3NH0A

Crystal structure of rnase t in complex with a non-preferred ssdna (aac)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
b'TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 64
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh0A00
3KLHA 3HT3A 2ETJA 4DQRA 3S3NA 1RT2A 4M3TA 3NCIA 2OPSA 1WSHA 3OYGA 1WSJA 1RCHA 3AA5X 4JLHA 2RKIA 2GUIA 5E41A 3V9WA 4ELUA 4HCCA 4N41A 1VK0A 3IG1A 4DTOA 4E1NA 3AVIA 4LH4A 5I3UA 3AA3A 3HP6A 4B8CA 1D5AA 3QO9A 4CGHA 3SUQA 3LAKA 3LP2A 4YNQA 5HROA 1ZBLA 3G0ZA 4BE1A 3ZSVA 1N5YA 2JGUA 1Q8IA 2VG6A 3SPZA 2KQ2A 4CEBA 3O3GA 4I7FA 3OJSA 4H4OA 2G8UA 1BIUA 1IH7A 1RDCA 3NBPA 1LWCA 1Y97A 1L3VA 3HL8A 4IDKA 1JXEA 3ALYA 5CY4A 1VSHA 2GV9A 4CFCA 3OYLA 3OJUA 3SNNA 3RWUA 3NH2A 4CESA 2YV0X 4KV8A 5K14A 4CJQA 2XY6A 4E0DA 1LAVA 1RBSA 1ZBUA 4C8OA 2Z1GA 4EP5A 3AVLA 4CJWA 4DFMA 1ZBHA 4JRPA 1IG9A 1RDDA 1TAUA 3NFAA 2LSNA 4NYFA 3OYKA 2IGIA 5J2MA 1W9HA 2BANA 2YHBA 3AVHA 1HPZA 4OKKA 3ZT3A 4CIGA 4DLGA 1RILA 1KTQA 3IRXA 4FJ8A 4Z4HA 3TR8A 4ZHRA 3DYAA 4K8XA 1C0MA 2HHQA 4H8KA 3TAMA 3OYCA 1RNHA 4RW6A 4KHNA 3AVGA 3ISNC 1WLJA 3L2UA 1VSIA 3L2QA 1NK0A 2VWKA 4KTZA 4KTQA 4EZ9A 1KFSA 1A5XA 1HYSA 1JLBA 4NCAA 4B9LA 5FRNA 3VQ6A 2HHSA 3OYHA 2F8SA 4B08A 1JLFA 4J2DA 3H08A 3NH1A 3RRHA 3KTQA 3KD5E 1REVA 4C8MA 4CHOA 3K2PA 3ZSYA 1U45A 1U49A 4FLTA 1X9MA 2JLEA 4MQ3A 3PO4A 3VQ8A 3ZT1A 4F3TA 3I0SA 4PY5A 2Z1HA 3NF6A 4CGDA 2QKBA 4CK3A 3RMBA 5HBMA 4BWJA 4B9NA 1VRTA 3DM2A 1RBVA 4CEQA 4CJKA 3T19A 1TK8A 2B4JA 4CEEA 2X78A 3AVBA 3S9HA 3T1AA 4CF0A 1BQNA 2OPQA 2PYJA 4CIEA 3DLRA 1RBUA 1B9FA 3QIPA 5HRNA 3LP3A 3TWHA 4B9UA 1XWLA 3K59A 4RW9A 5EU7A 4DMNA 3PX0A 4OPKA 4CEAA 4CJLA 2XY7A 4NCGA 4F2RA 1ZYQA 1G15A 4CIFA 4CF2A 4FZXC 4AHTA 1VSDA 3L3VA 4KRFA 4KFBA 3NH0A 4TSXA 1TK5A 3KKRA 3OS1A 1KCFA 2IDOA 1NK4A 3V4IA 1CZBA 4CF8A 4DS5A 1J5OA 3PY8A 3IAYA 1TV6A 4M3YA 4FJXA 4Z4IA 1NK5A 4DSJA 1JXBA 2HHTA 1LW2A 2RPIA 4E7IA 3JYTA 2D5RA 3NAEA 4E7LA 1R0AA 4FYDA 2DTUA 4FLUA 1LWFA 3LALA 1JL2A 3SCXA 3LP1A 3QLHA 2XY8A 1BCMA 4FZYA 4FW1A 1TL1A 4FK4A 3OYNA 2G8KA 3A2FA 3SV4A 4F8RA 4DF8A 4KAZA 3QEIA 2I5JA 3TI0A 3U6FA 3BGRA 1ASVA 3ZSQA 4EZ6A 4B9VA 4CJPA 3SZ2A 1ASWA 3QEXA 3DRRA 3AO3A 3CFOA 3ULDA 4KB1A 2DY4A 3OYMA 5J1EA 4CK1A 1WSIA 3TAPA 1UA1A 1NKEA 1ZBFA 4HVJA 1KVBA 5C25A 3ZSOA 1X9WA 1IKVA 3VQEA 2HB5A 4HCBA 1S1UA 3AO4A 4OJRA 4CFDA 2WOMA 3OVNA 2DFFA 3NGZA 5HRPA 2WONA 3VQDA 3OYFA 4PWDA 3KLGA 4FJJA 1DTTA 4CGJA 3HXMA 4RG8A 3L2WA 3S3MA 3VQ9A 3LWLA 3EZ5A 4FJ9A 1S5JA 4CERA 4FJGA 4C8KA 3O4NA 3ZT2A 1UA0A 1D9DA 3HJFA 1TKXA 4DQQA 1T05A 3VQ5A 4AHRA 4BWMA 3MXMA 1WSEA 1U04A 3HPHA 3V9ZA 3S3OA 2RF2A 2OPPA 1S1TA 3HPGA 3I0RA 5CYMA 4BDZA 3U3YA 4C8LA 4DSIA 4FXDA 2YNIA 4B8AB 1GOBA 1QSYA 4M45A 1B9DA 3DLKA 3DMJA 4CJEA 1NK6A 1Q9XA 2OA8A 4Y1CA 2OZSA 1EXQA 2P5OA 4J2AA 4H4MA 4FLWA 1NJZA 1X1PA 4AHSA 3L2RA 4BDYA 4CHNA 4QOZB 3KK3A 2KTQA 4I9QA 4M3XA 1RDBA 3M8PA 1IO2A 1T03A 3QEVA 4LH5A 5C42A 4CEDA 4O44A 2G8FA 2F96A 2PZSA 1SKRA 1SUQA 1F21A 1NKBA 4KHUA 3DLEA 3KIOA 1U48A 4I2PA 2BE2A 3HVTA 3V6DA 3AVCA 3MXJA 4Z4GA 1HRHA 3OYIA 3NHGA 1L3SA 1RT4A 4AH9A 3L8BA 1RTIA 3MEEA 3D0PA 4DU4A 5I42A 4M3ZA 2HNYA 4CFBA 4OLBA 4PUOA 2G8HA 4CJRA 2ZQBA 3VN5A 1WN7A 1Z25A 4JS5A 1SV5A 3DLBA 1IKXA 4ID5A 2P51A 3PUFA 1S9EA 3KK1A 5KGXA 3V9XA 1EKEA 4AHVA 1BGXT 5HRRA 1QSSA 2O4IA 2YKNA 1HQUA 1BI4B 4FVMA 2FBTA 5CZ2A 4ID1A 4F2SA 4KB0A 1QTMA 4CJUA 3UIQA 5CZ1A 3KLIA 3LP0A 3LZJA 3TAGA 4DTNA 2G8IA 4DQPA 1VSLA 4FM2A 5J2NA 4AHUA 1KRPA 3P83D 4OGCA 3K5MA 4CK2A 3PX4A 1RTDA 1D8YA 4LSLA 4DFJA 3ZSWA 3AVKA 3ZSRA 5C24A 3P5JA 4CF1A 1WAJA 4DSLA 4O0JA 4W5TA 3RTVA 3QEWA 4FJHA 2IC3A 4FJIA 3DOLA 4E7KA 1LAWA 1FKPA 1HNVA 3HP9A 3DLHA 1TGOA 1J53A 1CXQA 1FXXA 4BE0A 4FLVA 4OKJA 4Q5VA 1YT3A 3HVRA 3DOKA 3V1OA 5SZTA 3LPTA 3F73A 3SI6A 1U47A 1SKSA 1RBRA 1Q9YA 2PY5A 2PYLA 1NJYA 1S6QA 2QXFA 3QNOA 4RW7A 4O5BA 3RMCA 4L8RB 2YHAA 4M41A 1T8EA 2E4LA 4KREA 3ZT0A 3HK2A 3OYAA 1QSLA 2GBZA 2YNGA 4E89A 3LANA 4QCLA 4AHCA 1IKYA 4YFUA 1NK9A 3HSTB 2OYQA 4CJVA 5CYQA 4BDPA 3QEPA 3ZT4A 4E7HA 1WNSA 1NK8A 1SL2A 4N76A 2B5JA 1BCOA 3EY1A 4KHQA 4FK0A 3SUNA 4J2EA 1EX4A 1X9SA 4DWIA 4O55A 3LWMA 4ICLA 1XHZA 3MECA 3WNEA 4DU1A 4BE2A 1VSMA 2Z1IA 2KFNA 4W5NA 3SPYA 4DQIA 1WAFA 1C1AA 3NDKA 2HVIA 3AV9A 3MAQA 4FJ7A 3OYEA 4ZTFA 4W5QA 2XY5A 3OS2A 1S1VA 3AVNA 1C0TA 3V81A 4N56A 4FM1A 3LAMA 2ITGA 4N47A 4DTRA 5HLFA 4B9MA 2FBXA 4CGFA 3TAQA 2HW3A 2XRIA 3L3UA 3RR8A 1IKWA 1QHTA 2A1RA 4GMJB 4CJFA 4CJTA 3EYZA 4DTMA 1NJXA 1JLQA 1TL3A 3AVMA 1LV5A 2YKMA 3KD1E 4F3OA 3LZIA 4K8ZA 4FJMA 4KHYA 1VSJA 1B92A 1TKTA 1KFDA 3RRGA 3SQ0A 5HRSA 3HM9A 2HHWA 3MEGA 4PA1A 1BL3A 1HQEA 1FK9A 2EX3A 5T7BA 3PX6A 1NKCA 1L5UA 4FCYA 2KZZA 1CLQA 1VRUA 3OYJA 4JS4A 1RDAA 1XHXA 3M8SA 3SUPA 3T3FA 3DRPA 4DU3A 3VQ4A 3AVAA 1S9GA 1T7PA 5FRMA 2BGGA 1BHLA 4CGGA 1C0UA 4O0IA 2HVHA 2HHVA 3HYFA 4KTWA 3TAFA 3C95A 2W42A 4W5OA 2VWJA 5HP1A 2IAJA 3AVFA 3RMDA 1JLAA 1UOCA 1TK0A 2D0BA 4KKOA 4FLXA 3VQAA 5KI6A 2G8VA 3SQ1A 4Q0BA 4HUEA 2E6LA 3C6UA 4FW2A 3SYZA 4DFPA 3CFPA 3K5NA 4FLZA 1XI1A 4KHWA 4IG3A 4RW4A 2AJQA 3V1QA 3WNFA 4HTUA 1Z26A 4DTUA 3K5LA 3AA2A 2QKKA 1RBTA 2KW4A 3C6TA 1KSPA 4DLEA 4M42A 3HO1A 4DQSA 2OZMA 3IS9A 4OGEA 2Q3SA 4DSEA 4XIUA 1DLOA 3FFIA 2Y1IA 1BQMA 3SJJA 4JRQA 2KZMA 2X6NA 1JLCA 2NUBA 3QIOA 2R7YA 4FJLA 2Y1JA 2G8WA 4M3UA 3QESA 1YTUA 1RT7A 2HHXA 1HJRA 3TAEA 3M8RA 4ZTJA 3SQ2A 1NK7A 1RT3A 3B6OA 3QERA 3VQ7A 4OKEA 1NOYA 2FBVA 3OYDA 3JSMA 4J2BA 3VQQA 5DMRA 3DRSA 4NYNA 4QAGA 1ZBIA 2KFZA 2YNFA 3D45A 4IBNA 3VQCA 4CEZA 3QINA 3OS0A 4W5RA 3VQPA 1HMVA 3O3FA 2XHBA 4OVLA 1C1BA 1EETA 2DFEA 2BDPA 2P5GA 4FJNA 1BIZA 1BI4A 2B6AA 3NGIA 1S6PA 4IFVA 3ZSZA 4E1MA 3MEDA 5FROA 3QNNA 1C6VA 4CJSA 4LD0A 4LSNA 2VG5A 2DFHA 1FKOA 3VQBA 3TARA 1O1WA 4FJ5A 1A5VA 4BACA 3CQ8A 3NF7A 3ITHA 4DTXA 4CCHA 5FDLA 4M3RA 3CG7A 3AO5A 4CJ5A 1HNIA 2O4GA 3AA4A 2XO7A 3THVA 4B9TA 4DS4A 4GVMA 4ELTA 4NCBA 3SV3A 4KI6A 3KKSA 2Z1JA 3AO2A 3G10A 4Z4EA 1BISA 5KTQA 1LW0A 4CF9A 3RR7A 4LY7A 1U4BA 2IOCA 3PV8A 1CZ9A 1VSKA 2D0AA 4DTPA 2QK9A 4AILC 5DK5A 4CJ3A 3OYBA 3O3HA 4WE1A 3LDSA 1QS4A 1HYZA 1NOZA 1QQCA 1K6YA 3ASMA 1N6QA 3P1GA 4CHYA 3WNHA 4CHPA 4G1QA 1SKWA 3AO1A 4OPJA 3OY9A 1TVRA 1TAQA 3NF9A 1KLMA 4FK2A 1XC9A 2FC0A 4F4KA 1L3UA 4FLYA 1I3AA 1TKZA 2ZD1A 2X6SA 3NE6A 1JKHA 4DG1A 3V1RA 2EHGA 4CEFA 4E7JA 1W0HA 4OLAA 4DTSA 4IKFA 1JLGA 3RMAA 5JS1A 1SL0A 1YTAA 2D0CA 3QETA 3SUOA 1J9AA 2F8TA 1KVAA 1LWEA 4GW6A 3K57A 5KRSA 3V9UA 1NJWA 1RT1A 4Z4FA 3KK2A 2P1JA 3I8DA 4DSKA 2HNZA 4KO0A 4KI4A 3U3GA 1EP4A 3B6PA 1I39A 1WSGA 4CFAA 1ASUA 2A1SA 1S1WA 4RW8A 2HMIA 4CECA 1ITGA 3KLEA 1KLNA 2HHUA 4C8NA 3F9KA 2E6MA 3VA3A 1L3TA 1MU2A 5SWMA 3MXIA 1YVUA 1RT5A 4CHQA 5KRTA 4DF4A 3CM6A 3PO5A 4CHZA 2IS3A 1JLEA 1KVCA 2RN2A 4CJ4A 4HHTA 3E01A 5KGWA 5J2QA 1S1XA 1VSFA 2ATQA 3CYMA 1A5WA 3WNGA 4UQGA 4I9LA 3ZSXA 3K58A 4CEOA 4DFKA 2YNHA 3C94A 4N5SA 4DSFA 1HYVA 3K5OA 1UAXA 2HNDA 2OPRA 3AVJA 3O4QA 3SQ4A 1WSFA 3NGYA 5D3GA 3HPOA 1VSEA 4EP4A 5J2PA 3ZCMA 4B3OA 4HUGA 4M3WA 1C1CA 1J54A 1RT6A 1DTQA 1SL1A 4IFYA 4PQUA 4CGIA 2FBYA 1GOCA 1D9FA 3CM5A 4DTJA 4CE9A 4KPYA 3L2VA 2X74A 1RTHA 3M8QA 4ELVA 3LPUA 2VG7A 4FJKA 3KJVA 4O4GA 3VA0A 3DLGA 3NF8A 4I2QA 4Y1DA 4MFBA 4R5PA 4KHSA 4IG0A 5JS2A 4E3SA 4FZZA 1RTJA 3CFRA 1GOAA 3DI6A 3BDPA 1QE1A 4Z4CA 1JL1A 4Z0UA 1TKDA 4HUFA 1CXUA 3V9SA 3TABA 1UWBA 4E19A 4FM0A 2ZE2A 4B9SA 3KLFA 3TANA
chains in the Genus database with same CATH superfamily
4PKGA 3KLHA 2ETJA 1GLFO 4DQRA 3S3NA 4UY8O 2OPSA 2E2QA 3BUZB 3AA5X 4JKAA 4JI1K 4N41A 1VK0A 4OO1J 1SQKA 5GIPA 3AVIA 3AA3A 3MCPA 3HP6A 1VQ8N 3QO9A 4YNQA 1ZBLA 1N5YA 3UKRA 1Q8IA 3SAHA 2KQ2A 2NRWA 3O3GA 3OJSA 3G6EN 1EWQA 4DR4K 3NBPA 3ATUA 3HL8A 3ALYA 4CZJA 1IBKK 5BR9A 4CESA 4E0DA 5K14A 1GLEG 3ZYYX 3SBGA 3ULEA 3AVLA 3HOTA 1S72N 4QS8A 4JAXA 1IG9A 5GADP 2JWKA 4NYFA 4DLGA 4JI6K 1RILA 4A5BA 2UU9K 4ZHRA 2BUPA 3CPEA 2HHQA 3VETA 4H8KA 4DQ8A 3CQXA 5EOYA 3L2UA 3L2QA 4KTZA 4KTQA 1KFSA 1A5XA 2NZTA 4EAHD 4B9LA 5FRNA 1JLFA 4J2DA 3NH1A 4C8MA 4CHOA 3K2PA 3CF5L 2JLEA 4MQ3A 1YXQA 3VQ8A 3ZT1A 3I0SA 2Z1HA 2QKBA 5I9EB 4CEQA 3AGRA 3UE5A 4C1NK 1GLAG 4CIEA 1VQ4N 1B9FA 3N4QA 3QIPA 4QS9A 3FE1A 3VEXA 3VGKA 4B9UA 3OBYA 3K59A 4AM6A 4RW9A 4DMNA 3IFRA 1ZYQA 1G15A 4AHTA 1VSDA 4KRFA 1E4GT 2QWQA 3G4SN 1GLDG 3SMSA 3OS1A 1CZBA 4M3YA 1J5OA 1TV6A 4Z4IA 4B3SK 1Q18A 4E7IA 2V7YA 4G9ZA 2DTUA 1LWFA 4DV2K 1YVNA 3SCXA 1YAGA 3VTIA 4H5NA 4FW1A 2G8KA 3SV4A 1E4FT 1G99A 4KAZA 2FLOA 2I5JA 4PL8A 4EZ6A 3SZ2A 2IVPA 4CK1A 2D1KA 1KVBA 4MDAA 3VQEA 2HB5A 5MLCQ 2UUCK 2WOMA 2DFFA 3Q7BA 2O8CA 1GLLO 5HRPA 4FOEA 5H1SQ 2CH5A 2O8CB 1SS6A 3MDQA 3BF1A 1S5JA 4H0VB 4FJGA 1UA0A 4RCHA 1BUPA 3KWIA 4BWMA 3CI5A 2FXUA 3W3DA 3V9ZA 3UKUB 4WFAL 5ADXH 4R79A 2YNIA 4ILHA 1QSYA 2P9LA 1NK6A 2P9LB 4Y1CA 4DCHA 4J2AA 1NJZA 4BDYA 4M3XA 5EXWA 3M8PA 3TTFA 1T03A 2OCEA 2G8FA 3VESA 5EVZA 1SUQA 1SKRA 3OHRA 1U48A 3U8XA 3HI0A 3V6DA 1HRHA 4EIAA 4AH9A 3MEEA 4OLBA 4PUOA 3L0QA 3MWTA 5B8HA 5AQZA 4Y0WA 1IKXA 2P51A 1S9EA 1NM1A 1NLVA 4AHVA 2O4IA 4BGBA 5CZ2A 2FBTA 4F2SA 4ID1A 2NRRA 4KH5A 3LP0A 3THYA 3PIOL 1J6ZA 2J4RA 5CR4A 4FM2A 2Q0RA 3CCEN 3THYB 1V4TA 4CK2A 3PX4A 1OH8A 4DFJA 4YOUA 4JN4A 3T1HK 1WAJA 4IEIA 3QEWA 2IC3A 4K41A 3EL2A 5M1FA 1LAWA 1FKPA 4B1WB 1FXXA 3G25A 4CZEA 4Q5VA 3HVRA 3DOKA 3F73A 3LPTA 1RBRA 4M63C 2PY5A 3H3OB 4BRGA 3QNOA 2YHAA 3SAFA 3VF2A 3HK2A 1WB9A 2YNGA 4E89A 1K8KA 4AHCA 4BRHA 2NRTA 4BDPA 1WNSA 4WFBL 4H5VA 5KQ8A 4KHQA 4FK0A 3LDNA 4BRCA 4ICLA 5JVGL 2KFNA 2Z1IA 4W5NA 5AQIA 2A6AA 3PSIA 1NNEA 1OVQA 3NDKA 1LOTB 5E84A 2FSKA 1C0TA 3AAQA 3BP8A 2UXCK 2RE2A 3V81A 4FM1A 3LAMA 3HM8A 1HX1A 2VQEK 1IKWA 2NNWA 2A1RA 4CJ7A 4DTMA 1JLQA 2IVOA 4IDHA 5HL7L 1LV5A 4K8ZA 4FVUA 1B92A 1KFDA 2HHWA 3MEGA 4PA1A 4GKKK 4KH4A 1K8AO 1HQEA 1FK9A 3ID8A 5AQLA 1NKCA 2ZWHA 4FCYA 1VRUA 3M8SA 3SUPA 3T3FA 2RHKA 3IKMA 2E1ZA 3SMPA 1QHAA 3OA9A 4BC2A 3HTVA 2BGGA 1BHLA 1C0UA 4KTWA 2YJEA 2O8DA 2P9SB 4LF8K 3R9PA 4A2BA 4BRNA 3VQAA 2G8VA 3CFPA 1EO1A 2QKKA 1Z26A 3GBTA 1RBTA 2BTFA 3ZLJA 4DLEA 2HMPA 2OZMA 1NGEA 5KQDA 4J8FA 4XIUA 2E5LK 3L4QA 1C0FA 3R8EA 3T7ZA 1QZ5A 4FJLA 3QIOA 4M3UA 2R7YA 2O8FA 5KPRA 1HJRA 4I6MB 3VPZA 2O8FB 3VQ7A 2GEMA 3D2EA 5DMRA 3DRSA 4NYNA 3F5TA 3D45A 4IBNA 3NVMA 3VQCA 3QINA 4YDUC 4A2AA 1HMVA 2HHHK 2GUPA 5ADXA 4OVLA 1EETA 2A40A 4WQ5A 3QB0A 1ATNA 3MEDA 3S41A 4LD0A 3M3ZA 3VQBA 4LF9K 1A5VA 3EO3A 3ITHA 5KPTA 5AQPA 2D4WA 1HNIA 4CBUA 2P9UB 4MLHA 5AQYA 3SV3A 3KKSA 4Z4EA 1U4BA 1CZ9A 1VSKA 1YHQN 2D0AA 2QK9A 4CJ3A 1QQCA 1K6YA 2EWSA 4C23A 3QFPA 4RTFD 3OY9A 3E66A 1ZBSA 1XC9A 4ISGA 2ZD1A 1NGFA 1JKHA 3GDQA 4CEFA 4E7JA 2FF3B 4IKFA 1JLGA 3N4PA 4PKIA 4JD2B 1J9AA 4K0KK 3K57A 1NJWA 2WUSA 2P1JA 4BY9C 4EHTA 4RWTA 4NXNK 4KI4A 3FR0A 1I39A 1N32K 2YHXA 3CCSN 4XH1A 1KLNA 2HHUA 1NMDA 2ASOA 1IBMK 2E6MA 3VA3A 1L3TA 1MU2A 3LM9A 5SWMA 5KRTA 2CGJA 3WXJA 1S22A 4I9LA 1MWKA 2YNHA 2HNDA 3SQ4A 3AVJA 1P90A 3HPOA 1JCEA 4LFAK 4HUGA 5AQQA 3A5OC 1RT6A 4GV9A 5AQUA 1YJNN 4IFYA 5AZJA 3LPUA 3KJVA 3VA0A 3NVKA 3DLGA 4I2QA 4KHSA 4E3SA 4YHHK 2GELA 3DI6A 4Z4CA 1TKDA 2E20A 3V9SA 2A42A 1UWBA 5M1OA 4E19A 3J7AP 3T69A 3SBTA 3R3LA 1E3MA 3P4IA 2QWPA 1YIJN 3OYGA 1WSJA 2QA4N 4IJAA 4JLHA 5JLFA 2GUIA 2JWLA 3U4LA 3M6GA 4YOTA 4QS7A 4ELUA 3IG1A 5DM6L 1NGGA 3TU5A 3EEQA 4B8CA 3PLAA 1VQMN 3BF3A 3G0ZA 3ZSVA 5CHIA 2VG6A 4FL9A 4CEBA 4I7FA 2G8UA 1U2VB 2NRXA 1LWCA 1Y97A 4BDZA 3OJUA 4V19S 2GV9A 4FWPA 3NH2A 1IG8A 4KV8A 3IDHA 4FWLA 1HUXA 1RBSA 1HR0K 2Z1GA 4DFMA 4CZGA 1TAUA 3WT0A 1W9HA 2BANA 3AVHA 4FJ8A 1WOQA 1KTQA 3TR8A 3DYAA 1C0MA 4LC9B 4RW6A 4KHNA 5AQRA 3AVGA 1OVYA 1VSIA 3C6AA 3TTDA 4H5RA 3O5BA 3AARA 2HHSA 3OYHA 4B08A 3ZSYA 5BREA 2NRVA 4FLTA 4GKJK 2P9NA 2QM1A 1TYQA 4CK3A 3RMBA 4BWJA 1CZAN 1VRTA 3DM2A 1RBVA 3CETA 3T19A 4JI4K 2B4JA 3P31A 1VQ6N 3S9HA 2ZJPL 4CF0A 2GWKA 1BQNA 2YHWA 1RBUA 3H3NO 3PSFA 3PX0A 4CJLA 1VQON 4CIFA 3L3VA 4U7BA 3CQYA 3R1XA 3V4IA 4CF8A 4DS5A 4FJXA 3LDLA 1VQ9N 3CERA 4JK7A 3JS6A 2HHTA 4FYDA 5AQFA 3VF6A 4MO4A 3LP1A 3VTHA 3O9RA 5C12A 4JKGB 3VOVA 2ZGYA 3TI0A 4B1XB 3ZSQA 2NLXA 4B9VA 4CJPA 2DY4A 3AO3A 3ULDA 4KB1A 2QTDA 5IWAK 3OYMA 4JKBA 1HNZK 3TAPA 3OTOK 2W40A 5AQJA 5C25A 1IKVA 3CD6N 3NGZA 5DM7L 2WONA 4PWDA 3OYFA 3L2WA 1RFQA 4FJ9A 4K43A 4DUZK 4CERA 3GL1A 3ZT2A 4GV6A 4WFNL 3HJFA 1TKXA 3CJ7A 2O8BA 1T05A 4DHYA 3DXMA 4BR4A 2O8BB 1WSEA 1U04A 3HPHA 2VQFK 2RF2A 2OPPA 3DXMB 3HBTA 1HKGA 4B8AB 3CMAN 4B1ZA 3DLKA 3ATVA 3DMJA 4CJEA 3R6MA 3ZEUA 2OZSA 2A41A 3ZEUB 4AHSA 4YOXA 3L2RA 2W6LA 2KTQA 3O8MA 4B1UB 1KAZA 4LH5A 5C42A 4O44A 3K9JA 4Z4GA 1NGDA 1L3SA 1RT4A 5I42A 4CZKA 2E2OA 3O6WA 3CCLN 2HSTA 1WN7A 1SV5A 3EKUA 4XEIA 5KGXA 4LF4K 1QSSA 1QTMA 3UIQA 5CZ1A 3KLIA 4H0YB 1VSLA 5J2NA 2AP1A 4AHUA 1KRPA 5GAHP 1RTDA 1D8YA 3ZSWA 3P5JA 5LY3A 3G71N 3RTVA 4W5TA 3WUHA 4MO5A 4DR2K 5C0YA 1HNVA 1CXQA 4FLVA 3V1OA 1Q9YA 1RDUA 2CGKA 4L8RB 1X3NA 4KREA 4QCLA 1IKYA 2OYQA 2V7ZA 4CJVA 3QEPA 3CMEN 1NK8A 1SL2A 4N76A 2B5JA 1BCOA 3SUNA 1WBBA 1EX4A 1W2BM 4DU1A 4IFEA 5AQMA 1WAFA 1K73O 2HVIA 3AV9A 4FJ7A 3CCVN 3OYEA 2XY5A 3OS2A 1S1VA 3AVNA 4JKEA 1ZXOA 4B3MK 1GLBG 4N56A 4IO9L 4DTRA 5HLFA 4BR7A 4B9MA 3RR8A 1W7AA 5AQOA 4GMJB 4CJFA 3ZETB 2WTUA 3AVMA 2CGLA 4KHYA 4A59A 1VSJA 5HOOA 5F1XA 3SQ0A 3CHWA 5HRSA 4H0OA 2VCPA 3DAWA 1NGAA 4FPBA 3DRPA 2YCHA 1S9GA 2HVHA 3E9LA 2HHVA 3TAFA 4MLEA 4H5TA 2W42A 2IAJA 3BEXA 2A3ZA 1JLAA 1UOCA 3UKUA 4BRIA 4KKOA 3E1YA 3WXLA 1HNXK 5KI6A 4Q0BA 4FLZA 2AJQA 4DTUA 3WNFA 4LF7K 3AA2A 2KW4A 1KSPA 4JK9A 4B9QA 4DQSA 1T3VA 2Q3SA 1DLOA 2QI2A 3FFIA 2X6NA 3K9KA 1YTUA 1XNQK 2G8WA 4JKCA 5LMNK 1RT7A 3TAEA 4WF9L 4ZTJA 3QERA 4H0PA 2FBVA 3OYDA 3P38A 3VQQA 2KFZA 2YNFA 4X62K 5LL6Z 4BRAA 2XHBA 3MWPA 1C1BA 2DFEA 2BDPA 3FZHA 5AQNA 4FJNA 1BIZA 3NGIA 1VQNN 4E1MA 1C6VA 4CJSA 3A0IX 1FKOA 1O1WA 4FJ5A 4BACA 3CQ8A 3NF7A 4BQZA 4CCHA 5FDLA 3AO5A 5F0XA 3U9DA 2O4GA 3AA4A 4GVMA 5BN9A 4EHUA 2Z1JA 3MCAB 4IZ9A 3CXCM 4LY7A 4O8KA 3PV8A 4NLBA 5DK5A 3QBXA 3TSPA 4K25A 3WEEB 3LDQA 3D7EO 3FZMA 4CHYA 4CHPA 4G1QA 3AO1A 3DWLA 2QW9A 3FZKA 1TAQA 3IUCA 3NF9A 4FK2A 4DR5K 4FLYA 1I3AA 2HBJA 2EHGA 4OLAA 5BRHA 3SLCA 5JS1A 1SL0A 1JCFA 2Q31A 1XC3A 4GW6A 4ILJA 3V9UA 5KRSA 1RT1A 4CZIA 3L6QA 2HNZA 4NXMK 4DV3K 1WSGA 4CFAA 1SAZA 4RW8A 2HMIA 1VQKN 2YJFA 1NJIO 4CVNE 3HZ6A 3QDKA 3MXIA 3C65A 4DF4A 3CM6A 3PO5A 1IJJA 4XH5A 4CHZA 1KVCA 2PBDA 1S1XA 3CYMA 3MN6A 4UQGA 3ZSXA 3K58A 4CEOA 4N5SA 3ENBA 1HYVA 3K5OA 4NO7A 1XQSC 1WSFA 5D3GA 3VEVA 2YHYA 5IT9O 3AGKA 5J2PA 5LMUK 3H45C 1VQLN 1C1CA 4M3WA 4JI2K 1DTQA 1SL1A 2QWLA 2YI1A 4CGIA 3CM5A 4KPYA 1HNWK 3AAPA 1QQMA 2P9SA 3CFRA 5CE3A 1GOAA 3BDPA 1QE1A 1JL1A 4Z0UA 4JYAK 1JJ2M 4C1NI 2Q97A 3C7NB 3VGLA 3TABA 2HF3A 1OH6A 3HT3A 4M3TA 3MN5A 4X65K 3NCIA 4H0XB 4BR5A 2ZF5O 4IWVA 1WSHA 1RCHA 4I6MA 4OX9K 1Q7YO 5F2RA 2KKZA 3V9WA 4HCCA 4BVOA 2GTDA 4LH4A 4X66K 1XNRK 5C10A 4YDUA 1DGKN 1D5AA 3SUQA 3LAKA 3ENOA 4DUYK 3VERA 4IOAL 1BIUA 1BDGA 1EQYA 1L3VA 4IDKA 5CY4A 1QQNA 2GX9A 4B3TK 3J8AA 4CJQA 2F7TA 3QFUA 4C8OA 1XMOK 2YX6A 4GV3A 2P9UA 4JRPA 1ZBHA 1Y64A 1QVFM 3NFAA 2IGIA 5BR8K 3ZT3A 5J2MA 2YHBA 4CIGA 2PYJA 2P9PB 4K42A 4K8XA 1IV0A 3MX2A 2W41A 3OYCA 3ISNC 3HRGA 4EZ9A 1HYSA 1JLBA 3VQ6A 2W6KA 4JEPA 2F8SA 3H08A 3KD5E 3RRHA 1TUYA 3EZWA 3M1FA 1X9MA 3PO4A 1W97L 4CBWA 4H0TB 3A5NC 5HBMA 5LJWA 4JD2A 5E26A 1P8ZA 2X78A 4BR9A 3T1AA 4OPAA 2OPQA 2UXDK 1BWFO 1XWLA 3I56N 3H1VX 4OPKA 4F2RA 4NCGA 3D6RA 3A5LC 4CF2A 4KFBA 1YJWN 2UUAK 1TK5A 3VEOA 1KCFA 2VWBA 1NK4A 3IAYA 3PY8A 3WXMB 1NK5A 4DSJA 5M1QA 1LW2A 2RPIA 4DB3A 4DV5K 3JYTA 2D0PA 1R0AA 4E7LA 3LALA 1HJOA 4MDBA 1JL2A 1BCMA 4DKWA 4FZYA 4FK4A 3OYNA 3A2FA 5BRDA 3BY5A 1XMQK 4DF8A 3O9SA 5M1NA 3QEIA 4O8UA 3U6FA 2ASMA 3QEXA 3CFOA 4BQLA 1NKEA 1NG9A 4HVJA 1FW6A 1H1VA 3I55N 4HCBA 4ILGB 1I94K 4WQ4A 4BRKA 3ZX0A 1ATRA 4CGJA 4RG8A 2O8EB 3LWLA 3EZ5A 2DPNA 3SJHA 4DQQA 2KLAA 3HOSA 3CC2N 1M1KO 4AHRA 1C0GA 4DV0K 4L3QA 5EY4A 3I33A 5CYMA 3F2KA 3I0RA 4DSIA 4C8LA 2UYTA 3O80A 3EE9A 3ZX2A 1GOBA 3J81O 1U2VA 1EXQA 3W0LA 2P5OA 4FLWA 4DR3K 5AQWA 4CHNA 4QOZB 4DV7K 4AQYK 3SK3A 4I9QA 3K0SA 3QEVA 4CEDA 4KHUA 2F96A 1NKBA 5AJ3K 3DLEA 3THWB 3A8YA 3O9UA 4I2PA 3HVTA 1SZ2A 3AVCA 3MXJA 4A61A 2E2NA 4M3ZA 2NRZA 4BRPA 3D0PA 4DU4A 4CFBA 1DKGD 4CD1A 4CJRA 3VN5A 1Z25A 4CBXA 3J7YP 3DLBA 3KK1A 2HOEA 4IOCL 5HRRA 2YKNA 1HQUA 1BI4B 4FVMA 4KB0A 3I8BA 3LZJA 3TAGA 4DTNA 3CCQN 1QQOA 3LDOA 1OKJA 3CCJN 4OGCA 3Q7CA 2Q0UA 4LSLA 3AVKA 4PHTX 5BPNA 4JK8A 4B1YB 4FJHA 3HP9A 1TGOA 4DR1K 4BRLA 4OKJA 2AA4A 1S6QA 3RMCA 1T8EA 4M41A 2E4LA 3SAGA 1QSLA 4X64K 2GBZA 4U67L 4YFUA 5TKYA 3TTCA 3HSTB 1NK9A 4LFCK 5CYQA 2VYPA 4FOIA 2OTJN 4FWMA 3L4IA 4J2EA 2KHOA 1X9SA 3CC7N 1XHZA 3FZLA 5AQXA 1VSMA 3SPYA 1C1AA 3MAQA 1FJGK 4LF5K 3CCMN 5C15A 4W5QA 4FWKA 4GY2B 4JKGA 1T6CA 1XUPO 2ZGZA 2ITGA 2FSJA 2FBXA 4CGFA 2HW3A 2XRIA 3L3UA 4CJTA 1NJXA 1TL3A 1RGIA 3KD1E 2YKMA 3KVGA 3HM9A 1BL3A 1T6DA 2EX3A 3PX6A 1L5UA 1CLQA 4JS4A 1RDAA 1D4XA 3VQ4A 3VEYA 1T7PA 5FRMA 4CGGA 3HYFA 3QBWA 2QEXN 4W5OA 1X9JA 5HP1A 3AVFA 2D0BA 4FLXA 1HPMA 3SQ1A 3B8AX 4HUEA 3SYZA 3K5NA 4KHWA 4IG3A 3O4WA 3V1QA 5GAEP 3IS9A 4B3RK 1BQMA 3SJJA 4JRQA 3MN9A 1VQPN 1JLCA 5ELZA 2Y1JA 1NWKA 3EKSA 5AR0A 3SQ2A 4A62A 1NOYA 1S3XA 4JV5K 3JSMA 1N34K 4IXCA 3CJAA 4H5WA 1ESVA 5EX5A 4CEZA 4W5RA 3O3FA 3UKRB 4JI7K 4B1VA 1BG3A 1S6PA 3ZSZA 1M90O 3FZFA 5FROA 3QNNA 1QZ6A 4LSNA 2VG5A 2DFHA 1YJ9N 4M7YA 1KC8O 4M3RA 3CG7A 4CJ5A 3ULEB 2XO7A 4B9TA 4ELTA 4NCBA 4KI6A 3G10A 1LW0A 1NU0A 4BRFA 4CF9A 1N33K 3TSUA 3VF4A 2IVNA 4DTPA 4AILC 4FWRA 5FPNA 3OYBA 3O3HA 4WE1A 1HYZA 4Z94A 1NOZA 3ASMA 4WCEL 3P1GA 1QVGM 1SKWA 1TVRA 2E8AA 1KLMA 2FC0A 1L3UA 1TKZA 5JMVA 3ZX3A 1YF5L 1W0HA 5M1PA 4YOWA 1YTAA 3QETA 1KVAA 1LWEA 4Z4FA 4E1JA 3I8DA 4KO0A 3U3GA 1EP4A 4IOXA 3MK6A 2A1SA 1S1WA 2FSNA 4O5FA 1ITGA 1U6ZA 4C8NA 3F9KA 2ASPA 2Q1NA 4GVEA 1VHXA 1YVUA 5AQGA 3ZETA 3KK7A 3H46O 5AQTA 2IS3A 1JLEA 2Q36A 4HHTA 5KGWA 3E01A 5J2QA 1VSFA 2ATQA 1X9WA 1A5WA 3C94A 4DSFA 3O4QA 1DT9A 3NGYA 1KAYA 2PAVA 4EP4A 4B3OA 3MMVA 1J54A 4BGAA 4DV4K 1NMNA 4CE9A 3M8QA 1RTHA 2VG7A 3GE1A 4BRQA 4FJKA 3NF8A 4R5PA 4FZZA 4MFBA 5FPMA 3O9TA 4KH6A 1RTJA 4YORA 1YUWA 4H03B 2UUBK 1JCGA 2E2PA 4HUFA 1CXUA 2VGMA 3J7ZO 4FM0A 4BR2A 4B9SA 3KLFA 4BC3A 1RT2A 2CH6A 2RKIA 5JVHL 5E41A 4DTOA 3GOIA 4E1NA 5I3UA 3VEZA 4FWNA 3OW2M 4JHDA 4CGHA 3O1BA 3LP2A 5HROA 1K9MO 3BZCA 4BVPA 4JHDB 2JGUA 3O08A 4BE1A 3ENHA 3SPZA 1OH5A 1J5EK 4F3OA 3CIPA 4H4OA 4JI3K 1IH7A 1RDCA 5C2DA 2QWRA 1JXEA 1VSHA 4CFCA 3OYLA 1YITN 3SNNA 3RWUA 1MDUB 2ZM6K 2YV0X 2XY6A 5BPLA 1LAVA 1ZBUA 4YOYA 4IEEA 4EP5A 4CJWA 1RDDA 2LSNA 5C2FA 3OYKA 3CCUN 4OKKA 2I7NA 1HPZA 5A2QO 4KHPK 3IRXA 4Z4HA 3TAMA 3DLLL 1RNHA 4CZFA 3WEEA 3J80O 1WLJA 3F9MA 1NK0A 2VWKA 4NCAA 1VQ7N 2Q2RA 3KTQA 1REVA 1U45A 1U49A 3QMLA 1N36K 4F3TA 5JLHA 4PY5A 2QWNA 3NF6A 4CGDA 3WQUA 1WBDA 5FLXO 4FSVA 4JI5K 4B9NA 3CJBA 3EE8A 3IMXA 4CJKA 1TK8A 4CEEA 3AVBA 3AY9A 2WC9A 3DLRA 4LFBK 4BC5A 5HRNA 3LP3A 3TWHA 3CPWM 1GLJO 3BZKA 3VMFB 4IO8A 5EU7A 2XY7A 4CEAA 4FZXC 2F9WA 3NH0A 4TSXA 1K8KB 1NBWA 3KKRA 2IDOA 3CJ9A 1BO5O 4DR7K 1KXPA 3FLCO 1NGCA 2QWMA 4FWQA 2OTLN 3H1QA 3ID6A 1ZC6A 1JXBA 3KHYA 3NAEA 2D5RA 4FLUA 4FO0A 3LM2A 4YOVA 3C6HA 3QLHA 2XY8A 3VENA 3H6EA 1TL1A 4M7XA 4BG9A 3WXKA 2F9TA 4F8RA 1KD1O 3BGRA 1ASVA 1ASWA 3DRRA 3LDPA 3TSQA 5J1EA 1UA1A 1WSIA 1VQ5N 1ZBFA 2QWOA 1T44A 3ZSOA 2BH1A 3C7NA 1S1UA 3AO4A 4CI6A 4OJRA 4CFDA 1HKCA 5FPEA 3OVNA 2E88A 3VQDA 3KLGA 2V51B 4CW7B 1DTTA 3HXMA 2NRHA 3S3MA 3VQ9A 4C8KA 3O4NA 1DEJA 1D9DA 1NGJA 2OANA 3VQ5A 2A5XA 3MXMA 2FF6A 4HWIA 2O8DB 3S3OA 1S1TA 3HPGA 3U3YA 4FXDA 3E9OA 3E9PA 1B9DA 4M45A 4DV6K 3P39A 1Q9XA 2OA8A 4H4MA 2ZJQL 1X1PA 4CZHA 3KK3A 1RDBA 1IO2A 2PZSA 5JICA 3M5RA 1F21A 3KIOA 2BE2A 1R59O 3OYIA 3NHGA 3L8BA 2P9PA 1RTIA 2HNYA 4DR6K 2G8HA 3D2EB 2ZQBA 5TKWA 4JS5A 1HLUA 4ID5A 3UB5A 3PUFA 5GINA 3V9XA 1EKEA 1BGXT 5AQHA 4A5AA 2WBNA 4WQ5C 4CJUA 1MA9B 1BA0A 2G8IA 4DQPA 3P83D 3K5MA 4EFHA 3ZSRA 3DXKA 5C24A 4CF1A 4BRMA 4FWSA 4O0JA 4DSLA 1TUUA 3DXKB 4FJIA 3DOLA 4E7KA 2GWJA 3DLHA 1J53A 4BE0A 3LL3A 1YT3A 3A5MC 5AFUH 5SZTA 3SI6A 1U47A 1SKSA 2PYLA 1NJYA 2QXFA 3EN9A 4RW7A 4O5BA 4ISFA 3ZT0A 3OYAA 3LANA 4A57A 3ZT4A 4E7HA 3TPQA 2HBMA 3EY1A 4FWOA 4PKHA 1V4SA 4DWIA 4O55A 3LWMA 2QXLA 3MECA 3WNEA 4BE2A 4BC4A 1NGIA 4DQIA 4JI0K 4NLCA 4ZTFA 2H3GX 3CJCA 4N47A 2ITMA 3TAQA 4FJJA 1QHTA 4BREA 1VAZA 3EYZA 3O1WA 1WUAA 4CD3A 3PIPL 4FJMA 3C0BA 3LZIA 1RDWX 1TKTA 3RRGA 5BPMA 1KQSM 2HBKA 1EWRA 5GIOA 5T7BA 2O8EA 2KZZA 1NGBA 4WYBA 3OYJA 1XHXA 3VEWA 4DU3A 3AVAA 4DV1K 4CZMA 5AZJB 4O0IA 3C95A 3GG4A 2VWJA 5GAGP 1Q86O 3RMDA 1TK0A 2E6LA 3C6UA 4FW2A 4DFPA 1XI1A 1Z6RA 3OBWA 4RW4A 4HTUA 3K5LA 3C6TA 5BN8A 4WQ4C 4M42A 3HO1A 1O13A 4OGEA 4DSEA 3FGUA 2Y1IA 2KZMA 3MX5A 2NUBA 3QESA 3RVCA 1GLCG 3THWA 4ISEA 2HHXA 5AQSA 3M8RA 1NK7A 1RT3A 3B6OA 4JKHA 4OKEA 2UXBK 1BU6O 1OH7A 3QICA 4J2BA 3DJCA 4QAGA 1ZBIA 2ZJRL 3CC4N 1ATSA 3O9QA 3OS0A 3VQPA 4LF6K 3KZBA 5AQKA 2P5GA 1LCUA 1BI4A 2B6AA 4IFVA 1KAXA 3RSEA 2HF4A 1BA1A 3TARA 3RSEB 4DTXA 5AQVA 2PFUA 3THVA 4DS4A 5KPZA 1MWMA 5LJVA 3AO2A 1BISA 5KTQA 3RR7A 4AM7A 2IOCA 2HBLA 4NB4A 4GNIA 3LDSA 1QS4A 4JNEA 4BR0A 1N6QA 4PL7A 3WNHA 5BRFA 4OPJA 4F4KA 3HSCA 4FPAA 3MN7A 3NE6A 2P9NB 2X6SA 4IJNA 1HKBA 3V1RA 4DG1A 1Q81O 4DTSA 1TYQB 2P9KA 4YY3K 3RMAA 4JKFA 2D0CA 2P9KB 3SUOA 2F8TA 3WXIA 4BROA 3KK2A 4DSKA 1YI2N 3THXA 3B6PA 3CJ1A 1ASUA 4CZLA 3THXB 5AFUA 4CECA 3KLEA 2D0OA 3JAMO 1Q82O 4AF1A 1RT5A 4OPHA 4CHQA 3CCRN 4F9OA 2F4VK 3D2FA 3VGMA 4CJ4A 2WFBA 2RN2A 4DFKA 3D2FB 3WNGA 1BOTO 1IBLK 2IIRA 2VGNA 2P9IA 1Z05A 1UAXA 2OPRA 2P9IB 2V52B 1VSEA 3KWGA 3ZCMA 1NGHA 3NMUA 5FPDA 2E1YA 3WQTA 3FFKB 1N8RO 4PQUA 2FBYA 1GOCA 1D9FA 4DTJA 5AZIA 3L2VA 2X74A 4ELVA 5AZIB 4JKDA 4O4GA 4Y1DA 4BRDA 1ILYA 4IG0A 5JS2A 4XH4A 2I7PA 1X3MA 4JI8K 3JXUA 3T1YK 4BG8A 4HTLA 3U9ZA 5M1KA 2ZE2A 4KBOA 3TANA
chains in the Genus database with same CATH topology
3KLHA 3HT3A 2ETJA 4DQRA 3S3NA 1RT2A 4M3TA 3NCIA 2OPSA 1WSHA 3OYGA 1WSJA 1RCHA 3AA5X 4JLHA 2RKIA 2GUIA 5E41A 3V9WA 4ELUA 4HCCA 4N41A 1VK0A 3IG1A 4DTOA 4E1NA 3AVIA 4LH4A 5I3UA 3AA3A 3HP6A 4B8CA 1D5AA 3QO9A 4CGHA 3SUQA 3LAKA 3LP2A 4YNQA 5HROA 1ZBLA 3G0ZA 4BE1A 3ZSVA 1N5YA 2JGUA 1Q8IA 2VG6A 3SPZA 2KQ2A 4CEBA 3O3GA 4I7FA 3OJSA 4H4OA 2G8UA 1BIUA 1IH7A 1RDCA 3NBPA 1LWCA 1Y97A 1L3VA 3HL8A 4IDKA 1JXEA 3ALYA 5CY4A 1VSHA 2GV9A 4CFCA 3OYLA 3OJUA 3SNNA 3RWUA 3NH2A 4CESA 2YV0X 4KV8A 5K14A 4CJQA 2XY6A 4E0DA 1LAVA 1RBSA 1ZBUA 4C8OA 2Z1GA 4EP5A 3AVLA 4CJWA 4DFMA 1ZBHA 4JRPA 1IG9A 1RDDA 1TAUA 3NFAA 2LSNA 4NYFA 3OYKA 2IGIA 5J2MA 1W9HA 2BANA 2YHBA 3AVHA 1HPZA 4OKKA 3ZT3A 4CIGA 4DLGA 1RILA 1KTQA 3IRXA 4FJ8A 4Z4HA 3TR8A 4ZHRA 3DYAA 4K8XA 1C0MA 2HHQA 4H8KA 3TAMA 3OYCA 1RNHA 4RW6A 4KHNA 3AVGA 3ISNC 1WLJA 3L2UA 1VSIA 3L2QA 1NK0A 2VWKA 4KTZA 4KTQA 4EZ9A 1KFSA 1A5XA 1HYSA 1JLBA 4NCAA 4B9LA 5FRNA 3VQ6A 2HHSA 3OYHA 2F8SA 4B08A 1JLFA 4J2DA 3H08A 3NH1A 3RRHA 3KTQA 3KD5E 1REVA 4C8MA 4CHOA 3K2PA 3ZSYA 1U45A 1U49A 4FLTA 1X9MA 2JLEA 4MQ3A 3PO4A 3VQ8A 3ZT1A 4F3TA 3I0SA 4PY5A 2Z1HA 3NF6A 4CGDA 2QKBA 4CK3A 3RMBA 5HBMA 4BWJA 4B9NA 1VRTA 3DM2A 1RBVA 4CEQA 4CJKA 3T19A 1TK8A 2B4JA 4CEEA 2X78A 3AVBA 3S9HA 3T1AA 4CF0A 1BQNA 2OPQA 2PYJA 4CIEA 3DLRA 1RBUA 1B9FA 3QIPA 5HRNA 3LP3A 3TWHA 4B9UA 1XWLA 3K59A 4RW9A 5EU7A 4DMNA 3PX0A 4OPKA 4CEAA 4CJLA 2XY7A 4NCGA 4F2RA 1ZYQA 1G15A 4CIFA 4CF2A 4FZXC 4AHTA 1VSDA 3L3VA 4KRFA 4KFBA 3NH0A 4TSXA 1TK5A 3KKRA 3OS1A 1KCFA 2IDOA 1NK4A 3V4IA 1CZBA 4CF8A 4DS5A 1J5OA 3PY8A 3IAYA 1TV6A 4M3YA 4FJXA 4Z4IA 1NK5A 4DSJA 1JXBA 2HHTA 1LW2A 2RPIA 4E7IA 3JYTA 2D5RA 3NAEA 4E7LA 1R0AA 4FYDA 2DTUA 4FLUA 1LWFA 3LALA 1JL2A 3SCXA 3LP1A 3QLHA 2XY8A 1BCMA 4FZYA 4FW1A 1TL1A 4FK4A 3OYNA 2G8KA 3A2FA 3SV4A 4F8RA 4DF8A 4KAZA 3QEIA 2I5JA 3TI0A 3U6FA 3BGRA 1ASVA 3ZSQA 4EZ6A 4B9VA 4CJPA 3SZ2A 1ASWA 3QEXA 3DRRA 3AO3A 3CFOA 3ULDA 4KB1A 2DY4A 3OYMA 5J1EA 4CK1A 1WSIA 3TAPA 1UA1A 1NKEA 1ZBFA 4HVJA 1KVBA 5C25A 3ZSOA 1X9WA 1IKVA 3VQEA 2HB5A 4HCBA 1S1UA 3AO4A 4OJRA 4CFDA 2WOMA 3OVNA 2DFFA 3NGZA 5HRPA 2WONA 3VQDA 3OYFA 4PWDA 3KLGA 4FJJA 1DTTA 4CGJA 3HXMA 4RG8A 3L2WA 3S3MA 3VQ9A 3LWLA 3EZ5A 4FJ9A 1S5JA 4CERA 4FJGA 4C8KA 3O4NA 3ZT2A 1UA0A 1D9DA 3HJFA 1TKXA 4DQQA 1T05A 3VQ5A 4AHRA 4BWMA 3MXMA 1WSEA 1U04A 3HPHA 3V9ZA 3S3OA 2RF2A 2OPPA 1S1TA 3HPGA 3I0RA 5CYMA 4BDZA 3U3YA 4C8LA 4DSIA 4FXDA 2YNIA 4B8AB 1GOBA 1QSYA 4M45A 1B9DA 3DLKA 3DMJA 4CJEA 1NK6A 1Q9XA 2OA8A 4Y1CA 2OZSA 1EXQA 2P5OA 4J2AA 4H4MA 4FLWA 1NJZA 1X1PA 4AHSA 3L2RA 4BDYA 4CHNA 4QOZB 3KK3A 2KTQA 4I9QA 4M3XA 1RDBA 3M8PA 1IO2A 1T03A 3QEVA 4LH5A 5C42A 4CEDA 4O44A 2G8FA 2F96A 2PZSA 1SKRA 1SUQA 1F21A 1NKBA 4KHUA 3DLEA 3KIOA 1U48A 4I2PA 2BE2A 3HVTA 3V6DA 3AVCA 3MXJA 4Z4GA 1HRHA 3OYIA 3NHGA 1L3SA 1RT4A 4AH9A 3L8BA 1RTIA 3MEEA 3D0PA 4DU4A 5I42A 4M3ZA 2HNYA 4CFBA 4OLBA 4PUOA 2G8HA 4CJRA 2ZQBA 3VN5A 1WN7A 1Z25A 4JS5A 1SV5A 3DLBA 1IKXA 4ID5A 2P51A 3PUFA 1S9EA 3KK1A 5KGXA 3V9XA 1EKEA 4AHVA 1BGXT 5HRRA 1QSSA 2O4IA 2YKNA 1HQUA 1BI4B 4FVMA 2FBTA 5CZ2A 4ID1A 4F2SA 4KB0A 1QTMA 4CJUA 3UIQA 5CZ1A 3KLIA 3LP0A 3LZJA 3TAGA 4DTNA 2G8IA 4DQPA 1VSLA 4FM2A 5J2NA 4AHUA 1KRPA 3P83D 4OGCA 3K5MA 4CK2A 3PX4A 1RTDA 1D8YA 4LSLA 4DFJA 3ZSWA 3AVKA 3ZSRA 5C24A 3P5JA 4CF1A 1WAJA 4DSLA 4O0JA 4W5TA 3RTVA 3QEWA 4FJHA 2IC3A 4FJIA 3DOLA 4E7KA 1LAWA 1FKPA 1HNVA 3HP9A 3DLHA 1TGOA 1J53A 1CXQA 1FXXA 4BE0A 4FLVA 4OKJA 4Q5VA 1YT3A 3HVRA 3DOKA 3V1OA 5SZTA 3LPTA 3F73A 3SI6A 1U47A 1SKSA 1RBRA 1Q9YA 2PY5A 2PYLA 1NJYA 1S6QA 2QXFA 3QNOA 4RW7A 4O5BA 3RMCA 4L8RB 2YHAA 4M41A 1T8EA 2E4LA 4KREA 3ZT0A 3HK2A 3OYAA 1QSLA 2GBZA 2YNGA 4E89A 3LANA 4QCLA 4AHCA 1IKYA 4YFUA 1NK9A 3HSTB 2OYQA 4CJVA 5CYQA 4BDPA 3QEPA 3ZT4A 4E7HA 1WNSA 1NK8A 1SL2A 4N76A 2B5JA 1BCOA 3EY1A 4KHQA 4FK0A 3SUNA 4J2EA 1EX4A 1X9SA 4DWIA 4O55A 3LWMA 4ICLA 1XHZA 3MECA 3WNEA 4DU1A 4BE2A 1VSMA 2Z1IA 2KFNA 4W5NA 3SPYA 4DQIA 1WAFA 1C1AA 3NDKA 2HVIA 3AV9A 3MAQA 4FJ7A 3OYEA 4ZTFA 4W5QA 2XY5A 3OS2A 1S1VA 3AVNA 1C0TA 3V81A 4N56A 4FM1A 3LAMA 2ITGA 4N47A 4DTRA 5HLFA 4B9MA 2FBXA 4CGFA 3TAQA 2HW3A 2XRIA 3L3UA 3RR8A 1IKWA 1QHTA 2A1RA 4GMJB 4CJFA 4CJTA 3EYZA 4DTMA 1NJXA 1JLQA 1TL3A 3AVMA 1LV5A 2YKMA 3KD1E 4F3OA 3LZIA 4K8ZA 4FJMA 4KHYA 1VSJA 1B92A 1TKTA 1KFDA 3RRGA 3SQ0A 5HRSA 3HM9A 2HHWA 3MEGA 4PA1A 1BL3A 1HQEA 1FK9A 2EX3A 5T7BA 3PX6A 1NKCA 1L5UA 4FCYA 2KZZA 1CLQA 1VRUA 3OYJA 4JS4A 1RDAA 1XHXA 3M8SA 3SUPA 3T3FA 3DRPA 4DU3A 3VQ4A 3AVAA 1S9GA 1T7PA 5FRMA 2BGGA 1BHLA 4CGGA 1C0UA 4O0IA 2HVHA 2HHVA 3HYFA 4KTWA 3TAFA 3C95A 2W42A 4W5OA 2VWJA 5HP1A 2IAJA 3AVFA 3RMDA 1JLAA 1UOCA 1TK0A 2D0BA 4KKOA 4FLXA 3VQAA 5KI6A 2G8VA 3SQ1A 4Q0BA 4HUEA 2E6LA 3C6UA 4FW2A 3SYZA 4DFPA 3CFPA 3K5NA 4FLZA 1XI1A 4KHWA 4IG3A 4RW4A 2AJQA 3V1QA 3WNFA 4HTUA 1Z26A 4DTUA 3K5LA 3AA2A 2QKKA 1RBTA 2KW4A 3C6TA 1KSPA 4DLEA 4M42A 3HO1A 4DQSA 2OZMA 3IS9A 4OGEA 2Q3SA 4DSEA 4XIUA 1DLOA 3FFIA 2Y1IA 1BQMA 3SJJA 4JRQA 2KZMA 2X6NA 1JLCA 2NUBA 3QIOA 2R7YA 4FJLA 2Y1JA 2G8WA 4M3UA 3QESA 1YTUA 1RT7A 2HHXA 1HJRA 3TAEA 3M8RA 4ZTJA 3SQ2A 1NK7A 1RT3A 3B6OA 3QERA 3VQ7A 4OKEA 1NOYA 2FBVA 3OYDA 3JSMA 4J2BA 3VQQA 5DMRA 3DRSA 4NYNA 4QAGA 1ZBIA 2KFZA 2YNFA 3D45A 4IBNA 3VQCA 4CEZA 3QINA 3OS0A 4W5RA 3VQPA 1HMVA 3O3FA 2XHBA 4OVLA 1C1BA 1EETA 2DFEA 2BDPA 2P5GA 4FJNA 1BIZA 1BI4A 2B6AA 3NGIA 1S6PA 4IFVA 3ZSZA 4E1MA 3MEDA 5FROA 3QNNA 1C6VA 4CJSA 4LD0A 4LSNA 2VG5A 2DFHA 1FKOA 3VQBA 3TARA 1O1WA 4FJ5A 1A5VA 4BACA 3CQ8A 3NF7A 3ITHA 4DTXA 4CCHA 5FDLA 4M3RA 3CG7A 3AO5A 4CJ5A 1HNIA 2O4GA 3AA4A 2XO7A 3THVA 4B9TA 4DS4A 4GVMA 4ELTA 4NCBA 3SV3A 4KI6A 3KKSA 2Z1JA 3AO2A 3G10A 4Z4EA 1BISA 5KTQA 1LW0A 4CF9A 3RR7A 4LY7A 1U4BA 2IOCA 3PV8A 1CZ9A 1VSKA 2D0AA 4DTPA 2QK9A 4AILC 5DK5A 4CJ3A 3OYBA 3O3HA 4WE1A 3LDSA 1QS4A 1HYZA 1NOZA 1QQCA 1K6YA 3ASMA 1N6QA 3P1GA 4CHYA 3WNHA 4CHPA 4G1QA 1SKWA 3AO1A 4OPJA 3OY9A 1TVRA 1TAQA 3NF9A 1KLMA 4FK2A 1XC9A 2FC0A 4F4KA 1L3UA 4FLYA 1I3AA 1TKZA 2ZD1A 2X6SA 3NE6A 1JKHA 4DG1A 3V1RA 2EHGA 4CEFA 4E7JA 1W0HA 4OLAA 4DTSA 4IKFA 1JLGA 3RMAA 5JS1A 1SL0A 1YTAA 2D0CA 3QETA 3SUOA 1J9AA 2F8TA 1KVAA 1LWEA 4GW6A 3K57A 5KRSA 3V9UA 1NJWA 1RT1A 4Z4FA 3KK2A 2P1JA 3I8DA 4DSKA 2HNZA 4KO0A 4KI4A 3U3GA 1EP4A 3B6PA 1I39A 1WSGA 4CFAA 1ASUA 2A1SA 1S1WA 4RW8A 2HMIA 4CECA 1ITGA 3KLEA 1KLNA 2HHUA 4C8NA 3F9KA 2E6MA 3VA3A 1L3TA 1MU2A 5SWMA 3MXIA 1YVUA 1RT5A 4CHQA 5KRTA 4DF4A 3CM6A 3PO5A 4CHZA 2IS3A 1JLEA 1KVCA 2RN2A 4CJ4A 4HHTA 3E01A 5KGWA 5J2QA 1S1XA 1VSFA 2ATQA 3CYMA 1A5WA 3WNGA 4UQGA 4I9LA 3ZSXA 3K58A 4CEOA 4DFKA 2YNHA 3C94A 4N5SA 4DSFA 1HYVA 3K5OA 1UAXA 2HNDA 2OPRA 3AVJA 3O4QA 3SQ4A 1WSFA 3NGYA 5D3GA 3HPOA 1VSEA 4EP4A 5J2PA 3ZCMA 4B3OA 4HUGA 4M3WA 1C1CA 1J54A 1RT6A 1DTQA 1SL1A 4IFYA 4PQUA 4CGIA 2FBYA 1GOCA 1D9FA 3CM5A 4DTJA 4CE9A 4KPYA 3L2VA 2X74A 1RTHA 3M8QA 4ELVA 3LPUA 2VG7A 4FJKA 3KJVA 4O4GA 3VA0A 3DLGA 3NF8A 4I2QA 4Y1DA 4MFBA 4R5PA 4KHSA 4IG0A 5JS2A 4E3SA 4FZZA 1RTJA 3CFRA 1GOAA 3DI6A 3BDPA 1QE1A 4Z4CA 1JL1A 4Z0UA 1TKDA 4HUFA 1CXUA 3V9SA 3TABA 1UWBA 4E19A 4FM0A 2ZE2A 4B9SA 3KLFA 3TANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLH A;  3HT3 A;  2ETJ A;  4DQR A;  3S3N A;  1RT2 A;  4M3T A;  3NCI A;  2OPS A;  1WSH A;  3OYG A;  1WSJ A;  1RCH A;  3AA5 X;  4JLH A;  2RKI A;  2GUI A;  5E41 A;  3V9W A;  4ELU A;  4HCC A;  4N41 A;  1VK0 A;  3IG1 A;  4DTO A;  4E1N A;  3AVI A;  4LH4 A;  5I3U A;  3AA3 A;  3HP6 A;  4B8C A;  1D5A A;  3QO9 A;  4CGH A;  3SUQ A;  3LAK A;  3LP2 A;  4YNQ A;  5HRO A;  1ZBL A;  3G0Z A;  4BE1 A;  3ZSV A;  1N5Y A;  2JGU A;  1Q8I A;  2VG6 A;  3SPZ A;  2KQ2 A;  4CEB A;  3O3G A;  4I7F A;  3OJS A;  4H4O A;  2G8U A;  1BIU A;  1IH7 A;  1RDC A;  3NBP A;  1LWC A;  1Y97 A;  1L3V A;  3HL8 A;  4IDK A;  1JXE A;  3ALY A;  5CY4 A;  1VSH A;  2GV9 A;  4CFC A;  3OYL A;  3OJU A;  3SNN A;  3RWU A;  3NH2 A;  4CES A;  2YV0 X;  4KV8 A;  5K14 A;  4CJQ A;  2XY6 A;  4E0D A;  1LAV A;  1RBS A;  1ZBU A;  4C8O A;  2Z1G A;  4EP5 A;  3AVL A;  4CJW A;  4DFM A;  1ZBH A;  4JRP A;  1IG9 A;  1RDD A;  1TAU A;  3NFA A;  2LSN A;  4NYF A;  3OYK A;  2IGI A;  5J2M A;  1W9H A;  2BAN A;  2YHB A;  3AVH A;  1HPZ A;  4OKK A;  3ZT3 A;  4CIG A;  4DLG A;  1RIL A;  1KTQ A;  3IRX A;  4FJ8 A;  4Z4H A;  3TR8 A;  4ZHR A;  3DYA A;  4K8X A;  1C0M A;  2HHQ A;  4H8K A;  3TAM A;  3OYC A;  1RNH A;  4RW6 A;  4KHN A;  3AVG A;  3ISN C;  1WLJ A;  3L2U A;  1VSI A;  3L2Q A;  1NK0 A;  2VWK A;  4KTZ A;  4KTQ A;  4EZ9 A;  1KFS A;  1A5X A;  1HYS A;  1JLB A;  4NCA A;  4B9L A;  5FRN A;  3VQ6 A;  2HHS A;  3OYH A;  2F8S A;  4B08 A;  1JLF A;  4J2D A;  3H08 A;  3NH1 A;  3RRH A;  3KTQ A;  3KD5 E;  1REV A;  4C8M A;  4CHO A;  3K2P A;  3ZSY A;  1U45 A;  1U49 A;  4FLT A;  1X9M A;  2JLE A;  4MQ3 A;  3PO4 A;  3VQ8 A;  3ZT1 A;  4F3T A;  3I0S A;  4PY5 A;  2Z1H A;  3NF6 A;  4CGD A;  2QKB A;  4CK3 A;  3RMB A;  5HBM A;  4BWJ A;  4B9N A;  1VRT A;  3DM2 A;  1RBV A;  4CEQ A;  4CJK A;  3T19 A;  1TK8 A;  2B4J A;  4CEE A;  2X78 A;  3AVB A;  3S9H A;  3T1A A;  4CF0 A;  1BQN A;  2OPQ A;  2PYJ A;  4CIE A;  3DLR A;  1RBU A;  1B9F A;  3QIP A;  5HRN A;  3LP3 A;  3TWH A;  4B9U A;  1XWL A;  3K59 A;  4RW9 A;  5EU7 A;  4DMN A;  3PX0 A;  4OPK A;  4CEA A;  4CJL A;  2XY7 A;  4NCG A;  4F2R A;  1ZYQ A;  1G15 A;  4CIF A;  4CF2 A;  4FZX C;  4AHT A;  1VSD A;  3L3V A;  4KRF A;  4KFB A;  3NH0 A;  4TSX A;  1TK5 A;  3KKR A;  3OS1 A;  1KCF A;  2IDO A;  1NK4 A;  3V4I A;  1CZB A;  4CF8 A;  4DS5 A;  1J5O A;  3PY8 A;  3IAY A;  1TV6 A;  4M3Y A;  4FJX A;  4Z4I A;  1NK5 A;  4DSJ A;  1JXB A;  2HHT A;  1LW2 A;  2RPI A;  4E7I A;  3JYT A;  2D5R A;  3NAE A;  4E7L A;  1R0A A;  4FYD A;  2DTU A;  4FLU A;  1LWF A;  3LAL A;  1JL2 A;  3SCX A;  3LP1 A;  3QLH A;  2XY8 A;  1BCM A;  4FZY A;  4FW1 A;  1TL1 A;  4FK4 A;  3OYN A;  2G8K A;  3A2F A;  3SV4 A;  4F8R A;  4DF8 A;  4KAZ A;  3QEI A;  2I5J A;  3TI0 A;  3U6F A;  3BGR A;  1ASV A;  3ZSQ A;  4EZ6 A;  4B9V A;  4CJP A;  3SZ2 A;  1ASW A;  3QEX A;  3DRR A;  3AO3 A;  3CFO A;  3ULD A;  4KB1 A;  2DY4 A;  3OYM A;  5J1E A;  4CK1 A;  1WSI A;  3TAP A;  1UA1 A;  1NKE A;  1ZBF A;  4HVJ A;  1KVB A;  5C25 A;  3ZSO A;  1X9W A;  1IKV A;  3VQE A;  2HB5 A;  4HCB A;  1S1U A;  3AO4 A;  4OJR A;  4CFD A;  2WOM A;  3OVN A;  2DFF A;  3NGZ A;  5HRP A;  2WON A;  3VQD A;  3OYF A;  4PWD A;  3KLG A;  4FJJ A;  1DTT A;  4CGJ A;  3HXM A;  4RG8 A;  3L2W A;  3S3M A;  3VQ9 A;  3LWL A;  3EZ5 A;  4FJ9 A;  1S5J A;  4CER A;  4FJG A;  4C8K A;  3O4N A;  3ZT2 A;  1UA0 A;  1D9D A;  3HJF A;  1TKX A;  4DQQ A;  1T05 A;  3VQ5 A;  4AHR A;  4BWM A;  3MXM A;  1WSE A;  1U04 A;  3HPH A;  3V9Z A;  3S3O A;  2RF2 A;  2OPP A;  1S1T A;  3HPG A;  3I0R A;  5CYM A;  4BDZ A;  3U3Y A;  4C8L A;  4DSI A;  4FXD A;  2YNI A;  4B8A B;  1GOB A;  1QSY A;  4M45 A;  1B9D A;  3DLK A;  3DMJ A;  4CJE A;  1NK6 A;  1Q9X A;  2OA8 A;  4Y1C A;  2OZS A;  1EXQ A;  2P5O A;  4J2A A;  4H4M A;  4FLW A;  1NJZ A;  1X1P A;  4AHS A;  3L2R A;  4BDY A;  4CHN A;  4QOZ B;  3KK3 A;  2KTQ A;  4I9Q A;  4M3X A;  1RDB A;  3M8P A;  1IO2 A;  1T03 A;  3QEV A;  4LH5 A;  5C42 A;  4CED A;  4O44 A;  2G8F A;  2F96 A;  2PZS A;  1SKR A;  1SUQ A;  1F21 A;  1NKB A;  4KHU A;  3DLE A;  3KIO A;  1U48 A;  4I2P A;  2BE2 A;  3HVT A;  3V6D A;  3AVC A;  3MXJ A;  4Z4G A;  1HRH A;  3OYI A;  3NHG A;  1L3S A;  1RT4 A;  4AH9 A;  3L8B A;  1RTI A;  3MEE A;  3D0P A;  4DU4 A;  5I42 A;  4M3Z A;  2HNY A;  4CFB A;  4OLB A;  4PUO A;  2G8H A;  4CJR A;  2ZQB A;  3VN5 A;  1WN7 A;  1Z25 A;  4JS5 A;  1SV5 A;  3DLB A;  1IKX A;  4ID5 A;  2P51 A;  3PUF A;  1S9E A;  3KK1 A;  5KGX A;  3V9X A;  1EKE A;  4AHV A;  1BGX T;  5HRR A;  1QSS A;  2O4I A;  2YKN A;  1HQU A;  1BI4 B;  4FVM A;  2FBT A;  5CZ2 A;  4ID1 A;  4F2S A;  4KB0 A;  1QTM A;  4CJU A;  3UIQ A;  5CZ1 A;  3KLI A;  3LP0 A;  3LZJ A;  3TAG A;  4DTN A;  2G8I A;  4DQP A;  1VSL A;  4FM2 A;  5J2N A;  4AHU A;  1KRP A;  3P83 D;  4OGC A;  3K5M A;  4CK2 A;  3PX4 A;  1RTD A;  1D8Y A;  4LSL A;  4DFJ A;  3ZSW A;  3AVK A;  3ZSR A;  5C24 A;  3P5J A;  4CF1 A;  1WAJ A;  4DSL A;  4O0J A;  4W5T A;  3RTV A;  3QEW A;  4FJH A;  2IC3 A;  4FJI A;  3DOL A;  4E7K A;  1LAW A;  1FKP A;  1HNV A;  3HP9 A;  3DLH A;  1TGO A;  1J53 A;  1CXQ A;  1FXX A;  4BE0 A;  4FLV A;  4OKJ A;  4Q5V A;  1YT3 A;  3HVR A;  3DOK A;  3V1O A;  5SZT A;  3LPT A;  3F73 A;  3SI6 A;  1U47 A;  1SKS A;  1RBR A;  1Q9Y A;  2PY5 A;  2PYL A;  1NJY A;  1S6Q A;  2QXF A;  3QNO A;  4RW7 A;  4O5B A;  3RMC A;  4L8R B;  2YHA A;  4M41 A;  1T8E A;  2E4L A;  4KRE A;  3ZT0 A;  3HK2 A;  3OYA A;  1QSL A;  2GBZ A;  2YNG A;  4E89 A;  3LAN A;  4QCL A;  4AHC A;  1IKY A;  4YFU A;  1NK9 A;  3HST B;  2OYQ A;  4CJV A;  5CYQ A;  4BDP A;  3QEP A;  3ZT4 A;  4E7H A;  1WNS A;  1NK8 A;  1SL2 A;  4N76 A;  2B5J A;  1BCO A;  3EY1 A;  4KHQ A;  4FK0 A;  3SUN A;  4J2E A;  1EX4 A;  1X9S A;  4DWI A;  4O55 A;  3LWM A;  4ICL A;  1XHZ A;  3MEC A;  3WNE A;  4DU1 A;  4BE2 A;  1VSM A;  2Z1I A;  2KFN A;  4W5N A;  3SPY A;  4DQI A;  1WAF A;  1C1A A;  3NDK A;  2HVI A;  3AV9 A;  3MAQ A;  4FJ7 A;  3OYE A;  4ZTF A;  4W5Q A;  2XY5 A;  3OS2 A;  1S1V A;  3AVN A;  1C0T A;  3V81 A;  4N56 A;  4FM1 A;  3LAM A;  2ITG A;  4N47 A;  4DTR A;  5HLF A;  4B9M A;  2FBX A;  4CGF A;  3TAQ A;  2HW3 A;  2XRI A;  3L3U A;  3RR8 A;  1IKW A;  1QHT A;  2A1R A;  4GMJ B;  4CJF A;  4CJT A;  3EYZ A;  4DTM A;  1NJX A;  1JLQ A;  1TL3 A;  3AVM A;  1LV5 A;  2YKM A;  3KD1 E;  4F3O A;  3LZI A;  4K8Z A;  4FJM A;  4KHY A;  1VSJ A;  1B92 A;  1TKT A;  1KFD A;  3RRG A;  3SQ0 A;  5HRS A;  3HM9 A;  2HHW A;  3MEG A;  4PA1 A;  1BL3 A;  1HQE A;  1FK9 A;  2EX3 A;  5T7B A;  3PX6 A;  1NKC A;  1L5U A;  4FCY A;  2KZZ A;  1CLQ A;  1VRU A;  3OYJ A;  4JS4 A;  1RDA A;  1XHX A;  3M8S A;  3SUP A;  3T3F A;  3DRP A;  4DU3 A;  3VQ4 A;  3AVA A;  1S9G A;  1T7P A;  5FRM A;  2BGG A;  1BHL A;  4CGG A;  1C0U A;  4O0I A;  2HVH A;  2HHV A;  3HYF A;  4KTW A;  3TAF A;  3C95 A;  2W42 A;  4W5O A;  2VWJ A;  5HP1 A;  2IAJ A;  3AVF A;  3RMD A;  1JLA A;  1UOC A;  1TK0 A;  2D0B A;  4KKO A;  4FLX A;  3VQA A;  5KI6 A;  2G8V A;  3SQ1 A;  4Q0B A;  4HUE A;  2E6L A;  3C6U A;  4FW2 A;  3SYZ A;  4DFP A;  3CFP A;  3K5N A;  4FLZ A;  1XI1 A;  4KHW A;  4IG3 A;  4RW4 A;  2AJQ A;  3V1Q A;  3WNF A;  4HTU A;  1Z26 A;  4DTU A;  3K5L A;  3AA2 A;  2QKK A;  1RBT A;  2KW4 A;  3C6T A;  1KSP A;  4DLE A;  4M42 A;  3HO1 A;  4DQS A;  2OZM A;  3IS9 A;  4OGE A;  2Q3S A;  4DSE A;  4XIU A;  1DLO A;  3FFI A;  2Y1I A;  1BQM A;  3SJJ A;  4JRQ A;  2KZM A;  2X6N A;  1JLC A;  2NUB A;  3QIO A;  2R7Y A;  4FJL A;  2Y1J A;  2G8W A;  4M3U A;  3QES A;  1YTU A;  1RT7 A;  2HHX A;  1HJR A;  3TAE A;  3M8R A;  4ZTJ A;  3SQ2 A;  1NK7 A;  1RT3 A;  3B6O A;  3QER A;  3VQ7 A;  4OKE A;  1NOY A;  2FBV A;  3OYD A;  3JSM A;  4J2B A;  3VQQ A;  5DMR A;  3DRS A;  4NYN A;  4QAG A;  1ZBI A;  2KFZ A;  2YNF A;  3D45 A;  4IBN A;  3VQC A;  4CEZ A;  3QIN A;  3OS0 A;  4W5R A;  3VQP A;  1HMV A;  3O3F A;  2XHB A;  4OVL A;  1C1B A;  1EET A;  2DFE A;  2BDP A;  2P5G A;  4FJN A;  1BIZ A;  1BI4 A;  2B6A A;  3NGI A;  1S6P A;  4IFV A;  3ZSZ A;  4E1M A;  3MED A;  5FRO A;  3QNN A;  1C6V A;  4CJS A;  4LD0 A;  4LSN A;  2VG5 A;  2DFH A;  1FKO A;  3VQB A;  3TAR A;  1O1W A;  4FJ5 A;  1A5V A;  4BAC A;  3CQ8 A;  3NF7 A;  3ITH A;  4DTX A;  4CCH A;  5FDL A;  4M3R A;  3CG7 A;  3AO5 A;  4CJ5 A;  1HNI A;  2O4G A;  3AA4 A;  2XO7 A;  3THV A;  4B9T A;  4DS4 A;  4GVM A;  4ELT A;  4NCB A;  3SV3 A;  4KI6 A;  3KKS A;  2Z1J A;  3AO2 A;  3G10 A;  4Z4E A;  1BIS A;  5KTQ A;  1LW0 A;  4CF9 A;  3RR7 A;  4LY7 A;  1U4B A;  2IOC A;  3PV8 A;  1CZ9 A;  1VSK A;  2D0A A;  4DTP A;  2QK9 A;  4AIL C;  5DK5 A;  4CJ3 A;  3OYB A;  3O3H A;  4WE1 A;  3LDS A;  1QS4 A;  1HYZ A;  1NOZ A;  1QQC A;  1K6Y A;  3ASM A;  1N6Q A;  3P1G A;  4CHY A;  3WNH A;  4CHP A;  4G1Q A;  1SKW A;  3AO1 A;  4OPJ A;  3OY9 A;  1TVR A;  1TAQ A;  3NF9 A;  1KLM A;  4FK2 A;  1XC9 A;  2FC0 A;  4F4K A;  1L3U A;  4FLY A;  1I3A A;  1TKZ A;  2ZD1 A;  2X6S A;  3NE6 A;  1JKH A;  4DG1 A;  3V1R A;  2EHG A;  4CEF A;  4E7J A;  1W0H A;  4OLA A;  4DTS A;  4IKF A;  1JLG A;  3RMA A;  5JS1 A;  1SL0 A;  1YTA A;  2D0C A;  3QET A;  3SUO A;  1J9A A;  2F8T A;  1KVA A;  1LWE A;  4GW6 A;  3K57 A;  5KRS A;  3V9U A;  1NJW A;  1RT1 A;  4Z4F A;  3KK2 A;  2P1J A;  3I8D A;  4DSK A;  2HNZ A;  4KO0 A;  4KI4 A;  3U3G A;  1EP4 A;  3B6P A;  1I39 A;  1WSG A;  4CFA A;  1ASU A;  2A1S A;  1S1W A;  4RW8 A;  2HMI A;  4CEC A;  1ITG A;  3KLE A;  1KLN A;  2HHU A;  4C8N A;  3F9K A;  2E6M A;  3VA3 A;  1L3T A;  1MU2 A;  5SWM A;  3MXI A;  1YVU A;  1RT5 A;  4CHQ A;  5KRT A;  4DF4 A;  3CM6 A;  3PO5 A;  4CHZ A;  2IS3 A;  1JLE A;  1KVC A;  2RN2 A;  4CJ4 A;  4HHT A;  3E01 A;  5KGW A;  5J2Q A;  1S1X A;  1VSF A;  2ATQ A;  3CYM A;  1A5W A;  3WNG A;  4UQG A;  4I9L A;  3ZSX A;  3K58 A;  4CEO A;  4DFK A;  2YNH A;  3C94 A;  4N5S A;  4DSF A;  1HYV A;  3K5O A;  1UAX A;  2HND A;  2OPR A;  3AVJ A;  3O4Q A;  3SQ4 A;  1WSF A;  3NGY A;  5D3G A;  3HPO A;  1VSE A;  4EP4 A;  5J2P A;  3ZCM A;  4B3O A;  4HUG A;  4M3W A;  1C1C A;  1J54 A;  1RT6 A;  1DTQ A;  1SL1 A;  4IFY A;  4PQU A;  4CGI A;  2FBY A;  1GOC A;  1D9F A;  3CM5 A;  4DTJ A;  4CE9 A;  4KPY A;  3L2V A;  2X74 A;  1RTH A;  3M8Q A;  4ELV A;  3LPU A;  2VG7 A;  4FJK A;  3KJV A;  4O4G A;  3VA0 A;  3DLG A;  3NF8 A;  4I2Q A;  4Y1D A;  4MFB A;  4R5P A;  4KHS A;  4IG0 A;  5JS2 A;  4E3S A;  4FZZ A;  1RTJ A;  3CFR A;  1GOA A;  3DI6 A;  3BDP A;  1QE1 A;  4Z4C A;  1JL1 A;  4Z0U A;  1TKD A;  4HUF A;  1CXU A;  3V9S A;  3TAB A;  1UWB A;  4E19 A;  4FM0 A;  2ZE2 A;  4B9S A;  3KLF A;  3TAN A; 
#chains in the Genus database with same CATH topology
 4PKG A;  3KLH A;  2ETJ A;  1GLF O;  4DQR A;  3S3N A;  4UY8 O;  2OPS A;  2E2Q A;  3BUZ B;  3AA5 X;  4JKA A;  4JI1 K;  4N41 A;  1VK0 A;  4OO1 J;  1SQK A;  5GIP A;  3AVI A;  3AA3 A;  3MCP A;  3HP6 A;  1VQ8 N;  3QO9 A;  4YNQ A;  1ZBL A;  1N5Y A;  3UKR A;  1Q8I A;  3SAH A;  2KQ2 A;  2NRW A;  3O3G A;  3OJS A;  3G6E N;  1EWQ A;  4DR4 K;  3NBP A;  3ATU A;  3HL8 A;  3ALY A;  4CZJ A;  1IBK K;  5BR9 A;  4CES A;  4E0D A;  5K14 A;  1GLE G;  3ZYY X;  3SBG A;  3ULE A;  3AVL A;  3HOT A;  1S72 N;  4QS8 A;  4JAX A;  1IG9 A;  5GAD P;  2JWK A;  4NYF A;  4DLG A;  4JI6 K;  1RIL A;  4A5B A;  2UU9 K;  4ZHR A;  2BUP A;  3CPE A;  2HHQ A;  3VET A;  4H8K A;  4DQ8 A;  3CQX A;  5EOY A;  3L2U A;  3L2Q A;  4KTZ A;  4KTQ A;  1KFS A;  1A5X A;  2NZT A;  4EAH D;  4B9L A;  5FRN A;  1JLF A;  4J2D A;  3NH1 A;  4C8M A;  4CHO A;  3K2P A;  3CF5 L;  2JLE A;  4MQ3 A;  1YXQ A;  3VQ8 A;  3ZT1 A;  3I0S A;  2Z1H A;  2QKB A;  5I9E B;  4CEQ A;  3AGR A;  3UE5 A;  4C1N K;  1GLA G;  4CIE A;  1VQ4 N;  1B9F A;  3N4Q A;  3QIP A;  4QS9 A;  3FE1 A;  3VEX A;  3VGK A;  4B9U A;  3OBY A;  3K59 A;  4AM6 A;  4RW9 A;  4DMN A;  3IFR A;  1ZYQ A;  1G15 A;  4AHT A;  1VSD A;  4KRF A;  1E4G T;  2QWQ A;  3G4S N;  1GLD G;  3SMS A;  3OS1 A;  1CZB A;  4M3Y A;  1J5O A;  1TV6 A;  4Z4I A;  4B3S K;  1Q18 A;  4E7I A;  2V7Y A;  4G9Z A;  2DTU A;  1LWF A;  4DV2 K;  1YVN A;  3SCX A;  1YAG A;  3VTI A;  4H5N A;  4FW1 A;  2G8K A;  3SV4 A;  1E4F T;  1G99 A;  4KAZ A;  2FLO A;  2I5J A;  4PL8 A;  4EZ6 A;  3SZ2 A;  2IVP A;  4CK1 A;  2D1K A;  1KVB A;  4MDA A;  3VQE A;  2HB5 A;  5MLC Q;  2UUC K;  2WOM A;  2DFF A;  3Q7B A;  2O8C A;  1GLL O;  5HRP A;  4FOE A;  5H1S Q;  2CH5 A;  2O8C B;  1SS6 A;  3MDQ A;  3BF1 A;  1S5J A;  4H0V B;  4FJG A;  1UA0 A;  4RCH A;  1BUP A;  3KWI A;  4BWM A;  3CI5 A;  2FXU A;  3W3D A;  3V9Z A;  3UKU B;  4WFA L;  5ADX H;  4R79 A;  2YNI A;  4ILH A;  1QSY A;  2P9L A;  1NK6 A;  2P9L B;  4Y1C A;  4DCH A;  4J2A A;  1NJZ A;  4BDY A;  4M3X A;  5EXW A;  3M8P A;  3TTF A;  1T03 A;  2OCE A;  2G8F A;  3VES A;  5EVZ A;  1SUQ A;  1SKR A;  3OHR A;  1U48 A;  3U8X A;  3HI0 A;  3V6D A;  1HRH A;  4EIA A;  4AH9 A;  3MEE A;  4OLB A;  4PUO A;  3L0Q A;  3MWT A;  5B8H A;  5AQZ A;  4Y0W A;  1IKX A;  2P51 A;  1S9E A;  1NM1 A;  1NLV A;  4AHV A;  2O4I A;  4BGB A;  5CZ2 A;  2FBT A;  4F2S A;  4ID1 A;  2NRR A;  4KH5 A;  3LP0 A;  3THY A;  3PIO L;  1J6Z A;  2J4R A;  5CR4 A;  4FM2 A;  2Q0R A;  3CCE N;  3THY B;  1V4T A;  4CK2 A;  3PX4 A;  1OH8 A;  4DFJ A;  4YOU A;  4JN4 A;  3T1H K;  1WAJ A;  4IEI A;  3QEW A;  2IC3 A;  4K41 A;  3EL2 A;  5M1F A;  1LAW A;  1FKP A;  4B1W B;  1FXX A;  3G25 A;  4CZE A;  4Q5V A;  3HVR A;  3DOK A;  3F73 A;  3LPT A;  1RBR A;  4M63 C;  2PY5 A;  3H3O B;  4BRG A;  3QNO A;  2YHA A;  3SAF A;  3VF2 A;  3HK2 A;  1WB9 A;  2YNG A;  4E89 A;  1K8K A;  4AHC A;  4BRH A;  2NRT A;  4BDP A;  1WNS A;  4WFB L;  4H5V A;  5KQ8 A;  4KHQ A;  4FK0 A;  3LDN A;  4BRC A;  4ICL A;  5JVG L;  2KFN A;  2Z1I A;  4W5N A;  5AQI A;  2A6A A;  3PSI A;  1NNE A;  1OVQ A;  3NDK A;  1LOT B;  5E84 A;  2FSK A;  1C0T A;  3AAQ A;  3BP8 A;  2UXC K;  2RE2 A;  3V81 A;  4FM1 A;  3LAM A;  3HM8 A;  1HX1 A;  2VQE K;  1IKW A;  2NNW A;  2A1R A;  4CJ7 A;  4DTM A;  1JLQ A;  2IVO A;  4IDH A;  5HL7 L;  1LV5 A;  4K8Z A;  4FVU A;  1B92 A;  1KFD A;  2HHW A;  3MEG A;  4PA1 A;  4GKK K;  4KH4 A;  1K8A O;  1HQE A;  1FK9 A;  3ID8 A;  5AQL A;  1NKC A;  2ZWH A;  4FCY A;  1VRU A;  3M8S A;  3SUP A;  3T3F A;  2RHK A;  3IKM A;  2E1Z A;  3SMP A;  1QHA A;  3OA9 A;  4BC2 A;  3HTV A;  2BGG A;  1BHL A;  1C0U A;  4KTW A;  2YJE A;  2O8D A;  2P9S B;  4LF8 K;  3R9P A;  4A2B A;  4BRN A;  3VQA A;  2G8V A;  3CFP A;  1EO1 A;  2QKK A;  1Z26 A;  3GBT A;  1RBT A;  2BTF A;  3ZLJ A;  4DLE A;  2HMP A;  2OZM A;  1NGE A;  5KQD A;  4J8F A;  4XIU A;  2E5L K;  3L4Q A;  1C0F A;  3R8E A;  3T7Z A;  1QZ5 A;  4FJL A;  3QIO A;  4M3U A;  2R7Y A;  2O8F A;  5KPR A;  1HJR A;  4I6M B;  3VPZ A;  2O8F B;  3VQ7 A;  2GEM A;  3D2E A;  5DMR A;  3DRS A;  4NYN A;  3F5T A;  3D45 A;  4IBN A;  3NVM A;  3VQC A;  3QIN A;  4YDU C;  4A2A A;  1HMV A;  2HHH K;  2GUP A;  5ADX A;  4OVL A;  1EET A;  2A40 A;  4WQ5 A;  3QB0 A;  1ATN A;  3MED A;  3S41 A;  4LD0 A;  3M3Z A;  3VQB A;  4LF9 K;  1A5V A;  3EO3 A;  3ITH A;  5KPT A;  5AQP A;  2D4W A;  1HNI A;  4CBU A;  2P9U B;  4MLH A;  5AQY A;  3SV3 A;  3KKS A;  4Z4E A;  1U4B A;  1CZ9 A;  1VSK A;  1YHQ N;  2D0A A;  2QK9 A;  4CJ3 A;  1QQC A;  1K6Y A;  2EWS A;  4C23 A;  3QFP A;  4RTF D;  3OY9 A;  3E66 A;  1ZBS A;  1XC9 A;  4ISG A;  2ZD1 A;  1NGF A;  1JKH A;  3GDQ A;  4CEF A;  4E7J A;  2FF3 B;  4IKF A;  1JLG A;  3N4P A;  4PKI A;  4JD2 B;  1J9A A;  4K0K K;  3K57 A;  1NJW A;  2WUS A;  2P1J A;  4BY9 C;  4EHT A;  4RWT A;  4NXN K;  4KI4 A;  3FR0 A;  1I39 A;  1N32 K;  2YHX A;  3CCS N;  4XH1 A;  1KLN A;  2HHU A;  1NMD A;  2ASO A;  1IBM K;  2E6M A;  3VA3 A;  1L3T A;  1MU2 A;  3LM9 A;  5SWM A;  5KRT A;  2CGJ A;  3WXJ A;  1S22 A;  4I9L A;  1MWK A;  2YNH A;  2HND A;  3SQ4 A;  3AVJ A;  1P90 A;  3HPO A;  1JCE A;  4LFA K;  4HUG A;  5AQQ A;  3A5O C;  1RT6 A;  4GV9 A;  5AQU A;  1YJN N;  4IFY A;  5AZJ A;  3LPU A;  3KJV A;  3VA0 A;  3NVK A;  3DLG A;  4I2Q A;  4KHS A;  4E3S A;  4YHH K;  2GEL A;  3DI6 A;  4Z4C A;  1TKD A;  2E20 A;  3V9S A;  2A42 A;  1UWB A;  5M1O A;  4E19 A;  3J7A P;  3T69 A;  3SBT A;  3R3L A;  1E3M A;  3P4I A;  2QWP A;  1YIJ N;  3OYG A;  1WSJ A;  2QA4 N;  4IJA A;  4JLH A;  5JLF A;  2GUI A;  2JWL A;  3U4L A;  3M6G A;  4YOT A;  4QS7 A;  4ELU A;  3IG1 A;  5DM6 L;  1NGG A;  3TU5 A;  3EEQ A;  4B8C A;  3PLA A;  1VQM N;  3BF3 A;  3G0Z A;  3ZSV A;  5CHI A;  2VG6 A;  4FL9 A;  4CEB A;  4I7F A;  2G8U A;  1U2V B;  2NRX A;  1LWC A;  1Y97 A;  4BDZ A;  3OJU A;  4V19 S;  2GV9 A;  4FWP A;  3NH2 A;  1IG8 A;  4KV8 A;  3IDH A;  4FWL A;  1HUX A;  1RBS A;  1HR0 K;  2Z1G A;  4DFM A;  4CZG A;  1TAU A;  3WT0 A;  1W9H A;  2BAN A;  3AVH A;  4FJ8 A;  1WOQ A;  1KTQ A;  3TR8 A;  3DYA A;  1C0M A;  4LC9 B;  4RW6 A;  4KHN A;  5AQR A;  3AVG A;  1OVY A;  1VSI A;  3C6A A;  3TTD A;  4H5R A;  3O5B A;  3AAR A;  2HHS A;  3OYH A;  4B08 A;  3ZSY A;  5BRE A;  2NRV A;  4FLT A;  4GKJ K;  2P9N A;  2QM1 A;  1TYQ A;  4CK3 A;  3RMB A;  4BWJ A;  1CZA N;  1VRT A;  3DM2 A;  1RBV A;  3CET A;  3T19 A;  4JI4 K;  2B4J A;  3P31 A;  1VQ6 N;  3S9H A;  2ZJP L;  4CF0 A;  2GWK A;  1BQN A;  2YHW A;  1RBU A;  3H3N O;  3PSF A;  3PX0 A;  4CJL A;  1VQO N;  4CIF A;  3L3V A;  4U7B A;  3CQY A;  3R1X A;  3V4I A;  4CF8 A;  4DS5 A;  4FJX A;  3LDL A;  1VQ9 N;  3CER A;  4JK7 A;  3JS6 A;  2HHT A;  4FYD A;  5AQF A;  3VF6 A;  4MO4 A;  3LP1 A;  3VTH A;  3O9R A;  5C12 A;  4JKG B;  3VOV A;  2ZGY A;  3TI0 A;  4B1X B;  3ZSQ A;  2NLX A;  4B9V A;  4CJP A;  2DY4 A;  3AO3 A;  3ULD A;  4KB1 A;  2QTD A;  5IWA K;  3OYM A;  4JKB A;  1HNZ K;  3TAP A;  3OTO K;  2W40 A;  5AQJ A;  5C25 A;  1IKV A;  3CD6 N;  3NGZ A;  5DM7 L;  2WON A;  4PWD A;  3OYF A;  3L2W A;  1RFQ A;  4FJ9 A;  4K43 A;  4DUZ K;  4CER A;  3GL1 A;  3ZT2 A;  4GV6 A;  4WFN L;  3HJF A;  1TKX A;  3CJ7 A;  2O8B A;  1T05 A;  4DHY A;  3DXM A;  4BR4 A;  2O8B B;  1WSE A;  1U04 A;  3HPH A;  2VQF K;  2RF2 A;  2OPP A;  3DXM B;  3HBT A;  1HKG A;  4B8A B;  3CMA N;  4B1Z A;  3DLK A;  3ATV A;  3DMJ A;  4CJE A;  3R6M A;  3ZEU A;  2OZS A;  2A41 A;  3ZEU B;  4AHS A;  4YOX A;  3L2R A;  2W6L A;  2KTQ A;  3O8M A;  4B1U B;  1KAZ A;  4LH5 A;  5C42 A;  4O44 A;  3K9J A;  4Z4G A;  1NGD A;  1L3S A;  1RT4 A;  5I42 A;  4CZK A;  2E2O A;  3O6W A;  3CCL N;  2HST A;  1WN7 A;  1SV5 A;  3EKU A;  4XEI A;  5KGX A;  4LF4 K;  1QSS A;  1QTM A;  3UIQ A;  5CZ1 A;  3KLI A;  4H0Y B;  1VSL A;  5J2N A;  2AP1 A;  4AHU A;  1KRP A;  5GAH P;  1RTD A;  1D8Y A;  3ZSW A;  3P5J A;  5LY3 A;  3G71 N;  3RTV A;  4W5T A;  3WUH A;  4MO5 A;  4DR2 K;  5C0Y A;  1HNV A;  1CXQ A;  4FLV A;  3V1O A;  1Q9Y A;  1RDU A;  2CGK A;  4L8R B;  1X3N A;  4KRE A;  4QCL A;  1IKY A;  2OYQ A;  2V7Z A;  4CJV A;  3QEP A;  3CME N;  1NK8 A;  1SL2 A;  4N76 A;  2B5J A;  1BCO A;  3SUN A;  1WBB A;  1EX4 A;  1W2B M;  4DU1 A;  4IFE A;  5AQM A;  1WAF A;  1K73 O;  2HVI A;  3AV9 A;  4FJ7 A;  3CCV N;  3OYE A;  2XY5 A;  3OS2 A;  1S1V A;  3AVN A;  4JKE A;  1ZXO A;  4B3M K;  1GLB G;  4N56 A;  4IO9 L;  4DTR A;  5HLF A;  4BR7 A;  4B9M A;  3RR8 A;  1W7A A;  5AQO A;  4GMJ B;  4CJF A;  3ZET B;  2WTU A;  3AVM A;  2CGL A;  4KHY A;  4A59 A;  1VSJ A;  5HOO A;  5F1X A;  3SQ0 A;  3CHW A;  5HRS A;  4H0O A;  2VCP A;  3DAW A;  1NGA A;  4FPB A;  3DRP A;  2YCH A;  1S9G A;  2HVH A;  3E9L A;  2HHV A;  3TAF A;  4MLE A;  4H5T A;  2W42 A;  2IAJ A;  3BEX A;  2A3Z A;  1JLA A;  1UOC A;  3UKU A;  4BRI A;  4KKO A;  3E1Y A;  3WXL A;  1HNX K;  5KI6 A;  4Q0B A;  4FLZ A;  2AJQ A;  4DTU A;  3WNF A;  4LF7 K;  3AA2 A;  2KW4 A;  1KSP A;  4JK9 A;  4B9Q A;  4DQS A;  1T3V A;  2Q3S A;  1DLO A;  2QI2 A;  3FFI A;  2X6N A;  3K9K A;  1YTU A;  1XNQ K;  2G8W A;  4JKC A;  5LMN K;  1RT7 A;  3TAE A;  4WF9 L;  4ZTJ A;  3QER A;  4H0P A;  2FBV A;  3OYD A;  3P38 A;  3VQQ A;  2KFZ A;  2YNF A;  4X62 K;  5LL6 Z;  4BRA A;  2XHB A;  3MWP A;  1C1B A;  2DFE A;  2BDP A;  3FZH A;  5AQN A;  4FJN A;  1BIZ A;  3NGI A;  1VQN N;  4E1M A;  1C6V A;  4CJS A;  3A0I X;  1FKO A;  1O1W A;  4FJ5 A;  4BAC A;  3CQ8 A;  3NF7 A;  4BQZ A;  4CCH A;  5FDL A;  3AO5 A;  5F0X A;  3U9D A;  2O4G A;  3AA4 A;  4GVM A;  5BN9 A;  4EHU A;  2Z1J A;  3MCA B;  4IZ9 A;  3CXC M;  4LY7 A;  4O8K A;  3PV8 A;  4NLB A;  5DK5 A;  3QBX A;  3TSP A;  4K25 A;  3WEE B;  3LDQ A;  3D7E O;  3FZM A;  4CHY A;  4CHP A;  4G1Q A;  3AO1 A;  3DWL A;  2QW9 A;  3FZK A;  1TAQ A;  3IUC A;  3NF9 A;  4FK2 A;  4DR5 K;  4FLY A;  1I3A A;  2HBJ A;  2EHG A;  4OLA A;  5BRH A;  3SLC A;  5JS1 A;  1SL0 A;  1JCF A;  2Q31 A;  1XC3 A;  4GW6 A;  4ILJ A;  3V9U A;  5KRS A;  1RT1 A;  4CZI A;  3L6Q A;  2HNZ A;  4NXM K;  4DV3 K;  1WSG A;  4CFA A;  1SAZ A;  4RW8 A;  2HMI A;  1VQK N;  2YJF A;  1NJI O;  4CVN E;  3HZ6 A;  3QDK A;  3MXI A;  3C65 A;  4DF4 A;  3CM6 A;  3PO5 A;  1IJJ A;  4XH5 A;  4CHZ A;  1KVC A;  2PBD A;  1S1X A;  3CYM A;  3MN6 A;  4UQG A;  3ZSX A;  3K58 A;  4CEO A;  4N5S A;  3ENB A;  1HYV A;  3K5O A;  4NO7 A;  1XQS C;  1WSF A;  5D3G A;  3VEV A;  2YHY A;  5IT9 O;  3AGK A;  5J2P A;  5LMU K;  3H45 C;  1VQL N;  1C1C A;  4M3W A;  4JI2 K;  1DTQ A;  1SL1 A;  2QWL A;  2YI1 A;  4CGI A;  3CM5 A;  4KPY A;  1HNW K;  3AAP A;  1QQM A;  2P9S A;  3CFR A;  5CE3 A;  1GOA A;  3BDP A;  1QE1 A;  1JL1 A;  4Z0U A;  4JYA K;  1JJ2 M;  4C1N I;  2Q97 A;  3C7N B;  3VGL A;  3TAB A;  2HF3 A;  1OH6 A;  3HT3 A;  4M3T A;  3MN5 A;  4X65 K;  3NCI A;  4H0X B;  4BR5 A;  2ZF5 O;  4IWV A;  1WSH A;  1RCH A;  4I6M A;  4OX9 K;  1Q7Y O;  5F2R A;  2KKZ A;  3V9W A;  4HCC A;  4BVO A;  2GTD A;  4LH4 A;  4X66 K;  1XNR K;  5C10 A;  4YDU A;  1DGK N;  1D5A A;  3SUQ A;  3LAK A;  3ENO A;  4DUY K;  3VER A;  4IOA L;  1BIU A;  1BDG A;  1EQY A;  1L3V A;  4IDK A;  5CY4 A;  1QQN A;  2GX9 A;  4B3T K;  3J8A A;  4CJQ A;  2F7T A;  3QFU A;  4C8O A;  1XMO K;  2YX6 A;  4GV3 A;  2P9U A;  4JRP A;  1ZBH A;  1Y64 A;  1QVF M;  3NFA A;  2IGI A;  5BR8 K;  3ZT3 A;  5J2M A;  2YHB A;  4CIG A;  2PYJ A;  2P9P B;  4K42 A;  4K8X A;  1IV0 A;  3MX2 A;  2W41 A;  3OYC A;  3ISN C;  3HRG A;  4EZ9 A;  1HYS A;  1JLB A;  3VQ6 A;  2W6K A;  4JEP A;  2F8S A;  3H08 A;  3KD5 E;  3RRH A;  1TUY A;  3EZW A;  3M1F A;  1X9M A;  3PO4 A;  1W97 L;  4CBW A;  4H0T B;  3A5N C;  5HBM A;  5LJW A;  4JD2 A;  5E26 A;  1P8Z A;  2X78 A;  4BR9 A;  3T1A A;  4OPA A;  2OPQ A;  2UXD K;  1BWF O;  1XWL A;  3I56 N;  3H1V X;  4OPK A;  4F2R A;  4NCG A;  3D6R A;  3A5L C;  4CF2 A;  4KFB A;  1YJW N;  2UUA K;  1TK5 A;  3VEO A;  1KCF A;  2VWB A;  1NK4 A;  3IAY A;  3PY8 A;  3WXM B;  1NK5 A;  4DSJ A;  5M1Q A;  1LW2 A;  2RPI A;  4DB3 A;  4DV5 K;  3JYT A;  2D0P A;  1R0A A;  4E7L A;  3LAL A;  1HJO A;  4MDB A;  1JL2 A;  1BCM A;  4DKW A;  4FZY A;  4FK4 A;  3OYN A;  3A2F A;  5BRD A;  3BY5 A;  1XMQ K;  4DF8 A;  3O9S A;  5M1N A;  3QEI A;  4O8U A;  3U6F A;  2ASM A;  3QEX A;  3CFO A;  4BQL A;  1NKE A;  1NG9 A;  4HVJ A;  1FW6 A;  1H1V A;  3I55 N;  4HCB A;  4ILG B;  1I94 K;  4WQ4 A;  4BRK A;  3ZX0 A;  1ATR A;  4CGJ A;  4RG8 A;  2O8E B;  3LWL A;  3EZ5 A;  2DPN A;  3SJH A;  4DQQ A;  2KLA A;  3HOS A;  3CC2 N;  1M1K O;  4AHR A;  1C0G A;  4DV0 K;  4L3Q A;  5EY4 A;  3I33 A;  5CYM A;  3F2K A;  3I0R A;  4DSI A;  4C8L A;  2UYT A;  3O80 A;  3EE9 A;  3ZX2 A;  1GOB A;  3J81 O;  1U2V A;  1EXQ A;  3W0L A;  2P5O A;  4FLW A;  4DR3 K;  5AQW A;  4CHN A;  4QOZ B;  4DV7 K;  4AQY K;  3SK3 A;  4I9Q A;  3K0S A;  3QEV A;  4CED A;  4KHU A;  2F96 A;  1NKB A;  5AJ3 K;  3DLE A;  3THW B;  3A8Y A;  3O9U A;  4I2P A;  3HVT A;  1SZ2 A;  3AVC A;  3MXJ A;  4A61 A;  2E2N A;  4M3Z A;  2NRZ A;  4BRP A;  3D0P A;  4DU4 A;  4CFB A;  1DKG D;  4CD1 A;  4CJR A;  3VN5 A;  1Z25 A;  4CBX A;  3J7Y P;  3DLB A;  3KK1 A;  2HOE A;  4IOC L;  5HRR A;  2YKN A;  1HQU A;  1BI4 B;  4FVM A;  4KB0 A;  3I8B A;  3LZJ A;  3TAG A;  4DTN A;  3CCQ N;  1QQO A;  3LDO A;  1OKJ A;  3CCJ N;  4OGC A;  3Q7C A;  2Q0U A;  4LSL A;  3AVK A;  4PHT X;  5BPN A;  4JK8 A;  4B1Y B;  4FJH A;  3HP9 A;  1TGO A;  4DR1 K;  4BRL A;  4OKJ A;  2AA4 A;  1S6Q A;  3RMC A;  1T8E A;  4M41 A;  2E4L A;  3SAG A;  1QSL A;  4X64 K;  2GBZ A;  4U67 L;  4YFU A;  5TKY A;  3TTC A;  3HST B;  1NK9 A;  4LFC K;  5CYQ A;  2VYP A;  4FOI A;  2OTJ N;  4FWM A;  3L4I A;  4J2E A;  2KHO A;  1X9S A;  3CC7 N;  1XHZ A;  3FZL A;  5AQX A;  1VSM A;  3SPY A;  1C1A A;  3MAQ A;  1FJG K;  4LF5 K;  3CCM N;  5C15 A;  4W5Q A;  4FWK A;  4GY2 B;  4JKG A;  1T6C A;  1XUP O;  2ZGZ A;  2ITG A;  2FSJ A;  2FBX A;  4CGF A;  2HW3 A;  2XRI A;  3L3U A;  4CJT A;  1NJX A;  1TL3 A;  1RGI A;  3KD1 E;  2YKM A;  3KVG A;  3HM9 A;  1BL3 A;  1T6D A;  2EX3 A;  3PX6 A;  1L5U A;  1CLQ A;  4JS4 A;  1RDA A;  1D4X A;  3VQ4 A;  3VEY A;  1T7P A;  5FRM A;  4CGG A;  3HYF A;  3QBW A;  2QEX N;  4W5O A;  1X9J A;  5HP1 A;  3AVF A;  2D0B A;  4FLX A;  1HPM A;  3SQ1 A;  3B8A X;  4HUE A;  3SYZ A;  3K5N A;  4KHW A;  4IG3 A;  3O4W A;  3V1Q A;  5GAE P;  3IS9 A;  4B3R K;  1BQM A;  3SJJ A;  4JRQ A;  3MN9 A;  1VQP N;  1JLC A;  5ELZ A;  2Y1J A;  1NWK A;  3EKS A;  5AR0 A;  3SQ2 A;  4A62 A;  1NOY A;  1S3X A;  4JV5 K;  3JSM A;  1N34 K;  4IXC A;  3CJA A;  4H5W A;  1ESV A;  5EX5 A;  4CEZ A;  4W5R A;  3O3F A;  3UKR B;  4JI7 K;  4B1V A;  1BG3 A;  1S6P A;  3ZSZ A;  1M90 O;  3FZF A;  5FRO A;  3QNN A;  1QZ6 A;  4LSN A;  2VG5 A;  2DFH A;  1YJ9 N;  4M7Y A;  1KC8 O;  4M3R A;  3CG7 A;  4CJ5 A;  3ULE B;  2XO7 A;  4B9T A;  4ELT A;  4NCB A;  4KI6 A;  3G10 A;  1LW0 A;  1NU0 A;  4BRF A;  4CF9 A;  1N33 K;  3TSU A;  3VF4 A;  2IVN A;  4DTP A;  4AIL C;  4FWR A;  5FPN A;  3OYB A;  3O3H A;  4WE1 A;  1HYZ A;  4Z94 A;  1NOZ A;  3ASM A;  4WCE L;  3P1G A;  1QVG M;  1SKW A;  1TVR A;  2E8A A;  1KLM A;  2FC0 A;  1L3U A;  1TKZ A;  5JMV A;  3ZX3 A;  1YF5 L;  1W0H A;  5M1P A;  4YOW A;  1YTA A;  3QET A;  1KVA A;  1LWE A;  4Z4F A;  4E1J A;  3I8D A;  4KO0 A;  3U3G A;  1EP4 A;  4IOX A;  3MK6 A;  2A1S A;  1S1W A;  2FSN A;  4O5F A;  1ITG A;  1U6Z A;  4C8N A;  3F9K A;  2ASP A;  2Q1N A;  4GVE A;  1VHX A;  1YVU A;  5AQG A;  3ZET A;  3KK7 A;  3H46 O;  5AQT A;  2IS3 A;  1JLE A;  2Q36 A;  4HHT A;  5KGW A;  3E01 A;  5J2Q A;  1VSF A;  2ATQ A;  1X9W A;  1A5W A;  3C94 A;  4DSF A;  3O4Q A;  1DT9 A;  3NGY A;  1KAY A;  2PAV A;  4EP4 A;  4B3O A;  3MMV A;  1J54 A;  4BGA A;  4DV4 K;  1NMN A;  4CE9 A;  3M8Q A;  1RTH A;  2VG7 A;  3GE1 A;  4BRQ A;  4FJK A;  3NF8 A;  4R5P A;  4FZZ A;  4MFB A;  5FPM A;  3O9T A;  4KH6 A;  1RTJ A;  4YOR A;  1YUW A;  4H03 B;  2UUB K;  1JCG A;  2E2P A;  4HUF A;  1CXU A;  2VGM A;  3J7Z O;  4FM0 A;  4BR2 A;  4B9S A;  3KLF A;  4BC3 A;  1RT2 A;  2CH6 A;  2RKI A;  5JVH L;  5E41 A;  4DTO A;  3GOI A;  4E1N A;  5I3U A;  3VEZ A;  4FWN A;  3OW2 M;  4JHD A;  4CGH A;  3O1B A;  3LP2 A;  5HRO A;  1K9M O;  3BZC A;  4BVP A;  4JHD B;  2JGU A;  3O08 A;  4BE1 A;  3ENH A;  3SPZ A;  1OH5 A;  1J5E K;  4F3O A;  3CIP A;  4H4O A;  4JI3 K;  1IH7 A;  1RDC A;  5C2D A;  2QWR A;  1JXE A;  1VSH A;  4CFC A;  3OYL A;  1YIT N;  3SNN A;  3RWU A;  1MDU B;  2ZM6 K;  2YV0 X;  2XY6 A;  5BPL A;  1LAV A;  1ZBU A;  4YOY A;  4IEE A;  4EP5 A;  4CJW A;  1RDD A;  2LSN A;  5C2F A;  3OYK A;  3CCU N;  4OKK A;  2I7N A;  1HPZ A;  5A2Q O;  4KHP K;  3IRX A;  4Z4H A;  3TAM A;  3DLL L;  1RNH A;  4CZF A;  3WEE A;  3J80 O;  1WLJ A;  3F9M A;  1NK0 A;  2VWK A;  4NCA A;  1VQ7 N;  2Q2R A;  3KTQ A;  1REV A;  1U45 A;  1U49 A;  3QML A;  1N36 K;  4F3T A;  5JLH A;  4PY5 A;  2QWN A;  3NF6 A;  4CGD A;  3WQU A;  1WBD A;  5FLX O;  4FSV A;  4JI5 K;  4B9N A;  3CJB A;  3EE8 A;  3IMX A;  4CJK A;  1TK8 A;  4CEE A;  3AVB A;  3AY9 A;  2WC9 A;  3DLR A;  4LFB K;  4BC5 A;  5HRN A;  3LP3 A;  3TWH A;  3CPW M;  1GLJ O;  3BZK A;  3VMF B;  4IO8 A;  5EU7 A;  2XY7 A;  4CEA A;  4FZX C;  2F9W A;  3NH0 A;  4TSX A;  1K8K B;  1NBW A;  3KKR A;  2IDO A;  3CJ9 A;  1BO5 O;  4DR7 K;  1KXP A;  3FLC O;  1NGC A;  2QWM A;  4FWQ A;  2OTL N;  3H1Q A;  3ID6 A;  1ZC6 A;  1JXB A;  3KHY A;  3NAE A;  2D5R A;  4FLU A;  4FO0 A;  3LM2 A;  4YOV A;  3C6H A;  3QLH A;  2XY8 A;  3VEN A;  3H6E A;  1TL1 A;  4M7X A;  4BG9 A;  3WXK A;  2F9T A;  4F8R A;  1KD1 O;  3BGR A;  1ASV A;  1ASW A;  3DRR A;  3LDP A;  3TSQ A;  5J1E A;  1UA1 A;  1WSI A;  1VQ5 N;  1ZBF A;  2QWO A;  1T44 A;  3ZSO A;  2BH1 A;  3C7N A;  1S1U A;  3AO4 A;  4CI6 A;  4OJR A;  4CFD A;  1HKC A;  5FPE A;  3OVN A;  2E88 A;  3VQD A;  3KLG A;  2V51 B;  4CW7 B;  1DTT A;  3HXM A;  2NRH A;  3S3M A;  3VQ9 A;  4C8K A;  3O4N A;  1DEJ A;  1D9D A;  1NGJ A;  2OAN A;  3VQ5 A;  2A5X A;  3MXM A;  2FF6 A;  4HWI A;  2O8D B;  3S3O A;  1S1T A;  3HPG A;  3U3Y A;  4FXD A;  3E9O A;  3E9P A;  1B9D A;  4M45 A;  4DV6 K;  3P39 A;  1Q9X A;  2OA8 A;  4H4M A;  2ZJQ L;  1X1P A;  4CZH A;  3KK3 A;  1RDB A;  1IO2 A;  2PZS A;  5JIC A;  3M5R A;  1F21 A;  3KIO A;  2BE2 A;  1R59 O;  3OYI A;  3NHG A;  3L8B A;  2P9P A;  1RTI A;  2HNY A;  4DR6 K;  2G8H A;  3D2E B;  2ZQB A;  5TKW A;  4JS5 A;  1HLU A;  4ID5 A;  3UB5 A;  3PUF A;  5GIN A;  3V9X A;  1EKE A;  1BGX T;  5AQH A;  4A5A A;  2WBN A;  4WQ5 C;  4CJU A;  1MA9 B;  1BA0 A;  2G8I A;  4DQP A;  3P83 D;  3K5M A;  4EFH A;  3ZSR A;  3DXK A;  5C24 A;  4CF1 A;  4BRM A;  4FWS A;  4O0J A;  4DSL A;  1TUU A;  3DXK B;  4FJI A;  3DOL A;  4E7K A;  2GWJ A;  3DLH A;  1J53 A;  4BE0 A;  3LL3 A;  1YT3 A;  3A5M C;  5AFU H;  5SZT A;  3SI6 A;  1U47 A;  1SKS A;  2PYL A;  1NJY A;  2QXF A;  3EN9 A;  4RW7 A;  4O5B A;  4ISF A;  3ZT0 A;  3OYA A;  3LAN A;  4A57 A;  3ZT4 A;  4E7H A;  3TPQ A;  2HBM A;  3EY1 A;  4FWO A;  4PKH A;  1V4S A;  4DWI A;  4O55 A;  3LWM A;  2QXL A;  3MEC A;  3WNE A;  4BE2 A;  4BC4 A;  1NGI A;  4DQI A;  4JI0 K;  4NLC A;  4ZTF A;  2H3G X;  3CJC A;  4N47 A;  2ITM A;  3TAQ A;  4FJJ A;  1QHT A;  4BRE A;  1VAZ A;  3EYZ A;  3O1W A;  1WUA A;  4CD3 A;  3PIP L;  4FJM A;  3C0B A;  3LZI A;  1RDW X;  1TKT A;  3RRG A;  5BPM A;  1KQS M;  2HBK A;  1EWR A;  5GIO A;  5T7B A;  2O8E A;  2KZZ A;  1NGB A;  4WYB A;  3OYJ A;  1XHX A;  3VEW A;  4DU3 A;  3AVA A;  4DV1 K;  4CZM A;  5AZJ B;  4O0I A;  3C95 A;  3GG4 A;  2VWJ A;  5GAG P;  1Q86 O;  3RMD A;  1TK0 A;  2E6L A;  3C6U A;  4FW2 A;  4DFP A;  1XI1 A;  1Z6R A;  3OBW A;  4RW4 A;  4HTU A;  3K5L A;  3C6T A;  5BN8 A;  4WQ4 C;  4M42 A;  3HO1 A;  1O13 A;  4OGE A;  4DSE A;  3FGU A;  2Y1I A;  2KZM A;  3MX5 A;  2NUB A;  3QES A;  3RVC A;  1GLC G;  3THW A;  4ISE A;  2HHX A;  5AQS A;  3M8R A;  1NK7 A;  1RT3 A;  3B6O A;  4JKH A;  4OKE A;  2UXB K;  1BU6 O;  1OH7 A;  3QIC A;  4J2B A;  3DJC A;  4QAG A;  1ZBI A;  2ZJR L;  3CC4 N;  1ATS A;  3O9Q A;  3OS0 A;  3VQP A;  4LF6 K;  3KZB A;  5AQK A;  2P5G A;  1LCU A;  1BI4 A;  2B6A A;  4IFV A;  1KAX A;  3RSE A;  2HF4 A;  1BA1 A;  3TAR A;  3RSE B;  4DTX A;  5AQV A;  2PFU A;  3THV A;  4DS4 A;  5KPZ A;  1MWM A;  5LJV A;  3AO2 A;  1BIS A;  5KTQ A;  3RR7 A;  4AM7 A;  2IOC A;  2HBL A;  4NB4 A;  4GNI A;  3LDS A;  1QS4 A;  4JNE A;  4BR0 A;  1N6Q A;  4PL7 A;  3WNH A;  5BRF A;  4OPJ A;  4F4K A;  3HSC A;  4FPA A;  3MN7 A;  3NE6 A;  2P9N B;  2X6S A;  4IJN A;  1HKB A;  3V1R A;  4DG1 A;  1Q81 O;  4DTS A;  1TYQ B;  2P9K A;  4YY3 K;  3RMA A;  4JKF A;  2D0C A;  2P9K B;  3SUO A;  2F8T A;  3WXI A;  4BRO A;  3KK2 A;  4DSK A;  1YI2 N;  3THX A;  3B6P A;  3CJ1 A;  1ASU A;  4CZL A;  3THX B;  5AFU A;  4CEC A;  3KLE A;  2D0O A;  3JAM O;  1Q82 O;  4AF1 A;  1RT5 A;  4OPH A;  4CHQ A;  3CCR N;  4F9O A;  2F4V K;  3D2F A;  3VGM A;  4CJ4 A;  2WFB A;  2RN2 A;  4DFK A;  3D2F B;  3WNG A;  1BOT O;  1IBL K;  2IIR A;  2VGN A;  2P9I A;  1Z05 A;  1UAX A;  2OPR A;  2P9I B;  2V52 B;  1VSE A;  3KWG A;  3ZCM A;  1NGH A;  3NMU A;  5FPD A;  2E1Y A;  3WQT A;  3FFK B;  1N8R O;  4PQU A;  2FBY A;  1GOC A;  1D9F A;  4DTJ A;  5AZI A;  3L2V A;  2X74 A;  4ELV A;  5AZI B;  4JKD A;  4O4G A;  4Y1D A;  4BRD A;  1ILY A;  4IG0 A;  5JS2 A;  4XH4 A;  2I7P A;  1X3M A;  4JI8 K;  3JXU A;  3T1Y K;  4BG8 A;  4HTL A;  3U9Z A;  5M1K A;  2ZE2 A;  4KBO A;  3TAN A; 
#chains in the Genus database with same CATH homology
 3KLH A;  3HT3 A;  2ETJ A;  4DQR A;  3S3N A;  1RT2 A;  4M3T A;  3NCI A;  2OPS A;  1WSH A;  3OYG A;  1WSJ A;  1RCH A;  3AA5 X;  4JLH A;  2RKI A;  2GUI A;  5E41 A;  3V9W A;  4ELU A;  4HCC A;  4N41 A;  1VK0 A;  3IG1 A;  4DTO A;  4E1N A;  3AVI A;  4LH4 A;  5I3U A;  3AA3 A;  3HP6 A;  4B8C A;  1D5A A;  3QO9 A;  4CGH A;  3SUQ A;  3LAK A;  3LP2 A;  4YNQ A;  5HRO A;  1ZBL A;  3G0Z A;  4BE1 A;  3ZSV A;  1N5Y A;  2JGU A;  1Q8I A;  2VG6 A;  3SPZ A;  2KQ2 A;  4CEB A;  3O3G A;  4I7F A;  3OJS A;  4H4O A;  2G8U A;  1BIU A;  1IH7 A;  1RDC A;  3NBP A;  1LWC A;  1Y97 A;  1L3V A;  3HL8 A;  4IDK A;  1JXE A;  3ALY A;  5CY4 A;  1VSH A;  2GV9 A;  4CFC A;  3OYL A;  3OJU A;  3SNN A;  3RWU A;  3NH2 A;  4CES A;  2YV0 X;  4KV8 A;  5K14 A;  4CJQ A;  2XY6 A;  4E0D A;  1LAV A;  1RBS A;  1ZBU A;  4C8O A;  2Z1G A;  4EP5 A;  3AVL A;  4CJW A;  4DFM A;  1ZBH A;  4JRP A;  1IG9 A;  1RDD A;  1TAU A;  3NFA A;  2LSN A;  4NYF A;  3OYK A;  2IGI A;  5J2M A;  1W9H A;  2BAN A;  2YHB A;  3AVH A;  1HPZ A;  4OKK A;  3ZT3 A;  4CIG A;  4DLG A;  1RIL A;  1KTQ A;  3IRX A;  4FJ8 A;  4Z4H A;  3TR8 A;  4ZHR A;  3DYA A;  4K8X A;  1C0M A;  2HHQ A;  4H8K A;  3TAM A;  3OYC A;  1RNH A;  4RW6 A;  4KHN A;  3AVG A;  3ISN C;  1WLJ A;  3L2U A;  1VSI A;  3L2Q A;  1NK0 A;  2VWK A;  4KTZ A;  4KTQ A;  4EZ9 A;  1KFS A;  1A5X A;  1HYS A;  1JLB A;  4NCA A;  4B9L A;  5FRN A;  3VQ6 A;  2HHS A;  3OYH A;  2F8S A;  4B08 A;  1JLF A;  4J2D A;  3H08 A;  3NH1 A;  3RRH A;  3KTQ A;  3KD5 E;  1REV A;  4C8M A;  4CHO A;  3K2P A;  3ZSY A;  1U45 A;  1U49 A;  4FLT A;  1X9M A;  2JLE A;  4MQ3 A;  3PO4 A;  3VQ8 A;  3ZT1 A;  4F3T A;  3I0S A;  4PY5 A;  2Z1H A;  3NF6 A;  4CGD A;  2QKB A;  4CK3 A;  3RMB A;  5HBM A;  4BWJ A;  4B9N A;  1VRT A;  3DM2 A;  1RBV A;  4CEQ A;  4CJK A;  3T19 A;  1TK8 A;  2B4J A;  4CEE A;  2X78 A;  3AVB A;  3S9H A;  3T1A A;  4CF0 A;  1BQN A;  2OPQ A;  2PYJ A;  4CIE A;  3DLR A;  1RBU A;  1B9F A;  3QIP A;  5HRN A;  3LP3 A;  3TWH A;  4B9U A;  1XWL A;  3K59 A;  4RW9 A;  5EU7 A;  4DMN A;  3PX0 A;  4OPK A;  4CEA A;  4CJL A;  2XY7 A;  4NCG A;  4F2R A;  1ZYQ A;  1G15 A;  4CIF A;  4CF2 A;  4FZX C;  4AHT A;  1VSD A;  3L3V A;  4KRF A;  4KFB A;  3NH0 A;  4TSX A;  1TK5 A;  3KKR A;  3OS1 A;  1KCF A;  2IDO A;  1NK4 A;  3V4I A;  1CZB A;  4CF8 A;  4DS5 A;  1J5O A;  3PY8 A;  3IAY A;  1TV6 A;  4M3Y A;  4FJX A;  4Z4I A;  1NK5 A;  4DSJ A;  1JXB A;  2HHT A;  1LW2 A;  2RPI A;  4E7I A;  3JYT A;  2D5R A;  3NAE A;  4E7L A;  1R0A A;  4FYD A;  2DTU A;  4FLU A;  1LWF A;  3LAL A;  1JL2 A;  3SCX A;  3LP1 A;  3QLH A;  2XY8 A;  1BCM A;  4FZY A;  4FW1 A;  1TL1 A;  4FK4 A;  3OYN A;  2G8K A;  3A2F A;  3SV4 A;  4F8R A;  4DF8 A;  4KAZ A;  3QEI A;  2I5J A;  3TI0 A;  3U6F A;  3BGR A;  1ASV A;  3ZSQ A;  4EZ6 A;  4B9V A;  4CJP A;  3SZ2 A;  1ASW A;  3QEX A;  3DRR A;  3AO3 A;  3CFO A;  3ULD A;  4KB1 A;  2DY4 A;  3OYM A;  5J1E A;  4CK1 A;  1WSI A;  3TAP A;  1UA1 A;  1NKE A;  1ZBF A;  4HVJ A;  1KVB A;  5C25 A;  3ZSO A;  1X9W A;  1IKV A;  3VQE A;  2HB5 A;  4HCB A;  1S1U A;  3AO4 A;  4OJR A;  4CFD A;  2WOM A;  3OVN A;  2DFF A;  3NGZ A;  5HRP A;  2WON A;  3VQD A;  3OYF A;  4PWD A;  3KLG A;  4FJJ A;  1DTT A;  4CGJ A;  3HXM A;  4RG8 A;  3L2W A;  3S3M A;  3VQ9 A;  3LWL A;  3EZ5 A;  4FJ9 A;  1S5J A;  4CER A;  4FJG A;  4C8K A;  3O4N A;  3ZT2 A;  1UA0 A;  1D9D A;  3HJF A;  1TKX A;  4DQQ A;  1T05 A;  3VQ5 A;  4AHR A;  4BWM A;  3MXM A;  1WSE A;  1U04 A;  3HPH A;  3V9Z A;  3S3O A;  2RF2 A;  2OPP A;  1S1T A;  3HPG A;  3I0R A;  5CYM A;  4BDZ A;  3U3Y A;  4C8L A;  4DSI A;  4FXD A;  2YNI A;  4B8A B;  1GOB A;  1QSY A;  4M45 A;  1B9D A;  3DLK A;  3DMJ A;  4CJE A;  1NK6 A;  1Q9X A;  2OA8 A;  4Y1C A;  2OZS A;  1EXQ A;  2P5O A;  4J2A A;  4H4M A;  4FLW A;  1NJZ A;  1X1P A;  4AHS A;  3L2R A;  4BDY A;  4CHN A;  4QOZ B;  3KK3 A;  2KTQ A;  4I9Q A;  4M3X A;  1RDB A;  3M8P A;  1IO2 A;  1T03 A;  3QEV A;  4LH5 A;  5C42 A;  4CED A;  4O44 A;  2G8F A;  2F96 A;  2PZS A;  1SKR A;  1SUQ A;  1F21 A;  1NKB A;  4KHU A;  3DLE A;  3KIO A;  1U48 A;  4I2P A;  2BE2 A;  3HVT A;  3V6D A;  3AVC A;  3MXJ A;  4Z4G A;  1HRH A;  3OYI A;  3NHG A;  1L3S A;  1RT4 A;  4AH9 A;  3L8B A;  1RTI A;  3MEE A;  3D0P A;  4DU4 A;  5I42 A;  4M3Z A;  2HNY A;  4CFB A;  4OLB A;  4PUO A;  2G8H A;  4CJR A;  2ZQB A;  3VN5 A;  1WN7 A;  1Z25 A;  4JS5 A;  1SV5 A;  3DLB A;  1IKX A;  4ID5 A;  2P51 A;  3PUF A;  1S9E A;  3KK1 A;  5KGX A;  3V9X A;  1EKE A;  4AHV A;  1BGX T;  5HRR A;  1QSS A;  2O4I A;  2YKN A;  1HQU A;  1BI4 B;  4FVM A;  2FBT A;  5CZ2 A;  4ID1 A;  4F2S A;  4KB0 A;  1QTM A;  4CJU A;  3UIQ A;  5CZ1 A;  3KLI A;  3LP0 A;  3LZJ A;  3TAG A;  4DTN A;  2G8I A;  4DQP A;  1VSL A;  4FM2 A;  5J2N A;  4AHU A;  1KRP A;  3P83 D;  4OGC A;  3K5M A;  4CK2 A;  3PX4 A;  1RTD A;  1D8Y A;  4LSL A;  4DFJ A;  3ZSW A;  3AVK A;  3ZSR A;  5C24 A;  3P5J A;  4CF1 A;  1WAJ A;  4DSL A;  4O0J A;  4W5T A;  3RTV A;  3QEW A;  4FJH A;  2IC3 A;  4FJI A;  3DOL A;  4E7K A;  1LAW A;  1FKP A;  1HNV A;  3HP9 A;  3DLH A;  1TGO A;  1J53 A;  1CXQ A;  1FXX A;  4BE0 A;  4FLV A;  4OKJ A;  4Q5V A;  1YT3 A;  3HVR A;  3DOK A;  3V1O A;  5SZT A;  3LPT A;  3F73 A;  3SI6 A;  1U47 A;  1SKS A;  1RBR A;  1Q9Y A;  2PY5 A;  2PYL A;  1NJY A;  1S6Q A;  2QXF A;  3QNO A;  4RW7 A;  4O5B A;  3RMC A;  4L8R B;  2YHA A;  4M41 A;  1T8E A;  2E4L A;  4KRE A;  3ZT0 A;  3HK2 A;  3OYA A;  1QSL A;  2GBZ A;  2YNG A;  4E89 A;  3LAN A;  4QCL A;  4AHC A;  1IKY A;  4YFU A;  1NK9 A;  3HST B;  2OYQ A;  4CJV A;  5CYQ A;  4BDP A;  3QEP A;  3ZT4 A;  4E7H A;  1WNS A;  1NK8 A;  1SL2 A;  4N76 A;  2B5J A;  1BCO A;  3EY1 A;  4KHQ A;  4FK0 A;  3SUN A;  4J2E A;  1EX4 A;  1X9S A;  4DWI A;  4O55 A;  3LWM A;  4ICL A;  1XHZ A;  3MEC A;  3WNE A;  4DU1 A;  4BE2 A;  1VSM A;  2Z1I A;  2KFN A;  4W5N A;  3SPY A;  4DQI A;  1WAF A;  1C1A A;  3NDK A;  2HVI A;  3AV9 A;  3MAQ A;  4FJ7 A;  3OYE A;  4ZTF A;  4W5Q A;  2XY5 A;  3OS2 A;  1S1V A;  3AVN A;  1C0T A;  3V81 A;  4N56 A;  4FM1 A;  3LAM A;  2ITG A;  4N47 A;  4DTR A;  5HLF A;  4B9M A;  2FBX A;  4CGF A;  3TAQ A;  2HW3 A;  2XRI A;  3L3U A;  3RR8 A;  1IKW A;  1QHT A;  2A1R A;  4GMJ B;  4CJF A;  4CJT A;  3EYZ A;  4DTM A;  1NJX A;  1JLQ A;  1TL3 A;  3AVM A;  1LV5 A;  2YKM A;  3KD1 E;  4F3O A;  3LZI A;  4K8Z A;  4FJM A;  4KHY A;  1VSJ A;  1B92 A;  1TKT A;  1KFD A;  3RRG A;  3SQ0 A;  5HRS A;  3HM9 A;  2HHW A;  3MEG A;  4PA1 A;  1BL3 A;  1HQE A;  1FK9 A;  2EX3 A;  5T7B A;  3PX6 A;  1NKC A;  1L5U A;  4FCY A;  2KZZ A;  1CLQ A;  1VRU A;  3OYJ A;  4JS4 A;  1RDA A;  1XHX A;  3M8S A;  3SUP A;  3T3F A;  3DRP A;  4DU3 A;  3VQ4 A;  3AVA A;  1S9G A;  1T7P A;  5FRM A;  2BGG A;  1BHL A;  4CGG A;  1C0U A;  4O0I A;  2HVH A;  2HHV A;  3HYF A;  4KTW A;  3TAF A;  3C95 A;  2W42 A;  4W5O A;  2VWJ A;  5HP1 A;  2IAJ A;  3AVF A;  3RMD A;  1JLA A;  1UOC A;  1TK0 A;  2D0B A;  4KKO A;  4FLX A;  3VQA A;  5KI6 A;  2G8V A;  3SQ1 A;  4Q0B A;  4HUE A;  2E6L A;  3C6U A;  4FW2 A;  3SYZ A;  4DFP A;  3CFP A;  3K5N A;  4FLZ A;  1XI1 A;  4KHW A;  4IG3 A;  4RW4 A;  2AJQ A;  3V1Q A;  3WNF A;  4HTU A;  1Z26 A;  4DTU A;  3K5L A;  3AA2 A;  2QKK A;  1RBT A;  2KW4 A;  3C6T A;  1KSP A;  4DLE A;  4M42 A;  3HO1 A;  4DQS A;  2OZM A;  3IS9 A;  4OGE A;  2Q3S A;  4DSE A;  4XIU A;  1DLO A;  3FFI A;  2Y1I A;  1BQM A;  3SJJ A;  4JRQ A;  2KZM A;  2X6N A;  1JLC A;  2NUB A;  3QIO A;  2R7Y A;  4FJL A;  2Y1J A;  2G8W A;  4M3U A;  3QES A;  1YTU A;  1RT7 A;  2HHX A;  1HJR A;  3TAE A;  3M8R A;  4ZTJ A;  3SQ2 A;  1NK7 A;  1RT3 A;  3B6O A;  3QER A;  3VQ7 A;  4OKE A;  1NOY A;  2FBV A;  3OYD A;  3JSM A;  4J2B A;  3VQQ A;  5DMR A;  3DRS A;  4NYN A;  4QAG A;  1ZBI A;  2KFZ A;  2YNF A;  3D45 A;  4IBN A;  3VQC A;  4CEZ A;  3QIN A;  3OS0 A;  4W5R A;  3VQP A;  1HMV A;  3O3F A;  2XHB A;  4OVL A;  1C1B A;  1EET A;  2DFE A;  2BDP A;  2P5G A;  4FJN A;  1BIZ A;  1BI4 A;  2B6A A;  3NGI A;  1S6P A;  4IFV A;  3ZSZ A;  4E1M A;  3MED A;  5FRO A;  3QNN A;  1C6V A;  4CJS A;  4LD0 A;  4LSN A;  2VG5 A;  2DFH A;  1FKO A;  3VQB A;  3TAR A;  1O1W A;  4FJ5 A;  1A5V A;  4BAC A;  3CQ8 A;  3NF7 A;  3ITH A;  4DTX A;  4CCH A;  5FDL A;  4M3R A;  3CG7 A;  3AO5 A;  4CJ5 A;  1HNI A;  2O4G A;  3AA4 A;  2XO7 A;  3THV A;  4B9T A;  4DS4 A;  4GVM A;  4ELT A;  4NCB A;  3SV3 A;  4KI6 A;  3KKS A;  2Z1J A;  3AO2 A;  3G10 A;  4Z4E A;  1BIS A;  5KTQ A;  1LW0 A;  4CF9 A;  3RR7 A;  4LY7 A;  1U4B A;  2IOC A;  3PV8 A;  1CZ9 A;  1VSK A;  2D0A A;  4DTP A;  2QK9 A;  4AIL C;  5DK5 A;  4CJ3 A;  3OYB A;  3O3H A;  4WE1 A;  3LDS A;  1QS4 A;  1HYZ A;  1NOZ A;  1QQC A;  1K6Y A;  3ASM A;  1N6Q A;  3P1G A;  4CHY A;  3WNH A;  4CHP A;  4G1Q A;  1SKW A;  3AO1 A;  4OPJ A;  3OY9 A;  1TVR A;  1TAQ A;  3NF9 A;  1KLM A;  4FK2 A;  1XC9 A;  2FC0 A;  4F4K A;  1L3U A;  4FLY A;  1I3A A;  1TKZ A;  2ZD1 A;  2X6S A;  3NE6 A;  1JKH A;  4DG1 A;  3V1R A;  2EHG A;  4CEF A;  4E7J A;  1W0H A;  4OLA A;  4DTS A;  4IKF A;  1JLG A;  3RMA A;  5JS1 A;  1SL0 A;  1YTA A;  2D0C A;  3QET A;  3SUO A;  1J9A A;  2F8T A;  1KVA A;  1LWE A;  4GW6 A;  3K57 A;  5KRS A;  3V9U A;  1NJW A;  1RT1 A;  4Z4F A;  3KK2 A;  2P1J A;  3I8D A;  4DSK A;  2HNZ A;  4KO0 A;  4KI4 A;  3U3G A;  1EP4 A;  3B6P A;  1I39 A;  1WSG A;  4CFA A;  1ASU A;  2A1S A;  1S1W A;  4RW8 A;  2HMI A;  4CEC A;  1ITG A;  3KLE A;  1KLN A;  2HHU A;  4C8N A;  3F9K A;  2E6M A;  3VA3 A;  1L3T A;  1MU2 A;  5SWM A;  3MXI A;  1YVU A;  1RT5 A;  4CHQ A;  5KRT A;  4DF4 A;  3CM6 A;  3PO5 A;  4CHZ A;  2IS3 A;  1JLE A;  1KVC A;  2RN2 A;  4CJ4 A;  4HHT A;  3E01 A;  5KGW A;  5J2Q A;  1S1X A;  1VSF A;  2ATQ A;  3CYM A;  1A5W A;  3WNG A;  4UQG A;  4I9L A;  3ZSX A;  3K58 A;  4CEO A;  4DFK A;  2YNH A;  3C94 A;  4N5S A;  4DSF A;  1HYV A;  3K5O A;  1UAX A;  2HND A;  2OPR A;  3AVJ A;  3O4Q A;  3SQ4 A;  1WSF A;  3NGY A;  5D3G A;  3HPO A;  1VSE A;  4EP4 A;  5J2P A;  3ZCM A;  4B3O A;  4HUG A;  4M3W A;  1C1C A;  1J54 A;  1RT6 A;  1DTQ A;  1SL1 A;  4IFY A;  4PQU A;  4CGI A;  2FBY A;  1GOC A;  1D9F A;  3CM5 A;  4DTJ A;  4CE9 A;  4KPY A;  3L2V A;  2X74 A;  1RTH A;  3M8Q A;  4ELV A;  3LPU A;  2VG7 A;  4FJK A;  3KJV A;  4O4G A;  3VA0 A;  3DLG A;  3NF8 A;  4I2Q A;  4Y1D A;  4MFB A;  4R5P A;  4KHS A;  4IG0 A;  5JS2 A;  4E3S A;  4FZZ A;  1RTJ A;  3CFR A;  1GOA A;  3DI6 A;  3BDP A;  1QE1 A;  4Z4C A;  1JL1 A;  4Z0U A;  1TKD A;  4HUF A;  1CXU A;  3V9S A;  3TAB A;  1UWB A;  4E19 A;  4FM0 A;  2ZE2 A;  4B9S A;  3KLF A;  3TAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...