YB 3S3MA 4MFBA 4Z4CA 4JK7A 4NLCA 3BZCA 4FL9A 4AILC 2ZGZA 1JJ2M 2O4GA 4DSEA 1LWCA 1IJJA 1ZBIA 3KLFA 1WAFA 4DLGA 3ZSQA 3PY8A 3VGMA 4KTWA 4KRFA 4AHTA 4CJQA 3V9UA 1W9HA 4NO7A 4QS8A 1VSJA 1QQOA 1IG9A 1X1PA 2X6SA 3VTHA 1HKCA 3MN6A 4Z4IA 5FRNA 2YX6A 2X6NA 4FLUA 1HKGA 3ZSVA 3OY9A 4B3SK 4I9LA 1F21A 3QINA 2ZJQL 3THWB 4CIGA 4FLTA 1J9AA 4IDHA 1RDDA 4JRQA 1RT6A 2E6MA 5F1XA 1N34K 1VSKA 4JK8A 3MWTA 1BISA 3AO5A 1A5WA 5H1SQ 1G99A 3M6GA 4BG8A 1YVNA 4DS5A 3O9RA 1RT1A 1S5JA 1CZ9A 1VSDA 2W40A 3LP1A 5DM6L 3S3OA 1GLDG 1T6DA 4CHZA 3HXMA 3OYGA 1TAQA 1ATRA 3C0BA 3MDQA 4E7LA 2OPQA 3TSPA 3JXUA 4BQZA 3OYBA 2PYLA 3SCXA 3NVKA 3SJJA 4Z4EA 4YNQA 2QKBA 4CZFA 1MA9B 5HRPA 3V9WA 2X74A 4E7KA 4DV1K 3M8RA 3IS9A 2ASMA 3QBXA 1JXBA 5IWAK 4KH6A 3CCSN 4G1QA 4I2PA 3SUOA 4J2DA 2CH5A 4JN4A 1RDBA 3F2KA 1S6QA 3DLLL 3ZX2A 1X9SA 3FZHA 3OYNA 1ILYA 4JI6K 1C0UA 4CHPA 1VQPN 1Q82O 4KHNA 3DXKA 2YHXA 2J4RA 2BUPA 1WSJA 3O9QA 1TVRA 2YJFA 3WQTA 2A3ZA 2D1KA 4NYNA 4DSKA 3DRSA 1HYSA 3THVA 3CG7A 3S41A 4CEQA 2YNGA 3QNNA 4QS9A 4BR9A 3EKUA 4CGGA 5KQDA 2RN2A 5A2QO 4Q5VA 4M3UA 4BVOA 1VRTA 3SMPA 3PSFA 1O1WA 3M5RA 1XNQK 4DU4A 5AQRA 2EHGA 4M3ZA 3LDQA 3K58A 2HOEA 2NRVA 2Q0RA 1WSFA 5FPNA 4FJKA 3L2VA 3ZSZA 1MWKA 1U04A 2PAVA 5AQOA 4CERA 5LMUK 2Q1NA 3P31A 4PKHA 3SAFA 3THXB 2IOCA 3QEVA 2QWNA 3CJ7A 4R79A 1X3MA 2NRWA 4DTPA 4F8RA 4HTUA 3A8YA 4O5BA 1DEJA 3BUZB 2F9TA 3MCPA 3JAMO 1BQMA 1XQSC 1SS6A 4JEPA 3HP6A 3IUCA 4MO5A 1XHZA 2GEMA 2O8CB 4DFKA 3LDSA 3OVNA 3D7EO 1K8KA 3EE8A 1VQ7N 1EWRA 1KLNA 1VSEA 2XY7A 1QTMA 2YNIA 3AVAA 5M1OA 1OKJA 1ITGA 1WOQA 4JKGB 3O3FA 4DFJA 4CZJA 2ASPA 4CESA 3R6MA 4FVMA 2VWJA 2NRTA 1WSGA 4JI7K 4JRPA 3NF9A 3O5BA 3IAYA 2UUAK 1K9MO 3MN9A 3LDOA 1VQ6N 4DR6K 2I7PA 1Q86O 1JKHA 3QO9A 1YT3A 4BGBA 3HSTB 4ELVA 2KHOA 5TKWA 1VQNN 1UWBA 3ZX0A 1I39A 1S1XA 1KFDA 3U3YA 2HHUA 3RSEA 2GWJA 1Y64A 2OPSA 1IH7A 3O9SA 3I8DA 4KPYA 3C94A 4L8RB 4FPAA 3MX5A 2E1ZA 5KQ8A 4Y1CA 1BCOA 4OO1J 2HBKA 1P90A 3LL3A 1TK5A 1HNXK 1D5AA 1D8YA 4KREA 1BIUA 3CCEN 2IAJA 4JS4A 4LF6K 4DV6K 1T05A 3TWHA 2P51A 5AQYA 4DMNA 3KWIA 2IC3A 1RDAA 4ISEA 1XC9A 3AO2A 1L3VA 5E41A 1HX1A 3I33A 4YOTA 4AHRA 4W5TA 3I55N 3RMAA 4BRGA 3D0PA 3MN5A 3AVFA 2UU9K 4A62A 3L2QA 3VF2A 4Y1DA 2RHKA 3RVCA 4J2EA 1ASUA 3ASMA 1HLUA 3NH2A 2WONA 2DFEA 5M1FA 1OVQA 2P9PA 3ULDA 1TL1A 3FFKB 4CHYA 3CI5A 5AQTA 4IWVA 4FK4A 1U6ZA 3JYTA 2O8DB 3I0SA 2VWKA 4B1ZA 2FBXA 4O8UA 1KAYA 3WNFA 4CZHA 4W5NA 3VQDA 3L8BA 3VQBA 2E88A 4FLXA 1DTTA 1NGGA 3NF6A 3O3HA 4BY9C 5BPMA 2JLEA 3D2EB 3AO1A 3OJUA 3E9OA 4CJEA 1FJGK 4H5RA 4GV3A 1XHXA 2P9IB 4BR5A 4YOUA 3RRHA 2IGIA 3CQXA 3D2FA 3HK2A 3CYMA 3ZCMA 3WNGA 4A5AA 1BQNA 1YTAA 1UA0A 2E20A 3VQ4A 3UKRB 3JSMA 5JICA 3LPTA 1LWEA 4M3YA 1S3XA 4WFBL 5JVHL 3KTQA 4HUFA 3J80O 5ELZA 3T3FA 1C6VA 4JK9A 4DWIA 3B6PA 4ILJA 4IOXA 4IXCA 3TU5A 2B4JA 1S9EA 1HKBA 3PIPL 4WCEL 1U48A 5F2RA 1A5XA 2Z1HA 3VEWA 2NRZA 3ZT3A 3T7ZA 1DT9A 3SJHA 3AA4A 3VEXA 5LJWA 2P9SA 2I7NA 3O9UA 1S1UA 3H6EA 3KLEA 4CJVA 3CCUN 1D9FA 3OBYA 3V9SA 4C8LA 2G8KA 3HOSA 3BDPA 4IEIA 3AVJA 3T69A 4FWSA 4MLHA 2Z1IA 1BI4B 3UB5A 3NDKA 1YIJN 4A59A 1B9FA 3BF3A 4LFCK 5CHIA 2P9KB 3AVKA 4ZTFA 2HF4A 1NU0A 3HM9A 2XY5A 3DI6A 3F9KA 4KTZA 5IT9O 1JLBA 3TTFA 4OKJA 1FKPA 1EO1A 3AA2A 4CGJA 1NWKA 3ATUA 4W5QA 3MK6A 4H0XB 4CF9A 5HL7L 2HHTA 4DB3A 1U45A 4X64K 3MEEA 3ENOA 3AO3A 1U2VB 3O4NA 4GV9A 4CEDA 4DQQA 2O8EA 2Z1JA 3K9JA 2A41A 3OYIA 3M8SA 3IFRA 4RW9A 3LM9A 5AFUA 4CJFA 2NLXA 3VESA 4CD3A 3MN7A 3I8BA 4DFPA 3SPYA 4FJGA 1BHLA 3WXLA 4FZXC 2DFFA 3WXIA 1GLFO 1IG8A 4LF5K 3CXCM 4EZ6A 3ALYA 1NGCA 4X65K 5CR4A 4FJXA 3FFIA 4DQIA 1Q9XA 1NKCA 1J6ZA 3E66A 1H1VA 5KPZA 1QQCA 4IEEA 4KH4A 2KTQA 4CGFA 3RWUA 3DRRA 4FM2A 3VPZA 4E1NA 4G9ZA 4C1NI 3ULEB 1RT5A 4DR4K 4B9LA 4KB0A 1NMNA 4ZHRA 5B8HA 3G71N 1T6CA 2KFZA 1T03A 4DU1A 3DLRA 1J5OA 1FK9A 1NOZA 3C6HA 4MLEA 2A6AA 2E1YA 3LWMA 3CIPA 1S9GA 5GADP 4BR0A 2P9UB 2GX9A 5GIPA 2VYPA 1B92A 5AQZA 4H5TA 5C25A 1TKZA 4JI4K 4E1JA 3QNOA 1SL0A 2F4VK 1YHQN 1S1VA 4DQPA 4KH5A 5J2NA 1NKBA 3IDHA 1V4SA 4IG3A 1LOTB 4PQUA 1IKVA 1VQKN 3DYAA 4JHDA 1HQUA 3DAWA 3VMFB 1RNHA 4GY2B 3ZEUA 3OYLA 3THXA 3TAPA 4PY5A 2XRIA 4H5VA 3HPOA 4JYAK 3V1QA 4BR7A 3VQCA 3H3OB 5AQVA 4CIFA 3KD1E 2ZWHA 4B3OA 3EL2A 4J8FA 1W97L 3ATVA 4NXNK 3KK2A 2EWSA 1GLAG 4KBOA 3VTIA 2YHYA 1WBDA 3QIOA 1K8KB 1HUXA 3OYKA 1ZBLA 4LF4K 3S9HA 3FE1A 1WLJA 1RDUA 3PUFA 4JKGA 4BRQA 2UYTA 2PFUA 4ELTA 2IDOA 4CK3A 3FLCO 1HNIA 5BR8K 3CCJN 1X9WA 2XHBA 1OH7A 4FJ9A 2HHWA 3NBPA 2O4IA 1J53A 3I0RA 4F4KA 3ZSYA 1IV0A 4FWMA 4HWIA 4BROA 3UKUA 2D4WA 4AHSA 5E26A 3G6EN 3R1XA 3DJCA 3DXMB 2OANA 4X62K 1JL1A 1SKRA 4UY8O 3NH0A 2VGMA 2DY4A 1R59O 3OS0A 4XH1A 1FXXA 4DUYK 3CCLN 1S72N 4JI2K 3K5MA 4CHOA 4CF1A 2OA8A 4NCAA 3HZ6A 4I7FA 4KFBA 5M1KA 3CMAN 3MXMA 3VQ7A 3A5LC 4IFVA 3A5MC 3HRGA 4JKCA 1MU2A 3SV4A 4DTMA 4FJ5A 5FDLA 2XY8A 2OCEA 3AVNA 3CMEN 5AQXA 1RT7A 3OYEA 1WSHA 3QMLA 4YDUC 3THYB 4C1NK 5C12A 3HP9A 4FLVA 1HNWK 5BR9A 2HBMA 4DS4A 3LM2A 3CC7N 1DTQA 3QLHA 3LAKA 4ISFA 4DR3K 3AVCA 1N32K 1YJNN 1SV5A 4IZ9A 4CECA 4YOVA 4JD2B 4IJAA 2WBNA 3O4WA 4M3RA 4IBNA 4Z94A 4BWMA 3EY1A 4DR5K 1OH5A 1NGFA 3VF6A 3T19A 1EP4A 4GNIA 4FLZA 2YNFA 2E2PA 1KVBA 2HHVA 4MO4A 3J7AP 3IG1A 3MCAB 3TR8A 4IOAL 4WF9L 5KI6A 3F73A 4L3QA 2XY6A 3LP3A 3NGZA 2BTFA 3GL1A 2HW3A 3KKRA 1NK0A 2Q0UA 4A2BA 1BG3A 1K6YA 3SLCA 4H0PA 4HVJA 4CZEA 5F0XA 3MAQA 2HB5A 4B9TA 3KK7A 1VSMA 4ILGB 4YY3K 2YHWA 1NM1A 1SKSA 1YJWN 5J2PA 2VQFK 1TK8A 1JCFA 4BRCA 1HNZK 5EOYA 2UXCK 1O13A 3O1WA 5AJ3K 4B1VA 3UKRA 3HYFA 4C8MA 4BDYA 2ZF5O 4DTNA 5MLCQ 3CJ9A 3KZBA 3AVHA 2OPPA 1C0MA 2FF3B 4O5FA 4DTXA 1CXQA 5GAEP 4B1WB 1D4XA 1S6PA 4NB4A 5AR0A 3K59A 2G8IA 2AJQA 5BRHA 4H4MA 5AFUH 4M42A 3KIOA 1Q7YO 1RBUA 3WXKA 4CEZA 1E4FT 4BGAA 1WNSA 2GELA 2P9SB 3PX0A 5FPDA 4FVUA 3TAEA 1NK9A 1QZ5A 5HLFA 2PZSA 1IKYA 2CGJA 3O4QA 4JKAA 2QA4N 2D5RA 4YOYA 1NKEA 4PL8A 3Q7BA 2FBTA 1YJ9N 3HBTA 2F8SA 2GUPA 2LSNA 4BWJA 2O8FB 1WB9A 4CJTA 3HI0A 4X66K 3NVMA 2WUSA 4HCBA 3LDNA 3FZFA 1RTDA 1DLOA 1M1KO 1VQ5N 1VQ4N 1B9DA 1RDCA 3LDPA 4CF8A 1NJWA 1NOYA 2E6LA 1DKGD 2QWPA 3EYZA 5K14A 3P5JA 2Q3SA 4CF2A 4CGDA 3HL8A 3OJSA 1RTHA 3CERA 3NF8A 4F3TA 3LZIA 2D0PA 4DV5K 3TSQA 1E4GT 4C23A 1YAGA 1N33K 5BRDA 5CY4A 1W7AA 3EZWA 2CGKA 2GWKA 4W5OA 4XEIA 5AQQA 1U49A 3NHGA 2V51B 3CCRN 4IO9L 5C24A 3V6DA 4BE2A 2HVIA 2F9WA 4DQSA 2IVPA 2QTDA 5AZJA 4CZLA 1OH6A 2HHSA 4PWDA 3OBWA 3SBGA 2CH6A 1SKWA 2WFBA 4DTSA 1EX4A 4M45A 4BVPA 4IDKA 3FZKA 4O0JA 3UE5A 4FJIA 4DG1A 3H1VX 3BP8A 5AQWA 4KI4A 3L2WA 1IKWA 3ENBA 2FXUA 3S3NA 1S1WA 2G8HA 4KB1A 3AVIA 3SNNA 1C0GA 1KCFA 1V4TA 1I3AA 5AQIA 4DQRA 2OTLN 4K41A 4JAXA 4HHTA 3H45C 1LAWA 3L2UA 2A5XA 2P9UA 3N4PA 4H0VB 3CC2N 1N36K 3NFAA 1LCUA 2HNZA 5AZIB 3LP0A 2A1SA 5CE3A 4FLWA 2YHBA 3MEGA 1OH8A 1WUAA 2KLAA 1ESVA 2YI1A 4I6MB 4NYFA 1KXPA 4H8KA 3V4IA 3SUQA 1R0AA 4YDUA 4CBWA 2ITGA 2PBDA 4RW7A 4N41A 5AQKA 1NJIO 1SAZA 1TAUA 1RBVA 4FWKA 4I2QA 4CJLA 4BR4A 4DF8A 3AV9A 3VGLA 1JLEA 3DXKB 4CZIA 4OJRA 5DK5A 3ZETB 3QIPA 3MECA 2FLOA 5KTQA 1JCGA 2HMPA 1EKEA 4H4OA 3TI0A 1YI2N 4NLBA 3L6QA 3SUPA 1VHXA 3OYHA 3TPQA 4JNEA 4KV8A 3O1BA 5CYQA 4FWQA 3EO3A 4RG8A 3A5OC 3F9MA 4N47A 1FW6A 4ZTJA 4KHUA 4CJWA 2FF6A 3U9ZA 2KFNA 3V9ZA 3SAGA 4CFAA 1C0TA 2Q2RA 1NK8A 1A5VA 4CEFA 2EX3A 3B6OA 1L3SA 4B08A 4CZGA 1TGOA 4LY7A 1YF5L 3VEVA 5E84A 1LWFA 2FBYA 2YCHA 3DMJA 3VEZA 4JKDA 4K42A 3HVTA 1RT3A 4EZ9A 4AF1A 1NK4A 3PX6A 1Q8IA 2E2QA 3O9TA 1IKXA 4DTUA 4C8OA 3OS1A 3TARA 3O80A 1CZAN 1NGJA 4KO0A 4FM0A 3VA3A 5HROA 2X78A 3KLIA 5J2MA 3NMUA 1HPMA 4KHSA 4BC4A 1RCHA 3MX2A 4DTRA 4FJNA 4FXDA 4OKEA 3ZX3A 5KGXA 5FRMA 2HNYA 1KAZA 4I9QA 2ATQA 2NRRA 3V81A 4Y0WA 1QHTA 1VQ9N 4AQYK 5M1QA 4F9OA 1FKOA 2VG5A 3F5TA 2Q36A 3VEOA 4DSLA 4XIUA 2KW4A 3L4IA 4CEOA 2HVHA 1QSSA 3H08A 4UQGA 4O55A 3EKSA 3VEYA 2GTDA 3KLGA 3FR0A 4JD2A 5EY4A 1JCEA 3WEEB 4DV3K 4H5WA 3VF4A 3SBTA 2G8UA 1S1TA 4KKOA 1WN7A 3C95A 4CBXA 4H0TB 3TAFA 3A5NC 2A42A 1HYVA 1QQMA 4YOWA 3RSEB 4DV2K 3CFPA 3OYMA 3C6TA 3GBTA 4E19A 1VSIA 3D45A 4OPJA 3K5NA 3P38A 2KKZA 5BN9A 2WOMA 1VQLN 1XMOK 2HHQA 1GLJO 4NCBA 1BCMA 4B3TK 3GE1A 5JLFA 1X9MA 2ZJRL 1TUUA 4O44A 2P9LA 3WQUA 4KAZA 3VQPA 3L2RA 1NK7A 2UXDK 3UIQA 3EZ5A 3QEXA 2QXLA 3CFOA 1VSFA 3MXIA 2YV0X 4KHQA 4B3RK 4CJPA 4M7YA 4FOIA 5JLHA 3A0IX 3CPEA 2VG6A 4BRPA 1ATNA 1I94K 1J5EK 4JLHA 2P5GA 3AGRA 4LFBK 3ID6A 3H1QA 3DWLA 1NGAA 3R9PA 2NRHA 4FWNA 1U4BA 3ENHA 4JV5K 1BDGA 2Q97A 4B9QA 2FSNA 4LC9B 3DLBA 4FOEA 4OGEA 3KLHA 3KK1A 1BIZA 2NZTA 3MEDA 4BDZA 5JMVA 2O8DA 1NGDA 5GAGP 5AQUA 1TKDA 3AO4A 4O0IA 4HUGA 3FZLA 4K25A 4FJLA 4H03B 1YUWA 4OGCA 3QFUA 1IO2A 3W3DA 5KRSA 2A40A 4GKKK 1KLMA 2HF3A 3OA9A 3HT3A 2OTJN 1RBTA 2YJEA 1GLLO 4FJMA 1ZBUA 2ZE2A 5BPNA 1Q18A 2OZMA 1EXQA 3OYDA 4MQ3A 3G0ZA 1EQYA 3SPZA 2O8FA 4MDBA 1HQEA 4H5NA 4IFEA 3DLKA 1LV5A 1KD1O 4CFCA 3KVGA 4LSNA 1TYQB 2Y1JA 4FW2A 4B9NA 3AA5X 4OX9K 2HBLA 4O8KA 4LSLA 4FWPA 3VENA 2IVNA 1T8EA 4DTOA 4QS7A 4CHQA 1RTJA 4M63C 3J8AA 4M3WA 4WQ5C 3MXJA 1Z6RA 4ILHA 2QKKA 3VETA 1NK6A 3D6RA 1XWLA 4DR7K 3SUNA 3SZ2A 3RRGA 3CJ1A 1ZC6A 3TANA 3VA0A 4RW6A 1VSHA 3DLHA 4CBUA 3JS6A 1BI4A 2Y1IA 4CIEA 2VWBA 5AZJB 2XO7A 4Q0BA 2WTUA 2R7YA 2YKMA 4DR1K 3QETA 1ASWA 3NAEA 4JKBA 1KVCA 1N5YA 2G8WA 1KVAA 2GV9A 4A57A 3AVBA 3MWPA 4M41A 3V1RA 3Q7CA 5FPMA 1VRUA 4CI6A 2D0OA 3H46O 3A2FA 3WNEA 1NJXA 2HHXA 3K57A 3ZSRA 3ZSWA 2YNHA 1N6QA 2Z1GA 2FBVA 4M3TA 4FSVA 2AP1A 5T7BA 2O8EB 3CCVN 4NCGA 2BH1A 5AQMA 5ADXH 3CFRA 4FZZA 4EIAA 3IMXA 1L3UA 4OVLA 1WSIA 5LMNK 2YHAA 2W6LA 4JS5A 3R3LA 2ETJA 3VQ8A 4I6MA 4LD0A 3C65A 4CE9A 3LP2A 4K8ZA 5C10A 1LW2A 4K8XA 1RDWX 3CETA 3OYFA 4CGIA 5HBMA 2KZMA 1QVFM 4YORA 4B8CA 2QK9A 1BOTO 3G4SN 4N56A 4CEAA 3TTCA 4XH4A 3E1YA 3ZETA 3K5LA 1IBKK 5C2DA 3ULEA 2HHHK 2VG7A 2O8CA 4CJ3A
chains in the Genus database with same CATH topology
3ZCMA 5CY4A 3WNGA 1BQNA 3ITHA 4GVMA 4W5OA 1YTAA 1U49A 1UA0A 3NHGA 3VQ4A 3V6DA 3K5OA 5C24A 2HVIA 4BE2A 1JLQA 3JSMA 4DQSA 3QEWA 3LPTA 1LWEA 2D0BA 1TV6A 1VK0A 4M3YA 1REVA 4B9SA 3ZT1A 3KTQA 4HUFA 4DF4A 4QAGA 1VSLA 1SL2A 4CJRA 2E4LA 2HHSA 4PWDA 3RMBA 1QE1A 1BL3A 1RBRA 3T3FA 3M8PA 5J1EA 1SKWA 1C6VA 2JGUA 5HRRA 2W42A 4Z4HA 4DWIA 3B6PA 4DTSA 1EX4A 4M45A 4IDKA 3WNHA 4PUOA 2B4JA 1S9EA 4O0JA 1GOAA 1G15A 3SQ0A 3DOKA 1U48A 4DG1A 1ZYQA 4FJIA 3DLGA 3IRXA 1A5XA 3HO1A 4CJKA 4KI4A 2Z1HA 3L2WA 1IKWA 3ZT3A 4AHCA 3S3NA 1S1WA 5CZ1A 3OYJA 2G8HA 4KB1A 3AVIA 1YTUA 3AA4A 3QESA 1KCFA 3L3UA 3CQ8A 3QERA 3SNNA 4GW6A 3RR8A 3CM6A 1I3AA 5I3UA 4DQRA 1S1UA 5CYMA 1J54A 3KLEA 4CJVA 4DFMA 1D9FA 4HHTA 1LAWA 4F3OA 3L2UA 5JS2A 3V9SA 3ZSOA 2G8KA 1JLCA 4C8LA 3BDPA 3TAMA 3AVJA 3ZT2A 1NK5A 4IKFA 4FK2A 3LZJA 4BACA 4CGHA 4CJ3A 2Z1IA 1BI4B 5EU7A 3AVLA 3TAQA 1JL2A 3NDKA 3NFAA 2HNZA 3HVRA 3LP0A 1B9FA 2A1SA 3E01A 4AHUA 4FLWA 2YHBA 3MEGA 3AVKA 1RT4A 1JLGA 1TK0A 4ZTFA 1KRPA 4OLBA 3HPHA 3HM9A 4NYFA 2XY5A 2DTUA 2BE2A 3DI6A 4H8KA 3OS2A 3V4IA 3SUQA 3F9KA 4KTZA 1R0AA 1HPZA 2KQ2A 1JLBA 2ITGA 4OKJA 1FKPA 4Z4GA 4RW7A 4N41A 1RTIA 3AA2A 2P1JA 4CGJA 4W5QA 1NJZA 1YVUA 4CF9A 4QCLA 1RBVA 2HHTA 4CJUA 1CXUA 4DTJA 1RBSA 1CZBA 3KK3A 1U45A 4I2QA 4CJ4A 1QS4A 4CJLA 3DRPA 3MEEA 3AO3A 4OKKA 3O4NA 4DF8A 3AV9A 3VQ5A 4CEDA 4DQQA 1JLEA 3AA3A 2Z1JA 4HUEA 2BGGA 4OJRA 3OYIA 5DK5A 1ZBHA 3VQEA 3QIPA 3MECA 3M8SA 4DSFA 1RT2A 3P1GA 5KTQA 1EKEA 4H4OA 3TI0A 4RW9A 1HRHA 1C1CA 3SUPA 3OYHA 4KV8A 3VN5A 5CYQA 3SQ2A 4QOZB 4RG8A 4CJFA 4GMJB 1ZBFA 4CF0A 4N47A 1L5UA 3DLEA 4IG0A 3NH1A 3QEPA 4DFPA 4ZTJA 3SPYA 5FROA 1U47A 1BHLA 2ZQBA 3NGYA 4CJWA 4FJGA 4W5RA 4PA1A 4FZXC 3T1AA 4KHUA 2DFFA 3V9ZA 2KFNA 4CFAA 1C0TA 1NK8A 2EX3A 1A5VA 3B6OA 4RW8A 3ALYA 4CEFA 4BE1A 1L3SA 1EETA 3KD5E 4EZ6A 4Z0UA 4FJXA 3K2PA 4B08A 3FFIA 4DQIA 1UAXA 1Q9XA 1NKCA 1TGOA 4N5SA 4LY7A 3BGRA 2B6AA 3RMDA 1QQCA 3S3MA 4FJ7A 2O4IA 3AVGA 2BDPA 2KTQA 4MFBA 4Z4CA 1LWFA 4AILC 2O4GA 2FBYA 4CGFA 3RWUA 2ZD1A 3DMJA 3DRRA 4FM2A 4DSEA 1LWCA 2OPRA 4E1NA 4CFDA 4E7HA 1ZBIA 3KLFA 3HVTA 1RT3A 4EZ9A 1WAFA 3LAMA 3SQ4A 3PX6A 1Q8IA 1NK4A 1RT5A 1IKXA 4DLGA 4DTUA 4B9LA 4KB0A 3ZSQA 3OS1A 3TARA 4ZHRA 4EP4A 3PY8A 4YFUA 5C42A 4C8OA 4KTWA 3CM5A 4KO0A 4KRFA 4AHTA 4FM0A 2KFZA 4CJQA 3V9UA 4DU1A 1W9HA 3KJVA 1T03A 4ICLA 3VA3A 3DLRA 1J5OA 5HROA 1VSJA 4E7IA 1FK9A 2X78A 1NOZA 3KLIA 5J2MA 2G8VA 2QXFA 4KI6A 3SQ1A 1IG9A 3LWMA 4KHSA 1RCHA 1S9GA 1X1PA 3G10A 4DTRA 4FJNA 2X6SA 4FXDA 4OKEA 5KGXA 5FRMA 4O4GA 2HNYA 1B92A 5FRNA 5C25A 1WAJA 3QNOA 1TKZA 1SL0A 4Z4IA 4FJ8A 3AVMA 2KZZA 1RILA 1HNVA 4I9QA 2X6NA 2ATQA 4FLUA 3V81A 3ZSVA 1S1VA 1QSYA 4DQPA 3OY9A 4FYDA 5J2NA 3VQAA 1NKBA 4I9LA 1QHTA 4IG3A 1F21A 5I42A 3QINA 1IKVA 4PQUA 3QEIA 1JLAA 3DYAA 1Z26A 4C8KA 4CIGA 4FLTA 1HQUA 1J9AA 4J2BA 1HYZA 1FKOA 2VG5A 3L3VA 1RNHA 4CK2A 1RDDA 4JRQA 1RT6A 2E6MA 1VSKA 4DSLA 1D9DA 4XIUA 2KW4A 2HVHA 4CEOA 3PO5A 1BISA 3AO5A 4CCHA 1A5WA 3ZT4A 3OYLA 3TAPA 1CLQA 4PY5A 1QSSA 3H08A 2XRIA 4DS5A 4E0DA 4UQGA 3RR7A 4O55A 1RT1A 1QSLA 3HPOA 1S5JA 3V1QA 1CZ9A 2F96A 1VSDA 3VQCA 3LP1A 3KLGA 2D0AA 3S3OA 4CIFA 3ZSXA 3KD1E 4CHZA 5CZ2A 4B3OA 4N76A 3HXMA 3OYGA 1TAQA 4E7LA 2OPQA 4C8NA 1JLFA 3OYBA 2PYLA 3SCXA 4KTQA 4M3XA 3KK2A 3SJJA 2G8UA 4Z4EA 4YNQA 1S1TA 2HNDA 3KKSA 1WN7A 3C95A 4KKOA 3TAFA 2QKBA 3QIOA 1NJYA 1HYVA 3OYKA 1ZBLA 3CFPA 3S9HA 4E7KA 5HRPA 3V9WA 2X74A 1WLJA 1Q9YA 3OYMA 3C6TA 3M8RA 3IS9A 4E19A 1VSIA 3D45A 3PUFA 5D3GA 4DLEA 2OYQA 4OPJA 3K5NA 2B5JA 2A1RA 3NF7A 2IDOA 2WOMA 3RTVA 4ELTA 2HHQA 4CK3A 1JXBA 3V9XA 4TSXA 3SUOA 1HNIA 4G1QA 4I2PA 4J2DA 1BCMA 4NCBA 4FW1A 1X9WA 2XHBA 3M8QA 1RDBA 1X9MA 1S6QA 4O44A 4CFBA 1X9SA 3OYNA 4KAZA 4FJ9A 3VQPA 2HHWA 1C0UA 3NBPA 4CHPA 1J53A 3L2RA 1NK7A 4KHNA 3UIQA 3I0RA 3EZ5A 3QEXA 4F4KA 3CFOA 3ZSYA 3PO4A 2BANA 1VSFA 3MXIA 1T7PA 1WSJA 1TVRA 4ID5A 4AHSA 4NYNA 4DSKA 2YV0X 4KHQA 3DRSA 4B9MA 3THVA 1HYSA 4CJPA 3CG7A 3RMCA 4CEQA 3LALA 5KRTA 2YNGA 1TL3A 3QNNA 1JL1A 2VG6A 4CK1A 1SKRA 4CGGA 3NH0A 2YKNA 2RN2A 3O3GA 2DY4A 3OS0A 4JLHA 1FXXA 2P5GA 2GBZA 4Q5VA 3K5MA 2HMIA 4CHOA 4M3UA 4IFYA 1VRTA 4CF1A 4CJ5A 2OA8A 4NCAA 4KHYA 2F8TA 1O1WA 4I7FA 1U4BA 4KFBA 4DU4A 1C1AA 4CHNA 2EHGA 4M3ZA 3DLBA 3MXMA 3VQ7A 3HJFA 4IFVA 3K58A 4OGEA 3KLHA 3KK1A 1BIZA 3SV4A 1MU2A 3MEDA 4DTMA 4FJ5A 5FDLA 1GOCA 3AVNA 2I5JA 2XY8A 4BDZA 3DM2A 1WSFA 4FJKA 3L2VA 3ZSZA 1RT7A 3PV8A 1ASVA 3OYEA 1WSHA 3AO4A 1TKDA 1U04A 4O0IA 2D0CA 4CERA 4HUGA 4F2SA 3V1OA 3HP9A 3U6FA 2G8FA 4FLVA 1SL1A 4FJLA 5HP1A 3TAGA 4DS4A 4OGCA 2IOCA 3SV3A 1LW0A 4DTPA 1DTQA 3QEVA 1XI1A 1IO2A 4F8RA 4F2RA 3QLHA 3LAKA 5KRSA 4HTUA 3AVCA 4O5BA 4B9UA 1SV5A 4CECA 2PY5A 1KLMA 4WE1A 4IBNA 4LH5A 1GOBA 4M3RA 3HT3A 4BWMA 1BQMA 1RBTA 3EY1A 4FJMA 3U3GA 2RF2A 4BDPA 1L3TA 1ZBUA 2ZE2A 3HP6A 2OZMA 3T19A 1EP4A 1EXQA 1XHZA 4FLZA 2YNFA 3OYDA 3LDSA 4MQ3A 4DFKA 3G0ZA 1KVBA 3OVNA 3SPZA 5DMRA 2HHVA 1HQEA 3DLKA 3IG1A 1TKXA 1LV5A 3TR8A 1KLNA 1VSEA 2XY7A 1QTMA 2YNIA 3AVAA 4CFCA 1ITGA 4LSNA 3O3FA 3PX4A 3DOLA 4DFJA 2NUBA 4LH4A 5KI6A 4CJSA 3F73A 4CESA 3ISNC 2IS3A 4FVMA 3LPUA 2VWJA 2XY6A 2GUIA 2Y1JA 1WSGA 4FW2A 4JRPA 3AA5X 3NF9A 3LP3A 3OYCA 4B9NA 3LWLA 1TAUA 3NGZA 3IAYA 4FK0A 2HW3A 3SYZA 3KKRA 4E3SA 1NK0A 4LSLA 2DFHA 4FZYA 5JS1A 4ELUA 4HCCA 2RKIA 1K6YA 1T8EA 4DTOA 4HVJA 4CHQA 1JKHA 3VQ9A 1RTJA 3QO9A 1YT3A 2HB5A 3MAQA 4FM1A 3HSTB 4B9TA 4ELVA 4M3WA 1Z25A 3MXJA 4AHVA 1UWBA 1VSMA 1KFSA 2QKKA 4KHWA 1NK6A 1I39A 1S1XA 1SKSA 1KFDA 5HRNA 5J2PA 1TK8A 1LAVA 1XWLA 4E1MA 3U3YA 3SUNA 1KSPA 2HHUA 3SZ2A 4B9VA 2RPIA 3RRGA 2OPSA 3TANA 1BGXT 1IH7A 3I8DA 3VA0A 3P83D 3C94A 1VSHA 4RW6A 3DLHA 3HYFA 4KPYA 1JXEA 4L8RB 4FJHA 4C8MA 5J2QA 2Y1IA 1BI4A 4BDYA 4CIEA 4Q0BA 2XO7A 5SZTA 4E89A 2R7YA 4DTNA 2YKMA 4Y1CA 4ID1A 3QETA 1ASWA 1BCOA 1KTQA 1KVCA 3AVHA 3NAEA 1N5YA 1TK5A 1KVAA 2G8WA 4DSJA 2OPPA 1C0MA 1D5AA 2GV9A 4DTXA 1D8YA 4KREA 3SI6A 4OLAA 1BIUA 2IAJA 3AVBA 1CXQA 4CEEA 4JS4A 1T05A 1S6PA 3K59A 4M41A 3V1RA 2G8IA 3TWHA 2AJQA 2P51A 4H4MA 3NCIA 1VRUA 4DU3A 4DMNA 4FLYA 4M42A 4FJJA 3KIOA 1RBUA 3A2FA 1WSEA 2IC3A 3WNEA 4CEZA 2OZSA 1RDAA 1NJXA 1Y97A 2HHXA 3K57A 3ZSRA 3ZSWA 1XC9A 2YNHA 3AO2A 1L3VA 1N6QA 1WNSA 1TKTA 2Z1GA 4B8AB 3PX0A 2FBVA 5E41A 4W5TA 4AHRA 3TAEA 1NK9A 4M3TA 4E7JA 5HLFA 3RMAA 2PZSA 1IKYA 3O4QA 5T7BA 4NCGA 2P5OA 3D0PA 3CFRA 2D5RA 4FZZA 3AVFA 1NKEA 3ZT0A 4CEBA 1L3UA 3L2QA 4Y1DA 4J2EA 4OVLA 1HJRA 1ASUA 3ASMA 3VQQA 1SUQA 3NH2A 1C1BA 1WSIA 2FBTA 2YHAA 2WONA 2DFEA 4R5PA 3TABA 2F8SA 3LANA 5SWMA 3ULDA 1TL1A 4CHYA 4JS5A 2PYJA 2LSNA 4BWJA 4CJTA 2ETJA 4OPKA 1UA1A 3VQ8A 4FK4A 4LD0A 3JYTA 3I0SA 2VWKA 4HCBA 4CE9A 4DSIA 2FBXA 3LP2A 4K8ZA 5HRSA 3NE6A 4FCYA 3WNFA 1LW2A 1RTDA 3OYAA 4K8XA 1DLOA 3OYFA 4W5NA 1B9DA 4CGIA 5HBMA 2KZMA 1RDCA 2FC0A 3VQDA 3L8BA 4EP5A 3VQBA 1NJWA 4CF8A 4Z4FA 4J2AA 4B8CA 2QK9A 1HMVA 1UOCA 2E6LA 1NOYA 3HPGA 3VQ6A 4FLXA 1DTTA 3EYZA 5K14A 3NF6A 3P5JA 3O3HA 4RW4A 4N56A 4CEAA 2Q3SA 4CF2A 1W0HA 2JLEA 3AO1A 4CGDA 3HL8A 3OJUA 3OJSA 3K5LA 3NGIA 1RTHA 4CJEA 4AH9A 4F3TA 3NF8A 3C6UA 3LZIA 1XHXA 2VG7A 3RRHA 2IGIA 5KGWA 3HK2A 3CYMA 4BE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCM A;  5CY4 A;  3WNG A;  1BQN A;  3ITH A;  4GVM A;  4W5O A;  1YTA A;  1U49 A;  1UA0 A;  3NHG A;  3VQ4 A;  3V6D A;  3K5O A;  5C24 A;  2HVI A;  4BE2 A;  1JLQ A;  3JSM A;  4DQS A;  3QEW A;  3LPT A;  1LWE A;  2D0B A;  1TV6 A;  1VK0 A;  4M3Y A;  1REV A;  4B9S A;  3ZT1 A;  3KTQ A;  4HUF A;  4DF4 A;  4QAG A;  1VSL A;  1SL2 A;  4CJR A;  2E4L A;  2HHS A;  4PWD A;  3RMB A;  1QE1 A;  1BL3 A;  1RBR A;  3T3F A;  3M8P A;  5J1E A;  1SKW A;  1C6V A;  2JGU A;  5HRR A;  2W42 A;  4Z4H A;  4DWI A;  3B6P A;  4DTS A;  1EX4 A;  4M45 A;  4IDK A;  3WNH A;  4PUO A;  2B4J A;  1S9E A;  4O0J A;  1GOA A;  1G15 A;  3SQ0 A;  3DOK A;  1U48 A;  4DG1 A;  1ZYQ A;  4FJI A;  3DLG A;  3IRX A;  1A5X A;  3HO1 A;  4CJK A;  4KI4 A;  2Z1H A;  3L2W A;  1IKW A;  3ZT3 A;  4AHC A;  3S3N A;  1S1W A;  5CZ1 A;  3OYJ A;  2G8H A;  4KB1 A;  3AVI A;  1YTU A;  3AA4 A;  3QES A;  1KCF A;  3L3U A;  3CQ8 A;  3QER A;  3SNN A;  4GW6 A;  3RR8 A;  3CM6 A;  1I3A A;  5I3U A;  4DQR A;  1S1U A;  5CYM A;  1J54 A;  3KLE A;  4CJV A;  4DFM A;  1D9F A;  4HHT A;  1LAW A;  4F3O A;  3L2U A;  5JS2 A;  3V9S A;  3ZSO A;  2G8K A;  1JLC A;  4C8L A;  3BDP A;  3TAM A;  3AVJ A;  3ZT2 A;  1NK5 A;  4IKF A;  4FK2 A;  3LZJ A;  4BAC A;  4CGH A;  4CJ3 A;  2Z1I A;  1BI4 B;  5EU7 A;  3AVL A;  3TAQ A;  1JL2 A;  3NDK A;  3NFA A;  2HNZ A;  3HVR A;  3LP0 A;  1B9F A;  2A1S A;  3E01 A;  4AHU A;  4FLW A;  2YHB A;  3MEG A;  3AVK A;  1RT4 A;  1JLG A;  1TK0 A;  4ZTF A;  1KRP A;  4OLB A;  3HPH A;  3HM9 A;  4NYF A;  2XY5 A;  2DTU A;  2BE2 A;  3DI6 A;  4H8K A;  3OS2 A;  3V4I A;  3SUQ A;  3F9K A;  4KTZ A;  1R0A A;  1HPZ A;  2KQ2 A;  1JLB A;  2ITG A;  4OKJ A;  1FKP A;  4Z4G A;  4RW7 A;  4N41 A;  1RTI A;  3AA2 A;  2P1J A;  4CGJ A;  4W5Q A;  1NJZ A;  1YVU A;  4CF9 A;  4QCL A;  1RBV A;  2HHT A;  4CJU A;  1CXU A;  4DTJ A;  1RBS A;  1CZB A;  3KK3 A;  1U45 A;  4I2Q A;  4CJ4 A;  1QS4 A;  4CJL A;  3DRP A;  3MEE A;  3AO3 A;  4OKK A;  3O4N A;  4DF8 A;  3AV9 A;  3VQ5 A;  4CED A;  4DQQ A;  1JLE A;  3AA3 A;  2Z1J A;  4HUE A;  2BGG A;  4OJR A;  3OYI A;  5DK5 A;  1ZBH A;  3VQE A;  3QIP A;  3MEC A;  3M8S A;  4DSF A;  1RT2 A;  3P1G A;  5KTQ A;  1EKE A;  4H4O A;  3TI0 A;  4RW9 A;  1HRH A;  1C1C A;  3SUP A;  3OYH A;  4KV8 A;  3VN5 A;  5CYQ A;  3SQ2 A;  4QOZ B;  4RG8 A;  4CJF A;  4GMJ B;  1ZBF A;  4CF0 A;  4N47 A;  1L5U A;  3DLE A;  4IG0 A;  3NH1 A;  3QEP A;  4DFP A;  4ZTJ A;  3SPY A;  5FRO A;  1U47 A;  1BHL A;  2ZQB A;  3NGY A;  4CJW A;  4FJG A;  4W5R A;  4PA1 A;  4FZX C;  3T1A A;  4KHU A;  2DFF A;  3V9Z A;  2KFN A;  4CFA A;  1C0T A;  1NK8 A;  2EX3 A;  1A5V A;  3B6O A;  4RW8 A;  3ALY A;  4CEF A;  4BE1 A;  1L3S A;  1EET A;  3KD5 E;  4EZ6 A;  4Z0U A;  4FJX A;  3K2P A;  4B08 A;  3FFI A;  4DQI A;  1UAX A;  1Q9X A;  1NKC A;  1TGO A;  4N5S A;  4LY7 A;  3BGR A;  2B6A A;  3RMD A;  1QQC A;  3S3M A;  4FJ7 A;  2O4I A;  3AVG A;  2BDP A;  2KTQ A;  4MFB A;  4Z4C A;  1LWF A;  4AIL C;  2O4G A;  2FBY A;  4CGF A;  3RWU A;  2ZD1 A;  3DMJ A;  3DRR A;  4FM2 A;  4DSE A;  1LWC A;  2OPR A;  4E1N A;  4CFD A;  4E7H A;  1ZBI A;  3KLF A;  3HVT A;  1RT3 A;  4EZ9 A;  1WAF A;  3LAM A;  3SQ4 A;  3PX6 A;  1Q8I A;  1NK4 A;  1RT5 A;  1IKX A;  4DLG A;  4DTU A;  4B9L A;  4KB0 A;  3ZSQ A;  3OS1 A;  3TAR A;  4ZHR A;  4EP4 A;  3PY8 A;  4YFU A;  5C42 A;  4C8O A;  4KTW A;  3CM5 A;  4KO0 A;  4KRF A;  4AHT A;  4FM0 A;  2KFZ A;  4CJQ A;  3V9U A;  4DU1 A;  1W9H A;  3KJV A;  1T03 A;  4ICL A;  3VA3 A;  3DLR A;  1J5O A;  5HRO A;  1VSJ A;  4E7I A;  1FK9 A;  2X78 A;  1NOZ A;  3KLI A;  5J2M A;  2G8V A;  2QXF A;  4KI6 A;  3SQ1 A;  1IG9 A;  3LWM A;  4KHS A;  1RCH A;  1S9G A;  1X1P A;  3G10 A;  4DTR A;  4FJN A;  2X6S A;  4FXD A;  4OKE A;  5KGX A;  5FRM A;  4O4G A;  2HNY A;  1B92 A;  5FRN A;  5C25 A;  1WAJ A;  3QNO A;  1TKZ A;  1SL0 A;  4Z4I A;  4FJ8 A;  3AVM A;  2KZZ A;  1RIL A;  1HNV A;  4I9Q A;  2X6N A;  2ATQ A;  4FLU A;  3V81 A;  3ZSV A;  1S1V A;  1QSY A;  4DQP A;  3OY9 A;  4FYD A;  5J2N A;  3VQA A;  1NKB A;  4I9L A;  1QHT A;  4IG3 A;  1F21 A;  5I42 A;  3QIN A;  1IKV A;  4PQU A;  3QEI A;  1JLA A;  3DYA A;  1Z26 A;  4C8K A;  4CIG A;  4FLT A;  1HQU A;  1J9A A;  4J2B A;  1HYZ A;  1FKO A;  2VG5 A;  3L3V A;  1RNH A;  4CK2 A;  1RDD A;  4JRQ A;  1RT6 A;  2E6M A;  1VSK A;  4DSL A;  1D9D A;  4XIU A;  2KW4 A;  2HVH A;  4CEO A;  3PO5 A;  1BIS A;  3AO5 A;  4CCH A;  1A5W A;  3ZT4 A;  3OYL A;  3TAP A;  1CLQ A;  4PY5 A;  1QSS A;  3H08 A;  2XRI A;  4DS5 A;  4E0D A;  4UQG A;  3RR7 A;  4O55 A;  1RT1 A;  1QSL A;  3HPO A;  1S5J A;  3V1Q A;  1CZ9 A;  2F96 A;  1VSD A;  3VQC A;  3LP1 A;  3KLG A;  2D0A A;  3S3O A;  4CIF A;  3ZSX A;  3KD1 E;  4CHZ A;  5CZ2 A;  4B3O A;  4N76 A;  3HXM A;  3OYG A;  1TAQ A;  4E7L A;  2OPQ A;  4C8N A;  1JLF A;  3OYB A;  2PYL A;  3SCX A;  4KTQ A;  4M3X A;  3KK2 A;  3SJJ A;  2G8U A;  4Z4E A;  4YNQ A;  1S1T A;  2HND A;  3KKS A;  1WN7 A;  3C95 A;  4KKO A;  3TAF A;  2QKB A;  3QIO A;  1NJY A;  1HYV A;  3OYK A;  1ZBL A;  3CFP A;  3S9H A;  4E7K A;  5HRP A;  3V9W A;  2X74 A;  1WLJ A;  1Q9Y A;  3OYM A;  3C6T A;  3M8R A;  3IS9 A;  4E19 A;  1VSI A;  3D45 A;  3PUF A;  5D3G A;  4DLE A;  2OYQ A;  4OPJ A;  3K5N A;  2B5J A;  2A1R A;  3NF7 A;  2IDO A;  2WOM A;  3RTV A;  4ELT A;  2HHQ A;  4CK3 A;  1JXB A;  3V9X A;  4TSX A;  3SUO A;  1HNI A;  4G1Q A;  4I2P A;  4J2D A;  1BCM A;  4NCB A;  4FW1 A;  1X9W A;  2XHB A;  3M8Q A;  1RDB A;  1X9M A;  1S6Q A;  4O44 A;  4CFB A;  1X9S A;  3OYN A;  4KAZ A;  4FJ9 A;  3VQP A;  2HHW A;  1C0U A;  3NBP A;  4CHP A;  1J53 A;  3L2R A;  1NK7 A;  4KHN A;  3UIQ A;  3I0R A;  3EZ5 A;  3QEX A;  4F4K A;  3CFO A;  3ZSY A;  3PO4 A;  2BAN A;  1VSF A;  3MXI A;  1T7P A;  1WSJ A;  1TVR A;  4ID5 A;  4AHS A;  4NYN A;  4DSK A;  2YV0 X;  4KHQ A;  3DRS A;  4B9M A;  3THV A;  1HYS A;  4CJP A;  3CG7 A;  3RMC A;  4CEQ A;  3LAL A;  5KRT A;  2YNG A;  1TL3 A;  3QNN A;  1JL1 A;  2VG6 A;  4CK1 A;  1SKR A;  4CGG A;  3NH0 A;  2YKN A;  2RN2 A;  3O3G A;  2DY4 A;  3OS0 A;  4JLH A;  1FXX A;  2P5G A;  2GBZ A;  4Q5V A;  3K5M A;  2HMI A;  4CHO A;  4M3U A;  4IFY A;  1VRT A;  4CF1 A;  4CJ5 A;  2OA8 A;  4NCA A;  4KHY A;  2F8T A;  1O1W A;  4I7F A;  1U4B A;  4KFB A;  4DU4 A;  1C1A A;  4CHN A;  2EHG A;  4M3Z A;  3DLB A;  3MXM A;  3VQ7 A;  3HJF A;  4IFV A;  3K58 A;  4OGE A;  3KLH A;  3KK1 A;  1BIZ A;  3SV4 A;  1MU2 A;  3MED A;  4DTM A;  4FJ5 A;  5FDL A;  1GOC A;  3AVN A;  2I5J A;  2XY8 A;  4BDZ A;  3DM2 A;  1WSF A;  4FJK A;  3L2V A;  3ZSZ A;  1RT7 A;  3PV8 A;  1ASV A;  3OYE A;  1WSH A;  3AO4 A;  1TKD A;  1U04 A;  4O0I A;  2D0C A;  4CER A;  4HUG A;  4F2S A;  3V1O A;  3HP9 A;  3U6F A;  2G8F A;  4FLV A;  1SL1 A;  4FJL A;  5HP1 A;  3TAG A;  4DS4 A;  4OGC A;  2IOC A;  3SV3 A;  1LW0 A;  4DTP A;  1DTQ A;  3QEV A;  1XI1 A;  1IO2 A;  4F8R A;  4F2R A;  3QLH A;  3LAK A;  5KRS A;  4HTU A;  3AVC A;  4O5B A;  4B9U A;  1SV5 A;  4CEC A;  2PY5 A;  1KLM A;  4WE1 A;  4IBN A;  4LH5 A;  1GOB A;  4M3R A;  3HT3 A;  4BWM A;  1BQM A;  1RBT A;  3EY1 A;  4FJM A;  3U3G A;  2RF2 A;  4BDP A;  1L3T A;  1ZBU A;  2ZE2 A;  3HP6 A;  2OZM A;  3T19 A;  1EP4 A;  1EXQ A;  1XHZ A;  4FLZ A;  2YNF A;  3OYD A;  3LDS A;  4MQ3 A;  4DFK A;  3G0Z A;  1KVB A;  3OVN A;  3SPZ A;  5DMR A;  2HHV A;  1HQE A;  3DLK A;  3IG1 A;  1TKX A;  1LV5 A;  3TR8 A;  1KLN A;  1VSE A;  2XY7 A;  1QTM A;  2YNI A;  3AVA A;  4CFC A;  1ITG A;  4LSN A;  3O3F A;  3PX4 A;  3DOL A;  4DFJ A;  2NUB A;  4LH4 A;  5KI6 A;  4CJS A;  3F73 A;  4CES A;  3ISN C;  2IS3 A;  4FVM A;  3LPU A;  2VWJ A;  2XY6 A;  2GUI A;  2Y1J A;  1WSG A;  4FW2 A;  4JRP A;  3AA5 X;  3NF9 A;  3LP3 A;  3OYC A;  4B9N A;  3LWL A;  1TAU A;  3NGZ A;  3IAY A;  4FK0 A;  2HW3 A;  3SYZ A;  3KKR A;  4E3S A;  1NK0 A;  4LSL A;  2DFH A;  4FZY A;  5JS1 A;  4ELU A;  4HCC A;  2RKI A;  1K6Y A;  1T8E A;  4DTO A;  4HVJ A;  4CHQ A;  1JKH A;  3VQ9 A;  1RTJ A;  3QO9 A;  1YT3 A;  2HB5 A;  3MAQ A;  4FM1 A;  3HST B;  4B9T A;  4ELV A;  4M3W A;  1Z25 A;  3MXJ A;  4AHV A;  1UWB A;  1VSM A;  1KFS A;  2QKK A;  4KHW A;  1NK6 A;  1I39 A;  1S1X A;  1SKS A;  1KFD A;  5HRN A;  5J2P A;  1TK8 A;  1LAV A;  1XWL A;  4E1M A;  3U3Y A;  3SUN A;  1KSP A;  2HHU A;  3SZ2 A;  4B9V A;  2RPI A;  3RRG A;  2OPS A;  3TAN A;  1BGX T;  1IH7 A;  3I8D A;  3VA0 A;  3P83 D;  3C94 A;  1VSH A;  4RW6 A;  3DLH A;  3HYF A;  4KPY A;  1JXE A;  4L8R B;  4FJH A;  4C8M A;  5J2Q A;  2Y1I A;  1BI4 A;  4BDY A;  4CIE A;  4Q0B A;  2XO7 A;  5SZT A;  4E89 A;  2R7Y A;  4DTN A;  2YKM A;  4Y1C A;  4ID1 A;  3QET A;  1ASW A;  1BCO A;  1KTQ A;  1KVC A;  3AVH A;  3NAE A;  1N5Y A;  1TK5 A;  1KVA A;  2G8W A;  4DSJ A;  2OPP A;  1C0M A;  1D5A A;  2GV9 A;  4DTX A;  1D8Y A;  4KRE A;  3SI6 A;  4OLA A;  1BIU A;  2IAJ A;  3AVB A;  1CXQ A;  4CEE A;  4JS4 A;  1T05 A;  1S6P A;  3K59 A;  4M41 A;  3V1R A;  2G8I A;  3TWH A;  2AJQ A;  2P51 A;  4H4M A;  3NCI A;  1VRU A;  4DU3 A;  4DMN A;  4FLY A;  4M42 A;  4FJJ A;  3KIO A;  1RBU A;  3A2F A;  1WSE A;  2IC3 A;  3WNE A;  4CEZ A;  2OZS A;  1RDA A;  1NJX A;  1Y97 A;  2HHX A;  3K57 A;  3ZSR A;  3ZSW A;  1XC9 A;  2YNH A;  3AO2 A;  1L3V A;  1N6Q A;  1WNS A;  1TKT A;  2Z1G A;  4B8A B;  3PX0 A;  2FBV A;  5E41 A;  4W5T A;  4AHR A;  3TAE A;  1NK9 A;  4M3T A;  4E7J A;  5HLF A;  3RMA A;  2PZS A;  1IKY A;  3O4Q A;  5T7B A;  4NCG A;  2P5O A;  3D0P A;  3CFR A;  2D5R A;  4FZZ A;  3AVF A;  1NKE A;  3ZT0 A;  4CEB A;  1L3U A;  3L2Q A;  4Y1D A;  4J2E A;  4OVL A;  1HJR A;  1ASU A;  3ASM A;  3VQQ A;  1SUQ A;  3NH2 A;  1C1B A;  1WSI A;  2FBT A;  2YHA A;  2WON A;  2DFE A;  4R5P A;  3TAB A;  2F8S A;  3LAN A;  5SWM A;  3ULD A;  1TL1 A;  4CHY A;  4JS5 A;  2PYJ A;  2LSN A;  4BWJ A;  4CJT A;  2ETJ A;  4OPK A;  1UA1 A;  3VQ8 A;  4FK4 A;  4LD0 A;  3JYT A;  3I0S A;  2VWK A;  4HCB A;  4CE9 A;  4DSI A;  2FBX A;  3LP2 A;  4K8Z A;  5HRS A;  3NE6 A;  4FCY A;  3WNF A;  1LW2 A;  1RTD A;  3OYA A;  4K8X A;  1DLO A;  3OYF A;  4W5N A;  1B9D A;  4CGI A;  5HBM A;  2KZM A;  1RDC A;  2FC0 A;  3VQD A;  3L8B A;  4EP5 A;  3VQB A;  1NJW A;  4CF8 A;  4Z4F A;  4J2A A;  4B8C A;  2QK9 A;  1HMV A;  1UOC A;  2E6L A;  1NOY A;  3HPG A;  3VQ6 A;  4FLX A;  1DTT A;  3EYZ A;  5K14 A;  3NF6 A;  3P5J A;  3O3H A;  4RW4 A;  4N56 A;  4CEA A;  2Q3S A;  4CF2 A;  1W0H A;  2JLE A;  3AO1 A;  4CGD A;  3HL8 A;  3OJU A;  3OJS A;  3K5L A;  3NGI A;  1RTH A;  4CJE A;  4AH9 A;  4F3T A;  3NF8 A;  3C6U A;  3LZI A;  1XHX A;  2VG7 A;  3RRH A;  2IGI A;  5KGW A;  3HK2 A;  3CYM A;  4BE0 A; 
#chains in the Genus database with same CATH topology
 3AY9 A;  3L4Q A;  3VGK A;  3ID8 A;  1JLQ A;  3QEW A;  1TV6 A;  1VK0 A;  2VQE K;  3O08 A;  3ZT1 A;  4B9S A;  4DF4 A;  4QAG A;  1VSL A;  1SL2 A;  2CGL A;  1KAX A;  3CF5 L;  2ITM A;  3RMB A;  1HJO A;  1RBR A;  2W42 A;  3T1H K;  4GKJ K;  3G25 A;  1TUY A;  3HM8 A;  4JHD B;  3WNH A;  1G15 A;  3SQ0 A;  3DOK A;  2E2N A;  3DLG A;  3IRX A;  4M7X A;  3J7Y P;  4V19 S;  4CJK A;  3CJC A;  4WFA L;  3OYJ A;  1YTU A;  4DHY A;  5AQJ A;  4DV4 K;  3QES A;  3L3U A;  3CQ8 A;  1QVG M;  5I3U A;  3L0Q A;  5CYM A;  4BR2 A;  4RCH A;  4DFM A;  3CJB A;  4F3O A;  5KPR A;  3CCM N;  5JS2 A;  4DV7 K;  1NGE A;  3CJA A;  3ZT2 A;  4IKF A;  4FK2 A;  3LZJ A;  4CGH A;  3H3N O;  5EU7 A;  4PKI A;  3AVL A;  3TAQ A;  5LL6 Z;  4HTL A;  4OPA A;  3HVR A;  2AA4 A;  5AQN A;  3KWG A;  1X9J A;  4AHU A;  1JLG A;  4FWO A;  1KRP A;  2ASO A;  1HR0 K;  4CZK A;  3OS2 A;  4Z4G A;  4BRH A;  1RTI A;  2P1J A;  1NJZ A;  4BRK A;  3P4I A;  4DCH A;  2IVO A;  1CXU A;  1RBS A;  1CZB A;  3KK3 A;  4CJ4 A;  1QS4 A;  4IOC L;  2P9N A;  1XMQ K;  2O8B B;  5BN8 A;  3VQ5 A;  3E9L A;  3AA3 A;  2BGG A;  1ZBH A;  3C7N B;  3QBW A;  3VQE A;  2W6K A;  4LF7 K;  1IBM K;  1RT2 A;  3P1G A;  3C6A A;  2WC9 A;  3UKU B;  2UUB K;  1E3M A;  4AM6 A;  2IIR A;  1BA0 A;  3T1Y K;  3SQ2 A;  4QOZ B;  4GMJ B;  1ZBF A;  4CF0 A;  3NH1 A;  5AQF A;  5FRO A;  1IBL K;  4W5R A;  4PA1 A;  4BRD A;  2QEX N;  4PKG A;  1BA1 A;  4CJ7 A;  2QI2 A;  4BE1 A;  3AAP A;  1SZ2 A;  4PL7 A;  1VQO N;  3RMD A;  4FJ7 A;  1XUP O;  3AVG A;  4BRA A;  1K8A O;  2BDP A;  3EN9 A;  2ZD1 A;  2V7Y A;  3QDK A;  2OPR A;  3D2E A;  4CFD A;  4E7H A;  4CW7 B;  3SAH A;  3LAM A;  3SQ4 A;  1VQM N;  1BO5 O;  3AAR A;  4EP4 A;  3D2F B;  5C42 A;  4YFU A;  3CM5 A;  3KHY A;  3M1F A;  3M3Z A;  3KJV A;  4ICL A;  3PO4 A;  4E7I A;  4KI6 A;  4DKW A;  2G8V A;  2QXF A;  3SQ1 A;  3TSU A;  3G10 A;  2HST A;  3E9P A;  3WXM B;  4O4G A;  2JWK A;  2KZZ A;  1WAJ A;  2HBJ A;  4FJ8 A;  3AVM A;  1RIL A;  2VGN A;  1HNV A;  4U67 L;  4RWT A;  1RFQ A;  1QSY A;  3SK3 A;  3VER A;  5BRE A;  3CHW A;  4FYD A;  3VQA A;  3PLA A;  5I42 A;  1NGH A;  3QEI A;  1JLA A;  4C8K A;  1Z26 A;  4J2B A;  4CK2 A;  1HYZ A;  3L3V A;  3AGK A;  2QWL A;  1D9D A;  3PO5 A;  3GG4 A;  4CCH A;  3ZT4 A;  3K9K A;  1W2B M;  1CLQ A;  4E0D A;  4CZM A;  2QWR A;  3RR7 A;  5C15 A;  1QSL A;  2F96 A;  5EXW A;  2D0A A;  3ZSX A;  5CZ2 A;  1Q81 O;  4N76 A;  1S22 A;  4FO0 A;  3WT0 A;  4C8N A;  1JLF A;  3OHR A;  4NXM K;  4KTQ A;  4M3X A;  4GV6 A;  2HND A;  3KKS A;  4IO8 A;  1WBB A;  2NNW A;  4MDA A;  1NJY A;  2P9K A;  4BRM A;  1GLE G;  1Q9Y A;  5DM7 L;  4DLE A;  3HSC A;  2OYQ A;  5D3G A;  1TYQ A;  2B5J A;  4PHT X;  1MWM A;  5HOO A;  3NF7 A;  2A1R A;  3FZM A;  3RTV A;  4XH5 A;  3V9X A;  4TSX A;  3ZYY X;  4JI8 K;  4FW1 A;  4CVN E;  3M8Q A;  1U2V A;  4A2A A;  2F7T A;  4CFB A;  3OTO K;  5M1N A;  3EE9 A;  3AAQ A;  5EVZ A;  3SMS A;  1NNE A;  2BAN A;  1T7P A;  4ID5 A;  4EAH D;  4A61 A;  3QIC A;  4B9M A;  3RMC A;  3LAL A;  5KRT A;  3GDQ A;  1YXQ A;  1TL3 A;  4CK1 A;  2YKN A;  3O3G A;  5KPT A;  3HOT A;  2GBZ A;  2HMI A;  2V7Z A;  4WYB A;  3O8M A;  4IFY A;  4CJ5 A;  4KHY A;  2F8T A;  1C1A A;  4CHN A;  3HJF A;  1NGB A;  4WFN L;  5EX5 A;  1GOC A;  2QWM A;  4WQ4 A;  2I5J A;  3DM2 A;  1KQS M;  3THW A;  3PV8 A;  1ASV A;  4AM7 A;  4GVE A;  2D0C A;  3BEX A;  4F2S A;  3V1O A;  3U6F A;  2G8F A;  2QM1 A;  3CPW M;  1SL1 A;  5HP1 A;  3TAG A;  3SV3 A;  1LW0 A;  1YIT N;  1XI1 A;  1VAZ A;  4F2R A;  3BZK A;  1X3N A;  3OW2 M;  1QHA A;  4B9U A;  2PY5 A;  4WE1 A;  4FPB A;  3CCQ N;  4FWL A;  1GOB A;  4LH5 A;  5FPE A;  3U3G A;  2FSK A;  2RF2 A;  4BDP A;  1L3T A;  1P8Z A;  4BRE A;  4B1Y B;  5DMR A;  1TKX A;  4DQ8 A;  1ATS A;  1NLV A;  4JI5 K;  3PX4 A;  3DOL A;  2NUB A;  4LH4 A;  4CJS A;  1SQK A;  5C2F A;  3ISN C;  2IS3 A;  3K0S A;  3LPU A;  2GUI A;  3ZEU B;  2E5L K;  3U4L A;  3OYC A;  3LWL A;  3CC4 N;  4FK0 A;  4JI1 K;  3SYZ A;  4E3S A;  4BG9 A;  2DFH A;  4FZY A;  5JS1 A;  1BWF O;  4ELU A;  4HCC A;  2RKI A;  4H0O A;  3BY5 A;  4IJN A;  3VQ9 A;  4FM1 A;  3GOI A;  1Z25 A;  4AHV A;  1KFS A;  4KHW A;  3CQY A;  4U7B A;  5HRN A;  1LAV A;  3W0L A;  4E1M A;  4EHU A;  1KSP A;  4B9V A;  2RPI A;  3FGU A;  2UXB K;  1BGX T;  1Z05 A;  3P83 D;  4YOX A;  1JXE A;  3IKM A;  3PIO L;  1GLB G;  5J2Q A;  4FJH A;  5SZT A;  4E89 A;  3J7Z O;  1OVY A;  4ID1 A;  4OPH A;  1KTQ A;  5C0Y A;  5AZI A;  4DSJ A;  3SI6 A;  4OLA A;  4CEE A;  3N4Q A;  3TTD A;  4DUZ K;  3VOV A;  3NCI A;  5AQP A;  5M1P A;  4DU3 A;  3ZLJ A;  4FLY A;  4FJJ A;  2OZS A;  2H3G X;  1WSE A;  1M90 O;  1Y97 A;  4DR2 K;  1RGI A;  5JVG L;  1TKT A;  4BC5 A;  4B8A B;  2QW9 A;  3DXM A;  4BRF A;  4BRL A;  4E7J A;  2NRX A;  1K73 O;  5ADX A;  5BRF A;  2P5O A;  4RTF D;  4BC3 A;  3J81 O;  3ZT0 A;  4CEB A;  2V52 B;  3PSI A;  1QQN A;  5I9E B;  1HJR A;  3VQQ A;  1SUQ A;  1MDU B;  1C1B A;  4R5P A;  3TAB A;  1NG9 A;  1C0F A;  3LAN A;  5SWM A;  3U8X A;  2PYJ A;  1EWQ A;  1N8R O;  3I56 N;  4OPK A;  1UA1 A;  4B1U B;  1XC3 A;  5AQS A;  4DSI A;  3THY A;  3CD6 N;  5HRS A;  3NE6 A;  4FCY A;  4LFA K;  1BUP A;  3OYA A;  5GIO A;  4JI0 K;  2E8A A;  2FC0 A;  4EP5 A;  5LJV A;  2QWQ A;  4YHH K;  4Z4F A;  4J2A A;  2VCP A;  2P9N B;  1UOC A;  1GLC G;  1HMV A;  3U9D A;  3HPG A;  2O8B A;  3VQ6 A;  3R8E A;  4JKF A;  4RW4 A;  1W0H A;  3C7N A;  3NGI A;  4LF9 K;  4AH9 A;  3C6U A;  4FWR A;  5KGW A;  3O6W A;  2Q31 A;  4EFH A;  2ZJP L;  5TKY A;  3HTV A;  4BE0 A;  3ITH A;  4GVM A;  3K5O A;  4BRI A;  2ZGY A;  4KHP K;  2D0B A;  1VQ8 N;  1REV A;  2E2O A;  4CJR A;  2QWO A;  2E4L A;  1NBW A;  5AQL A;  1QE1 A;  1BL3 A;  1XNR K;  3M8P A;  5J1E A;  2JGU A;  2FSJ A;  5HRR A;  4Z4H A;  3LDL A;  3P39 A;  2W41 A;  4PUO A;  1GOA A;  5AQG A;  4WQ5 A;  1ZYQ A;  1T44 A;  4ISG A;  3HO1 A;  4K0K K;  1ZBS A;  4AHC A;  5CZ1 A;  2DPN A;  3QER A;  4GW6 A;  3RR8 A;  3CM6 A;  2JWL A;  1J54 A;  4CD1 A;  3ZSO A;  1JLC A;  3TAM A;  3WEE A;  2UUC K;  1NK5 A;  4BAC A;  5GIN A;  5FLX O;  1QZ6 A;  1JL2 A;  3QFP A;  2P9P B;  5GAH P;  3E01 A;  1RT4 A;  1TK0 A;  3B8A X;  4OLB A;  3HPH A;  4WQ4 C;  4JI3 K;  2DTU A;  2BE2 A;  3WUH A;  4BRN A;  4EHT A;  1HPZ A;  2KQ2 A;  4K43 A;  3QB0 A;  4JKH A;  1YVU A;  3WXJ A;  4QCL A;  4A5B A;  4CJU A;  1DGK N;  4DTJ A;  4B1X B;  3EEQ A;  4LF8 K;  3DRP A;  4OKK A;  2P9L B;  1BU6 O;  2RE2 A;  4HUE A;  3BF1 A;  4B3M K;  4DSF A;  4BQL A;  2ZM6 K;  2P9I A;  1HRH A;  1C1C A;  3VN5 A;  1NMD A;  1NGI A;  1L5U A;  3DLE A;  4IG0 A;  3QEP A;  1U47 A;  3NGY A;  2ZQB A;  5LY3 A;  3T1A A;  1ZXO A;  3MMV A;  3KD5 E;  5AQH A;  4RW8 A;  1EET A;  4Z0U A;  3K2P A;  1T3V A;  4DV0 K;  1KC8 O;  1UAX A;  4JKE A;  4N5S A;  3BGR A;  2B6A A;  5BPL A;  4BC2 A;  4H0Y B;  3S3M A;  4MFB A;  4Z4C A;  4JK7 A;  4NLC A;  3BZC A;  4FL9 A;  4AIL C;  2ZGZ A;  1JJ2 M;  2O4G A;  4DSE A;  1LWC A;  1IJJ A;  1ZBI A;  3KLF A;  1WAF A;  4DLG A;  3ZSQ A;  3PY8 A;  3VGM A;  4KTW A;  4KRF A;  4AHT A;  4CJQ A;  3V9U A;  1W9H A;  4NO7 A;  4QS8 A;  1VSJ A;  1QQO A;  1IG9 A;  1X1P A;  2X6S A;  3VTH A;  1HKC A;  3MN6 A;  4Z4I A;  5FRN A;  2YX6 A;  2X6N A;  4FLU A;  1HKG A;  3ZSV A;  3OY9 A;  4B3S K;  4I9L A;  1F21 A;  3QIN A;  2ZJQ L;  3THW B;  4CIG A;  4FLT A;  1J9A A;  4IDH A;  1RDD A;  4JRQ A;  1RT6 A;  2E6M A;  5F1X A;  1N34 K;  1VSK A;  4JK8 A;  3MWT A;  1BIS A;  3AO5 A;  1A5W A;  5H1S Q;  1G99 A;  3M6G A;  4BG8 A;  1YVN A;  4DS5 A;  3O9R A;  1RT1 A;  1S5J A;  1CZ9 A;  1VSD A;  2W40 A;  3LP1 A;  5DM6 L;  3S3O A;  1GLD G;  1T6D A;  4CHZ A;  3HXM A;  3OYG A;  1TAQ A;  1ATR A;  3C0B A;  3MDQ A;  4E7L A;  2OPQ A;  3TSP A;  3JXU A;  4BQZ A;  3OYB A;  2PYL A;  3SCX A;  3NVK A;  3SJJ A;  4Z4E A;  4YNQ A;  2QKB A;  4CZF A;  1MA9 B;  5HRP A;  3V9W A;  2X74 A;  4E7K A;  4DV1 K;  3M8R A;  3IS9 A;  2ASM A;  3QBX A;  1JXB A;  5IWA K;  4KH6 A;  3CCS N;  4G1Q A;  4I2P A;  3SUO A;  4J2D A;  2CH5 A;  4JN4 A;  1RDB A;  3F2K A;  1S6Q A;  3DLL L;  3ZX2 A;  1X9S A;  3FZH A;  3OYN A;  1ILY A;  4JI6 K;  1C0U A;  4CHP A;  1VQP N;  1Q82 O;  4KHN A;  3DXK A;  2YHX A;  2J4R A;  2BUP A;  1WSJ A;  3O9Q A;  1TVR A;  2YJF A;  3WQT A;  2A3Z A;  2D1K A;  4NYN A;  4DSK A;  3DRS A;  1HYS A;  3THV A;  3CG7 A;  3S41 A;  4CEQ A;  2YNG A;  3QNN A;  4QS9 A;  4BR9 A;  3EKU A;  4CGG A;  5KQD A;  2RN2 A;  5A2Q O;  4Q5V A;  4M3U A;  4BVO A;  1VRT A;  3SMP A;  3PSF A;  1O1W A;  3M5R A;  1XNQ K;  4DU4 A;  5AQR A;  2EHG A;  4M3Z A;  3LDQ A;  3K58 A;  2HOE A;  2NRV A;  2Q0R A;  1WSF A;  5FPN A;  4FJK A;  3L2V A;  3ZSZ A;  1MWK A;  1U04 A;  2PAV A;  5AQO A;  4CER A;  5LMU K;  2Q1N A;  3P31 A;  4PKH A;  3SAF A;  3THX B;  2IOC A;  3QEV A;  2QWN A;  3CJ7 A;  4R79 A;  1X3M A;  2NRW A;  4DTP A;  4F8R A;  4HTU A;  3A8Y A;  4O5B A;  1DEJ A;  3BUZ B;  2F9T A;  3MCP A;  3JAM O;  1BQM A;  1XQS C;  1SS6 A;  4JEP A;  3HP6 A;  3IUC A;  4MO5 A;  1XHZ A;  2GEM A;  2O8C B;  4DFK A;  3LDS A;  3OVN A;  3D7E O;  1K8K A;  3EE8 A;  1VQ7 N;  1EWR A;  1KLN A;  1VSE A;  2XY7 A;  1QTM A;  2YNI A;  3AVA A;  5M1O A;  1OKJ A;  1ITG A;  1WOQ A;  4JKG B;  3O3F A;  4DFJ A;  4CZJ A;  2ASP A;  4CES A;  3R6M A;  4FVM A;  2VWJ A;  2NRT A;  1WSG A;  4JI7 K;  4JRP A;  3NF9 A;  3O5B A;  3IAY A;  2UUA K;  1K9M O;  3MN9 A;  3LDO A;  1VQ6 N;  4DR6 K;  2I7P A;  1Q86 O;  1JKH A;  3QO9 A;  1YT3 A;  4BGB A;  3HST B;  4ELV A;  2KHO A;  5TKW A;  1VQN N;  1UWB A;  3ZX0 A;  1I39 A;  1S1X A;  1KFD A;  3U3Y A;  2HHU A;  3RSE A;  2GWJ A;  1Y64 A;  2OPS A;  1IH7 A;  3O9S A;  3I8D A;  4KPY A;  3C94 A;  4L8R B;  4FPA A;  3MX5 A;  2E1Z A;  5KQ8 A;  4Y1C A;  1BCO A;  4OO1 J;  2HBK A;  1P90 A;  3LL3 A;  1TK5 A;  1HNX K;  1D5A A;  1D8Y A;  4KRE A;  1BIU A;  3CCE N;  2IAJ A;  4JS4 A;  4LF6 K;  4DV6 K;  1T05 A;  3TWH A;  2P51 A;  5AQY A;  4DMN A;  3KWI A;  2IC3 A;  1RDA A;  4ISE A;  1XC9 A;  3AO2 A;  1L3V A;  5E41 A;  1HX1 A;  3I33 A;  4YOT A;  4AHR A;  4W5T A;  3I55 N;  3RMA A;  4BRG A;  3D0P A;  3MN5 A;  3AVF A;  2UU9 K;  4A62 A;  3L2Q A;  3VF2 A;  4Y1D A;  2RHK A;  3RVC A;  4J2E A;  1ASU A;  3ASM A;  1HLU A;  3NH2 A;  2WON A;  2DFE A;  5M1F A;  1OVQ A;  2P9P A;  3ULD A;  1TL1 A;  3FFK B;  4CHY A;  3CI5 A;  5AQT A;  4IWV A;  4FK4 A;  1U6Z A;  3JYT A;  2O8D B;  3I0S A;  2VWK A;  4B1Z A;  2FBX A;  4O8U A;  1KAY A;  3WNF A;  4CZH A;  4W5N A;  3VQD A;  3L8B A;  3VQB A;  2E88 A;  4FLX A;  1DTT A;  1NGG A;  3NF6 A;  3O3H A;  4BY9 C;  5BPM A;  2JLE A;  3D2E B;  3AO1 A;  3OJU A;  3E9O A;  4CJE A;  1FJG K;  4H5R A;  4GV3 A;  1XHX A;  2P9I B;  4BR5 A;  4YOU A;  3RRH A;  2IGI A;  3CQX A;  3D2F A;  3HK2 A;  3CYM A;  3ZCM A;  3WNG A;  4A5A A;  1BQN A;  1YTA A;  1UA0 A;  2E20 A;  3VQ4 A;  3UKR B;  3JSM A;  5JIC A;  3LPT A;  1LWE A;  4M3Y A;  1S3X A;  4WFB L;  5JVH L;  3KTQ A;  4HUF A;  3J80 O;  5ELZ A;  3T3F A;  1C6V A;  4JK9 A;  4DWI A;  3B6P A;  4ILJ A;  4IOX A;  4IXC A;  3TU5 A;  2B4J A;  1S9E A;  1HKB A;  3PIP L;  4WCE L;  1U48 A;  5F2R A;  1A5X A;  2Z1H A;  3VEW A;  2NRZ A;  3ZT3 A;  3T7Z A;  1DT9 A;  3SJH A;  3AA4 A;  3VEX A;  5LJW A;  2P9S A;  2I7N A;  3O9U A;  1S1U A;  3H6E A;  3KLE A;  4CJV A;  3CCU N;  1D9F A;  3OBY A;  3V9S A;  4C8L A;  2G8K A;  3HOS A;  3BDP A;  4IEI A;  3AVJ A;  3T69 A;  4FWS A;  4MLH A;  2Z1I A;  1BI4 B;  3UB5 A;  3NDK A;  1YIJ N;  4A59 A;  1B9F A;  3BF3 A;  4LFC K;  5CHI A;  2P9K B;  3AVK A;  4ZTF A;  2HF4 A;  1NU0 A;  3HM9 A;  2XY5 A;  3DI6 A;  3F9K A;  4KTZ A;  5IT9 O;  1JLB A;  3TTF A;  4OKJ A;  1FKP A;  1EO1 A;  3AA2 A;  4CGJ A;  1NWK A;  3ATU A;  4W5Q A;  3MK6 A;  4H0X B;  4CF9 A;  5HL7 L;  2HHT A;  4DB3 A;  1U45 A;  4X64 K;  3MEE A;  3ENO A;  3AO3 A;  1U2V B;  3O4N A;  4GV9 A;  4CED A;  4DQQ A;  2O8E A;  2Z1J A;  3K9J A;  2A41 A;  3OYI A;  3M8S A;  3IFR A;  4RW9 A;  3LM9 A;  5AFU A;  4CJF A;  2NLX A;  3VES A;  4CD3 A;  3MN7 A;  3I8B A;  4DFP A;  3SPY A;  4FJG A;  1BHL A;  3WXL A;  4FZX C;  2DFF A;  3WXI A;  1GLF O;  1IG8 A;  4LF5 K;  3CXC M;  4EZ6 A;  3ALY A;  1NGC A;  4X65 K;  5CR4 A;  4FJX A;  3FFI A;  4DQI A;  1Q9X A;  1NKC A;  1J6Z A;  3E66 A;  1H1V A;  5KPZ A;  1QQC A;  4IEE A;  4KH4 A;  2KTQ A;  4CGF A;  3RWU A;  3DRR A;  4FM2 A;  3VPZ A;  4E1N A;  4G9Z A;  4C1N I;  3ULE B;  1RT5 A;  4DR4 K;  4B9L A;  4KB0 A;  1NMN A;  4ZHR A;  5B8H A;  3G71 N;  1T6C A;  2KFZ A;  1T03 A;  4DU1 A;  3DLR A;  1J5O A;  1FK9 A;  1NOZ A;  3C6H A;  4MLE A;  2A6A A;  2E1Y A;  3LWM A;  3CIP A;  1S9G A;  5GAD P;  4BR0 A;  2P9U B;  2GX9 A;  5GIP A;  2VYP A;  1B92 A;  5AQZ A;  4H5T A;  5C25 A;  1TKZ A;  4JI4 K;  4E1J A;  3QNO A;  1SL0 A;  2F4V K;  1YHQ N;  1S1V A;  4DQP A;  4KH5 A;  5J2N A;  1NKB A;  3IDH A;  1V4S A;  4IG3 A;  1LOT B;  4PQU A;  1IKV A;  1VQK N;  3DYA A;  4JHD A;  1HQU A;  3DAW A;  3VMF B;  1RNH A;  4GY2 B;  3ZEU A;  3OYL A;  3THX A;  3TAP A;  4PY5 A;  2XRI A;  4H5V A;  3HPO A;  4JYA K;  3V1Q A;  4BR7 A;  3VQC A;  3H3O B;  5AQV A;  4CIF A;  3KD1 E;  2ZWH A;  4B3O A;  3EL2 A;  4J8F A;  1W97 L;  3ATV A;  4NXN K;  3KK2 A;  2EWS A;  1GLA G;  4KBO A;  3VTI A;  2YHY A;  1WBD A;  3QIO A;  1K8K B;  1HUX A;  3OYK A;  1ZBL A;  4LF4 K;  3S9H A;  3FE1 A;  1WLJ A;  1RDU A;  3PUF A;  4JKG A;  4BRQ A;  2UYT A;  2PFU A;  4ELT A;  2IDO A;  4CK3 A;  3FLC O;  1HNI A;  5BR8 K;  3CCJ N;  1X9W A;  2XHB A;  1OH7 A;  4FJ9 A;  2HHW A;  3NBP A;  2O4I A;  1J53 A;  3I0R A;  4F4K A;  3ZSY A;  1IV0 A;  4FWM A;  4HWI A;  4BRO A;  3UKU A;  2D4W A;  4AHS A;  5E26 A;  3G6E N;  3R1X A;  3DJC A;  3DXM B;  2OAN A;  4X62 K;  1JL1 A;  1SKR A;  4UY8 O;  3NH0 A;  2VGM A;  2DY4 A;  1R59 O;  3OS0 A;  4XH1 A;  1FXX A;  4DUY K;  3CCL N;  1S72 N;  4JI2 K;  3K5M A;  4CHO A;  4CF1 A;  2OA8 A;  4NCA A;  3HZ6 A;  4I7F A;  4KFB A;  5M1K A;  3CMA N;  3MXM A;  3VQ7 A;  3A5L C;  4IFV A;  3A5M C;  3HRG A;  4JKC A;  1MU2 A;  3SV4 A;  4DTM A;  4FJ5 A;  5FDL A;  2XY8 A;  2OCE A;  3AVN A;  3CME N;  5AQX A;  1RT7 A;  3OYE A;  1WSH A;  3QML A;  4YDU C;  3THY B;  4C1N K;  5C12 A;  3HP9 A;  4FLV A;  1HNW K;  5BR9 A;  2HBM A;  4DS4 A;  3LM2 A;  3CC7 N;  1DTQ A;  3QLH A;  3LAK A;  4ISF A;  4DR3 K;  3AVC A;  1N32 K;  1YJN N;  1SV5 A;  4IZ9 A;  4CEC A;  4YOV A;  4JD2 B;  4IJA A;  2WBN A;  3O4W A;  4M3R A;  4IBN A;  4Z94 A;  4BWM A;  3EY1 A;  4DR5 K;  1OH5 A;  1NGF A;  3VF6 A;  3T19 A;  1EP4 A;  4GNI A;  4FLZ A;  2YNF A;  2E2P A;  1KVB A;  2HHV A;  4MO4 A;  3J7A P;  3IG1 A;  3MCA B;  3TR8 A;  4IOA L;  4WF9 L;  5KI6 A;  3F73 A;  4L3Q A;  2XY6 A;  3LP3 A;  3NGZ A;  2BTF A;  3GL1 A;  2HW3 A;  3KKR A;  1NK0 A;  2Q0U A;  4A2B A;  1BG3 A;  1K6Y A;  3SLC A;  4H0P A;  4HVJ A;  4CZE A;  5F0X A;  3MAQ A;  2HB5 A;  4B9T A;  3KK7 A;  1VSM A;  4ILG B;  4YY3 K;  2YHW A;  1NM1 A;  1SKS A;  1YJW N;  5J2P A;  2VQF K;  1TK8 A;  1JCF A;  4BRC A;  1HNZ K;  5EOY A;  2UXC K;  1O13 A;  3O1W A;  5AJ3 K;  4B1V A;  3UKR A;  3HYF A;  4C8M A;  4BDY A;  2ZF5 O;  4DTN A;  5MLC Q;  3CJ9 A;  3KZB A;  3AVH A;  2OPP A;  1C0M A;  2FF3 B;  4O5F A;  4DTX A;  1CXQ A;  5GAE P;  4B1W B;  1D4X A;  1S6P A;  4NB4 A;  5AR0 A;  3K59 A;  2G8I A;  2AJQ A;  5BRH A;  4H4M A;  5AFU H;  4M42 A;  3KIO A;  1Q7Y O;  1RBU A;  3WXK A;  4CEZ A;  1E4F T;  4BGA A;  1WNS A;  2GEL A;  2P9S B;  3PX0 A;  5FPD A;  4FVU A;  3TAE A;  1NK9 A;  1QZ5 A;  5HLF A;  2PZS A;  1IKY A;  2CGJ A;  3O4Q A;  4JKA A;  2QA4 N;  2D5R A;  4YOY A;  1NKE A;  4PL8 A;  3Q7B A;  2FBT A;  1YJ9 N;  3HBT A;  2F8S A;  2GUP A;  2LSN A;  4BWJ A;  2O8F B;  1WB9 A;  4CJT A;  3HI0 A;  4X66 K;  3NVM A;  2WUS A;  4HCB A;  3LDN A;  3FZF A;  1RTD A;  1DLO A;  1M1K O;  1VQ5 N;  1VQ4 N;  1B9D A;  1RDC A;  3LDP A;  4CF8 A;  1NJW A;  1NOY A;  2E6L A;  1DKG D;  2QWP A;  3EYZ A;  5K14 A;  3P5J A;  2Q3S A;  4CF2 A;  4CGD A;  3HL8 A;  3OJS A;  1RTH A;  3CER A;  3NF8 A;  4F3T A;  3LZI A;  2D0P A;  4DV5 K;  3TSQ A;  1E4G T;  4C23 A;  1YAG A;  1N33 K;  5BRD A;  5CY4 A;  1W7A A;  3EZW A;  2CGK A;  2GWK A;  4W5O A;  4XEI A;  5AQQ A;  1U49 A;  3NHG A;  2V51 B;  3CCR N;  4IO9 L;  5C24 A;  3V6D A;  4BE2 A;  2HVI A;  2F9W A;  4DQS A;  2IVP A;  2QTD A;  5AZJ A;  4CZL A;  1OH6 A;  2HHS A;  4PWD A;  3OBW A;  3SBG A;  2CH6 A;  1SKW A;  2WFB A;  4DTS A;  1EX4 A;  4M45 A;  4BVP A;  4IDK A;  3FZK A;  4O0J A;  3UE5 A;  4FJI A;  4DG1 A;  3H1V X;  3BP8 A;  5AQW A;  4KI4 A;  3L2W A;  1IKW A;  3ENB A;  2FXU A;  3S3N A;  1S1W A;  2G8H A;  4KB1 A;  3AVI A;  3SNN A;  1C0G A;  1KCF A;  1V4T A;  1I3A A;  5AQI A;  4DQR A;  2OTL N;  4K41 A;  4JAX A;  4HHT A;  3H45 C;  1LAW A;  3L2U A;  2A5X A;  2P9U A;  3N4P A;  4H0V B;  3CC2 N;  1N36 K;  3NFA A;  1LCU A;  2HNZ A;  5AZI B;  3LP0 A;  2A1S A;  5CE3 A;  4FLW A;  2YHB A;  3MEG A;  1OH8 A;  1WUA A;  2KLA A;  1ESV A;  2YI1 A;  4I6M B;  4NYF A;  1KXP A;  4H8K A;  3V4I A;  3SUQ A;  1R0A A;  4YDU A;  4CBW A;  2ITG A;  2PBD A;  4RW7 A;  4N41 A;  5AQK A;  1NJI O;  1SAZ A;  1TAU A;  1RBV A;  4FWK A;  4I2Q A;  4CJL A;  4BR4 A;  4DF8 A;  3AV9 A;  3VGL A;  1JLE A;  3DXK B;  4CZI A;  4OJR A;  5DK5 A;  3ZET B;  3QIP A;  3MEC A;  2FLO A;  5KTQ A;  1JCG A;  2HMP A;  1EKE A;  4H4O A;  3TI0 A;  1YI2 N;  4NLB A;  3L6Q A;  3SUP A;  1VHX A;  3OYH A;  3TPQ A;  4JNE A;  4KV8 A;  3O1B A;  5CYQ A;  4FWQ A;  3EO3 A;  4RG8 A;  3A5O C;  3F9M A;  4N47 A;  1FW6 A;  4ZTJ A;  4KHU A;  4CJW A;  2FF6 A;  3U9Z A;  2KFN A;  3V9Z A;  3SAG A;  4CFA A;  1C0T A;  2Q2R A;  1NK8 A;  1A5V A;  4CEF A;  2EX3 A;  3B6O A;  1L3S A;  4B08 A;  4CZG A;  1TGO A;  4LY7 A;  1YF5 L;  3VEV A;  5E84 A;  1LWF A;  2FBY A;  2YCH A;  3DMJ A;  3VEZ A;  4JKD A;  4K42 A;  3HVT A;  1RT3 A;  4EZ9 A;  4AF1 A;  1NK4 A;  3PX6 A;  1Q8I A;  2E2Q A;  3O9T A;  1IKX A;  4DTU A;  4C8O A;  3OS1 A;  3TAR A;  3O80 A;  1CZA N;  1NGJ A;  4KO0 A;  4FM0 A;  3VA3 A;  5HRO A;  2X78 A;  3KLI A;  5J2M A;  3NMU A;  1HPM A;  4KHS A;  4BC4 A;  1RCH A;  3MX2 A;  4DTR A;  4FJN A;  4FXD A;  4OKE A;  3ZX3 A;  5KGX A;  5FRM A;  2HNY A;  1KAZ A;  4I9Q A;  2ATQ A;  2NRR A;  3V81 A;  4Y0W A;  1QHT A;  1VQ9 N;  4AQY K;  5M1Q A;  4F9O A;  1FKO A;  2VG5 A;  3F5T A;  2Q36 A;  3VEO A;  4DSL A;  4XIU A;  2KW4 A;  3L4I A;  4CEO A;  2HVH A;  1QSS A;  3H08 A;  4UQG A;  4O55 A;  3EKS A;  3VEY A;  2GTD A;  3KLG A;  3FR0 A;  4JD2 A;  5EY4 A;  1JCE A;  3WEE B;  4DV3 K;  4H5W A;  3VF4 A;  3SBT A;  2G8U A;  1S1T A;  4KKO A;  1WN7 A;  3C95 A;  4CBX A;  4H0T B;  3TAF A;  3A5N C;  2A42 A;  1HYV A;  1QQM A;  4YOW A;  3RSE B;  4DV2 K;  3CFP A;  3OYM A;  3C6T A;  3GBT A;  4E19 A;  1VSI A;  3D45 A;  4OPJ A;  3K5N A;  3P38 A;  2KKZ A;  5BN9 A;  2WOM A;  1VQL N;  1XMO K;  2HHQ A;  1GLJ O;  4NCB A;  1BCM A;  4B3T K;  3GE1 A;  5JLF A;  1X9M A;  2ZJR L;  1TUU A;  4O44 A;  2P9L A;  3WQU A;  4KAZ A;  3VQP A;  3L2R A;  1NK7 A;  2UXD K;  3UIQ A;  3EZ5 A;  3QEX A;  2QXL A;  3CFO A;  1VSF A;  3MXI A;  2YV0 X;  4KHQ A;  4B3R K;  4CJP A;  4M7Y A;  4FOI A;  5JLH A;  3A0I X;  3CPE A;  2VG6 A;  4BRP A;  1ATN A;  1I94 K;  1J5E K;  4JLH A;  2P5G A;  3AGR A;  4LFB K;  3ID6 A;  3H1Q A;  3DWL A;  1NGA A;  3R9P A;  2NRH A;  4FWN A;  1U4B A;  3ENH A;  4JV5 K;  1BDG A;  2Q97 A;  4B9Q A;  2FSN A;  4LC9 B;  3DLB A;  4FOE A;  4OGE A;  3KLH A;  3KK1 A;  1BIZ A;  2NZT A;  3MED A;  4BDZ A;  5JMV A;  2O8D A;  1NGD A;  5GAG P;  5AQU A;  1TKD A;  3AO4 A;  4O0I A;  4HUG A;  3FZL A;  4K25 A;  4FJL A;  4H03 B;  1YUW A;  4OGC A;  3QFU A;  1IO2 A;  3W3D A;  5KRS A;  2A40 A;  4GKK K;  1KLM A;  2HF3 A;  3OA9 A;  3HT3 A;  2OTJ N;  1RBT A;  2YJE A;  1GLL O;  4FJM A;  1ZBU A;  2ZE2 A;  5BPN A;  1Q18 A;  2OZM A;  1EXQ A;  3OYD A;  4MQ3 A;  3G0Z A;  1EQY A;  3SPZ A;  2O8F A;  4MDB A;  1HQE A;  4H5N A;  4IFE A;  3DLK A;  1LV5 A;  1KD1 O;  4CFC A;  3KVG A;  4LSN A;  1TYQ B;  2Y1J A;  4FW2 A;  4B9N A;  3AA5 X;  4OX9 K;  2HBL A;  4O8K A;  4LSL A;  4FWP A;  3VEN A;  2IVN A;  1T8E A;  4DTO A;  4QS7 A;  4CHQ A;  1RTJ A;  4M63 C;  3J8A A;  4M3W A;  4WQ5 C;  3MXJ A;  1Z6R A;  4ILH A;  2QKK A;  3VET A;  1NK6 A;  3D6R A;  1XWL A;  4DR7 K;  3SUN A;  3SZ2 A;  3RRG A;  3CJ1 A;  1ZC6 A;  3TAN A;  3VA0 A;  4RW6 A;  1VSH A;  3DLH A;  4CBU A;  3JS6 A;  1BI4 A;  2Y1I A;  4CIE A;  2VWB A;  5AZJ B;  2XO7 A;  4Q0B A;  2WTU A;  2R7Y A;  2YKM A;  4DR1 K;  3QET A;  1ASW A;  3NAE A;  4JKB A;  1KVC A;  1N5Y A;  2G8W A;  1KVA A;  2GV9 A;  4A57 A;  3AVB A;  3MWP A;  4M41 A;  3V1R A;  3Q7C A;  5FPM A;  1VRU A;  4CI6 A;  2D0O A;  3H46 O;  3A2F A;  3WNE A;  1NJX A;  2HHX A;  3K57 A;  3ZSR A;  3ZSW A;  2YNH A;  1N6Q A;  2Z1G A;  2FBV A;  4M3T A;  4FSV A;  2AP1 A;  5T7B A;  2O8E B;  3CCV N;  4NCG A;  2BH1 A;  5AQM A;  5ADX H;  3CFR A;  4FZZ A;  4EIA A;  3IMX A;  1L3U A;  4OVL A;  1WSI A;  5LMN K;  2YHA A;  2W6L A;  4JS5 A;  3R3L A;  2ETJ A;  3VQ8 A;  4I6M A;  4LD0 A;  3C65 A;  4CE9 A;  3LP2 A;  4K8Z A;  5C10 A;  1LW2 A;  4K8X A;  1RDW X;  3CET A;  3OYF A;  4CGI A;  5HBM A;  2KZM A;  1QVF M;  4YOR A;  4B8C A;  2QK9 A;  1BOT O;  3G4S N;  4N56 A;  4CEA A;  3TTC A;  4XH4 A;  3E1Y A;  3ZET A;  3K5L A;  1IBK K;  5C2D A;  3ULE A;  2HHH K;  2VG7 A;  2O8C A;  4CJ3 A; 
#chains in the Genus database with same CATH homology
 3ZCM A;  5CY4 A;  3WNG A;  1BQN A;  3ITH A;  4GVM A;  4W5O A;  1YTA A;  1U49 A;  1UA0 A;  3NHG A;  3VQ4 A;  3V6D A;  3K5O A;  5C24 A;  2HVI A;  4BE2 A;  1JLQ A;  3JSM A;  4DQS A;  3QEW A;  3LPT A;  1LWE A;  2D0B A;  1TV6 A;  1VK0 A;  4M3Y A;  1REV A;  4B9S A;  3ZT1 A;  3KTQ A;  4HUF A;  4DF4 A;  4QAG A;  1VSL A;  1SL2 A;  4CJR A;  2E4L A;  2HHS A;  4PWD A;  3RMB A;  1QE1 A;  1BL3 A;  1RBR A;  3T3F A;  3M8P A;  5J1E A;  1SKW A;  1C6V A;  2JGU A;  5HRR A;  2W42 A;  4Z4H A;  4DWI A;  3B6P A;  4DTS A;  1EX4 A;  4M45 A;  4IDK A;  3WNH A;  4PUO A;  2B4J A;  1S9E A;  4O0J A;  1GOA A;  1G15 A;  3SQ0 A;  3DOK A;  1U48 A;  4DG1 A;  1ZYQ A;  4FJI A;  3DLG A;  3IRX A;  1A5X A;  3HO1 A;  4CJK A;  4KI4 A;  2Z1H A;  3L2W A;  1IKW A;  3ZT3 A;  4AHC A;  3S3N A;  1S1W A;  5CZ1 A;  3OYJ A;  2G8H A;  4KB1 A;  3AVI A;  1YTU A;  3AA4 A;  3QES A;  1KCF A;  3L3U A;  3CQ8 A;  3QER A;  3SNN A;  4GW6 A;  3RR8 A;  3CM6 A;  1I3A A;  5I3U A;  4DQR A;  1S1U A;  5CYM A;  1J54 A;  3KLE A;  4CJV A;  4DFM A;  1D9F A;  4HHT A;  1LAW A;  4F3O A;  3L2U A;  5JS2 A;  3V9S A;  3ZSO A;  2G8K A;  1JLC A;  4C8L A;  3BDP A;  3TAM A;  3AVJ A;  3ZT2 A;  1NK5 A;  4IKF A;  4FK2 A;  3LZJ A;  4BAC A;  4CGH A;  4CJ3 A;  2Z1I A;  1BI4 B;  5EU7 A;  3AVL A;  3TAQ A;  1JL2 A;  3NDK A;  3NFA A;  2HNZ A;  3HVR A;  3LP0 A;  1B9F A;  2A1S A;  3E01 A;  4AHU A;  4FLW A;  2YHB A;  3MEG A;  3AVK A;  1RT4 A;  1JLG A;  1TK0 A;  4ZTF A;  1KRP A;  4OLB A;  3HPH A;  3HM9 A;  4NYF A;  2XY5 A;  2DTU A;  2BE2 A;  3DI6 A;  4H8K A;  3OS2 A;  3V4I A;  3SUQ A;  3F9K A;  4KTZ A;  1R0A A;  1HPZ A;  2KQ2 A;  1JLB A;  2ITG A;  4OKJ A;  1FKP A;  4Z4G A;  4RW7 A;  4N41 A;  1RTI A;  3AA2 A;  2P1J A;  4CGJ A;  4W5Q A;  1NJZ A;  1YVU A;  4CF9 A;  4QCL A;  1RBV A;  2HHT A;  4CJU A;  1CXU A;  4DTJ A;  1RBS A;  1CZB A;  3KK3 A;  1U45 A;  4I2Q A;  4CJ4 A;  1QS4 A;  4CJL A;  3DRP A;  3MEE A;  3AO3 A;  4OKK A;  3O4N A;  4DF8 A;  3AV9 A;  3VQ5 A;  4CED A;  4DQQ A;  1JLE A;  3AA3 A;  2Z1J A;  4HUE A;  2BGG A;  4OJR A;  3OYI A;  5DK5 A;  1ZBH A;  3VQE A;  3QIP A;  3MEC A;  3M8S A;  4DSF A;  1RT2 A;  3P1G A;  5KTQ A;  1EKE A;  4H4O A;  3TI0 A;  4RW9 A;  1HRH A;  1C1C A;  3SUP A;  3OYH A;  4KV8 A;  3VN5 A;  5CYQ A;  3SQ2 A;  4QOZ B;  4RG8 A;  4CJF A;  4GMJ B;  1ZBF A;  4CF0 A;  4N47 A;  1L5U A;  3DLE A;  4IG0 A;  3NH1 A;  3QEP A;  4DFP A;  4ZTJ A;  3SPY A;  5FRO A;  1U47 A;  1BHL A;  2ZQB A;  3NGY A;  4CJW A;  4FJG A;  4W5R A;  4PA1 A;  4FZX C;  3T1A A;  4KHU A;  2DFF A;  3V9Z A;  2KFN A;  4CFA A;  1C0T A;  1NK8 A;  2EX3 A;  1A5V A;  3B6O A;  4RW8 A;  3ALY A;  4CEF A;  4BE1 A;  1L3S A;  1EET A;  3KD5 E;  4EZ6 A;  4Z0U A;  4FJX A;  3K2P A;  4B08 A;  3FFI A;  4DQI A;  1UAX A;  1Q9X A;  1NKC A;  1TGO A;  4N5S A;  4LY7 A;  3BGR A;  2B6A A;  3RMD A;  1QQC A;  3S3M A;  4FJ7 A;  2O4I A;  3AVG A;  2BDP A;  2KTQ A;  4MFB A;  4Z4C A;  1LWF A;  4AIL C;  2O4G A;  2FBY A;  4CGF A;  3RWU A;  2ZD1 A;  3DMJ A;  3DRR A;  4FM2 A;  4DSE A;  1LWC A;  2OPR A;  4E1N A;  4CFD A;  4E7H A;  1ZBI A;  3KLF A;  3HVT A;  1RT3 A;  4EZ9 A;  1WAF A;  3LAM A;  3SQ4 A;  3PX6 A;  1Q8I A;  1NK4 A;  1RT5 A;  1IKX A;  4DLG A;  4DTU A;  4B9L A;  4KB0 A;  3ZSQ A;  3OS1 A;  3TAR A;  4ZHR A;  4EP4 A;  3PY8 A;  4YFU A;  5C42 A;  4C8O A;  4KTW A;  3CM5 A;  4KO0 A;  4KRF A;  4AHT A;  4FM0 A;  2KFZ A;  4CJQ A;  3V9U A;  4DU1 A;  1W9H A;  3KJV A;  1T03 A;  4ICL A;  3VA3 A;  3DLR A;  1J5O A;  5HRO A;  1VSJ A;  4E7I A;  1FK9 A;  2X78 A;  1NOZ A;  3KLI A;  5J2M A;  2G8V A;  2QXF A;  4KI6 A;  3SQ1 A;  1IG9 A;  3LWM A;  4KHS A;  1RCH A;  1S9G A;  1X1P A;  3G10 A;  4DTR A;  4FJN A;  2X6S A;  4FXD A;  4OKE A;  5KGX A;  5FRM A;  4O4G A;  2HNY A;  1B92 A;  5FRN A;  5C25 A;  1WAJ A;  3QNO A;  1TKZ A;  1SL0 A;  4Z4I A;  4FJ8 A;  3AVM A;  2KZZ A;  1RIL A;  1HNV A;  4I9Q A;  2X6N A;  2ATQ A;  4FLU A;  3V81 A;  3ZSV A;  1S1V A;  1QSY A;  4DQP A;  3OY9 A;  4FYD A;  5J2N A;  3VQA A;  1NKB A;  4I9L A;  1QHT A;  4IG3 A;  1F21 A;  5I42 A;  3QIN A;  1IKV A;  4PQU A;  3QEI A;  1JLA A;  3DYA A;  1Z26 A;  4C8K A;  4CIG A;  4FLT A;  1HQU A;  1J9A A;  4J2B A;  1HYZ A;  1FKO A;  2VG5 A;  3L3V A;  1RNH A;  4CK2 A;  1RDD A;  4JRQ A;  1RT6 A;  2E6M A;  1VSK A;  4DSL A;  1D9D A;  4XIU A;  2KW4 A;  2HVH A;  4CEO A;  3PO5 A;  1BIS A;  3AO5 A;  4CCH A;  1A5W A;  3ZT4 A;  3OYL A;  3TAP A;  1CLQ A;  4PY5 A;  1QSS A;  3H08 A;  2XRI A;  4DS5 A;  4E0D A;  4UQG A;  3RR7 A;  4O55 A;  1RT1 A;  1QSL A;  3HPO A;  1S5J A;  3V1Q A;  1CZ9 A;  2F96 A;  1VSD A;  3VQC A;  3LP1 A;  3KLG A;  2D0A A;  3S3O A;  4CIF A;  3ZSX A;  3KD1 E;  4CHZ A;  5CZ2 A;  4B3O A;  4N76 A;  3HXM A;  3OYG A;  1TAQ A;  4E7L A;  2OPQ A;  4C8N A;  1JLF A;  3OYB A;  2PYL A;  3SCX A;  4KTQ A;  4M3X A;  3KK2 A;  3SJJ A;  2G8U A;  4Z4E A;  4YNQ A;  1S1T A;  2HND A;  3KKS A;  1WN7 A;  3C95 A;  4KKO A;  3TAF A;  2QKB A;  3QIO A;  1NJY A;  1HYV A;  3OYK A;  1ZBL A;  3CFP A;  3S9H A;  4E7K A;  5HRP A;  3V9W A;  2X74 A;  1WLJ A;  1Q9Y A;  3OYM A;  3C6T A;  3M8R A;  3IS9 A;  4E19 A;  1VSI A;  3D45 A;  3PUF A;  5D3G A;  4DLE A;  2OYQ A;  4OPJ A;  3K5N A;  2B5J A;  2A1R A;  3NF7 A;  2IDO A;  2WOM A;  3RTV A;  4ELT A;  2HHQ A;  4CK3 A;  1JXB A;  3V9X A;  4TSX A;  3SUO A;  1HNI A;  4G1Q A;  4I2P A;  4J2D A;  1BCM A;  4NCB A;  4FW1 A;  1X9W A;  2XHB A;  3M8Q A;  1RDB A;  1X9M A;  1S6Q A;  4O44 A;  4CFB A;  1X9S A;  3OYN A;  4KAZ A;  4FJ9 A;  3VQP A;  2HHW A;  1C0U A;  3NBP A;  4CHP A;  1J53 A;  3L2R A;  1NK7 A;  4KHN A;  3UIQ A;  3I0R A;  3EZ5 A;  3QEX A;  4F4K A;  3CFO A;  3ZSY A;  3PO4 A;  2BAN A;  1VSF A;  3MXI A;  1T7P A;  1WSJ A;  1TVR A;  4ID5 A;  4AHS A;  4NYN A;  4DSK A;  2YV0 X;  4KHQ A;  3DRS A;  4B9M A;  3THV A;  1HYS A;  4CJP A;  3CG7 A;  3RMC A;  4CEQ A;  3LAL A;  5KRT A;  2YNG A;  1TL3 A;  3QNN A;  1JL1 A;  2VG6 A;  4CK1 A;  1SKR A;  4CGG A;  3NH0 A;  2YKN A;  2RN2 A;  3O3G A;  2DY4 A;  3OS0 A;  4JLH A;  1FXX A;  2P5G A;  2GBZ A;  4Q5V A;  3K5M A;  2HMI A;  4CHO A;  4M3U A;  4IFY A;  1VRT A;  4CF1 A;  4CJ5 A;  2OA8 A;  4NCA A;  4KHY A;  2F8T A;  1O1W A;  4I7F A;  1U4B A;  4KFB A;  4DU4 A;  1C1A A;  4CHN A;  2EHG A;  4M3Z A;  3DLB A;  3MXM A;  3VQ7 A;  3HJF A;  4IFV A;  3K58 A;  4OGE A;  3KLH A;  3KK1 A;  1BIZ A;  3SV4 A;  1MU2 A;  3MED A;  4DTM A;  4FJ5 A;  5FDL A;  1GOC A;  3AVN A;  2I5J A;  2XY8 A;  4BDZ A;  3DM2 A;  1WSF A;  4FJK A;  3L2V A;  3ZSZ A;  1RT7 A;  3PV8 A;  1ASV A;  3OYE A;  1WSH A;  3AO4 A;  1TKD A;  1U04 A;  4O0I A;  2D0C A;  4CER A;  4HUG A;  4F2S A;  3V1O A;  3HP9 A;  3U6F A;  2G8F A;  4FLV A;  1SL1 A;  4FJL A;  5HP1 A;  3TAG A;  4DS4 A;  4OGC A;  2IOC A;  3SV3 A;  1LW0 A;  4DTP A;  1DTQ A;  3QEV A;  1XI1 A;  1IO2 A;  4F8R A;  4F2R A;  3QLH A;  3LAK A;  5KRS A;  4HTU A;  3AVC A;  4O5B A;  4B9U A;  1SV5 A;  4CEC A;  2PY5 A;  1KLM A;  4WE1 A;  4IBN A;  4LH5 A;  1GOB A;  4M3R A;  3HT3 A;  4BWM A;  1BQM A;  1RBT A;  3EY1 A;  4FJM A;  3U3G A;  2RF2 A;  4BDP A;  1L3T A;  1ZBU A;  2ZE2 A;  3HP6 A;  2OZM A;  3T19 A;  1EP4 A;  1EXQ A;  1XHZ A;  4FLZ A;  2YNF A;  3OYD A;  3LDS A;  4MQ3 A;  4DFK A;  3G0Z A;  1KVB A;  3OVN A;  3SPZ A;  5DMR A;  2HHV A;  1HQE A;  3DLK A;  3IG1 A;  1TKX A;  1LV5 A;  3TR8 A;  1KLN A;  1VSE A;  2XY7 A;  1QTM A;  2YNI A;  3AVA A;  4CFC A;  1ITG A;  4LSN A;  3O3F A;  3PX4 A;  3DOL A;  4DFJ A;  2NUB A;  4LH4 A;  5KI6 A;  4CJS A;  3F73 A;  4CES A;  3ISN C;  2IS3 A;  4FVM A;  3LPU A;  2VWJ A;  2XY6 A;  2GUI A;  2Y1J A;  1WSG A;  4FW2 A;  4JRP A;  3AA5 X;  3NF9 A;  3LP3 A;  3OYC A;  4B9N A;  3LWL A;  1TAU A;  3NGZ A;  3IAY A;  4FK0 A;  2HW3 A;  3SYZ A;  3KKR A;  4E3S A;  1NK0 A;  4LSL A;  2DFH A;  4FZY A;  5JS1 A;  4ELU A;  4HCC A;  2RKI A;  1K6Y A;  1T8E A;  4DTO A;  4HVJ A;  4CHQ A;  1JKH A;  3VQ9 A;  1RTJ A;  3QO9 A;  1YT3 A;  2HB5 A;  3MAQ A;  4FM1 A;  3HST B;  4B9T A;  4ELV A;  4M3W A;  1Z25 A;  3MXJ A;  4AHV A;  1UWB A;  1VSM A;  1KFS A;  2QKK A;  4KHW A;  1NK6 A;  1I39 A;  1S1X A;  1SKS A;  1KFD A;  5HRN A;  5J2P A;  1TK8 A;  1LAV A;  1XWL A;  4E1M A;  3U3Y A;  3SUN A;  1KSP A;  2HHU A;  3SZ2 A;  4B9V A;  2RPI A;  3RRG A;  2OPS A;  3TAN A;  1BGX T;  1IH7 A;  3I8D A;  3VA0 A;  3P83 D;  3C94 A;  1VSH A;  4RW6 A;  3DLH A;  3HYF A;  4KPY A;  1JXE A;  4L8R B;  4FJH A;  4C8M A;  5J2Q A;  2Y1I A;  1BI4 A;  4BDY A;  4CIE A;  4Q0B A;  2XO7 A;  5SZT A;  4E89 A;  2R7Y A;  4DTN A;  2YKM A;  4Y1C A;  4ID1 A;  3QET A;  1ASW A;  1BCO A;  1KTQ A;  1KVC A;  3AVH A;  3NAE A;  1N5Y A;  1TK5 A;  1KVA A;  2G8W A;  4DSJ A;  2OPP A;  1C0M A;  1D5A A;  2GV9 A;  4DTX A;  1D8Y A;  4KRE A;  3SI6 A;  4OLA A;  1BIU A;  2IAJ A;  3AVB A;  1CXQ A;  4CEE A;  4JS4 A;  1T05 A;  1S6P A;  3K59 A;  4M41 A;  3V1R A;  2G8I A;  3TWH A;  2AJQ A;  2P51 A;  4H4M A;  3NCI A;  1VRU A;  4DU3 A;  4DMN A;  4FLY A;  4M42 A;  4FJJ A;  3KIO A;  1RBU A;  3A2F A;  1WSE A;  2IC3 A;  3WNE A;  4CEZ A;  2OZS A;  1RDA A;  1NJX A;  1Y97 A;  2HHX A;  3K57 A;  3ZSR A;  3ZSW A;  1XC9 A;  2YNH A;  3AO2 A;  1L3V A;  1N6Q A;  1WNS A;  1TKT A;  2Z1G A;  4B8A B;  3PX0 A;  2FBV A;  5E41 A;  4W5T A;  4AHR A;  3TAE A;  1NK9 A;  4M3T A;  4E7J A;  5HLF A;  3RMA A;  2PZS A;  1IKY A;  3O4Q A;  5T7B A;  4NCG A;  2P5O A;  3D0P A;  3CFR A;  2D5R A;  4FZZ A;  3AVF A;  1NKE A;  3ZT0 A;  4CEB A;  1L3U A;  3L2Q A;  4Y1D A;  4J2E A;  4OVL A;  1HJR A;  1ASU A;  3ASM A;  3VQQ A;  1SUQ A;  3NH2 A;  1C1B A;  1WSI A;  2FBT A;  2YHA A;  2WON A;  2DFE A;  4R5P A;  3TAB A;  2F8S A;  3LAN A;  5SWM A;  3ULD A;  1TL1 A;  4CHY A;  4JS5 A;  2PYJ A;  2LSN A;  4BWJ A;  4CJT A;  2ETJ A;  4OPK A;  1UA1 A;  3VQ8 A;  4FK4 A;  4LD0 A;  3JYT A;  3I0S A;  2VWK A;  4HCB A;  4CE9 A;  4DSI A;  2FBX A;  3LP2 A;  4K8Z A;  5HRS A;  3NE6 A;  4FCY A;  3WNF A;  1LW2 A;  1RTD A;  3OYA A;  4K8X A;  1DLO A;  3OYF A;  4W5N A;  1B9D A;  4CGI A;  5HBM A;  2KZM A;  1RDC A;  2FC0 A;  3VQD A;  3L8B A;  4EP5 A;  3VQB A;  1NJW A;  4CF8 A;  4Z4F A;  4J2A A;  4B8C A;  2QK9 A;  1HMV A;  1UOC A;  2E6L A;  1NOY A;  3HPG A;  3VQ6 A;  4FLX A;  1DTT A;  3EYZ A;  5K14 A;  3NF6 A;  3P5J A;  3O3H A;  4RW4 A;  4N56 A;  4CEA A;  2Q3S A;  4CF2 A;  1W0H A;  2JLE A;  3AO1 A;  4CGD A;  3HL8 A;  3OJU A;  3OJS A;  3K5L A;  3NGI A;  1RTH A;  4CJE A;  4AH9 A;  4F3T A;  3NF8 A;  3C6U A;  3LZI A;  1XHX A;  2VG7 A;  3RRH A;  2IGI A;  5KGW A;  3HK2 A;  3CYM A;  4BE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...