3NH0A

Crystal structure of rnase t in complex with a non-preferred ssdna (aac)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 64
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh0A00
1YTUA 3OYEA 4FM2A 3TAQA 4FJIA 3LP1A 3TANA 4DS5A 1FKOA 1RTHA 3VQEA 4AILC 1D8YA 4F3TA 1C1BA 3OYGA 4KB1A 3LPTA 2YNFA 3AVKA 1JLAA 3LAKA 4KHNA 3B6OA 2OZMA 3ZCMA 4HVJA 3NHGA 1L3SA 4MQ3A 1BISA 5J2PA 1TAQA 3CM5A 2Q3SA 4J2DA 4QOZB 5HP1A 3TAMA 3TABA 3SJJA 4WE1A 3TAPA 3DRRA 4DU3A 1X9SA 4Y1DA 3WNEA 4CGJA 3S3MA 4DFMA 5J2NA 4E7JA 2JLEA 3VA3A 1IG9A 4CF1A 3SQ2A 4ID5A 3NAEA 3HPGA 1I39A 1TGOA 5KGXA 4Y1CA 4DFKA 1RDCA 1L5UA 5C24A 4BDPA 3SV4A 4K8ZA 1W9HA 4DSJA 1QHTA 3CG7A 4MFBA 1SKWA 4L8RB 1NK6A 2Z1JA 3PUFA 1VSKA 4I2QA 4AHCA 5HRNA 3AVHA 4FM0A 1O1WA 4E7LA 3OYDA 2KFZA 4C8MA 4DF8A 5JS2A 2B5JA 3D45A 4DG1A 1ASWA 4KTZA 5CYMA 5KRTA 3EY1A 3QNOA 3VQ6A 2RKIA 3NH2A 1WSJA 3OYHA 1RBVA 2OPQA 4JRQA 3QESA 3QEWA 1REVA 3M8SA 4I7FA 4Z4CA 1WSGA 1T7PA 1VRUA 1L3VA 4N41A 3BDPA 2GV9A 4J2BA 3VQ8A 1SL2A 4CF9A 3OYMA 3AVMA 3SPZA 1IH7A 1UA1A 3IG1A 4E7HA 3NF7A 1D9FA 4FLYA 4M3ZA 3LP2A 4FK2A 4N47A 3HPHA 4Q5VA 3O3GA 1VSDA 4I2PA 4ELVA 4OKEA 1TVRA 3AA3A 3RMDA 2ZD1A 3KLIA 5C42A 1RT4A 1NJWA 1WSIA 2G8KA 2FBXA 4ZTJA 3C94A 3AA5X 4KRFA 3THVA 4FJ8A 4RW7A 1RBTA 1XWLA 1SV5A 3I8DA 4CF2A 2XY6A 4Z4EA 2G8IA 5D3GA 3KK1A 3VQAA 3T3FA 1U45A 1WAFA 4CHQA 1LV5A 1KRPA 4CGGA 3G0ZA 3DLHA 1LWFA 4CGFA 2FC0A 3AV9A 4CJKA 4PY5A 3OJUA 1TK8A 1CLQA 3V9XA 3KLEA 3C6TA 2D0BA 3DOKA 4CJFA 2VWJA 3RR8A 1Z25A 4CEFA 4KI4A 3F9KA 1QSLA 1TL1A 4DMNA 3K57A 4FZYA 1J53A 4OKKA 1RDBA 2ZQBA 3AO1A 2HB5A 1VSHA 3HP6A 3KJVA 4DLEA 4DTJA 3OYJA 3DYAA 4AHUA 3LAMA 1KVCA 4DSKA 1U48A 2PZSA 3DLBA 2YNIA 1C0TA 1HQEA 1SUQA 3P5JA 3ZT3A 3K59A 1L3TA 1WNSA 2YHAA 3MEEA 3HVRA 1ASUA 3LDSA 4W5RA 4NCBA 3ZSRA 2OA8A 1TK5A 3QNNA 4CF8A 3AVLA 4O0IA 1RBRA 2X78A 3PX4A 2O4GA 1LAWA 3DI6A 4ELTA 3JYTA 2OPRA 4CK2A 1S1TA 4NYNA 3VA0A 3AVIA 4DTOA 3VQ5A 4CHZA 3DOLA 4W5OA 4DF4A 3TAEA 3HM9A 3QEPA 4CFCA 3V9WA 4LD0A 3QEVA 3QIOA 4H8KA 1BHLA 1Q8IA 3NF6A 3NCIA 1SL1A 2WONA 3K5NA 4AHSA 4CGIA 3DRPA 4NCGA 3K5LA 3SZ2A 2ZE2A 4KHYA 4Z4FA 1GOAA 2KZMA 4JLHA 4IG3A 4CJVA 3QO9A 4B9SA 4O44A 2D5RA 4HCCA 3T19A 1VSMA 4KTQA 1C0MA 4CK3A 1ZBHA 3LZIA 1IKWA 1RNHA 4IFYA 3V81A 1U04A 1JLCA 3IRXA 4RW6A 4BE2A 3RRHA 4DTMA 3TI0A 3B6PA 3DLGA 4IFVA 4YFUA 4FLWA 4Z4GA 4FLTA 4CJ3A 4E89A 3SCXA 4CFDA 3SQ4A 3TR8A 2ITGA 4CCHA 2QK9A 1EP4A 3ASMA 1KCFA 4OJRA 3SV3A 3SI6A 4HCBA 2E6LA 1BCMA 4DWIA 3OYFA 3LWMA 3WNGA 2Y1IA 3K58A 3SUNA 2PYLA 4M3TA 4BDZA 1EETA 3ZSZA 1QE1A 4E1NA 3HPOA 4DU4A 4DSEA 4DTSA 3V6DA 1C1CA 3RWUA 1D9DA 1BCOA 2IDOA 3K2PA 2OPPA 3OYNA 2GUIA 2BGGA 3G10A 1J9AA 2W42A 1UAXA 3P1GA 3S9HA 4EP5A 3AA2A 4FJ7A 4J2AA 5J1EA 1IKXA 1QTMA 5SWMA 4DQSA 4CIFA 2GBZA 3V9UA 3CFOA 1A5WA 1RTJA 1JL2A 4BWMA 4OPJA 4E7KA 1U4BA 3KIOA 1HNIA 1XHXA 4B08A 1NKBA 2PY5A 5FDLA 3ISNC 3ZSQA 3RTVA 3ZSOA 4W5TA 2DFHA 3SUOA 1J5OA 4E3SA 4DQPA 2OZSA 1W0HA 3AVNA 4DTRA 2IOCA 3AVJA 1VSFA 1QQCA 5KI6A 4W5QA 2Z1GA 4DTXA 2A1SA 4DFPA 1T03A 4M3YA 4KFBA 5JS1A 2O4IA 1WSHA 1CXQA 5I42A 3OJSA 1U47A 3OS1A 2ATQA 4FW2A 4LY7A 2XY7A 4RG8A 3QLHA 4DTUA 3L2VA 1QSYA 4LSNA 4OGCA 1WAJA 2DFFA 4FLXA 2OPSA 5CZ1A 1LWCA 3ZT1A 1S1UA 4CE9A 1UA0A 2QKKA 1FXXA 1TKDA 2KTQA 4CEOA 3UIQA 1RT7A 1RT6A 3QERA 2IS3A 3VQ4A 2X6NA 3V9ZA 2FBYA 1C6VA 3TWHA 3AVAA 4B9LA 2D0CA 4CHYA 1TKXA 1RTDA 4CJ5A 2G8VA 2PYJA 4FJKA 4CEQA 4OLBA 1CZ9A 3VQPA 4CHNA 3HT3A 3KK2A 3E01A 1EKEA 4CGHA 2ETJA 4FJNA 3M8QA 1RTIA 1F21A 5HBMA 3M8RA 3OYBA 1NK8A 4I9QA 4ZHRA 3F73A 2R7YA 4NYFA 4BDYA 4BE1A 4KV8A 2HHQA 1WSFA 2P51A 4ICLA 3ZT2A 2KW4A 3ZT4A 3KTQA 3PO5A 1IKYA 1FKPA 1RT2A 3P83D 4CF0A 3MAQA 5I3UA 5E41A 1A5XA 1NK9A 2E6MA 4HHTA 3DMJA 4CIGA 5C25A 3LP0A 2WOMA 1TKTA 4E0DA 4EZ6A 1KVBA 4CJUA 4FK0A 2HHTA 4B9MA 5HRPA 1HYZA 4RW4A 1MU2A 1VSEA 2D0AA 4LH4A 2YNHA 2XHBA 4FXDA 1NJZA 1Z26A 4JRPA 4F3OA 4QCLA 2X6SA 2HHUA 3PO4A 4M3UA 1JL1A 3AVBA 2HHSA 2HHWA 1VK0A 4DTPA 3MXJA 4CJPA 2Z1HA 5SZTA 5T7BA 1ZBUA 4FJMA 4PQUA 4CHPA 3TARA 5HRSA 1HYSA 1UWBA 3MXIA 3S3NA 4TSXA 2I5JA 3DLEA 2BANA 3ZSYA 4CFAA 3MECA 4CJLA 3OYCA 3ZT0A 1XHZA 4B8CA 4CEBA 3OYKA 3PX0A 1SKSA 3KD1E 4H4MA 4FZXC 3K5OA 2HHVA 3FFIA 2YKMA 1QS4A 2VG6A 2QKBA 3TAFA 4FJLA 4F8RA 3L3UA 1KFDA 3OYAA 3L2QA 1BL3A 3AO4A 1YVUA 1B9FA 1BI4A 1SL0A 4EZ9A 2YHBA 3QETA 4FLZA 1KTQA 1G15A 3C6UA 2HHXA 4GMJB 3QEXA 1JLFA 1NK7A 1JLBA 3NF8A 2G8WA 4BWJA 3LALA 4KI6A 3DM2A 3OYIA 4CIEA 2YNGA 3KLHA 1IO2A 3KKSA 5K14A 3NGYA 2P5GA 1D5AA 3DRSA 1TAUA 3CYMA 1JXBA 1S1XA 3A2FA 3AVCA 2BDPA 5FRNA 1X9WA 3ITHA 4LSLA 3KK3A 3RMAA 2P1JA 1UOCA 2HNDA 3O3HA 4HTUA 4DSIA 1KVAA 4DQRA 1S1VA 3KLFA 4OLAA 2F8SA 3SQ1A 5J2QA 1WLJA 1NJXA 1LW2A 3S3OA 3NGIA 1Q9XA 1IKVA 2G8FA 4JS5A 4PUOA 1WN7A 1X1PA 3NFAA 4AHRA 3C95A 4AHTA 4B9VA 1NK5A 1RBUA 3L8BA 4FM1A 2X74A 3OVNA 3RMCA 1KSPA 1HQUA 4FJXA 1NOZA 4KTWA 3RR7A 4FLVA 2Y1JA 4IDKA 4BACA 4E7IA 1GOCA 5KGWA 3KKRA 1BIUA 3BGRA 4KHSA 3O4QA 4DQIA 3OYLA 3WNHA 2QXFA 3MEDA 2KZZA 4CJSA 4FK4A 1YT3A 3O3FA 1RILA 3SYZA 3HXMA 1J54A 4AHVA 5CZ2A 2OYQA 4C8KA 2HVHA 1A5VA 4FJJA 3L2RA 2F96A 3TAGA 1R0AA 2YV0X 1NKCA 1JXEA 1LWEA 4CESA 4M3XA 1KLNA 1S1WA 3HO1A 3EZ5A 4O4GA 1YTAA 4O5BA 3VQDA 3I0SA 3V1RA 3L2UA 4KHUA 4B3OA 3NH0A 4IG0A 1HMVA 1S6PA 1VSLA 1B92A 4Z0UA 2RPIA 3QINA 4CFBA 4YNQA 3CFRA 1XC9A 1WSEA 1X9MA 4W5NA 3SUPA 3LWLA 1BGXT 3U3GA 2HNZA 2RN2A 4FJHA 1BQMA 4C8LA 4FJ9A 1BQNA 3AVFA 2XO7A 1NK0A 4KAZA 4RW9A 4IKFA 4OGEA 3ULDA 4DU1A 4KB0A 1VSIA 5DMRA 3NDKA 2HVIA 2DTUA 4LH5A 4CECA 4E19A 3CFPA 1HYVA 4G1QA 4CJQA 1L3UA 1HPZA 4CEEA 3AVGA 1B9DA 3VQ9A 4DLGA 2IGIA 2E4LA 1DLOA 2XRIA 4DTNA 1NOYA 1TV6A 3IAYA 4F4KA 4CJTA 3VQQA 3HYFA 4CK1A 3PX6A 4RW8A 4M45A 4ZTFA 3WNFA 2P5OA 3SPYA 4CEZA 2XY8A 3V9SA 3V4IA 3U6FA 3V1OA 3JSMA 4F2RA 3HL8A 3ZSXA 2EX3A 2KQ2A 4M42A 2YKNA 1HRHA 1RBSA 4ID1A 3LP3A 1XI1A 3PY8A 4CJ4A 1S6QA 3LANA 4C8OA 3SNNA 1TK0A 3HJFA 4FJ5A 2A1RA 4M3RA 3ZSWA 1U49A 4DSLA 1CZBA 4R5PA 4K8XA 4OPKA 3D0PA 4B9NA 4CEAA 4J2EA 2F8TA 1TKZA 5CY4A 1S5JA 2Z1IA 1ZBLA 4DS4A 4FZZA 3NF9A 2FBVA 4QAGA 1RT5A 1ZYQA 4N56A 4FJGA 5FRMA 4Q0BA 4KPYA 2DY4A 5KTQA 4M41A 2JGUA 4B9UA 1S9GA 4CGDA 4KKOA 4E1MA 3QEIA 1LW0A 1VRTA 3I0RA 4O0JA 1EXQA 1ITGA 4HUGA 3NH1A 4F2SA 2IAJA 5DK5A 4FLUA 3T1AA 3O4NA 4JS4A 1T8EA 1NKEA 1NJYA 5J2MA 5KRSA 2VWKA 4FVMA 4ELUA 1KLMA 4KREA 2VG5A 1JLQA 2HNYA 5HRRA 4DFJA 2B4JA 4IBNA 2XY5A 1S9EA 3L2WA 3NGZA 3SQ0A 3MEGA 3RMBA 3DLKA 4C8NA 1BI4B 3AO5A 4OKJA 2G8UA 3H08A 1I3AA 3NBPA 2HW3A 3RRGA 3NE6A 4GW6A 3DLRA 4XIUA 2IC3A 1EX4A 4CJRA 3KLGA 1RDAA 2EHGA 1HJRA 3AO2A 3CM6A 5CYQA 3VN5A 1KFSA 1HNVA 4DSFA 1QSSA 4N76A 4FYDA 3HVTA 4KHQA 4I9LA 4PA1A 4KO0A 1DTQA 3ALYA 1N6QA 2G8HA 3SUQA 1T05A 2HMIA 2BE2A 1TL3A 4H4OA 3AO3A 3M8PA 2AJQA 1BIZA 1K6YA 3VQCA 4CJEA 1JKHA 1CXUA 4CERA 4B8AB 3K5MA 4HUEA 1RT3A 2VG7A 3U3YA 3PV8A 3VQ7A 2B6AA 4CHOA 3CQ8A 3EYZA 3V1QA 1Y97A 4O55A 3LPUA 4FW1A 4AH9A 3OS0A 3AA4A 1N5YA 2RF2A 1DTTA 5FROA 4GVMA 4FCYA 4UQGA 1VSJA 2DFEA 4N5SA 5HLFA 1Q9YA 4CJWA 1RT1A 3OY9A 1ASVA 1LAVA 3ZSVA 1RDDA 4OVLA 1NK4A 3HSTB 1GOBA 3MXMA 5EU7A 1JLGA 3LZJA 4HUFA 3HK2A 4DQQA 2LSNA 2KFNA 1ZBIA 1JLEA 4Z4HA 4BE0A 4M3WA 3OS2A 3L3VA 1C1AA 1C0UA 4CEDA 2NUBA 5HROA 4NCAA 4EP4A 1ZBFA 2FBTA 3IS9A 1RCHA 3HP9A 4B9TA 1FK9A 3KD5E 3QIPA 4PWDA 3VQBA 4KHWA 1SKRA 4Z4IA
chains in the Genus database with same CATH superfamily
4DS5A 1FKOA 1RTHA 1QQMA 1W2BM 5EOYA 2D1KA 1C1BA 3SAFA 3B6OA 4HVJA 3NHGA 3VF2A 4MQ3A 3CM5A 2Q3SA 4J2DA 5LMNK 5HP1A 4BVPA 1RDWX 5C0YA 2QWNA 2IVPA 3CCUN 1K73O 3LDLA 3QBXA 5J2NA 4CF1A 3SQ2A 3NAEA 3FE1A 1TGOA 3T69A 2CGKA 1L5UA 4K8ZA 1RDUA 4MFBA 2Z1JA 4OO1J 1VSKA 4AHCA 3VGMA 5CE3A 3CCSN 4E7LA 2KFZA 5JS2A 2B5JA 5M1QA 4JKAA 1L3TA 3NH2A 2RKIA 1BA0A 3QEWA 3EO3A 2NRHA 4I7FA 3M8SA 5BPLA 1GLLO 3CPWM 1L3VA 3BUZB 3SAGA 4GVEA 4A2BA 4CBUA 4E1JA 1SL2A 4J2BA 3ZETA 3OYMA 1R59O 3IG1A 4YOVA 4BROA 3WXJA 5AFUH 2OANA 1TUYA 4BR2A 3AA3A 4ISFA 3KLIA 5C42A 1XNQK 4O8UA 3E9OA 1NJWA 4ZTJA 4FJ8A 3I8BA 1RBTA 1SV5A 2P9NA 4CF2A 4Z4EA 2G8IA 5D3GA 3CQXA 3VQAA 4DHYA 5HOOA 3G0ZA 5AFUA 3U9DA 3SMPA 1TK8A 3KLEA 3GL1A 2E2PA 1VQMN 2NRRA 1Z25A 4KI4A 3F9KA 4NB4A 2BUPA 3K57A 3C7NA 1I94K 2RE2A 1RDBA 5DM6L 2HB5A 4JD2A 3O9TA 3OYJA 1LCUA 1NU0A 5BR9A 3IUCA 5AJ3K 3ZT3A 3O8MA 1FW6A 4JK8A 1QZ5A 3U4LA 1TK5A 3QNNA 1S72N 3JYTA 1S1TA 4IJNA 1P90A 3TAEA 5AQHA 3V9WA 1YJWN 5M1KA 3QEVA 4H8KA 1DEJA 1BOTO 4IG3A 4CJVA 4O44A 2D5RA 3A5NC 1IKWA 3IRXA 5AQLA 2HBMA 4CFDA 1KCFA 3SV3A 1TYQA 3R8EA 4UY8O 4X62K 5AQOA 5GINA 4AQYK 4BDZA 1EETA 1J6ZA 3V6DA 1BCOA 2HF4A 3K2PA 3OYNA 2GUIA 3G10A 2QW9A 2W42A 3TSUA 1YI2N 5I9EB 4EP5A 1O13A 3FZMA 5J1EA 1IKXA 5SWMA 4CIFA 1A5WA 1JL2A 4H0OA 1U4BA 3C6AA 3KIOA 1XHXA 2PY5A 1J5OA 3ZSOA 4W5TA 5IWAK 2IOCA 2Z1GA 4DFPA 5JS1A 1WSHA 1CXQA 3GOIA 2ATQA 4A59A 4FW2A 4QS8A 2P9SB 5TKYA 5F0XA 3L2VA 4LSNA 4OGCA 3S41A 1WAJA 2OPSA 4CE9A 1TKDA 1NMDA 3UIQA 2ZJPL 2D0CA 4FJKA 3HOSA 4CEQA 4LF6K 1CZ9A 1MDUB 3VGLA 3E01A 4XH5A 1ZC6A 2HHHK 3MN9A 2HHQA 4ICLA 2P51A 2CGLA 2KW4A 1IKYA 1FKPA 3KWGA 5I3UA 1KQSM 3MAQA 1A5XA 3CJ1A 4HHTA 3EN9A 4CIGA 3LP0A 5C25A 1TKTA 5AQNA 4E0DA 4WQ4A 4FPAA 2GUPA 1MU2A 2XHBA 2V7ZA 1JCGA 3EKSA 1Z26A 4BRQA 1HKBA 4PL8A 1NJZA 4QCLA 2Q0UA 2E2NA 3PO4A 2VGMA 3CCEN 4DTPA 4CJPA 5T7BA 3CF5L 4IDHA 3TARA 5HRSA 1UWBA 3S3NA 4H0PA 4CJLA 3MECA 2YKMA 1QS4A 2VG6A 2QKBA 4XEIA 3L2QA 1VQ4N 3AO4A 3EE8A 2V51B 4DUYK 1KTQA 4FVUA 3C6UA 2HHXA 2QWRA 4GMJB 3QEXA 2G8WA 2ITMA 3LALA 4MLEA 4KI6A 4XH4A 4PL7A 3DRSA 4LF8K 1JXBA 3A2FA 1OH8A 1X9WA 1C0GA 3DWLA 1UOCA 4HTUA 2O8EA 2HF3A 1NJXA 1LW2A 3S3OA 3NGIA 2Q97A 4BREA 4PUOA 1WN7A 3C95A 2ZGZA 2HBLA 1WBBA 4FJXA 4BQLA 3F9MA 2P9KA 3TTCA 3O4QA 3IMXA 2JWKA 3PLAA 3O3FA 1EO1A 3HXMA 4FWSA 4AHVA 4BC3A 1YIJN 1A5VA 3VEYA 4FJJA 3L2RA 1OVYA 3TAGA 4RTFD 2YV0X 1NKCA 4CESA 4M3XA 3EZ5A 1NGJA 3V1RA 3L2UA 3THXA 4B3OA 4IG0A 4FWQA 1B92A 4JKGA 3QINA 4Z0UA 3WEEB 3CFRA 3SUPA 2ZGYA 3G4SN 1QZ6A 2HNZA 4FJHA 1BQMA 1BQNA 3AVFA 2XO7A 3ULDA 1VHXA 1VSIA 3NDKA 4E19A 4G1QA 4CJQA 4YOTA 2VCPA 3AVGA 5H1SQ 1B9DA 2IGIA 1DLOA 2XRIA 1NOYA 5KPTA 3IAYA 3P38A 4GKJK 4JKBA 3WNFA 2P5OA 2QA4N 2GELA 4CEZA 4U7BA 3V9SA 1HUXA 4F2RA 3C6HA 2KQ2A 1HRHA 1RBSA 1XI1A 3LP3A 4KB1A 1K9MO 2PBDA 3QFUA 2UXCK 4FPBA 4DV4K 4DS4A 4FZZA 2DY4A 3CCJN 5FPMA 4B1YB 2W6LA 2JGUA 1GLFO 4CZLA 4B9UA 1DGKN 1S9GA 4E1MA 4O0JA 1ITGA 4IJAA 3NH1A 4F2SA 1KAYA 3QBWA 1NKEA 1NJYA 1KLMA 5TKWA 4GV9A 3CPEA 3SQ0A 4AF1A 3C0BA 3DLKA 4JAXA 1BI4B 3Q7CA 2HW3A 4BG8A 3PSFA 2FSNA 3TTFA 2IC3A 1OH6A 5CYQA 4OPHA 5BN9A 3SJHA 4I9LA 4PA1A 4H4OA 1EWQA 1BIZA 1K6YA 4CJEA 1JKHA 3K5MA 3HSCA 4HUEA 3VF6A 3VQ7A 2VQEK 1K8AO 2P9UB 3HM8A 3EYZA 3VEXA 4AH9A 3A5OC 3OS0A 1N5YA 4YOYA 4N5SA 5HLFA 4CJWA 1RT1A 2E8AA 3RSEB 3OY9A 1YJ9N 5BRDA 3HSTB 5EU7A 1JLGA 5FPNA 4DQQA 2PAVA 4DR6K 3ZX0A 4H5VA 2Q0RA 4M3WA 1BWFO 2W6KA 3OS2A 3SMSA 5HROA 4KHPK 4EP4A 3IS9A 3KD5E 3M6GA 1N34K 1KC8O 4DUZK 1NWKA 3LP1A 1OH7A 3WQUA 2D0OA 3VQEA 4AILC 2UU9K 1FJGK 1HNWK 2YHYA 1ESVA 3OYGA 1C0FA 3LDPA 4O5FA 1BISA 3OTOK 3R1XA 5AQVA 3TABA 4WE1A 2O8FB 4DU3A 1X9SA 4Y1DA 3MCAB 4YDUC 4YOWA 2JLEA 4E7JA 1VAZA 3HPGA 1I39A 2W40A 3MN7A 5C24A 4WFNL 3T1HK 4DSJA 4X66K 1S3XA 1P8ZA 3PUFA 4K0KK 5EVZA 5GIOA 4C8MA 2D4WA 4DG1A 1ASWA 1D4XA 2ASOA 4KTZA 4BRIA 3QNOA 3OYHA 3QESA 3H46O 2WBNA 2ASPA 3O08A 4KH6A 1T7PA 1VRUA 3H1VX 3VQ8A 4CF9A 3D2EA 3AVMA 1IH7A 4E7HA 3H3NO 4FLYA 5KQDA 4BC2A 4DR5K 4FK2A 3THYA 1VSDA 4ELVA 3RMDA 2ZD1A 3O1BA 5AQMA 1W7AA 2FBXA 4CI6A 3CCVN 4FWKA 3O5BA 3I8DA 3AGRA 5AQJA 1U45A 3DLHA 4CGFA 5JLFA 1KAXA 3AV9A 4PY5A 3OJUA 3H3OB 1CLQA 3OA9A 3C6TA 3C7NB 2WC9A 3TSQA 4BR0A 1QSLA 2JWLA 3AO1A 4DLEA 5ADXA 3HP6A 1DKGD 3VEOA 1BDGA 3LAMA 1KVCA 5KPZA 4R79A 1U48A 3FFKB 3T1YK 3DLBA 1C0TA 3BF1A 4B3MK 3K59A 3CI5A 1WNSA 2GEMA 3EKUA 2YHAA 2GTDA 3LDSA 2OA8A 4JKCA 3CJAA 4CVNE 3AVLA 4B1ZA 1RBRA 2X78A 3PX4A 2O4GA 4ELTA 3MWTA 4CK2A 2FF6A 4NYNA 4H0YB 3BY5A 4XH1A 4CFCA 4WF9L 4LD0A 3NF6A 4DR1K 4FWLA 2WONA 4AHSA 4CGIA 4KHYA 4B9SA 4HCCA 2QXLA 1VSMA 1C0MA 4CK3A 3HI0A 3TANA 3V81A 4IFYA 1U04A 1JLCA 3RRHA 1YITN 4IFVA 2I7NA 4YFUA 4FLWA 4FLTA 4Z4GA 4CJ3A 3SCXA 1EP4A 2HBJA 3ASMA 3SI6A 2CH6A 1BCMA 4BRLA 5C12A 4DWIA 2Y1IA 3WNGA 2UXDK 3N4QA 4K42A 3UKRA 3E1YA 4AM6A 4BRKA 4E1NA 4DU4A 4DTSA 2F4VK 4LF4K 3O6WA 1D9DA 4JI2K 3AARA 2P9IB 4FJ7A 5AZIB 2A41A 4FL9A 1T6CA 1NM1A 1MWKA 4BWMA 1RTJA 1SQKA 4OPJA 4DR7K 2HBKA 1NKBA 3ZSQA 1K8KB 4DQPA 4E3SA 1YVNA 4W5QA 4DTXA 2A1SA 4KFBA 3T7ZA 5I42A 3OJSA 2V52B 4LY7A 2XY7A 2NLXA 4CZEA 1QSYA 5AQXA 4FO0A 5CZ1A 1LWCA 3ZT1A 1S1UA 1VQLN 3DXMA 4CEOA 1RT7A 4JV5K 3VQ4A 1YF5L 3V9ZA 1C6VA 3AVAA 4EIAA 1RTDA 5AQQA 1YXQA 2G8VA 4LFBK 4CHNA 4A61A 2FF3B 3HT3A 2VWBA 3SAHA 3J81O 4IOAL 2IVOA 4JKDA 1F21A 3M8RA 3OYBA 3VOVA 1NK8A 5AQPA 4I9QA 3QFPA 4C1NK 4ZHRA 3QICA 4NYFA 5LJWA 2O8DB 4FWMA 3ZT2A 3J8AA 1NK9A 2E6MA 3QDKA 4H03B 4FWOA 4YORA 5HRPA 1VSEA 2NRZA 5IT9O 4FXDA 4H0TB 4QS9A 4JRPA 3Q7BA 5JVHL 2X6SA 2HHUA 5AQSA 4M3UA 1JL1A 4ISEA 3TTDA 1VK0A 4PQUA 4FJMA 5SZTA 1XQSC 1ZBUA 4CHPA 3IKMA 4O8KA 5BRHA 2I5JA 4OPAA 3DLEA 2GWJA 5AQFA 3KD1E 3K5OA 1ILYA 4F8RA 4YY3K 3MWPA 3OW2M 3GG4A 5FLXO 1VQPN 1SL0A 2YHBA 4FLZA 3IFRA 4HWIA 3E66A 3LM9A 4IOCL 3SLCA 1SS6A 3DM2A 1U2VB 2YNGA 1IO2A 3KKSA 3LDQA 5K14A 4JI1K 3A8YA 5FRNA 4IXCA 3CCLN 2O8EB 3HZ6A 1IJJA 1IG8A 4PKHA 3TU5A 4A57A 4OLAA 5J2QA 2HOEA 5M1PA 4GNIA 2G8FA 1X1PA 4AHRA 3MK6A 4B9VA 1NK5A 1RBUA 4KTWA 3RR7A 1VQON 2Y1JA 4IDKA 2P9KB 1GLBG 1GOCA 1OKJA 3BGRA 4KHSA 3MEDA 4FK4A 2P9PB 1NNEA 2E88A 5CZ2A 2F9TA 4C8KA 4QS7A 4BRAA 1JXEA 1LWEA 4BGBA 3CC2N 3THXB 4BC5A 1S1WA 4FWNA 4O4GA 4JKGB 4U67L 4BC4A 4KHUA 1S6PA 4CFBA 2RPIA 1X9MA 4A5BA 1BGXT 2RN2A 4FJ9A 4C8LA 3BZKA 1LOTB 1NK0A 4KAZA 4EHTA 4OGEA 4KB0A 2HVIA 2DTUA 5C2DA 1HYVA 3CJ9A 4Z94A 3DXKB 4CEEA 4LF7K 2QI2A 2E4LA 1TV6A 4CBXA 3VQQA 3HYFA 4CK1A 3PX6A 2NRVA 3O9QA 2D0PA 3P31A 4DR2K 3U6FA 3V1OA 2EX3A 4JK7A 4ID1A 3PY8A 4C8OA 4CJ4A 3HJFA 3ZSWA 3VEZA 4DSLA 4J2EA 4OPKA 5CY4A 2Z1IA 5GIPA 2NRWA 3WQTA 4BG9A 5FRMA 4Q0BA 4N56A 4KPYA 5KTQA 4M41A 4JN4A 1IBMK 1LW0A 1J5EK 4CZJA 1EXQA 2YJEA 4M7XA 3E9PA 3T1AA 4C1NI 4ELUA 4GKKK 2BTFA 1JLQA 1S9EA 3MEGA 4M63C 1I3AA 3NE6A 3DLRA 4XIUA 1CZAN 3VN5A 2EHGA 1GLJO 1HJRA 3AO2A 4B1VA 3E9LA 4JNEA 4FYDA 4WQ5A 5AZJA 1DTQA 3ALYA 4CD3A 2G8HA 1EWRA 3ULEB 2FLOA 3F5TA 4Y0WA 4B8AB 1RT3A 2VG7A 3PV8A 4CHOA 4B1WB 3ENOA 4FW1A 3AA4A 2RF2A 4H5NA 2YI1A 4IO9L 3KZBA 4GVMA 3J7ZO 3NVMA 1Q9YA 3ZSVA 3GBTA 3ID8A 4YOUA 1GOBA 4YDUA 3HOTA 1ZBIA 2KFNA 1JLEA 4Z4HA 4BE0A 5AQGA 5M1NA 3L3VA 1C1AA 3WUHA 4NCAA 2NUBA 1ZBFA 4CZMA 3VQBA 4KHWA 3J7YP 1TUUA 3MDQA 3OYEA 3TAQA 3FGUA 1ZBSA 4LC9B 5EY4A 2O8BB 3LPTA 3AVKA 1JLAA 3BP8A 3LAKA 2VQFK 4BRPA 1Q81O 2OZMA 4KHNA 5KPRA 1L3SA 1HKCA 5J2PA 1TAQA 4FWPA 1E3MA 5C15A 3D2FA 3TAPA 3DRRA 2P9LA 3L0QA 5BPMA 3WNEA 4CGJA 3S3MA 3L4QA 3VA3A 1NJIO 5KGXA 4DFKA 4BDPA 3OBWA 3B8AX 3VPZA 5BR8K 3RVCA 1QHTA 3CG7A 4L8RB 3GDQA 1T3VA 3QMLA 4I2QA 5HRNA 3AVHA 1MWMA 4FM0A 1O1WA 5FPEA 3OYDA 3OHRA 4DF8A 3D45A 4GY2B 3ZX3A 5KRTA 3EY1A 3SBGA 3VMFB 1WSJA 2OPQA 1REVA 2P9SA 3D2EB 4B3RK 2GV9A 1Q86O 3G71N 3ENBA 4WCEL 3NF7A 2E2QA 3L4IA 4M3ZA 1MA9B 5EX5A 3O3GA 4H5TA 4I2PA 2EWSA 3O80A 2QEXN 3C94A 3AA5X 4KRFA 1HNXK 1XWLA 2QWPA 3T3FA 4BRHA 4CHQA 1KRPA 3A5LC 1LWFA 3AY9A 2FC0A 4CJKA 1GLDG 4CJFA 2VWJA 1VQ7N 1TL1A 5AQKA 4DMNA 1J53A 3K9KA 1VSHA 5F1XA 2O8CA 3DYAA 3WXLA 3LL3A 5BPNA 2YNIA 1HQEA 1SUQA 1WB9A 2A5XA 4DV2K 3MEEA 4W5RA 4NCBA 3ZSRA 5BREA 3F2KA 3SBTA 1QHAA 1KXPA 2Q36A 1NGBA 2OPRA 4WFBL 5HL7L 3VA0A 2WUSA 3VQ5A 4DF4A 4W5OA 3QEPA 4I6MA 3QIOA 1SL1A 1BHLA 4WQ4C 4Z4FA 3ID6A 4NCGA 2KZMA 1GOAA 4JLHA 4IFEA 3QO9A 5E26A 3T19A 4JYAK 4KTQA 1ZBHA 3ZEUB 3LZIA 4WYBA 4RW6A 4DTMA 3TI0A 3B6PA 3EL2A 2NRTA 2F7TA 4E89A 4H5RA 3TR8A 2ITGA 4PKIA 5JMVA 4OJRA 4G9ZA 4L3QA 3KHYA 3CXCM 5JLHA 3LWMA 4X65K 2PYLA 4M3TA 1N32K 3ZSZA 1QE1A 3HPOA 1C1CA 3W0LA 2IDOA 2OPPA 1J9AA 4BY9C 2FXUA 1UAXA 3CC7N 3HBTA 3S9HA 3V9UA 3AAQA 3FZKA 1HNIA 5C10A 5FDLA 4J2AA 2QWLA 1W0HA 3AVNA 4DTRA 3AVJA 5KI6A 1VSFA 1QQCA 3EE9A 5M1OA 4M3YA 3LDOA 2O4IA 3I56N 4RG8A 3QLHA 1XC3A 1VQ5N 1QVFM 3DXMB 3CCMN 3H1QA 2DFFA 4FLXA 3ZETB 4IO8A 2QKKA 1FXXA 5EXWA 3WEEA 3UKUA 2KTQA 2F9WA 3QERA 4FOIA 3TWHA 5ELZA 3ZLJA 4CHYA 1TKXA 2GX9A 3VQPA 4ISGA 3ENHA 4CGHA 3P4IA 5C2FA 1RTIA 3VETA 5HBMA 1NGCA 2E20A 5A2QO 2P9NB 1M1KO 3FZHA 4CJ7A 2R7YA 4BE1A 4KV8A 5E84A 1WSFA 2Q2RA 1KAZA 3PO5A 4MO4A 4NLBA 4CD1A 3THWA 5E41A 3CJ7A 4EZ6A 2WOMA 1KVBA 1SZ2A 4CJUA 4RW4A 4JD2B 2D0AA 5AQRA 5CHIA 5KQ8A 2RHKA 1N33K 3MXJA 2Z1HA 4BR7A 4JHDA 3MXIA 4MO5A 3PSIA 3CMAN 2BANA 3ZSYA 4CFAA 3ZT0A 1OVQA 4B8CA 3PX0A 4FZXC 4AM7A 1N8RO 4B1XB 3TAFA 4FJLA 1KFDA 3OYAA 2UYTA 2J4RA 1BL3A 1Q7YO 1ATNA 2WTUA 1BI4A 3QETA 4BVOA 1WBDA 3MX2A 1BG3A 1JLFA 1JLBA 3NF8A 4DV5K 2Q1NA 4CIEA 4JI7K 3KLHA 2P5GA 2OTJN 3WXMB 3CYMA 2VYPA 4JI4K 3AAPA 3KK3A 3RMAA 4BRGA 2P1JA 1TYQB 3O3HA 2P9UA 4DSIA 1BA1A 4BGAA 1S1VA 3KLFA 1WLJA 1NGIA 1GLAG 2FSJA 1Q9XA 3J80O 3NFAA 3OVNA 1IV0A 1KSPA 2QTDA 1NOZA 4BACA 4H0XB 5LJVA 5KGWA 1RGIA 3CHWA 4DQIA 2QXFA 2QM1A 4CJSA 1YT3A 2KLAA 3LM2A 2HVHA 4GV6A 3MN5A 3R9PA 2F96A 1R0AA 2WFBA 3PIOL 4DV6K 4K41A 3HO1A 1YTAA 4H0VB 3NH0A 1HMVA 3KTQA 1XC9A 1WSEA 3MX5A 4W5NA 3LWLA 3U3GA 3P39A 2O8FA 4CZFA 4YHHK 1X3NA 1WUAA 4DU1A 4IZ9A 5DMRA 4LH5A 5JICA 3CFPA 5GAHP 4DB3A 4DV1K 1HPZA 4DLGA 4CZGA 5AQIA 4CJTA 3I55N 4RW8A 2E5LK 4A2AA 5AQZA 3SPYA 1Z05A 1YJNN 4GV3A 1U6ZA 3LANA 3J7AP 4B3TK 2YJFA 2A1RA 1U49A 1KD1O 3D0PA 2QWMA 1ZBLA 4KH5A 4DR4K 2FBVA 1RT5A 4DR3K 4IOXA 1BO5O 4KKOA 3QEIA 3KVGA 1VRTA 2UUCK 2ZF5O 3O4NA 4JS4A 1T8EA 2GWKA 5KRSA 4FVMA 2VG5A 4DFJA 2ZWHA 5GADP 2B4JA 4IBNA 4MDAA 3L2WA 3NGZA 1VQ9N 4RWTA 3U8XA 4B1UB 2G8UA 3H08A 4GW6A 1EX4A 5AZJB 1HLUA 1RDAA 4BR4A 4CJRA 3KLGA 4LFAK 4N76A 1HNVA 4DSFA 1NGEA 2KHOA 3HVTA 4KHQA 4KO0A 3SUQA 4DKWA 2BE2A 1TL3A 3VGKA 3AO3A 3M8PA 1DT9A 1GLCG 3U3YA 3KWIA 3CQ8A 3V1QA 2I7PA 4O55A 3LPUA 1V4SA 1DTTA 5FROA 1VSJA 1XMQK 2OCEA 1ASVA 1LAVA 3GE1A 3DLLL 4A5AA 4CBWA 1RDDA 4OVLA 3MXMA 1T44A 1HPMA 1Q82O 3BF3A 1NGFA 2YHWA 1X9JA 3TPQA 2OTLN 1RCHA 3HP9A 1FK9A 3OBYA 3W3DA 2CGJA 1SKRA 2E2OA 4Z4IA 1YTUA 4FM2A 4FJIA 1D8YA 1NG9A 4NO7A 4F3TA 5F2RA 4CZIA 3N4PA 4FSVA 3O9SA 2YNFA 3ZCMA 3D2FB 2P9LB 4A62A 3O4WA 4QOZB 3TAMA 3SJJA 2A40A 3WXIA 2P9IA 5AZIA 3L6QA 4DFMA 3JXUA 2QWOA 1IG9A 2HMPA 4ID5A 4JKHA 3QB0A 4JI8K 2A42A 4Y1CA 1RDCA 3SV4A 1W9HA 4ILGB 5M1FA 1HX1A 1SKWA 3O1WA 1NK6A 1K8KA 3K9JA 3DJCA 1G99A 4FJ5A 5CYMA 2F8TA 3VQ6A 4JRQA 1RBVA 4JK9A 4Z4CA 1WSGA 4N41A 2A6AA 3BDPA 2Q31A 3SPZA 1OH5A 4EAHD 1UA1A 1GLEG 1ZXOA 1JCFA 1D9FA 3LP2A 4CZKA 4X64K 4N47A 3HPHA 4Q5VA 3VF4A 4OKEA 2YHXA 1TVRA 3ZYYX 3UB5A 3M1FA 5AQTA 1RT4A 3HTVA 2G8KA 1WSIA 3THVA 4RW7A 3H6EA 2XY6A 1H1VA 2W41A 3KK1A 1WAFA 1LV5A 4CGGA 5GAGP 2O8DA 4KBOA 3CCQN 3SK3A 4JI3K 1QVGM 3V9XA 3RR8A 2D0BA 3DOKA 2ASMA 4CZHA 3CJCA 4CEFA 2O8CB 4LF9K 2IIRA 4FZYA 4OKKA 2ZQBA 3VERA 3KJVA 3WT0A 4DTJA 3D6RA 3G6EN 4AHUA 3R3LA 3CJBA 4DSKA 2PZSA 1VQ8N 4CW7B 1Z6RA 1NGGA 4C23A 4H5WA 3LDNA 3P5JA 3A5MC 2VGNA 3FZLA 3HVRA 1ASUA 1HKGA 1ATSA 4CF8A 4O0IA 1LAWA 3DI6A 4I6MB 4BRDA 3AVIA 4DTOA 2HHSA 4CHZA 3DOLA 3G25A 4KH4A 4JKEA 3HM9A 3UE5A 1XMOK 5CR4A 1Q8IA 3NCIA 3RWUA 3K5NA 1RFQA 3DRPA 3K5LA 3U9ZA 2ZE2A 3SZ2A 1U2VA 4FWRA 1RNHA 4BE2A 4YOXA 4HTLA 3DLGA 5B8HA 4LFCK 2QK9A 4CCHA 3SQ4A 2QWQA 4HCBA 2E6LA 2NZTA 5LL6Z 3OYFA 1V4TA 5AR0A 3K58A 3SUNA 3O9RA 4DSEA 2BGGA 3NVKA 3P1GA 1QQOA 3AA2A 3I33A 1QTMA 4DQSA 1YAGA 2GBZA 2HSTA 5LY3A 3CFOA 4E7KA 1NLVA 4B08A 3RTVA 3ISNC 2ZM6K 3SUOA 2DFHA 1NMNA 2OZSA 2P9PA 1T03A 1U47A 3OS1A 5AQUA 1EQYA 3AGKA 4DTUA 3UKUB 5BRFA 1UA0A 4NXMK 2UUAK 3CC4N 2KKZA 3H45C 1RT6A 2IS3A 2X6NA 4BRNA 2FBYA 4MDBA 4B9LA 2PYJA 3THYB 4CJ5A 3TSPA 5MLCQ 4OLBA 4BQZA 3KK2A 1X3MA 1HJOA 1EKEA 4FJNA 2ETJA 3DXKA 3M8QA 4DV0K 1S22A 2E1YA 1XUPO 1IBLK 1NGDA 3MN6A 3F73A 3THWB 5BN8A 4BDYA 3CMEN 3CETA 1HNZK 3BZCA 3ZT4A 1W97L 2H3GX 1RT2A 3VESA 4CF0A 3P83D 3DMJA 4FK0A 2AA4A 2HHTA 4PHTX 4B9MA 1HYZA 2BH1A 4LH4A 5DM7L 2YNHA 1E4GT 2DPNA 3VEWA 4F3OA 3ATVA 3AVBA 4JHDB 2HHWA 4BRMA 3D7EO 1NGHA 1HYSA 1VQ6N 4TSXA 2UUBK 3OYCA 1XHZA 3IDHA 3OYKA 4BR9A 4CEBA 1SKSA 4H4MA 2HHVA 3FFIA 3L3UA 3JS6A 1YVUA 1B9FA 4EZ9A 2YCHA 1G15A 4IEIA 4IEEA 2IVNA 1NK7A 4NLCA 4BWJA 1JJ2M 4LF5K 3FR0A 3OYIA 3NGYA 4EHUA 1D5AA 3ULEA 1TAUA 1S1XA 3AVCA 4PKGA 3FLCO 4M7YA 4RCHA 2BDPA 4V19S 3NMUA 3ITHA 5AQYA 4DV3K 4LSLA 3VEVA 2HNDA 1KVAA 4DQRA 2F8SA 3SQ1A 3UKRB 4K25A 1IKVA 4JS5A 4ILHA 2YX6A 4AHTA 3L8BA 4JI6K 4IWVA 4FM1A 2X74A 3VENA 3RMCA 1HQUA 3CIPA 4WQ5C 5LMUK 4FLVA 1WOQA 4E7IA 3KKRA 3M5RA 1BIUA 4WFAL 5AQWA 3OYLA 3WNHA 2KZZA 4BRFA 3DAWA 1N36K 1RILA 3SYZA 1J54A 2OYQA 1BUPA 1E4FT 5JVGL 1BU6O 1VQNN 2AP1A 1KLNA 4O5BA 2O8BA 3VQDA 3I0SA 4B3SK 4JI0K 3CD6N 3CQYA 1VSLA 3JAMO 4YNQA 3O9UA 4DCHA 1YUWA 4RW9A 4IKFA 3CCRN 4CECA 1L3UA 2FSKA 4BR5A 3VQ9A 3EEQA 4DTNA 4F4KA 1Y64A 4M45A 4ZTFA 4JEPA 2XY8A 3V4IA 3JSMA 3HL8A 3WXKA 3ZSXA 4M42A 2YKNA 3MCPA 1S6QA 3SNNA 1TK0A 1JCEA 4M3RA 2UXBK 4K8XA 1CZBA 4R5PA 4B9NA 4CEAA 1TKZA 1S5JA 4F9OA 3KK7A 3PIPL 3NF9A 1ZYQA 4QAGA 4FJGA 1T6DA 2NNWA 4BRCA 4CGDA 3M3ZA 5ADXH 3FZFA 3I0RA 4HUGA 1Q18A 2IAJA 5DK5A 4FLUA 4EFHA 5FPDA 5J2MA 2VWKA 4KREA 4DQ8A 2HNYA 5HRRA 2XY5A 4OX9K 2ZJRL 1YHQN 3RMBA 4C8NA 3AO5A 4OKJA 3NBPA 3RRGA 3A0IX 1KFSA 3CM6A 1QSSA 4MLHA 3MMVA 1N6QA 4J8FA 1T05A 2HMIA 1NBWA 1VQKN 3HRGA 2V7YA 1NGAA 2AJQA 3VQCA 1CXUA 4CERA 1ATRA 4FOEA 2B6AA 2ZJQL 3C65A 2NRXA 2E1ZA 5GAEP 1Y97A 4K43A 1M90O 4DV7K 4FCYA 4UQGA 2DFEA 3VTHA 3K0SA 3ATUA 3CERA 4JKFA 1SAZA 3R6MA 3VTIA 1NK4A 2PFUA 3RSEA 3LZJA 4HUFA 1IBKK 3HK2A 2LSNA 1HR0K 2CH5A 2A3ZA 4NXNK 3BEXA 1C0UA 4JI5K 4ILJA 4CEDA 3ZX2A 2FBTA 3ZEUA 4B9QA 1QQNA 4B9TA 1XNRK 3QIPA 3EZWA 4PWDA
chains in the Genus database with same CATH topology
1YTUA 3OYEA 4FM2A 3TAQA 4FJIA 3LP1A 3TANA 4DS5A 1FKOA 1RTHA 3VQEA 4AILC 1D8YA 4F3TA 1C1BA 3OYGA 4KB1A 3LPTA 2YNFA 3AVKA 1JLAA 3LAKA 4KHNA 3B6OA 2OZMA 3ZCMA 4HVJA 3NHGA 1L3SA 4MQ3A 1BISA 5J2PA 1TAQA 3CM5A 2Q3SA 4J2DA 4QOZB 5HP1A 3TAMA 3TABA 3SJJA 4WE1A 3TAPA 3DRRA 4DU3A 1X9SA 4Y1DA 3WNEA 4CGJA 3S3MA 4DFMA 5J2NA 4E7JA 2JLEA 3VA3A 1IG9A 4CF1A 3SQ2A 4ID5A 3NAEA 3HPGA 1I39A 1TGOA 5KGXA 4Y1CA 4DFKA 1RDCA 1L5UA 5C24A 4BDPA 3SV4A 4K8ZA 1W9HA 4DSJA 1QHTA 3CG7A 4MFBA 1SKWA 4L8RB 1NK6A 2Z1JA 3PUFA 1VSKA 4I2QA 4AHCA 5HRNA 3AVHA 4FM0A 1O1WA 4E7LA 3OYDA 2KFZA 4C8MA 4DF8A 5JS2A 2B5JA 3D45A 4DG1A 1ASWA 4KTZA 5CYMA 5KRTA 3EY1A 3QNOA 3VQ6A 2RKIA 3NH2A 1WSJA 3OYHA 1RBVA 2OPQA 4JRQA 3QESA 3QEWA 1REVA 3M8SA 4I7FA 4Z4CA 1WSGA 1T7PA 1VRUA 1L3VA 4N41A 3BDPA 2GV9A 4J2BA 3VQ8A 1SL2A 4CF9A 3OYMA 3AVMA 3SPZA 1IH7A 1UA1A 3IG1A 4E7HA 3NF7A 1D9FA 4FLYA 4M3ZA 3LP2A 4FK2A 4N47A 3HPHA 4Q5VA 3O3GA 1VSDA 4I2PA 4ELVA 4OKEA 1TVRA 3AA3A 3RMDA 2ZD1A 3KLIA 5C42A 1RT4A 1NJWA 1WSIA 2G8KA 2FBXA 4ZTJA 3C94A 3AA5X 4KRFA 3THVA 4FJ8A 4RW7A 1RBTA 1XWLA 1SV5A 3I8DA 4CF2A 2XY6A 4Z4EA 2G8IA 5D3GA 3KK1A 3VQAA 3T3FA 1U45A 1WAFA 4CHQA 1LV5A 1KRPA 4CGGA 3G0ZA 3DLHA 1LWFA 4CGFA 2FC0A 3AV9A 4CJKA 4PY5A 3OJUA 1TK8A 1CLQA 3V9XA 3KLEA 3C6TA 2D0BA 3DOKA 4CJFA 2VWJA 3RR8A 1Z25A 4CEFA 4KI4A 3F9KA 1QSLA 1TL1A 4DMNA 3K57A 4FZYA 1J53A 4OKKA 1RDBA 2ZQBA 3AO1A 2HB5A 1VSHA 3HP6A 3KJVA 4DLEA 4DTJA 3OYJA 3DYAA 4AHUA 3LAMA 1KVCA 4DSKA 1U48A 2PZSA 3DLBA 2YNIA 1C0TA 1HQEA 1SUQA 3P5JA 3ZT3A 3K59A 1L3TA 1WNSA 2YHAA 3MEEA 3HVRA 1ASUA 3LDSA 4W5RA 4NCBA 3ZSRA 2OA8A 1TK5A 3QNNA 4CF8A 3AVLA 4O0IA 1RBRA 2X78A 3PX4A 2O4GA 1LAWA 3DI6A 4ELTA 3JYTA 2OPRA 4CK2A 1S1TA 4NYNA 3VA0A 3AVIA 4DTOA 3VQ5A 4CHZA 3DOLA 4W5OA 4DF4A 3TAEA 3HM9A 3QEPA 4CFCA 3V9WA 4LD0A 3QEVA 3QIOA 4H8KA 1BHLA 1Q8IA 3NF6A 3NCIA 1SL1A 2WONA 3K5NA 4AHSA 4CGIA 3DRPA 4NCGA 3K5LA 3SZ2A 2ZE2A 4KHYA 4Z4FA 1GOAA 2KZMA 4JLHA 4IG3A 4CJVA 3QO9A 4B9SA 4O44A 2D5RA 4HCCA 3T19A 1VSMA 4KTQA 1C0MA 4CK3A 1ZBHA 3LZIA 1IKWA 1RNHA 4IFYA 3V81A 1U04A 1JLCA 3IRXA 4RW6A 4BE2A 3RRHA 4DTMA 3TI0A 3B6PA 3DLGA 4IFVA 4YFUA 4FLWA 4Z4GA 4FLTA 4CJ3A 4E89A 3SCXA 4CFDA 3SQ4A 3TR8A 2ITGA 4CCHA 2QK9A 1EP4A 3ASMA 1KCFA 4OJRA 3SV3A 3SI6A 4HCBA 2E6LA 1BCMA 4DWIA 3OYFA 3LWMA 3WNGA 2Y1IA 3K58A 3SUNA 2PYLA 4M3TA 4BDZA 1EETA 3ZSZA 1QE1A 4E1NA 3HPOA 4DU4A 4DSEA 4DTSA 3V6DA 1C1CA 3RWUA 1D9DA 1BCOA 2IDOA 3K2PA 2OPPA 3OYNA 2GUIA 2BGGA 3G10A 1J9AA 2W42A 1UAXA 3P1GA 3S9HA 4EP5A 3AA2A 4FJ7A 4J2AA 5J1EA 1IKXA 1QTMA 5SWMA 4DQSA 4CIFA 2GBZA 3V9UA 3CFOA 1A5WA 1RTJA 1JL2A 4BWMA 4OPJA 4E7KA 1U4BA 3KIOA 1HNIA 1XHXA 4B08A 1NKBA 2PY5A 5FDLA 3ISNC 3ZSQA 3RTVA 3ZSOA 4W5TA 2DFHA 3SUOA 1J5OA 4E3SA 4DQPA 2OZSA 1W0HA 3AVNA 4DTRA 2IOCA 3AVJA 1VSFA 1QQCA 5KI6A 4W5QA 2Z1GA 4DTXA 2A1SA 4DFPA 1T03A 4M3YA 4KFBA 5JS1A 2O4IA 1WSHA 1CXQA 5I42A 3OJSA 1U47A 3OS1A 2ATQA 4FW2A 4LY7A 2XY7A 4RG8A 3QLHA 4DTUA 3L2VA 1QSYA 4LSNA 4OGCA 1WAJA 2DFFA 4FLXA 2OPSA 5CZ1A 1LWCA 3ZT1A 1S1UA 4CE9A 1UA0A 2QKKA 1FXXA 1TKDA 2KTQA 4CEOA 3UIQA 1RT7A 1RT6A 3QERA 2IS3A 3VQ4A 2X6NA 3V9ZA 2FBYA 1C6VA 3TWHA 3AVAA 4B9LA 2D0CA 4CHYA 1TKXA 1RTDA 4CJ5A 2G8VA 2PYJA 4FJKA 4CEQA 4OLBA 1CZ9A 3VQPA 4CHNA 3HT3A 3KK2A 3E01A 1EKEA 4CGHA 2ETJA 4FJNA 3M8QA 1RTIA 1F21A 5HBMA 3M8RA 3OYBA 1NK8A 4I9QA 4ZHRA 3F73A 2R7YA 4NYFA 4BDYA 4BE1A 4KV8A 2HHQA 1WSFA 2P51A 4ICLA 3ZT2A 2KW4A 3ZT4A 3KTQA 3PO5A 1IKYA 1FKPA 1RT2A 3P83D 4CF0A 3MAQA 5I3UA 5E41A 1A5XA 1NK9A 2E6MA 4HHTA 3DMJA 4CIGA 5C25A 3LP0A 2WOMA 1TKTA 4E0DA 4EZ6A 1KVBA 4CJUA 4FK0A 2HHTA 4B9MA 5HRPA 1HYZA 4RW4A 1MU2A 1VSEA 2D0AA 4LH4A 2YNHA 2XHBA 4FXDA 1NJZA 1Z26A 4JRPA 4F3OA 4QCLA 2X6SA 2HHUA 3PO4A 4M3UA 1JL1A 3AVBA 2HHSA 2HHWA 1VK0A 4DTPA 3MXJA 4CJPA 2Z1HA 5SZTA 5T7BA 1ZBUA 4FJMA 4PQUA 4CHPA 3TARA 5HRSA 1HYSA 1UWBA 3MXIA 3S3NA 4TSXA 2I5JA 3DLEA 2BANA 3ZSYA 4CFAA 3MECA 4CJLA 3OYCA 3ZT0A 1XHZA 4B8CA 4CEBA 3OYKA 3PX0A 1SKSA 3KD1E 4H4MA 4FZXC 3K5OA 2HHVA 3FFIA 2YKMA 1QS4A 2VG6A 2QKBA 3TAFA 4FJLA 4F8RA 3L3UA 1KFDA 3OYAA 3L2QA 1BL3A 3AO4A 1YVUA 1B9FA 1BI4A 1SL0A 4EZ9A 2YHBA 3QETA 4FLZA 1KTQA 1G15A 3C6UA 2HHXA 4GMJB 3QEXA 1JLFA 1NK7A 1JLBA 3NF8A 2G8WA 4BWJA 3LALA 4KI6A 3DM2A 3OYIA 4CIEA 2YNGA 3KLHA 1IO2A 3KKSA 5K14A 3NGYA 2P5GA 1D5AA 3DRSA 1TAUA 3CYMA 1JXBA 1S1XA 3A2FA 3AVCA 2BDPA 5FRNA 1X9WA 3ITHA 4LSLA 3KK3A 3RMAA 2P1JA 1UOCA 2HNDA 3O3HA 4HTUA 4DSIA 1KVAA 4DQRA 1S1VA 3KLFA 4OLAA 2F8SA 3SQ1A 5J2QA 1WLJA 1NJXA 1LW2A 3S3OA 3NGIA 1Q9XA 1IKVA 2G8FA 4JS5A 4PUOA 1WN7A 1X1PA 3NFAA 4AHRA 3C95A 4AHTA 4B9VA 1NK5A 1RBUA 3L8BA 4FM1A 2X74A 3OVNA 3RMCA 1KSPA 1HQUA 4FJXA 1NOZA 4KTWA 3RR7A 4FLVA 2Y1JA 4IDKA 4BACA 4E7IA 1GOCA 5KGWA 3KKRA 1BIUA 3BGRA 4KHSA 3O4QA 4DQIA 3OYLA 3WNHA 2QXFA 3MEDA 2KZZA 4CJSA 4FK4A 1YT3A 3O3FA 1RILA 3SYZA 3HXMA 1J54A 4AHVA 5CZ2A 2OYQA 4C8KA 2HVHA 1A5VA 4FJJA 3L2RA 2F96A 3TAGA 1R0AA 2YV0X 1NKCA 1JXEA 1LWEA 4CESA 4M3XA 1KLNA 1S1WA 3HO1A 3EZ5A 4O4GA 1YTAA 4O5BA 3VQDA 3I0SA 3V1RA 3L2UA 4KHUA 4B3OA 3NH0A 4IG0A 1HMVA 1S6PA 1VSLA 1B92A 4Z0UA 2RPIA 3QINA 4CFBA 4YNQA 3CFRA 1XC9A 1WSEA 1X9MA 4W5NA 3SUPA 3LWLA 1BGXT 3U3GA 2HNZA 2RN2A 4FJHA 1BQMA 4C8LA 4FJ9A 1BQNA 3AVFA 2XO7A 1NK0A 4KAZA 4RW9A 4IKFA 4OGEA 3ULDA 4DU1A 4KB0A 1VSIA 5DMRA 3NDKA 2HVIA 2DTUA 4LH5A 4CECA 4E19A 3CFPA 1HYVA 4G1QA 4CJQA 1L3UA 1HPZA 4CEEA 3AVGA 1B9DA 3VQ9A 4DLGA 2IGIA 2E4LA 1DLOA 2XRIA 4DTNA 1NOYA 1TV6A 3IAYA 4F4KA 4CJTA 3VQQA 3HYFA 4CK1A 3PX6A 4RW8A 4M45A 4ZTFA 3WNFA 2P5OA 3SPYA 4CEZA 2XY8A 3V9SA 3V4IA 3U6FA 3V1OA 3JSMA 4F2RA 3HL8A 3ZSXA 2EX3A 2KQ2A 4M42A 2YKNA 1HRHA 1RBSA 4ID1A 3LP3A 1XI1A 3PY8A 4CJ4A 1S6QA 3LANA 4C8OA 3SNNA 1TK0A 3HJFA 4FJ5A 2A1RA 4M3RA 3ZSWA 1U49A 4DSLA 1CZBA 4R5PA 4K8XA 4OPKA 3D0PA 4B9NA 4CEAA 4J2EA 2F8TA 1TKZA 5CY4A 1S5JA 2Z1IA 1ZBLA 4DS4A 4FZZA 3NF9A 2FBVA 4QAGA 1RT5A 1ZYQA 4N56A 4FJGA 5FRMA 4Q0BA 4KPYA 2DY4A 5KTQA 4M41A 2JGUA 4B9UA 1S9GA 4CGDA 4KKOA 4E1MA 3QEIA 1LW0A 1VRTA 3I0RA 4O0JA 1EXQA 1ITGA 4HUGA 3NH1A 4F2SA 2IAJA 5DK5A 4FLUA 3T1AA 3O4NA 4JS4A 1T8EA 1NKEA 1NJYA 5J2MA 5KRSA 2VWKA 4FVMA 4ELUA 1KLMA 4KREA 2VG5A 1JLQA 2HNYA 5HRRA 4DFJA 2B4JA 4IBNA 2XY5A 1S9EA 3L2WA 3NGZA 3SQ0A 3MEGA 3RMBA 3DLKA 4C8NA 1BI4B 3AO5A 4OKJA 2G8UA 3H08A 1I3AA 3NBPA 2HW3A 3RRGA 3NE6A 4GW6A 3DLRA 4XIUA 2IC3A 1EX4A 4CJRA 3KLGA 1RDAA 2EHGA 1HJRA 3AO2A 3CM6A 5CYQA 3VN5A 1KFSA 1HNVA 4DSFA 1QSSA 4N76A 4FYDA 3HVTA 4KHQA 4I9LA 4PA1A 4KO0A 1DTQA 3ALYA 1N6QA 2G8HA 3SUQA 1T05A 2HMIA 2BE2A 1TL3A 4H4OA 3AO3A 3M8PA 2AJQA 1BIZA 1K6YA 3VQCA 4CJEA 1JKHA 1CXUA 4CERA 4B8AB 3K5MA 4HUEA 1RT3A 2VG7A 3U3YA 3PV8A 3VQ7A 2B6AA 4CHOA 3CQ8A 3EYZA 3V1QA 1Y97A 4O55A 3LPUA 4FW1A 4AH9A 3OS0A 3AA4A 1N5YA 2RF2A 1DTTA 5FROA 4GVMA 4FCYA 4UQGA 1VSJA 2DFEA 4N5SA 5HLFA 1Q9YA 4CJWA 1RT1A 3OY9A 1ASVA 1LAVA 3ZSVA 1RDDA 4OVLA 1NK4A 3HSTB 1GOBA 3MXMA 5EU7A 1JLGA 3LZJA 4HUFA 3HK2A 4DQQA 2LSNA 2KFNA 1ZBIA 1JLEA 4Z4HA 4BE0A 4M3WA 3OS2A 3L3VA 1C1AA 1C0UA 4CEDA 2NUBA 5HROA 4NCAA 4EP4A 1ZBFA 2FBTA 3IS9A 1RCHA 3HP9A 4B9TA 1FK9A 3KD5E 3QIPA 4PWDA 3VQBA 4KHWA 1SKRA 4Z4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTU A;  3OYE A;  4FM2 A;  3TAQ A;  4FJI A;  3LP1 A;  3TAN A;  4DS5 A;  1FKO A;  1RTH A;  3VQE A;  4AIL C;  1D8Y A;  4F3T A;  1C1B A;  3OYG A;  4KB1 A;  3LPT A;  2YNF A;  3AVK A;  1JLA A;  3LAK A;  4KHN A;  3B6O A;  2OZM A;  3ZCM A;  4HVJ A;  3NHG A;  1L3S A;  4MQ3 A;  1BIS A;  5J2P A;  1TAQ A;  3CM5 A;  2Q3S A;  4J2D A;  4QOZ B;  5HP1 A;  3TAM A;  3TAB A;  3SJJ A;  4WE1 A;  3TAP A;  3DRR A;  4DU3 A;  1X9S A;  4Y1D A;  3WNE A;  4CGJ A;  3S3M A;  4DFM A;  5J2N A;  4E7J A;  2JLE A;  3VA3 A;  1IG9 A;  4CF1 A;  3SQ2 A;  4ID5 A;  3NAE A;  3HPG A;  1I39 A;  1TGO A;  5KGX A;  4Y1C A;  4DFK A;  1RDC A;  1L5U A;  5C24 A;  4BDP A;  3SV4 A;  4K8Z A;  1W9H A;  4DSJ A;  1QHT A;  3CG7 A;  4MFB A;  1SKW A;  4L8R B;  1NK6 A;  2Z1J A;  3PUF A;  1VSK A;  4I2Q A;  4AHC A;  5HRN A;  3AVH A;  4FM0 A;  1O1W A;  4E7L A;  3OYD A;  2KFZ A;  4C8M A;  4DF8 A;  5JS2 A;  2B5J A;  3D45 A;  4DG1 A;  1ASW A;  4KTZ A;  5CYM A;  5KRT A;  3EY1 A;  3QNO A;  3VQ6 A;  2RKI A;  3NH2 A;  1WSJ A;  3OYH A;  1RBV A;  2OPQ A;  4JRQ A;  3QES A;  3QEW A;  1REV A;  3M8S A;  4I7F A;  4Z4C A;  1WSG A;  1T7P A;  1VRU A;  1L3V A;  4N41 A;  3BDP A;  2GV9 A;  4J2B A;  3VQ8 A;  1SL2 A;  4CF9 A;  3OYM A;  3AVM A;  3SPZ A;  1IH7 A;  1UA1 A;  3IG1 A;  4E7H A;  3NF7 A;  1D9F A;  4FLY A;  4M3Z A;  3LP2 A;  4FK2 A;  4N47 A;  3HPH A;  4Q5V A;  3O3G A;  1VSD A;  4I2P A;  4ELV A;  4OKE A;  1TVR A;  3AA3 A;  3RMD A;  2ZD1 A;  3KLI A;  5C42 A;  1RT4 A;  1NJW A;  1WSI A;  2G8K A;  2FBX A;  4ZTJ A;  3C94 A;  3AA5 X;  4KRF A;  3THV A;  4FJ8 A;  4RW7 A;  1RBT A;  1XWL A;  1SV5 A;  3I8D A;  4CF2 A;  2XY6 A;  4Z4E A;  2G8I A;  5D3G A;  3KK1 A;  3VQA A;  3T3F A;  1U45 A;  1WAF A;  4CHQ A;  1LV5 A;  1KRP A;  4CGG A;  3G0Z A;  3DLH A;  1LWF A;  4CGF A;  2FC0 A;  3AV9 A;  4CJK A;  4PY5 A;  3OJU A;  1TK8 A;  1CLQ A;  3V9X A;  3KLE A;  3C6T A;  2D0B A;  3DOK A;  4CJF A;  2VWJ A;  3RR8 A;  1Z25 A;  4CEF A;  4KI4 A;  3F9K A;  1QSL A;  1TL1 A;  4DMN A;  3K57 A;  4FZY A;  1J53 A;  4OKK A;  1RDB A;  2ZQB A;  3AO1 A;  2HB5 A;  1VSH A;  3HP6 A;  3KJV A;  4DLE A;  4DTJ A;  3OYJ A;  3DYA A;  4AHU A;  3LAM A;  1KVC A;  4DSK A;  1U48 A;  2PZS A;  3DLB A;  2YNI A;  1C0T A;  1HQE A;  1SUQ A;  3P5J A;  3ZT3 A;  3K59 A;  1L3T A;  1WNS A;  2YHA A;  3MEE A;  3HVR A;  1ASU A;  3LDS A;  4W5R A;  4NCB A;  3ZSR A;  2OA8 A;  1TK5 A;  3QNN A;  4CF8 A;  3AVL A;  4O0I A;  1RBR A;  2X78 A;  3PX4 A;  2O4G A;  1LAW A;  3DI6 A;  4ELT A;  3JYT A;  2OPR A;  4CK2 A;  1S1T A;  4NYN A;  3VA0 A;  3AVI A;  4DTO A;  3VQ5 A;  4CHZ A;  3DOL A;  4W5O A;  4DF4 A;  3TAE A;  3HM9 A;  3QEP A;  4CFC A;  3V9W A;  4LD0 A;  3QEV A;  3QIO A;  4H8K A;  1BHL A;  1Q8I A;  3NF6 A;  3NCI A;  1SL1 A;  2WON A;  3K5N A;  4AHS A;  4CGI A;  3DRP A;  4NCG A;  3K5L A;  3SZ2 A;  2ZE2 A;  4KHY A;  4Z4F A;  1GOA A;  2KZM A;  4JLH A;  4IG3 A;  4CJV A;  3QO9 A;  4B9S A;  4O44 A;  2D5R A;  4HCC A;  3T19 A;  1VSM A;  4KTQ A;  1C0M A;  4CK3 A;  1ZBH A;  3LZI A;  1IKW A;  1RNH A;  4IFY A;  3V81 A;  1U04 A;  1JLC A;  3IRX A;  4RW6 A;  4BE2 A;  3RRH A;  4DTM A;  3TI0 A;  3B6P A;  3DLG A;  4IFV A;  4YFU A;  4FLW A;  4Z4G A;  4FLT A;  4CJ3 A;  4E89 A;  3SCX A;  4CFD A;  3SQ4 A;  3TR8 A;  2ITG A;  4CCH A;  2QK9 A;  1EP4 A;  3ASM A;  1KCF A;  4OJR A;  3SV3 A;  3SI6 A;  4HCB A;  2E6L A;  1BCM A;  4DWI A;  3OYF A;  3LWM A;  3WNG A;  2Y1I A;  3K58 A;  3SUN A;  2PYL A;  4M3T A;  4BDZ A;  1EET A;  3ZSZ A;  1QE1 A;  4E1N A;  3HPO A;  4DU4 A;  4DSE A;  4DTS A;  3V6D A;  1C1C A;  3RWU A;  1D9D A;  1BCO A;  2IDO A;  3K2P A;  2OPP A;  3OYN A;  2GUI A;  2BGG A;  3G10 A;  1J9A A;  2W42 A;  1UAX A;  3P1G A;  3S9H A;  4EP5 A;  3AA2 A;  4FJ7 A;  4J2A A;  5J1E A;  1IKX A;  1QTM A;  5SWM A;  4DQS A;  4CIF A;  2GBZ A;  3V9U A;  3CFO A;  1A5W A;  1RTJ A;  1JL2 A;  4BWM A;  4OPJ A;  4E7K A;  1U4B A;  3KIO A;  1HNI A;  1XHX A;  4B08 A;  1NKB A;  2PY5 A;  5FDL A;  3ISN C;  3ZSQ A;  3RTV A;  3ZSO A;  4W5T A;  2DFH A;  3SUO A;  1J5O A;  4E3S A;  4DQP A;  2OZS A;  1W0H A;  3AVN A;  4DTR A;  2IOC A;  3AVJ A;  1VSF A;  1QQC A;  5KI6 A;  4W5Q A;  2Z1G A;  4DTX A;  2A1S A;  4DFP A;  1T03 A;  4M3Y A;  4KFB A;  5JS1 A;  2O4I A;  1WSH A;  1CXQ A;  5I42 A;  3OJS A;  1U47 A;  3OS1 A;  2ATQ A;  4FW2 A;  4LY7 A;  2XY7 A;  4RG8 A;  3QLH A;  4DTU A;  3L2V A;  1QSY A;  4LSN A;  4OGC A;  1WAJ A;  2DFF A;  4FLX A;  2OPS A;  5CZ1 A;  1LWC A;  3ZT1 A;  1S1U A;  4CE9 A;  1UA0 A;  2QKK A;  1FXX A;  1TKD A;  2KTQ A;  4CEO A;  3UIQ A;  1RT7 A;  1RT6 A;  3QER A;  2IS3 A;  3VQ4 A;  2X6N A;  3V9Z A;  2FBY A;  1C6V A;  3TWH A;  3AVA A;  4B9L A;  2D0C A;  4CHY A;  1TKX A;  1RTD A;  4CJ5 A;  2G8V A;  2PYJ A;  4FJK A;  4CEQ A;  4OLB A;  1CZ9 A;  3VQP A;  4CHN A;  3HT3 A;  3KK2 A;  3E01 A;  1EKE A;  4CGH A;  2ETJ A;  4FJN A;  3M8Q A;  1RTI A;  1F21 A;  5HBM A;  3M8R A;  3OYB A;  1NK8 A;  4I9Q A;  4ZHR A;  3F73 A;  2R7Y A;  4NYF A;  4BDY A;  4BE1 A;  4KV8 A;  2HHQ A;  1WSF A;  2P51 A;  4ICL A;  3ZT2 A;  2KW4 A;  3ZT4 A;  3KTQ A;  3PO5 A;  1IKY A;  1FKP A;  1RT2 A;  3P83 D;  4CF0 A;  3MAQ A;  5I3U A;  5E41 A;  1A5X A;  1NK9 A;  2E6M A;  4HHT A;  3DMJ A;  4CIG A;  5C25 A;  3LP0 A;  2WOM A;  1TKT A;  4E0D A;  4EZ6 A;  1KVB A;  4CJU A;  4FK0 A;  2HHT A;  4B9M A;  5HRP A;  1HYZ A;  4RW4 A;  1MU2 A;  1VSE A;  2D0A A;  4LH4 A;  2YNH A;  2XHB A;  4FXD A;  1NJZ A;  1Z26 A;  4JRP A;  4F3O A;  4QCL A;  2X6S A;  2HHU A;  3PO4 A;  4M3U A;  1JL1 A;  3AVB A;  2HHS A;  2HHW A;  1VK0 A;  4DTP A;  3MXJ A;  4CJP A;  2Z1H A;  5SZT A;  5T7B A;  1ZBU A;  4FJM A;  4PQU A;  4CHP A;  3TAR A;  5HRS A;  1HYS A;  1UWB A;  3MXI A;  3S3N A;  4TSX A;  2I5J A;  3DLE A;  2BAN A;  3ZSY A;  4CFA A;  3MEC A;  4CJL A;  3OYC A;  3ZT0 A;  1XHZ A;  4B8C A;  4CEB A;  3OYK A;  3PX0 A;  1SKS A;  3KD1 E;  4H4M A;  4FZX C;  3K5O A;  2HHV A;  3FFI A;  2YKM A;  1QS4 A;  2VG6 A;  2QKB A;  3TAF A;  4FJL A;  4F8R A;  3L3U A;  1KFD A;  3OYA A;  3L2Q A;  1BL3 A;  3AO4 A;  1YVU A;  1B9F A;  1BI4 A;  1SL0 A;  4EZ9 A;  2YHB A;  3QET A;  4FLZ A;  1KTQ A;  1G15 A;  3C6U A;  2HHX A;  4GMJ B;  3QEX A;  1JLF A;  1NK7 A;  1JLB A;  3NF8 A;  2G8W A;  4BWJ A;  3LAL A;  4KI6 A;  3DM2 A;  3OYI A;  4CIE A;  2YNG A;  3KLH A;  1IO2 A;  3KKS A;  5K14 A;  3NGY A;  2P5G A;  1D5A A;  3DRS A;  1TAU A;  3CYM A;  1JXB A;  1S1X A;  3A2F A;  3AVC A;  2BDP A;  5FRN A;  1X9W A;  3ITH A;  4LSL A;  3KK3 A;  3RMA A;  2P1J A;  1UOC A;  2HND A;  3O3H A;  4HTU A;  4DSI A;  1KVA A;  4DQR A;  1S1V A;  3KLF A;  4OLA A;  2F8S A;  3SQ1 A;  5J2Q A;  1WLJ A;  1NJX A;  1LW2 A;  3S3O A;  3NGI A;  1Q9X A;  1IKV A;  2G8F A;  4JS5 A;  4PUO A;  1WN7 A;  1X1P A;  3NFA A;  4AHR A;  3C95 A;  4AHT A;  4B9V A;  1NK5 A;  1RBU A;  3L8B A;  4FM1 A;  2X74 A;  3OVN A;  3RMC A;  1KSP A;  1HQU A;  4FJX A;  1NOZ A;  4KTW A;  3RR7 A;  4FLV A;  2Y1J A;  4IDK A;  4BAC A;  4E7I A;  1GOC A;  5KGW A;  3KKR A;  1BIU A;  3BGR A;  4KHS A;  3O4Q A;  4DQI A;  3OYL A;  3WNH A;  2QXF A;  3MED A;  2KZZ A;  4CJS A;  4FK4 A;  1YT3 A;  3O3F A;  1RIL A;  3SYZ A;  3HXM A;  1J54 A;  4AHV A;  5CZ2 A;  2OYQ A;  4C8K A;  2HVH A;  1A5V A;  4FJJ A;  3L2R A;  2F96 A;  3TAG A;  1R0A A;  2YV0 X;  1NKC A;  1JXE A;  1LWE A;  4CES A;  4M3X A;  1KLN A;  1S1W A;  3HO1 A;  3EZ5 A;  4O4G A;  1YTA A;  4O5B A;  3VQD A;  3I0S A;  3V1R A;  3L2U A;  4KHU A;  4B3O A;  3NH0 A;  4IG0 A;  1HMV A;  1S6P A;  1VSL A;  1B92 A;  4Z0U A;  2RPI A;  3QIN A;  4CFB A;  4YNQ A;  3CFR A;  1XC9 A;  1WSE A;  1X9M A;  4W5N A;  3SUP A;  3LWL A;  1BGX T;  3U3G A;  2HNZ A;  2RN2 A;  4FJH A;  1BQM A;  4C8L A;  4FJ9 A;  1BQN A;  3AVF A;  2XO7 A;  1NK0 A;  4KAZ A;  4RW9 A;  4IKF A;  4OGE A;  3ULD A;  4DU1 A;  4KB0 A;  1VSI A;  5DMR A;  3NDK A;  2HVI A;  2DTU A;  4LH5 A;  4CEC A;  4E19 A;  3CFP A;  1HYV A;  4G1Q A;  4CJQ A;  1L3U A;  1HPZ A;  4CEE A;  3AVG A;  1B9D A;  3VQ9 A;  4DLG A;  2IGI A;  2E4L A;  1DLO A;  2XRI A;  4DTN A;  1NOY A;  1TV6 A;  3IAY A;  4F4K A;  4CJT A;  3VQQ A;  3HYF A;  4CK1 A;  3PX6 A;  4RW8 A;  4M45 A;  4ZTF A;  3WNF A;  2P5O A;  3SPY A;  4CEZ A;  2XY8 A;  3V9S A;  3V4I A;  3U6F A;  3V1O A;  3JSM A;  4F2R A;  3HL8 A;  3ZSX A;  2EX3 A;  2KQ2 A;  4M42 A;  2YKN A;  1HRH A;  1RBS A;  4ID1 A;  3LP3 A;  1XI1 A;  3PY8 A;  4CJ4 A;  1S6Q A;  3LAN A;  4C8O A;  3SNN A;  1TK0 A;  3HJF A;  4FJ5 A;  2A1R A;  4M3R A;  3ZSW A;  1U49 A;  4DSL A;  1CZB A;  4R5P A;  4K8X A;  4OPK A;  3D0P A;  4B9N A;  4CEA A;  4J2E A;  2F8T A;  1TKZ A;  5CY4 A;  1S5J A;  2Z1I A;  1ZBL A;  4DS4 A;  4FZZ A;  3NF9 A;  2FBV A;  4QAG A;  1RT5 A;  1ZYQ A;  4N56 A;  4FJG A;  5FRM A;  4Q0B A;  4KPY A;  2DY4 A;  5KTQ A;  4M41 A;  2JGU A;  4B9U A;  1S9G A;  4CGD A;  4KKO A;  4E1M A;  3QEI A;  1LW0 A;  1VRT A;  3I0R A;  4O0J A;  1EXQ A;  1ITG A;  4HUG A;  3NH1 A;  4F2S A;  2IAJ A;  5DK5 A;  4FLU A;  3T1A A;  3O4N A;  4JS4 A;  1T8E A;  1NKE A;  1NJY A;  5J2M A;  5KRS A;  2VWK A;  4FVM A;  4ELU A;  1KLM A;  4KRE A;  2VG5 A;  1JLQ A;  2HNY A;  5HRR A;  4DFJ A;  2B4J A;  4IBN A;  2XY5 A;  1S9E A;  3L2W A;  3NGZ A;  3SQ0 A;  3MEG A;  3RMB A;  3DLK A;  4C8N A;  1BI4 B;  3AO5 A;  4OKJ A;  2G8U A;  3H08 A;  1I3A A;  3NBP A;  2HW3 A;  3RRG A;  3NE6 A;  4GW6 A;  3DLR A;  4XIU A;  2IC3 A;  1EX4 A;  4CJR A;  3KLG A;  1RDA A;  2EHG A;  1HJR A;  3AO2 A;  3CM6 A;  5CYQ A;  3VN5 A;  1KFS A;  1HNV A;  4DSF A;  1QSS A;  4N76 A;  4FYD A;  3HVT A;  4KHQ A;  4I9L A;  4PA1 A;  4KO0 A;  1DTQ A;  3ALY A;  1N6Q A;  2G8H A;  3SUQ A;  1T05 A;  2HMI A;  2BE2 A;  1TL3 A;  4H4O A;  3AO3 A;  3M8P A;  2AJQ A;  1BIZ A;  1K6Y A;  3VQC A;  4CJE A;  1JKH A;  1CXU A;  4CER A;  4B8A B;  3K5M A;  4HUE A;  1RT3 A;  2VG7 A;  3U3Y A;  3PV8 A;  3VQ7 A;  2B6A A;  4CHO A;  3CQ8 A;  3EYZ A;  3V1Q A;  1Y97 A;  4O55 A;  3LPU A;  4FW1 A;  4AH9 A;  3OS0 A;  3AA4 A;  1N5Y A;  2RF2 A;  1DTT A;  5FRO A;  4GVM A;  4FCY A;  4UQG A;  1VSJ A;  2DFE A;  4N5S A;  5HLF A;  1Q9Y A;  4CJW A;  1RT1 A;  3OY9 A;  1ASV A;  1LAV A;  3ZSV A;  1RDD A;  4OVL A;  1NK4 A;  3HST B;  1GOB A;  3MXM A;  5EU7 A;  1JLG A;  3LZJ A;  4HUF A;  3HK2 A;  4DQQ A;  2LSN A;  2KFN A;  1ZBI A;  1JLE A;  4Z4H A;  4BE0 A;  4M3W A;  3OS2 A;  3L3V A;  1C1A A;  1C0U A;  4CED A;  2NUB A;  5HRO A;  4NCA A;  4EP4 A;  1ZBF A;  2FBT A;  3IS9 A;  1RCH A;  3HP9 A;  4B9T A;  1FK9 A;  3KD5 E;  3QIP A;  4PWD A;  3VQB A;  4KHW A;  1SKR A;  4Z4I A; 
#chains in the Genus database with same CATH topology
 4DS5 A;  1FKO A;  1RTH A;  1QQM A;  1W2B M;  5EOY A;  2D1K A;  1C1B A;  3SAF A;  3B6O A;  4HVJ A;  3NHG A;  3VF2 A;  4MQ3 A;  3CM5 A;  2Q3S A;  4J2D A;  5LMN K;  5HP1 A;  4BVP A;  1RDW X;  5C0Y A;  2QWN A;  2IVP A;  3CCU N;  1K73 O;  3LDL A;  3QBX A;  5J2N A;  4CF1 A;  3SQ2 A;  3NAE A;  3FE1 A;  1TGO A;  3T69 A;  2CGK A;  1L5U A;  4K8Z A;  1RDU A;  4MFB A;  2Z1J A;  4OO1 J;  1VSK A;  4AHC A;  3VGM A;  5CE3 A;  3CCS N;  4E7L A;  2KFZ A;  5JS2 A;  2B5J A;  5M1Q A;  4JKA A;  1L3T A;  3NH2 A;  2RKI A;  1BA0 A;  3QEW A;  3EO3 A;  2NRH A;  4I7F A;  3M8S A;  5BPL A;  1GLL O;  3CPW M;  1L3V A;  3BUZ B;  3SAG A;  4GVE A;  4A2B A;  4CBU A;  4E1J A;  1SL2 A;  4J2B A;  3ZET A;  3OYM A;  1R59 O;  3IG1 A;  4YOV A;  4BRO A;  3WXJ A;  5AFU H;  2OAN A;  1TUY A;  4BR2 A;  3AA3 A;  4ISF A;  3KLI A;  5C42 A;  1XNQ K;  4O8U A;  3E9O A;  1NJW A;  4ZTJ A;  4FJ8 A;  3I8B A;  1RBT A;  1SV5 A;  2P9N A;  4CF2 A;  4Z4E A;  2G8I A;  5D3G A;  3CQX A;  3VQA A;  4DHY A;  5HOO A;  3G0Z A;  5AFU A;  3U9D A;  3SMP A;  1TK8 A;  3KLE A;  3GL1 A;  2E2P A;  1VQM N;  2NRR A;  1Z25 A;  4KI4 A;  3F9K A;  4NB4 A;  2BUP A;  3K57 A;  3C7N A;  1I94 K;  2RE2 A;  1RDB A;  5DM6 L;  2HB5 A;  4JD2 A;  3O9T A;  3OYJ A;  1LCU A;  1NU0 A;  5BR9 A;  3IUC A;  5AJ3 K;  3ZT3 A;  3O8M A;  1FW6 A;  4JK8 A;  1QZ5 A;  3U4L A;  1TK5 A;  3QNN A;  1S72 N;  3JYT A;  1S1T A;  4IJN A;  1P90 A;  3TAE A;  5AQH A;  3V9W A;  1YJW N;  5M1K A;  3QEV A;  4H8K A;  1DEJ A;  1BOT O;  4IG3 A;  4CJV A;  4O44 A;  2D5R A;  3A5N C;  1IKW A;  3IRX A;  5AQL A;  2HBM A;  4CFD A;  1KCF A;  3SV3 A;  1TYQ A;  3R8E A;  4UY8 O;  4X62 K;  5AQO A;  5GIN A;  4AQY K;  4BDZ A;  1EET A;  1J6Z A;  3V6D A;  1BCO A;  2HF4 A;  3K2P A;  3OYN A;  2GUI A;  3G10 A;  2QW9 A;  2W42 A;  3TSU A;  1YI2 N;  5I9E B;  4EP5 A;  1O13 A;  3FZM A;  5J1E A;  1IKX A;  5SWM A;  4CIF A;  1A5W A;  1JL2 A;  4H0O A;  1U4B A;  3C6A A;  3KIO A;  1XHX A;  2PY5 A;  1J5O A;  3ZSO A;  4W5T A;  5IWA K;  2IOC A;  2Z1G A;  4DFP A;  5JS1 A;  1WSH A;  1CXQ A;  3GOI A;  2ATQ A;  4A59 A;  4FW2 A;  4QS8 A;  2P9S B;  5TKY A;  5F0X A;  3L2V A;  4LSN A;  4OGC A;  3S41 A;  1WAJ A;  2OPS A;  4CE9 A;  1TKD A;  1NMD A;  3UIQ A;  2ZJP L;  2D0C A;  4FJK A;  3HOS A;  4CEQ A;  4LF6 K;  1CZ9 A;  1MDU B;  3VGL A;  3E01 A;  4XH5 A;  1ZC6 A;  2HHH K;  3MN9 A;  2HHQ A;  4ICL A;  2P51 A;  2CGL A;  2KW4 A;  1IKY A;  1FKP A;  3KWG A;  5I3U A;  1KQS M;  3MAQ A;  1A5X A;  3CJ1 A;  4HHT A;  3EN9 A;  4CIG A;  3LP0 A;  5C25 A;  1TKT A;  5AQN A;  4E0D A;  4WQ4 A;  4FPA A;  2GUP A;  1MU2 A;  2XHB A;  2V7Z A;  1JCG A;  3EKS A;  1Z26 A;  4BRQ A;  1HKB A;  4PL8 A;  1NJZ A;  4QCL A;  2Q0U A;  2E2N A;  3PO4 A;  2VGM A;  3CCE N;  4DTP A;  4CJP A;  5T7B A;  3CF5 L;  4IDH A;  3TAR A;  5HRS A;  1UWB A;  3S3N A;  4H0P A;  4CJL A;  3MEC A;  2YKM A;  1QS4 A;  2VG6 A;  2QKB A;  4XEI A;  3L2Q A;  1VQ4 N;  3AO4 A;  3EE8 A;  2V51 B;  4DUY K;  1KTQ A;  4FVU A;  3C6U A;  2HHX A;  2QWR A;  4GMJ B;  3QEX A;  2G8W A;  2ITM A;  3LAL A;  4MLE A;  4KI6 A;  4XH4 A;  4PL7 A;  3DRS A;  4LF8 K;  1JXB A;  3A2F A;  1OH8 A;  1X9W A;  1C0G A;  3DWL A;  1UOC A;  4HTU A;  2O8E A;  2HF3 A;  1NJX A;  1LW2 A;  3S3O A;  3NGI A;  2Q97 A;  4BRE A;  4PUO A;  1WN7 A;  3C95 A;  2ZGZ A;  2HBL A;  1WBB A;  4FJX A;  4BQL A;  3F9M A;  2P9K A;  3TTC A;  3O4Q A;  3IMX A;  2JWK A;  3PLA A;  3O3F A;  1EO1 A;  3HXM A;  4FWS A;  4AHV A;  4BC3 A;  1YIJ N;  1A5V A;  3VEY A;  4FJJ A;  3L2R A;  1OVY A;  3TAG A;  4RTF D;  2YV0 X;  1NKC A;  4CES A;  4M3X A;  3EZ5 A;  1NGJ A;  3V1R A;  3L2U A;  3THX A;  4B3O A;  4IG0 A;  4FWQ A;  1B92 A;  4JKG A;  3QIN A;  4Z0U A;  3WEE B;  3CFR A;  3SUP A;  2ZGY A;  3G4S N;  1QZ6 A;  2HNZ A;  4FJH A;  1BQM A;  1BQN A;  3AVF A;  2XO7 A;  3ULD A;  1VHX A;  1VSI A;  3NDK A;  4E19 A;  4G1Q A;  4CJQ A;  4YOT A;  2VCP A;  3AVG A;  5H1S Q;  1B9D A;  2IGI A;  1DLO A;  2XRI A;  1NOY A;  5KPT A;  3IAY A;  3P38 A;  4GKJ K;  4JKB A;  3WNF A;  2P5O A;  2QA4 N;  2GEL A;  4CEZ A;  4U7B A;  3V9S A;  1HUX A;  4F2R A;  3C6H A;  2KQ2 A;  1HRH A;  1RBS A;  1XI1 A;  3LP3 A;  4KB1 A;  1K9M O;  2PBD A;  3QFU A;  2UXC K;  4FPB A;  4DV4 K;  4DS4 A;  4FZZ A;  2DY4 A;  3CCJ N;  5FPM A;  4B1Y B;  2W6L A;  2JGU A;  1GLF O;  4CZL A;  4B9U A;  1DGK N;  1S9G A;  4E1M A;  4O0J A;  1ITG A;  4IJA A;  3NH1 A;  4F2S A;  1KAY A;  3QBW A;  1NKE A;  1NJY A;  1KLM A;  5TKW A;  4GV9 A;  3CPE A;  3SQ0 A;  4AF1 A;  3C0B A;  3DLK A;  4JAX A;  1BI4 B;  3Q7C A;  2HW3 A;  4BG8 A;  3PSF A;  2FSN A;  3TTF A;  2IC3 A;  1OH6 A;  5CYQ A;  4OPH A;  5BN9 A;  3SJH A;  4I9L A;  4PA1 A;  4H4O A;  1EWQ A;  1BIZ A;  1K6Y A;  4CJE A;  1JKH A;  3K5M A;  3HSC A;  4HUE A;  3VF6 A;  3VQ7 A;  2VQE K;  1K8A O;  2P9U B;  3HM8 A;  3EYZ A;  3VEX A;  4AH9 A;  3A5O C;  3OS0 A;  1N5Y A;  4YOY A;  4N5S A;  5HLF A;  4CJW A;  1RT1 A;  2E8A A;  3RSE B;  3OY9 A;  1YJ9 N;  5BRD A;  3HST B;  5EU7 A;  1JLG A;  5FPN A;  4DQQ A;  2PAV A;  4DR6 K;  3ZX0 A;  4H5V A;  2Q0R A;  4M3W A;  1BWF O;  2W6K A;  3OS2 A;  3SMS A;  5HRO A;  4KHP K;  4EP4 A;  3IS9 A;  3KD5 E;  3M6G A;  1N34 K;  1KC8 O;  4DUZ K;  1NWK A;  3LP1 A;  1OH7 A;  3WQU A;  2D0O A;  3VQE A;  4AIL C;  2UU9 K;  1FJG K;  1HNW K;  2YHY A;  1ESV A;  3OYG A;  1C0F A;  3LDP A;  4O5F A;  1BIS A;  3OTO K;  3R1X A;  5AQV A;  3TAB A;  4WE1 A;  2O8F B;  4DU3 A;  1X9S A;  4Y1D A;  3MCA B;  4YDU C;  4YOW A;  2JLE A;  4E7J A;  1VAZ A;  3HPG A;  1I39 A;  2W40 A;  3MN7 A;  5C24 A;  4WFN L;  3T1H K;  4DSJ A;  4X66 K;  1S3X A;  1P8Z A;  3PUF A;  4K0K K;  5EVZ A;  5GIO A;  4C8M A;  2D4W A;  4DG1 A;  1ASW A;  1D4X A;  2ASO A;  4KTZ A;  4BRI A;  3QNO A;  3OYH A;  3QES A;  3H46 O;  2WBN A;  2ASP A;  3O08 A;  4KH6 A;  1T7P A;  1VRU A;  3H1V X;  3VQ8 A;  4CF9 A;  3D2E A;  3AVM A;  1IH7 A;  4E7H A;  3H3N O;  4FLY A;  5KQD A;  4BC2 A;  4DR5 K;  4FK2 A;  3THY A;  1VSD A;  4ELV A;  3RMD A;  2ZD1 A;  3O1B A;  5AQM A;  1W7A A;  2FBX A;  4CI6 A;  3CCV N;  4FWK A;  3O5B A;  3I8D A;  3AGR A;  5AQJ A;  1U45 A;  3DLH A;  4CGF A;  5JLF A;  1KAX A;  3AV9 A;  4PY5 A;  3OJU A;  3H3O B;  1CLQ A;  3OA9 A;  3C6T A;  3C7N B;  2WC9 A;  3TSQ A;  4BR0 A;  1QSL A;  2JWL A;  3AO1 A;  4DLE A;  5ADX A;  3HP6 A;  1DKG D;  3VEO A;  1BDG A;  3LAM A;  1KVC A;  5KPZ A;  4R79 A;  1U48 A;  3FFK B;  3T1Y K;  3DLB A;  1C0T A;  3BF1 A;  4B3M K;  3K59 A;  3CI5 A;  1WNS A;  2GEM A;  3EKU A;  2YHA A;  2GTD A;  3LDS A;  2OA8 A;  4JKC A;  3CJA A;  4CVN E;  3AVL A;  4B1Z A;  1RBR A;  2X78 A;  3PX4 A;  2O4G A;  4ELT A;  3MWT A;  4CK2 A;  2FF6 A;  4NYN A;  4H0Y B;  3BY5 A;  4XH1 A;  4CFC A;  4WF9 L;  4LD0 A;  3NF6 A;  4DR1 K;  4FWL A;  2WON A;  4AHS A;  4CGI A;  4KHY A;  4B9S A;  4HCC A;  2QXL A;  1VSM A;  1C0M A;  4CK3 A;  3HI0 A;  3TAN A;  3V81 A;  4IFY A;  1U04 A;  1JLC A;  3RRH A;  1YIT N;  4IFV A;  2I7N A;  4YFU A;  4FLW A;  4FLT A;  4Z4G A;  4CJ3 A;  3SCX A;  1EP4 A;  2HBJ A;  3ASM A;  3SI6 A;  2CH6 A;  1BCM A;  4BRL A;  5C12 A;  4DWI A;  2Y1I A;  3WNG A;  2UXD K;  3N4Q A;  4K42 A;  3UKR A;  3E1Y A;  4AM6 A;  4BRK A;  4E1N A;  4DU4 A;  4DTS A;  2F4V K;  4LF4 K;  3O6W A;  1D9D A;  4JI2 K;  3AAR A;  2P9I B;  4FJ7 A;  5AZI B;  2A41 A;  4FL9 A;  1T6C A;  1NM1 A;  1MWK A;  4BWM A;  1RTJ A;  1SQK A;  4OPJ A;  4DR7 K;  2HBK A;  1NKB A;  3ZSQ A;  1K8K B;  4DQP A;  4E3S A;  1YVN A;  4W5Q A;  4DTX A;  2A1S A;  4KFB A;  3T7Z A;  5I42 A;  3OJS A;  2V52 B;  4LY7 A;  2XY7 A;  2NLX A;  4CZE A;  1QSY A;  5AQX A;  4FO0 A;  5CZ1 A;  1LWC A;  3ZT1 A;  1S1U A;  1VQL N;  3DXM A;  4CEO A;  1RT7 A;  4JV5 K;  3VQ4 A;  1YF5 L;  3V9Z A;  1C6V A;  3AVA A;  4EIA A;  1RTD A;  5AQQ A;  1YXQ A;  2G8V A;  4LFB K;  4CHN A;  4A61 A;  2FF3 B;  3HT3 A;  2VWB A;  3SAH A;  3J81 O;  4IOA L;  2IVO A;  4JKD A;  1F21 A;  3M8R A;  3OYB A;  3VOV A;  1NK8 A;  5AQP A;  4I9Q A;  3QFP A;  4C1N K;  4ZHR A;  3QIC A;  4NYF A;  5LJW A;  2O8D B;  4FWM A;  3ZT2 A;  3J8A A;  1NK9 A;  2E6M A;  3QDK A;  4H03 B;  4FWO A;  4YOR A;  5HRP A;  1VSE A;  2NRZ A;  5IT9 O;  4FXD A;  4H0T B;  4QS9 A;  4JRP A;  3Q7B A;  5JVH L;  2X6S A;  2HHU A;  5AQS A;  4M3U A;  1JL1 A;  4ISE A;  3TTD A;  1VK0 A;  4PQU A;  4FJM A;  5SZT A;  1XQS C;  1ZBU A;  4CHP A;  3IKM A;  4O8K A;  5BRH A;  2I5J A;  4OPA A;  3DLE A;  2GWJ A;  5AQF A;  3KD1 E;  3K5O A;  1ILY A;  4F8R A;  4YY3 K;  3MWP A;  3OW2 M;  3GG4 A;  5FLX O;  1VQP N;  1SL0 A;  2YHB A;  4FLZ A;  3IFR A;  4HWI A;  3E66 A;  3LM9 A;  4IOC L;  3SLC A;  1SS6 A;  3DM2 A;  1U2V B;  2YNG A;  1IO2 A;  3KKS A;  3LDQ A;  5K14 A;  4JI1 K;  3A8Y A;  5FRN A;  4IXC A;  3CCL N;  2O8E B;  3HZ6 A;  1IJJ A;  1IG8 A;  4PKH A;  3TU5 A;  4A57 A;  4OLA A;  5J2Q A;  2HOE A;  5M1P A;  4GNI A;  2G8F A;  1X1P A;  4AHR A;  3MK6 A;  4B9V A;  1NK5 A;  1RBU A;  4KTW A;  3RR7 A;  1VQO N;  2Y1J A;  4IDK A;  2P9K B;  1GLB G;  1GOC A;  1OKJ A;  3BGR A;  4KHS A;  3MED A;  4FK4 A;  2P9P B;  1NNE A;  2E88 A;  5CZ2 A;  2F9T A;  4C8K A;  4QS7 A;  4BRA A;  1JXE A;  1LWE A;  4BGB A;  3CC2 N;  3THX B;  4BC5 A;  1S1W A;  4FWN A;  4O4G A;  4JKG B;  4U67 L;  4BC4 A;  4KHU A;  1S6P A;  4CFB A;  2RPI A;  1X9M A;  4A5B A;  1BGX T;  2RN2 A;  4FJ9 A;  4C8L A;  3BZK A;  1LOT B;  1NK0 A;  4KAZ A;  4EHT A;  4OGE A;  4KB0 A;  2HVI A;  2DTU A;  5C2D A;  1HYV A;  3CJ9 A;  4Z94 A;  3DXK B;  4CEE A;  4LF7 K;  2QI2 A;  2E4L A;  1TV6 A;  4CBX A;  3VQQ A;  3HYF A;  4CK1 A;  3PX6 A;  2NRV A;  3O9Q A;  2D0P A;  3P31 A;  4DR2 K;  3U6F A;  3V1O A;  2EX3 A;  4JK7 A;  4ID1 A;  3PY8 A;  4C8O A;  4CJ4 A;  3HJF A;  3ZSW A;  3VEZ A;  4DSL A;  4J2E A;  4OPK A;  5CY4 A;  2Z1I A;  5GIP A;  2NRW A;  3WQT A;  4BG9 A;  5FRM A;  4Q0B A;  4N56 A;  4KPY A;  5KTQ A;  4M41 A;  4JN4 A;  1IBM K;  1LW0 A;  1J5E K;  4CZJ A;  1EXQ A;  2YJE A;  4M7X A;  3E9P A;  3T1A A;  4C1N I;  4ELU A;  4GKK K;  2BTF A;  1JLQ A;  1S9E A;  3MEG A;  4M63 C;  1I3A A;  3NE6 A;  3DLR A;  4XIU A;  1CZA N;  3VN5 A;  2EHG A;  1GLJ O;  1HJR A;  3AO2 A;  4B1V A;  3E9L A;  4JNE A;  4FYD A;  4WQ5 A;  5AZJ A;  1DTQ A;  3ALY A;  4CD3 A;  2G8H A;  1EWR A;  3ULE B;  2FLO A;  3F5T A;  4Y0W A;  4B8A B;  1RT3 A;  2VG7 A;  3PV8 A;  4CHO A;  4B1W B;  3ENO A;  4FW1 A;  3AA4 A;  2RF2 A;  4H5N A;  2YI1 A;  4IO9 L;  3KZB A;  4GVM A;  3J7Z O;  3NVM A;  1Q9Y A;  3ZSV A;  3GBT A;  3ID8 A;  4YOU A;  1GOB A;  4YDU A;  3HOT A;  1ZBI A;  2KFN A;  1JLE A;  4Z4H A;  4BE0 A;  5AQG A;  5M1N A;  3L3V A;  1C1A A;  3WUH A;  4NCA A;  2NUB A;  1ZBF A;  4CZM A;  3VQB A;  4KHW A;  3J7Y P;  1TUU A;  3MDQ A;  3OYE A;  3TAQ A;  3FGU A;  1ZBS A;  4LC9 B;  5EY4 A;  2O8B B;  3LPT A;  3AVK A;  1JLA A;  3BP8 A;  3LAK A;  2VQF K;  4BRP A;  1Q81 O;  2OZM A;  4KHN A;  5KPR A;  1L3S A;  1HKC A;  5J2P A;  1TAQ A;  4FWP A;  1E3M A;  5C15 A;  3D2F A;  3TAP A;  3DRR A;  2P9L A;  3L0Q A;  5BPM A;  3WNE A;  4CGJ A;  3S3M A;  3L4Q A;  3VA3 A;  1NJI O;  5KGX A;  4DFK A;  4BDP A;  3OBW A;  3B8A X;  3VPZ A;  5BR8 K;  3RVC A;  1QHT A;  3CG7 A;  4L8R B;  3GDQ A;  1T3V A;  3QML A;  4I2Q A;  5HRN A;  3AVH A;  1MWM A;  4FM0 A;  1O1W A;  5FPE A;  3OYD A;  3OHR A;  4DF8 A;  3D45 A;  4GY2 B;  3ZX3 A;  5KRT A;  3EY1 A;  3SBG A;  3VMF B;  1WSJ A;  2OPQ A;  1REV A;  2P9S A;  3D2E B;  4B3R K;  2GV9 A;  1Q86 O;  3G71 N;  3ENB A;  4WCE L;  3NF7 A;  2E2Q A;  3L4I A;  4M3Z A;  1MA9 B;  5EX5 A;  3O3G A;  4H5T A;  4I2P A;  2EWS A;  3O80 A;  2QEX N;  3C94 A;  3AA5 X;  4KRF A;  1HNX K;  1XWL A;  2QWP A;  3T3F A;  4BRH A;  4CHQ A;  1KRP A;  3A5L C;  1LWF A;  3AY9 A;  2FC0 A;  4CJK A;  1GLD G;  4CJF A;  2VWJ A;  1VQ7 N;  1TL1 A;  5AQK A;  4DMN A;  1J53 A;  3K9K A;  1VSH A;  5F1X A;  2O8C A;  3DYA A;  3WXL A;  3LL3 A;  5BPN A;  2YNI A;  1HQE A;  1SUQ A;  1WB9 A;  2A5X A;  4DV2 K;  3MEE A;  4W5R A;  4NCB A;  3ZSR A;  5BRE A;  3F2K A;  3SBT A;  1QHA A;  1KXP A;  2Q36 A;  1NGB A;  2OPR A;  4WFB L;  5HL7 L;  3VA0 A;  2WUS A;  3VQ5 A;  4DF4 A;  4W5O A;  3QEP A;  4I6M A;  3QIO A;  1SL1 A;  1BHL A;  4WQ4 C;  4Z4F A;  3ID6 A;  4NCG A;  2KZM A;  1GOA A;  4JLH A;  4IFE A;  3QO9 A;  5E26 A;  3T19 A;  4JYA K;  4KTQ A;  1ZBH A;  3ZEU B;  3LZI A;  4WYB A;  4RW6 A;  4DTM A;  3TI0 A;  3B6P A;  3EL2 A;  2NRT A;  2F7T A;  4E89 A;  4H5R A;  3TR8 A;  2ITG A;  4PKI A;  5JMV A;  4OJR A;  4G9Z A;  4L3Q A;  3KHY A;  3CXC M;  5JLH A;  3LWM A;  4X65 K;  2PYL A;  4M3T A;  1N32 K;  3ZSZ A;  1QE1 A;  3HPO A;  1C1C A;  3W0L A;  2IDO A;  2OPP A;  1J9A A;  4BY9 C;  2FXU A;  1UAX A;  3CC7 N;  3HBT A;  3S9H A;  3V9U A;  3AAQ A;  3FZK A;  1HNI A;  5C10 A;  5FDL A;  4J2A A;  2QWL A;  1W0H A;  3AVN A;  4DTR A;  3AVJ A;  5KI6 A;  1VSF A;  1QQC A;  3EE9 A;  5M1O A;  4M3Y A;  3LDO A;  2O4I A;  3I56 N;  4RG8 A;  3QLH A;  1XC3 A;  1VQ5 N;  1QVF M;  3DXM B;  3CCM N;  3H1Q A;  2DFF A;  4FLX A;  3ZET B;  4IO8 A;  2QKK A;  1FXX A;  5EXW A;  3WEE A;  3UKU A;  2KTQ A;  2F9W A;  3QER A;  4FOI A;  3TWH A;  5ELZ A;  3ZLJ A;  4CHY A;  1TKX A;  2GX9 A;  3VQP A;  4ISG A;  3ENH A;  4CGH A;  3P4I A;  5C2F A;  1RTI A;  3VET A;  5HBM A;  1NGC A;  2E20 A;  5A2Q O;  2P9N B;  1M1K O;  3FZH A;  4CJ7 A;  2R7Y A;  4BE1 A;  4KV8 A;  5E84 A;  1WSF A;  2Q2R A;  1KAZ A;  3PO5 A;  4MO4 A;  4NLB A;  4CD1 A;  3THW A;  5E41 A;  3CJ7 A;  4EZ6 A;  2WOM A;  1KVB A;  1SZ2 A;  4CJU A;  4RW4 A;  4JD2 B;  2D0A A;  5AQR A;  5CHI A;  5KQ8 A;  2RHK A;  1N33 K;  3MXJ A;  2Z1H A;  4BR7 A;  4JHD A;  3MXI A;  4MO5 A;  3PSI A;  3CMA N;  2BAN A;  3ZSY A;  4CFA A;  3ZT0 A;  1OVQ A;  4B8C A;  3PX0 A;  4FZX C;  4AM7 A;  1N8R O;  4B1X B;  3TAF A;  4FJL A;  1KFD A;  3OYA A;  2UYT A;  2J4R A;  1BL3 A;  1Q7Y O;  1ATN A;  2WTU A;  1BI4 A;  3QET A;  4BVO A;  1WBD A;  3MX2 A;  1BG3 A;  1JLF A;  1JLB A;  3NF8 A;  4DV5 K;  2Q1N A;  4CIE A;  4JI7 K;  3KLH A;  2P5G A;  2OTJ N;  3WXM B;  3CYM A;  2VYP A;  4JI4 K;  3AAP A;  3KK3 A;  3RMA A;  4BRG A;  2P1J A;  1TYQ B;  3O3H A;  2P9U A;  4DSI A;  1BA1 A;  4BGA A;  1S1V A;  3KLF A;  1WLJ A;  1NGI A;  1GLA G;  2FSJ A;  1Q9X A;  3J80 O;  3NFA A;  3OVN A;  1IV0 A;  1KSP A;  2QTD A;  1NOZ A;  4BAC A;  4H0X B;  5LJV A;  5KGW A;  1RGI A;  3CHW A;  4DQI A;  2QXF A;  2QM1 A;  4CJS A;  1YT3 A;  2KLA A;  3LM2 A;  2HVH A;  4GV6 A;  3MN5 A;  3R9P A;  2F96 A;  1R0A A;  2WFB A;  3PIO L;  4DV6 K;  4K41 A;  3HO1 A;  1YTA A;  4H0V B;  3NH0 A;  1HMV A;  3KTQ A;  1XC9 A;  1WSE A;  3MX5 A;  4W5N A;  3LWL A;  3U3G A;  3P39 A;  2O8F A;  4CZF A;  4YHH K;  1X3N A;  1WUA A;  4DU1 A;  4IZ9 A;  5DMR A;  4LH5 A;  5JIC A;  3CFP A;  5GAH P;  4DB3 A;  4DV1 K;  1HPZ A;  4DLG A;  4CZG A;  5AQI A;  4CJT A;  3I55 N;  4RW8 A;  2E5L K;  4A2A A;  5AQZ A;  3SPY A;  1Z05 A;  1YJN N;  4GV3 A;  1U6Z A;  3LAN A;  3J7A P;  4B3T K;  2YJF A;  2A1R A;  1U49 A;  1KD1 O;  3D0P A;  2QWM A;  1ZBL A;  4KH5 A;  4DR4 K;  2FBV A;  1RT5 A;  4DR3 K;  4IOX A;  1BO5 O;  4KKO A;  3QEI A;  3KVG A;  1VRT A;  2UUC K;  2ZF5 O;  3O4N A;  4JS4 A;  1T8E A;  2GWK A;  5KRS A;  4FVM A;  2VG5 A;  4DFJ A;  2ZWH A;  5GAD P;  2B4J A;  4IBN A;  4MDA A;  3L2W A;  3NGZ A;  1VQ9 N;  4RWT A;  3U8X A;  4B1U B;  2G8U A;  3H08 A;  4GW6 A;  1EX4 A;  5AZJ B;  1HLU A;  1RDA A;  4BR4 A;  4CJR A;  3KLG A;  4LFA K;  4N76 A;  1HNV A;  4DSF A;  1NGE A;  2KHO A;  3HVT A;  4KHQ A;  4KO0 A;  3SUQ A;  4DKW A;  2BE2 A;  1TL3 A;  3VGK A;  3AO3 A;  3M8P A;  1DT9 A;  1GLC G;  3U3Y A;  3KWI A;  3CQ8 A;  3V1Q A;  2I7P A;  4O55 A;  3LPU A;  1V4S A;  1DTT A;  5FRO A;  1VSJ A;  1XMQ K;  2OCE A;  1ASV A;  1LAV A;  3GE1 A;  3DLL L;  4A5A A;  4CBW A;  1RDD A;  4OVL A;  3MXM A;  1T44 A;  1HPM A;  1Q82 O;  3BF3 A;  1NGF A;  2YHW A;  1X9J A;  3TPQ A;  2OTL N;  1RCH A;  3HP9 A;  1FK9 A;  3OBY A;  3W3D A;  2CGJ A;  1SKR A;  2E2O A;  4Z4I A;  1YTU A;  4FM2 A;  4FJI A;  1D8Y A;  1NG9 A;  4NO7 A;  4F3T A;  5F2R A;  4CZI A;  3N4P A;  4FSV A;  3O9S A;  2YNF A;  3ZCM A;  3D2F B;  2P9L B;  4A62 A;  3O4W A;  4QOZ B;  3TAM A;  3SJJ A;  2A40 A;  3WXI A;  2P9I A;  5AZI A;  3L6Q A;  4DFM A;  3JXU A;  2QWO A;  1IG9 A;  2HMP A;  4ID5 A;  4JKH A;  3QB0 A;  4JI8 K;  2A42 A;  4Y1C A;  1RDC A;  3SV4 A;  1W9H A;  4ILG B;  5M1F A;  1HX1 A;  1SKW A;  3O1W A;  1NK6 A;  1K8K A;  3K9J A;  3DJC A;  1G99 A;  4FJ5 A;  5CYM A;  2F8T A;  3VQ6 A;  4JRQ A;  1RBV A;  4JK9 A;  4Z4C A;  1WSG A;  4N41 A;  2A6A A;  3BDP A;  2Q31 A;  3SPZ A;  1OH5 A;  4EAH D;  1UA1 A;  1GLE G;  1ZXO A;  1JCF A;  1D9F A;  3LP2 A;  4CZK A;  4X64 K;  4N47 A;  3HPH A;  4Q5V A;  3VF4 A;  4OKE A;  2YHX A;  1TVR A;  3ZYY X;  3UB5 A;  3M1F A;  5AQT A;  1RT4 A;  3HTV A;  2G8K A;  1WSI A;  3THV A;  4RW7 A;  3H6E A;  2XY6 A;  1H1V A;  2W41 A;  3KK1 A;  1WAF A;  1LV5 A;  4CGG A;  5GAG P;  2O8D A;  4KBO A;  3CCQ N;  3SK3 A;  4JI3 K;  1QVG M;  3V9X A;  3RR8 A;  2D0B A;  3DOK A;  2ASM A;  4CZH A;  3CJC A;  4CEF A;  2O8C B;  4LF9 K;  2IIR A;  4FZY A;  4OKK A;  2ZQB A;  3VER A;  3KJV A;  3WT0 A;  4DTJ A;  3D6R A;  3G6E N;  4AHU A;  3R3L A;  3CJB A;  4DSK A;  2PZS A;  1VQ8 N;  4CW7 B;  1Z6R A;  1NGG A;  4C23 A;  4H5W A;  3LDN A;  3P5J A;  3A5M C;  2VGN A;  3FZL A;  3HVR A;  1ASU A;  1HKG A;  1ATS A;  4CF8 A;  4O0I A;  1LAW A;  3DI6 A;  4I6M B;  4BRD A;  3AVI A;  4DTO A;  2HHS A;  4CHZ A;  3DOL A;  3G25 A;  4KH4 A;  4JKE A;  3HM9 A;  3UE5 A;  1XMO K;  5CR4 A;  1Q8I A;  3NCI A;  3RWU A;  3K5N A;  1RFQ A;  3DRP A;  3K5L A;  3U9Z A;  2ZE2 A;  3SZ2 A;  1U2V A;  4FWR A;  1RNH A;  4BE2 A;  4YOX A;  4HTL A;  3DLG A;  5B8H A;  4LFC K;  2QK9 A;  4CCH A;  3SQ4 A;  2QWQ A;  4HCB A;  2E6L A;  2NZT A;  5LL6 Z;  3OYF A;  1V4T A;  5AR0 A;  3K58 A;  3SUN A;  3O9R A;  4DSE A;  2BGG A;  3NVK A;  3P1G A;  1QQO A;  3AA2 A;  3I33 A;  1QTM A;  4DQS A;  1YAG A;  2GBZ A;  2HST A;  5LY3 A;  3CFO A;  4E7K A;  1NLV A;  4B08 A;  3RTV A;  3ISN C;  2ZM6 K;  3SUO A;  2DFH A;  1NMN A;  2OZS A;  2P9P A;  1T03 A;  1U47 A;  3OS1 A;  5AQU A;  1EQY A;  3AGK A;  4DTU A;  3UKU B;  5BRF A;  1UA0 A;  4NXM K;  2UUA K;  3CC4 N;  2KKZ A;  3H45 C;  1RT6 A;  2IS3 A;  2X6N A;  4BRN A;  2FBY A;  4MDB A;  4B9L A;  2PYJ A;  3THY B;  4CJ5 A;  3TSP A;  5MLC Q;  4OLB A;  4BQZ A;  3KK2 A;  1X3M A;  1HJO A;  1EKE A;  4FJN A;  2ETJ A;  3DXK A;  3M8Q A;  4DV0 K;  1S22 A;  2E1Y A;  1XUP O;  1IBL K;  1NGD A;  3MN6 A;  3F73 A;  3THW B;  5BN8 A;  4BDY A;  3CME N;  3CET A;  1HNZ K;  3BZC A;  3ZT4 A;  1W97 L;  2H3G X;  1RT2 A;  3VES A;  4CF0 A;  3P83 D;  3DMJ A;  4FK0 A;  2AA4 A;  2HHT A;  4PHT X;  4B9M A;  1HYZ A;  2BH1 A;  4LH4 A;  5DM7 L;  2YNH A;  1E4G T;  2DPN A;  3VEW A;  4F3O A;  3ATV A;  3AVB A;  4JHD B;  2HHW A;  4BRM A;  3D7E O;  1NGH A;  1HYS A;  1VQ6 N;  4TSX A;  2UUB K;  3OYC A;  1XHZ A;  3IDH A;  3OYK A;  4BR9 A;  4CEB A;  1SKS A;  4H4M A;  2HHV A;  3FFI A;  3L3U A;  3JS6 A;  1YVU A;  1B9F A;  4EZ9 A;  2YCH A;  1G15 A;  4IEI A;  4IEE A;  2IVN A;  1NK7 A;  4NLC A;  4BWJ A;  1JJ2 M;  4LF5 K;  3FR0 A;  3OYI A;  3NGY A;  4EHU A;  1D5A A;  3ULE A;  1TAU A;  1S1X A;  3AVC A;  4PKG A;  3FLC O;  4M7Y A;  4RCH A;  2BDP A;  4V19 S;  3NMU A;  3ITH A;  5AQY A;  4DV3 K;  4LSL A;  3VEV A;  2HND A;  1KVA A;  4DQR A;  2F8S A;  3SQ1 A;  3UKR B;  4K25 A;  1IKV A;  4JS5 A;  4ILH A;  2YX6 A;  4AHT A;  3L8B A;  4JI6 K;  4IWV A;  4FM1 A;  2X74 A;  3VEN A;  3RMC A;  1HQU A;  3CIP A;  4WQ5 C;  5LMU K;  4FLV A;  1WOQ A;  4E7I A;  3KKR A;  3M5R A;  1BIU A;  4WFA L;  5AQW A;  3OYL A;  3WNH A;  2KZZ A;  4BRF A;  3DAW A;  1N36 K;  1RIL A;  3SYZ A;  1J54 A;  2OYQ A;  1BUP A;  1E4F T;  5JVG L;  1BU6 O;  1VQN N;  2AP1 A;  1KLN A;  4O5B A;  2O8B A;  3VQD A;  3I0S A;  4B3S K;  4JI0 K;  3CD6 N;  3CQY A;  1VSL A;  3JAM O;  4YNQ A;  3O9U A;  4DCH A;  1YUW A;  4RW9 A;  4IKF A;  3CCR N;  4CEC A;  1L3U A;  2FSK A;  4BR5 A;  3VQ9 A;  3EEQ A;  4DTN A;  4F4K A;  1Y64 A;  4M45 A;  4ZTF A;  4JEP A;  2XY8 A;  3V4I A;  3JSM A;  3HL8 A;  3WXK A;  3ZSX A;  4M42 A;  2YKN A;  3MCP A;  1S6Q A;  3SNN A;  1TK0 A;  1JCE A;  4M3R A;  2UXB K;  4K8X A;  1CZB A;  4R5P A;  4B9N A;  4CEA A;  1TKZ A;  1S5J A;  4F9O A;  3KK7 A;  3PIP L;  3NF9 A;  1ZYQ A;  4QAG A;  4FJG A;  1T6D A;  2NNW A;  4BRC A;  4CGD A;  3M3Z A;  5ADX H;  3FZF A;  3I0R A;  4HUG A;  1Q18 A;  2IAJ A;  5DK5 A;  4FLU A;  4EFH A;  5FPD A;  5J2M A;  2VWK A;  4KRE A;  4DQ8 A;  2HNY A;  5HRR A;  2XY5 A;  4OX9 K;  2ZJR L;  1YHQ N;  3RMB A;  4C8N A;  3AO5 A;  4OKJ A;  3NBP A;  3RRG A;  3A0I X;  1KFS A;  3CM6 A;  1QSS A;  4MLH A;  3MMV A;  1N6Q A;  4J8F A;  1T05 A;  2HMI A;  1NBW A;  1VQK N;  3HRG A;  2V7Y A;  1NGA A;  2AJQ A;  3VQC A;  1CXU A;  4CER A;  1ATR A;  4FOE A;  2B6A A;  2ZJQ L;  3C65 A;  2NRX A;  2E1Z A;  5GAE P;  1Y97 A;  4K43 A;  1M90 O;  4DV7 K;  4FCY A;  4UQG A;  2DFE A;  3VTH A;  3K0S A;  3ATU A;  3CER A;  4JKF A;  1SAZ A;  3R6M A;  3VTI A;  1NK4 A;  2PFU A;  3RSE A;  3LZJ A;  4HUF A;  1IBK K;  3HK2 A;  2LSN A;  1HR0 K;  2CH5 A;  2A3Z A;  4NXN K;  3BEX A;  1C0U A;  4JI5 K;  4ILJ A;  4CED A;  3ZX2 A;  2FBT A;  3ZEU A;  4B9Q A;  1QQN A;  4B9T A;  1XNR K;  3QIP A;  3EZW A;  4PWD A; 
#chains in the Genus database with same CATH homology
 1YTU A;  3OYE A;  4FM2 A;  3TAQ A;  4FJI A;  3LP1 A;  3TAN A;  4DS5 A;  1FKO A;  1RTH A;  3VQE A;  4AIL C;  1D8Y A;  4F3T A;  1C1B A;  3OYG A;  4KB1 A;  3LPT A;  2YNF A;  3AVK A;  1JLA A;  3LAK A;  4KHN A;  3B6O A;  2OZM A;  3ZCM A;  4HVJ A;  3NHG A;  1L3S A;  4MQ3 A;  1BIS A;  5J2P A;  1TAQ A;  3CM5 A;  2Q3S A;  4J2D A;  4QOZ B;  5HP1 A;  3TAM A;  3TAB A;  3SJJ A;  4WE1 A;  3TAP A;  3DRR A;  4DU3 A;  1X9S A;  4Y1D A;  3WNE A;  4CGJ A;  3S3M A;  4DFM A;  5J2N A;  4E7J A;  2JLE A;  3VA3 A;  1IG9 A;  4CF1 A;  3SQ2 A;  4ID5 A;  3NAE A;  3HPG A;  1I39 A;  1TGO A;  5KGX A;  4Y1C A;  4DFK A;  1RDC A;  1L5U A;  5C24 A;  4BDP A;  3SV4 A;  4K8Z A;  1W9H A;  4DSJ A;  1QHT A;  3CG7 A;  4MFB A;  1SKW A;  4L8R B;  1NK6 A;  2Z1J A;  3PUF A;  1VSK A;  4I2Q A;  4AHC A;  5HRN A;  3AVH A;  4FM0 A;  1O1W A;  4E7L A;  3OYD A;  2KFZ A;  4C8M A;  4DF8 A;  5JS2 A;  2B5J A;  3D45 A;  4DG1 A;  1ASW A;  4KTZ A;  5CYM A;  5KRT A;  3EY1 A;  3QNO A;  3VQ6 A;  2RKI A;  3NH2 A;  1WSJ A;  3OYH A;  1RBV A;  2OPQ A;  4JRQ A;  3QES A;  3QEW A;  1REV A;  3M8S A;  4I7F A;  4Z4C A;  1WSG A;  1T7P A;  1VRU A;  1L3V A;  4N41 A;  3BDP A;  2GV9 A;  4J2B A;  3VQ8 A;  1SL2 A;  4CF9 A;  3OYM A;  3AVM A;  3SPZ A;  1IH7 A;  1UA1 A;  3IG1 A;  4E7H A;  3NF7 A;  1D9F A;  4FLY A;  4M3Z A;  3LP2 A;  4FK2 A;  4N47 A;  3HPH A;  4Q5V A;  3O3G A;  1VSD A;  4I2P A;  4ELV A;  4OKE A;  1TVR A;  3AA3 A;  3RMD A;  2ZD1 A;  3KLI A;  5C42 A;  1RT4 A;  1NJW A;  1WSI A;  2G8K A;  2FBX A;  4ZTJ A;  3C94 A;  3AA5 X;  4KRF A;  3THV A;  4FJ8 A;  4RW7 A;  1RBT A;  1XWL A;  1SV5 A;  3I8D A;  4CF2 A;  2XY6 A;  4Z4E A;  2G8I A;  5D3G A;  3KK1 A;  3VQA A;  3T3F A;  1U45 A;  1WAF A;  4CHQ A;  1LV5 A;  1KRP A;  4CGG A;  3G0Z A;  3DLH A;  1LWF A;  4CGF A;  2FC0 A;  3AV9 A;  4CJK A;  4PY5 A;  3OJU A;  1TK8 A;  1CLQ A;  3V9X A;  3KLE A;  3C6T A;  2D0B A;  3DOK A;  4CJF A;  2VWJ A;  3RR8 A;  1Z25 A;  4CEF A;  4KI4 A;  3F9K A;  1QSL A;  1TL1 A;  4DMN A;  3K57 A;  4FZY A;  1J53 A;  4OKK A;  1RDB A;  2ZQB A;  3AO1 A;  2HB5 A;  1VSH A;  3HP6 A;  3KJV A;  4DLE A;  4DTJ A;  3OYJ A;  3DYA A;  4AHU A;  3LAM A;  1KVC A;  4DSK A;  1U48 A;  2PZS A;  3DLB A;  2YNI A;  1C0T A;  1HQE A;  1SUQ A;  3P5J A;  3ZT3 A;  3K59 A;  1L3T A;  1WNS A;  2YHA A;  3MEE A;  3HVR A;  1ASU A;  3LDS A;  4W5R A;  4NCB A;  3ZSR A;  2OA8 A;  1TK5 A;  3QNN A;  4CF8 A;  3AVL A;  4O0I A;  1RBR A;  2X78 A;  3PX4 A;  2O4G A;  1LAW A;  3DI6 A;  4ELT A;  3JYT A;  2OPR A;  4CK2 A;  1S1T A;  4NYN A;  3VA0 A;  3AVI A;  4DTO A;  3VQ5 A;  4CHZ A;  3DOL A;  4W5O A;  4DF4 A;  3TAE A;  3HM9 A;  3QEP A;  4CFC A;  3V9W A;  4LD0 A;  3QEV A;  3QIO A;  4H8K A;  1BHL A;  1Q8I A;  3NF6 A;  3NCI A;  1SL1 A;  2WON A;  3K5N A;  4AHS A;  4CGI A;  3DRP A;  4NCG A;  3K5L A;  3SZ2 A;  2ZE2 A;  4KHY A;  4Z4F A;  1GOA A;  2KZM A;  4JLH A;  4IG3 A;  4CJV A;  3QO9 A;  4B9S A;  4O44 A;  2D5R A;  4HCC A;  3T19 A;  1VSM A;  4KTQ A;  1C0M A;  4CK3 A;  1ZBH A;  3LZI A;  1IKW A;  1RNH A;  4IFY A;  3V81 A;  1U04 A;  1JLC A;  3IRX A;  4RW6 A;  4BE2 A;  3RRH A;  4DTM A;  3TI0 A;  3B6P A;  3DLG A;  4IFV A;  4YFU A;  4FLW A;  4Z4G A;  4FLT A;  4CJ3 A;  4E89 A;  3SCX A;  4CFD A;  3SQ4 A;  3TR8 A;  2ITG A;  4CCH A;  2QK9 A;  1EP4 A;  3ASM A;  1KCF A;  4OJR A;  3SV3 A;  3SI6 A;  4HCB A;  2E6L A;  1BCM A;  4DWI A;  3OYF A;  3LWM A;  3WNG A;  2Y1I A;  3K58 A;  3SUN A;  2PYL A;  4M3T A;  4BDZ A;  1EET A;  3ZSZ A;  1QE1 A;  4E1N A;  3HPO A;  4DU4 A;  4DSE A;  4DTS A;  3V6D A;  1C1C A;  3RWU A;  1D9D A;  1BCO A;  2IDO A;  3K2P A;  2OPP A;  3OYN A;  2GUI A;  2BGG A;  3G10 A;  1J9A A;  2W42 A;  1UAX A;  3P1G A;  3S9H A;  4EP5 A;  3AA2 A;  4FJ7 A;  4J2A A;  5J1E A;  1IKX A;  1QTM A;  5SWM A;  4DQS A;  4CIF A;  2GBZ A;  3V9U A;  3CFO A;  1A5W A;  1RTJ A;  1JL2 A;  4BWM A;  4OPJ A;  4E7K A;  1U4B A;  3KIO A;  1HNI A;  1XHX A;  4B08 A;  1NKB A;  2PY5 A;  5FDL A;  3ISN C;  3ZSQ A;  3RTV A;  3ZSO A;  4W5T A;  2DFH A;  3SUO A;  1J5O A;  4E3S A;  4DQP A;  2OZS A;  1W0H A;  3AVN A;  4DTR A;  2IOC A;  3AVJ A;  1VSF A;  1QQC A;  5KI6 A;  4W5Q A;  2Z1G A;  4DTX A;  2A1S A;  4DFP A;  1T03 A;  4M3Y A;  4KFB A;  5JS1 A;  2O4I A;  1WSH A;  1CXQ A;  5I42 A;  3OJS A;  1U47 A;  3OS1 A;  2ATQ A;  4FW2 A;  4LY7 A;  2XY7 A;  4RG8 A;  3QLH A;  4DTU A;  3L2V A;  1QSY A;  4LSN A;  4OGC A;  1WAJ A;  2DFF A;  4FLX A;  2OPS A;  5CZ1 A;  1LWC A;  3ZT1 A;  1S1U A;  4CE9 A;  1UA0 A;  2QKK A;  1FXX A;  1TKD A;  2KTQ A;  4CEO A;  3UIQ A;  1RT7 A;  1RT6 A;  3QER A;  2IS3 A;  3VQ4 A;  2X6N A;  3V9Z A;  2FBY A;  1C6V A;  3TWH A;  3AVA A;  4B9L A;  2D0C A;  4CHY A;  1TKX A;  1RTD A;  4CJ5 A;  2G8V A;  2PYJ A;  4FJK A;  4CEQ A;  4OLB A;  1CZ9 A;  3VQP A;  4CHN A;  3HT3 A;  3KK2 A;  3E01 A;  1EKE A;  4CGH A;  2ETJ A;  4FJN A;  3M8Q A;  1RTI A;  1F21 A;  5HBM A;  3M8R A;  3OYB A;  1NK8 A;  4I9Q A;  4ZHR A;  3F73 A;  2R7Y A;  4NYF A;  4BDY A;  4BE1 A;  4KV8 A;  2HHQ A;  1WSF A;  2P51 A;  4ICL A;  3ZT2 A;  2KW4 A;  3ZT4 A;  3KTQ A;  3PO5 A;  1IKY A;  1FKP A;  1RT2 A;  3P83 D;  4CF0 A;  3MAQ A;  5I3U A;  5E41 A;  1A5X A;  1NK9 A;  2E6M A;  4HHT A;  3DMJ A;  4CIG A;  5C25 A;  3LP0 A;  2WOM A;  1TKT A;  4E0D A;  4EZ6 A;  1KVB A;  4CJU A;  4FK0 A;  2HHT A;  4B9M A;  5HRP A;  1HYZ A;  4RW4 A;  1MU2 A;  1VSE A;  2D0A A;  4LH4 A;  2YNH A;  2XHB A;  4FXD A;  1NJZ A;  1Z26 A;  4JRP A;  4F3O A;  4QCL A;  2X6S A;  2HHU A;  3PO4 A;  4M3U A;  1JL1 A;  3AVB A;  2HHS A;  2HHW A;  1VK0 A;  4DTP A;  3MXJ A;  4CJP A;  2Z1H A;  5SZT A;  5T7B A;  1ZBU A;  4FJM A;  4PQU A;  4CHP A;  3TAR A;  5HRS A;  1HYS A;  1UWB A;  3MXI A;  3S3N A;  4TSX A;  2I5J A;  3DLE A;  2BAN A;  3ZSY A;  4CFA A;  3MEC A;  4CJL A;  3OYC A;  3ZT0 A;  1XHZ A;  4B8C A;  4CEB A;  3OYK A;  3PX0 A;  1SKS A;  3KD1 E;  4H4M A;  4FZX C;  3K5O A;  2HHV A;  3FFI A;  2YKM A;  1QS4 A;  2VG6 A;  2QKB A;  3TAF A;  4FJL A;  4F8R A;  3L3U A;  1KFD A;  3OYA A;  3L2Q A;  1BL3 A;  3AO4 A;  1YVU A;  1B9F A;  1BI4 A;  1SL0 A;  4EZ9 A;  2YHB A;  3QET A;  4FLZ A;  1KTQ A;  1G15 A;  3C6U A;  2HHX A;  4GMJ B;  3QEX A;  1JLF A;  1NK7 A;  1JLB A;  3NF8 A;  2G8W A;  4BWJ A;  3LAL A;  4KI6 A;  3DM2 A;  3OYI A;  4CIE A;  2YNG A;  3KLH A;  1IO2 A;  3KKS A;  5K14 A;  3NGY A;  2P5G A;  1D5A A;  3DRS A;  1TAU A;  3CYM A;  1JXB A;  1S1X A;  3A2F A;  3AVC A;  2BDP A;  5FRN A;  1X9W A;  3ITH A;  4LSL A;  3KK3 A;  3RMA A;  2P1J A;  1UOC A;  2HND A;  3O3H A;  4HTU A;  4DSI A;  1KVA A;  4DQR A;  1S1V A;  3KLF A;  4OLA A;  2F8S A;  3SQ1 A;  5J2Q A;  1WLJ A;  1NJX A;  1LW2 A;  3S3O A;  3NGI A;  1Q9X A;  1IKV A;  2G8F A;  4JS5 A;  4PUO A;  1WN7 A;  1X1P A;  3NFA A;  4AHR A;  3C95 A;  4AHT A;  4B9V A;  1NK5 A;  1RBU A;  3L8B A;  4FM1 A;  2X74 A;  3OVN A;  3RMC A;  1KSP A;  1HQU A;  4FJX A;  1NOZ A;  4KTW A;  3RR7 A;  4FLV A;  2Y1J A;  4IDK A;  4BAC A;  4E7I A;  1GOC A;  5KGW A;  3KKR A;  1BIU A;  3BGR A;  4KHS A;  3O4Q A;  4DQI A;  3OYL A;  3WNH A;  2QXF A;  3MED A;  2KZZ A;  4CJS A;  4FK4 A;  1YT3 A;  3O3F A;  1RIL A;  3SYZ A;  3HXM A;  1J54 A;  4AHV A;  5CZ2 A;  2OYQ A;  4C8K A;  2HVH A;  1A5V A;  4FJJ A;  3L2R A;  2F96 A;  3TAG A;  1R0A A;  2YV0 X;  1NKC A;  1JXE A;  1LWE A;  4CES A;  4M3X A;  1KLN A;  1S1W A;  3HO1 A;  3EZ5 A;  4O4G A;  1YTA A;  4O5B A;  3VQD A;  3I0S A;  3V1R A;  3L2U A;  4KHU A;  4B3O A;  3NH0 A;  4IG0 A;  1HMV A;  1S6P A;  1VSL A;  1B92 A;  4Z0U A;  2RPI A;  3QIN A;  4CFB A;  4YNQ A;  3CFR A;  1XC9 A;  1WSE A;  1X9M A;  4W5N A;  3SUP A;  3LWL A;  1BGX T;  3U3G A;  2HNZ A;  2RN2 A;  4FJH A;  1BQM A;  4C8L A;  4FJ9 A;  1BQN A;  3AVF A;  2XO7 A;  1NK0 A;  4KAZ A;  4RW9 A;  4IKF A;  4OGE A;  3ULD A;  4DU1 A;  4KB0 A;  1VSI A;  5DMR A;  3NDK A;  2HVI A;  2DTU A;  4LH5 A;  4CEC A;  4E19 A;  3CFP A;  1HYV A;  4G1Q A;  4CJQ A;  1L3U A;  1HPZ A;  4CEE A;  3AVG A;  1B9D A;  3VQ9 A;  4DLG A;  2IGI A;  2E4L A;  1DLO A;  2XRI A;  4DTN A;  1NOY A;  1TV6 A;  3IAY A;  4F4K A;  4CJT A;  3VQQ A;  3HYF A;  4CK1 A;  3PX6 A;  4RW8 A;  4M45 A;  4ZTF A;  3WNF A;  2P5O A;  3SPY A;  4CEZ A;  2XY8 A;  3V9S A;  3V4I A;  3U6F A;  3V1O A;  3JSM A;  4F2R A;  3HL8 A;  3ZSX A;  2EX3 A;  2KQ2 A;  4M42 A;  2YKN A;  1HRH A;  1RBS A;  4ID1 A;  3LP3 A;  1XI1 A;  3PY8 A;  4CJ4 A;  1S6Q A;  3LAN A;  4C8O A;  3SNN A;  1TK0 A;  3HJF A;  4FJ5 A;  2A1R A;  4M3R A;  3ZSW A;  1U49 A;  4DSL A;  1CZB A;  4R5P A;  4K8X A;  4OPK A;  3D0P A;  4B9N A;  4CEA A;  4J2E A;  2F8T A;  1TKZ A;  5CY4 A;  1S5J A;  2Z1I A;  1ZBL A;  4DS4 A;  4FZZ A;  3NF9 A;  2FBV A;  4QAG A;  1RT5 A;  1ZYQ A;  4N56 A;  4FJG A;  5FRM A;  4Q0B A;  4KPY A;  2DY4 A;  5KTQ A;  4M41 A;  2JGU A;  4B9U A;  1S9G A;  4CGD A;  4KKO A;  4E1M A;  3QEI A;  1LW0 A;  1VRT A;  3I0R A;  4O0J A;  1EXQ A;  1ITG A;  4HUG A;  3NH1 A;  4F2S A;  2IAJ A;  5DK5 A;  4FLU A;  3T1A A;  3O4N A;  4JS4 A;  1T8E A;  1NKE A;  1NJY A;  5J2M A;  5KRS A;  2VWK A;  4FVM A;  4ELU A;  1KLM A;  4KRE A;  2VG5 A;  1JLQ A;  2HNY A;  5HRR A;  4DFJ A;  2B4J A;  4IBN A;  2XY5 A;  1S9E A;  3L2W A;  3NGZ A;  3SQ0 A;  3MEG A;  3RMB A;  3DLK A;  4C8N A;  1BI4 B;  3AO5 A;  4OKJ A;  2G8U A;  3H08 A;  1I3A A;  3NBP A;  2HW3 A;  3RRG A;  3NE6 A;  4GW6 A;  3DLR A;  4XIU A;  2IC3 A;  1EX4 A;  4CJR A;  3KLG A;  1RDA A;  2EHG A;  1HJR A;  3AO2 A;  3CM6 A;  5CYQ A;  3VN5 A;  1KFS A;  1HNV A;  4DSF A;  1QSS A;  4N76 A;  4FYD A;  3HVT A;  4KHQ A;  4I9L A;  4PA1 A;  4KO0 A;  1DTQ A;  3ALY A;  1N6Q A;  2G8H A;  3SUQ A;  1T05 A;  2HMI A;  2BE2 A;  1TL3 A;  4H4O A;  3AO3 A;  3M8P A;  2AJQ A;  1BIZ A;  1K6Y A;  3VQC A;  4CJE A;  1JKH A;  1CXU A;  4CER A;  4B8A B;  3K5M A;  4HUE A;  1RT3 A;  2VG7 A;  3U3Y A;  3PV8 A;  3VQ7 A;  2B6A A;  4CHO A;  3CQ8 A;  3EYZ A;  3V1Q A;  1Y97 A;  4O55 A;  3LPU A;  4FW1 A;  4AH9 A;  3OS0 A;  3AA4 A;  1N5Y A;  2RF2 A;  1DTT A;  5FRO A;  4GVM A;  4FCY A;  4UQG A;  1VSJ A;  2DFE A;  4N5S A;  5HLF A;  1Q9Y A;  4CJW A;  1RT1 A;  3OY9 A;  1ASV A;  1LAV A;  3ZSV A;  1RDD A;  4OVL A;  1NK4 A;  3HST B;  1GOB A;  3MXM A;  5EU7 A;  1JLG A;  3LZJ A;  4HUF A;  3HK2 A;  4DQQ A;  2LSN A;  2KFN A;  1ZBI A;  1JLE A;  4Z4H A;  4BE0 A;  4M3W A;  3OS2 A;  3L3V A;  1C1A A;  1C0U A;  4CED A;  2NUB A;  5HRO A;  4NCA A;  4EP4 A;  1ZBF A;  2FBT A;  3IS9 A;  1RCH A;  3HP9 A;  4B9T A;  1FK9 A;  3KD5 E;  3QIP A;  4PWD A;  3VQB A;  4KHW A;  1SKR A;  4Z4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...