3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
3FCUB 5KYUB 4C2AA 4UM9D 3BQMB 1YVRA 3TW0A 1JEYB 2VDOB 1JLMA 1QCYA 2NUPA 3EG9A 3EOBI 3T3MB 1DGQA 4GZ8A 4O3TB 2XGGA 3EFOA 4IHKA 5KYXA 1U0NA 1QC5A 2NUPB 1IDOA 1SQ0A 4K3JB 2QTVA 2XWBF 3IBSA 3NIDB 5KYXB 3EFOB 1AUQA 1QC5B 1RS0A 4FX5A 4O02A 5KYYB 2X5NA 2P28A 3F74A 4IXDA 3V4VB 4FWWA 3EGDA 3ZE1B 3K71B 1DZIA 2VDQB 1U8CA 3EOAI 3PPWA 2VDRB 3HXOA 1TYEB 3N2NA 5BV8A 1U0OC 5HJ2A 2I6SA 1U8CB 1M2VA 5KYNA 3NVQA 1SHYB 1MQ9A 3GXBA 5E6RA 1JV2A 3PPXA 1RRKA 2VDNB 1M2VB 5E6RB 4WJKB 3M6FA 3RAGA 1JV2B 4MMYA 1JEQA 4JX0A 5ES4B 1XDGA 1OAKA 4UM9B 1BHO1 2VC2B 1YVPA 3AL9A 1MF7A 1ZONA 4HQNA 5KYYA 4MMYB 1JEQB 2B2XA 3VI3B 4MMZB 2NVOA 1V7PC 4HQFA 3K71A 3VI4B 3ZE0B 1BHQ1 1IJKA 4MMXA 1N9ZA 2M32A 2O7NA 4HQOA 1SHUX 3IJEA 1CK4A 1PD0A 1ZOOA 3ZQKA 4G1EA 3BQNB 4BJ3A 4MMXB 4M76B 4WK0B 3IJEB 1M2OA 1IDN1 4G1EB 3Q3GE 4CN8A 4G1MA 2VDMB 2ODQA 4C29A 4F1JA 1L5GA 1IJBA 2I6QA 1CQPA 3NIGB 3HI6A 1UEXC 2VDKB 3AFCA 3PPVA 1Q0PA 4G1MB 3ZDYB 1SSLA 4IGIA 1L5GB 2ADFA 3F78A 1OLZA 4O3UB 4HQLA 3K72A 1AO3A 2ICAA 4Z7OB 4WK2B 4MMZA 3HXQA 3OKWA 2ODPA 3K72B 3ZDZB 3NIFB 1MHPA 2VDLB 2IUEA 4HQKA 4PN7A 3OKYB 1FE8A 1T6BY 5E6UA 1AOXA 5KYWA 4WK4B 5E6SA 2NUTA 3EH2A 4A0QA 4XW2A 3EGXB 3T3PB 5E6UB 1RD4A 5KYWB 1ZOPA 4NEHB 1LFAA 5E6SB 2NUTB 4CN9A 1PT6A 3OL2A 1T0PA 1YUKA 4UM8B 1ATZA 1MQ8B 3EH1A 3OL2B 3K6SA 3TXAA 3QA3E 2WINI 2I91A 4F1KA 4NENA 1M1XA 2P26A 3ZDXB 4Z7QB 3EG9B 4JDUA 3K6SB 1MJNA 5HDBB 1PD1A 3PPYA 5LN1A 4NENB 1M1XB 1M1UA 3TCXB 3ZE2B 3V4PB 1XUOA 2WW8A 3FCSA 2VDPB 2XWJI 1XDDA 1SHTX 4CNBA 1N3YA 4O02B 3EGXA 1M10A 3BN3A 3FCSB 3AL8A 4Z7NB 3TVYA 3EGDB 5HGJA 2UZYB 1RTKA 5KYUA 1NA5A 1PCXA 3AL8B 1FNSA 1JEYA 3E2MA 4DMUB 1MQAA 4C2BA 4WFQA
chains in the Genus database with same CATH superfamily
3KJHA 3CSUA 2CKMA 4AQ7A 3PQ3A 2KX7A 3OJLA 4UXHA 3S8YA 3CRNA 3NBZC 3N87A 3QE3A 3PUHA 5H7XA 3HUJF 5EU6E 3L3DB 1HWHB 4WKGA 2O8BA 4EVNA 3AKZA 4I50F 1OAOA 2PWDA 2JH2A 5C71A 1KB9K 5AVVA 4MB2A 3RB5A 5IARA 1NBVH 3DSNA 4RPJA 1KJQA 3IAS1 3NBUA 3FOAA 4DILA 2F53A 2VXQH 2IQIA 5DJYA 2H9YA 4IBVA 3B9AA 2WPDA 1WAMA 5LN4A 5C0IB 3BCDA 3MAWA 4M3NA 3VNQA 3K6OA 3N5AA 1M2OB 3O83A 5P8WA 4X8JA 4D4LA 5FXMA 4R31A 4J0GA 3LV3A 4NFDA 1IONA 4LOIA 2R69A 1JAYA 4KNUA 1HE8A 2SKCA 4P0TA 1RZKL 1ZUD1 3PY9A 2QVZX 4JLRB 3IGFA 3TW6A 2RHMA 1V55B 3AM8C 3TC9A 3JS5A 1ZLUH 4E5UA 1BPVA 1XO8A 2B83A 3N1PC 3KLMX 3UXEA 1IJFA 4GQPH 4XRGA 4LWPA 1IGIL 3PFHA 1QTSA 4XNBA 1PGPA 1ML4A 3CVWA 2QL9A 5CZKA 2YC1A 4URHA 1FBIH 1OTSC 3O8LA 4I4TB 3BAYA 4OK5A 2CLVA 2R7KA 2ATPB 5JRDS 4M5ZH 3DONA 4L07A 3OX3A 4MW0A 4M7LL 2HW8A 1F6BA 3QUTA 3W06A 4V33A 1UKZA 1BFSA 3D81A 1S2OA 4JC0A 3TPKA 4TMTA 2WKSA 2CLRB 5HHXL 3VU1A 3K46A 3ULUC 1R88A 2IQ9H 1EESA 2V4UA 1SHYB 1ULBA 3OX8B 1UFVA 2PAAA 2E87A 5EO9B 1ND0A 4HK0A 1A96A 1SBSL 3UK7A 1MFNA 4R0LC 5FI1B 2ZIXA 3G08B 3LYAA 3DBRB 3FOLB 1MF2L 2OL3H 4GC9A 1JWUA 5LHDA 4BUZA 1N3LA 4EI7A 4FBLA 4JVWA 3LRLA 1FDTA 1WCIA 3IOMA 2XWTA 3FAZA 1W4BA 1MCWW 4IIGA 3JYPA 2Q9BA 4LLUB 2FJSA 3L45A 2A77L 3TBSB 5H35A 1DKMA 3JZIA 1XJ0A 1FSPA 4B84A 4M1KA 2J43A 4BNYA 4R2GD 5DURD 2NPOA 1YWGO 4PJXB 1WAAA 3RI3A 5EJ5A 5FO1A 1BOYA 3C5VA 4C05A 2A6IA 5DGQA 3HYCA 4NMWA 4K3GA 4DCCA 3UTSA 3N1MC 4MWFB 1MLDA 4HHAA 3EOYG 4J1UA 5AICA 2MSLA 3ZDDA 5G3ZA 4L9LB 3JWDC 1C3JA 5HHNA 4AUUA 5J1TB 4NKIH 4H6VA 3RLSA 1BZDA 4G80A 4BLWA 3CNQS 5C0NC 1HHIB 4C06A 1EXMA 3CF0A 3RWGA 2C3GA 3N28A 4NYMR 1K8IB 1F9EA 4KAFA 3P2IA 1N0XL 1ZPUA 1JQDA 4PB0L 4BNHA 1RZIB 4GPEA 3VOSA 1ULTA 4W9NC 1RLIA 1Y1SA 4GMHA 1Z45A 2ZAMA 2ONCA 1GFWA 4Y1AB 3ZE1F 3RU7A 5A16A 2DQCH 1MGPA 5K9QI 4KVGA 5E7BA 3I4CA 4O8CA 4OLHA 1B3JA 2WQWA 3O4OB 2M32A 3NONA 5BR1A 1RDFA 1JNYA 1AHHA 5F2FA 1N6UA 5CEJA 1P33A 5FOBA 1YC2A 3OZAA 5KCMA 4G1MA 5J56B 1DRKA 3RTAA 2OWEA 1MA3A 1HQCA 4B6OA 4FFWC 5H3LA 3HS0A 4P3KA 3KYJB 2JVUA 4TTSA 4H5SB 4POUB 3P73B 1SC3A 4EJSB 3Q01A 5D4IA 5I6NA 3MODH 4XW2A 3DSRA 4EFNA 3MIZA 1NUAA 4Y1TA 1RUML 3TESA 3N55A 2Q3LA 2HMWA 5JHLH 2HJHA 3OU7A 3NBFA 4ZXBB 3MERA 5F7UA 2G30A 4M89A 2HT3C 4XB7A 4A8TA 2FWIA 4B3FX 2VYVD 1VGVA 1Q94B 5LQMA 5BV1A 1GV0A 4G43B 1J0BA 1R3IH 2FW7A 5DYNA 2F54E 1OOEA 4EOGA 1BWMA 3OJEA 2NY5L 2EYUA 4PGFA 1TFPA 2DPGA 4G8IB 1ODSA 4PU0A 5FGCE 4MS4B 4JLDA 1GFIA 3T8XA 3X43A 5FHAH 4PJ5E 4P2OD 3T4YA 5A3VA 5IB1A 4JS7A 1T1YA 4FS8A 3OIGA 5KSPA 4EH1A 3S98A 3C6SB 5D8JL 2F5AH 4I88A 1IBCA 2VK1A 3I6BA 3QPCA 1TZIA 3NOXA 1A3RL 1NVEA 4RIIA 3B4NA 2F8TA 1JOIA 4LSPH 3AL9A 1I8TA 5T33L 1ZJAA 4ZO8A 3A4TA 5IN4A 1WQ4A 1O6ZA 2O4UX 3U0VA 3VZQA 1E1LA 4DUPA 2P3YA 4J2TA 4RQUA 4Z77A 4D0BB 2R29L 5PNTA 5AHRA 1STOA 2G9HB 1NMAH 2F0CA 1L0YA 1ZT7B 2E55A 3HMXL 1ISSA 2FUCA 4DG5A 3CM0A 1Z18A 5MHSD 2L0XA 4FXGA 3GMQB 5IJVB 2QL5A 4CU7A 1D9KA 1FNGB 5EIHA 4LSWA 2BI4A 5KJCA 2EJBA 3DDZX 4K7PH 5C07A 1UJ3C 1TJGH 1XIWD 2V3DA 1KZ6A 5ALFA 3K16A 1E1QD 3HI6H 4X83A 3SNHA 1MNUL 5B4MC 1GAQA 3HTLX 1VLQA 3ZT6A 4IRSD 1OTUC 5E2BA 2WM3A 1JT9A 5JW3H 3ROOB 4CV2A 1FA9A 1BD3A 2NZ8A 1A9EA 4PRHA 4XC1L 4F7MA 1W6LA 3R2JA 1R24A 3D0LA 3M7IA 1ZDQA 4M48L 5SY9A 3FIJA 5BUQA 1N4DA 2JCYA 1OF2A 3DURB 2WBJA 3WJAA 4FSXA 3F98A 1DANT 2A57A 3KLSA 5LNEA 2QR3A 4RAVA 2BM1A 1OY1A 4V2IA 2IH5A 3F2VA 3ILPA 5BXYA 4LYYA 2ZYWX 3DX1A 3RWIB 1V0JA 1QI5A 5EU6A 1JLLB 3J81A 4ZW6A 3DMPA 4RIGA 4QHNB 5BS0B 2OYSA 1Z4NA 5H59A 5EZYF 5EZIH 2J9FA 1NI4B 4PN6A 2XMSA 4WXRA 1SURA 1IHPA 2RGXA 2CO7B 3B38A 4J0HA 3I75B 1B15A 2I54A 1OV4A 2XY1A 1W2WB 4FQHA 4JO4L 3GMOA 1NYTA 4YRLA 1C8QA 3TA3B 1UKQA 3CZQA 4XXWA 3GA0A 1YU9A 4W5HA 2TSYB 2FRXA 2ED6A 3CINA 2D1QA 5ANMB 2JG3A 2D2FA 4N7MA 3ZWBA 4Y67A 3OB0H 2F9BT 2KKQA 4YRTA 5H37H 1K6EA 3EYOA 3CVIL 1ZD2P 2WIJA 4F33A 2NW2A 1VG8A 3MLTA 4E9QA 4NO0D 3NGMA 5BRJA 1GTVA 4AC4A 2FO8A 5SV3A 4LGVA 5I51A 1YI0A 1DQMH 3WVNA 1K6IA 2YA0A 3EFDH 5AK6A 3BIWA 4DP2X 3DEAA 4WNAA 1HDEA 5T1JA 4REMA 4P49A 1QH8A 4F9PC 1LI7A 1SXAA 1AHWC 4OCYH 3OJCA 1FZJA 1N1MA 5M29A 1IQPA 1LP9F 4HP5A 4GFDA 1WIUA 3EVZA 4TLUA 3RWDA 3A10A 2E1PA 1Q0HA 2XWBF 5DVKA 2D5CA 3V0VB 3M1OA 1GDTA 2O9JA 2TSBA 3T9CA 2I60H 5FO7B 4KKZA 1KDZA 2HSZA 1D6VL 5C0CB 5LBUA 4F04A 4AG6A 5HHPB 3D2AA 1PK9A 4M93B 4F6CA 3OM0A 3TJMA 4YO0B 3APNA 4FE9A 3DXAB 1LEIB 3L82B 1IBLB 2ROYA 3CUEF 2EKSA 3NIGE 3CZ4A 2D4DA 5BW7A 3W04A 3H3FA 1SZNA 1FPQA 4C59B 4LDOB 2NY6B 2R3SA 4R2GC 4O4HF 4XEHA 5AUOB 2WKOF 1UKCA 1MN4A 1DVQA 2NOYA 4UT7L 1ZEMA 5J89A 1WCWA 2J48A 3DBXB 1HL4A 2IXTA 4HV8B 1BMDA 2BNUA 2VOJA 3NIWA 1QP1A 1ZFNA 5T1MB 4NCDA 4AS1A 2BS71 2BJHA 1U2GA 1ECYA 5F9DC 1C0PA 3KT3A 4FQLL 3Q5GA 4LZJA 3EYUL 2ZVDA 4LE0A 4C30A 2UUDH 3OIDA 3BI9X 2O19A 3OMZA 1T9DA 4G85A 1HNFA 5EZLA 5M7QA 4BQNA 1ZJWA 1LH0A 2H26B 2R7MA 5KDDA 4TULL 1AE1A 3L54A 1P7KB 3UTPD 4MMXC 2VITA 1D4OA 1Q22A 5LM3A 1EFPB 1OV6A 1GS7A 2QI9C 5FBQB 5KYUB 3JQBC 1F8YA 4PG6A 1ORHA 1WBYB 2F4NA 5FKPA 4B75A 3O2SB 1UM8A 3NIDB 1KDJA 3VXRD 3UCFA 4B6SA 5DMGD 4FCHA 5A3SA 4KPFC 4OZHE 1IBMB 5I0DA 3ZD8A 3MLZL 3OJWA 1XTUA 2GM4A 1M57B 4IDOA 3LZNA 3LGSA 4WW2F 3BN9D 1F0KA 5BW5A 7MHTA 4QRFA 3MXTA 4E5DA 721PA 2GKGA 2RE8A 4WI9A 1MJGM 4LSUL 2X9QA 5IBPA 3BXGA 1AG0A 5FYLE 1Z2AA 1Y63A 2AJYH 2NZ9D 1RYFA 5TGZA 3AS1A 1VL0A 5F71A 3CX8A 5JH7F 5JT1A 4P2AA 4L3FA 1XGZA 1KC3A 2TMKA 4JCCA 1FRFS 4GUDA 1GW0A 4CKXA 1F0YA 3AJAA 1CYDA 4XGIA 3LQ2A 1DDHB 1XE3A 2LKCA 2FL5B 3BMNB 2V3FA 4J6RH 4OGAD 3FW1A 5DYOB 5AIBA 3ZU8A 3NRPA 1OXYA 1OKKD 1VFOA 4OLWH 3ETGA 2LW7A 1NXQA 3OETA 4PC6A 4A03A 1JFHA 4FFYH 1NLFA 4ZUTA 5KANI 4KVPA 1AF4A 2AERT 3UKOA 1ETHA 1UDCA 5CSGA 2XDHA 1S3KL 4PJBF 3NKFA 3T54A 4PCLA 6CHYA 1FE8H 5FK9B 4A0RA 4P2OC 2R8BA 1U2DC 2OBGA 3TYFA 3EGIA 4IWNA 2GXAA 2FJHA 5E1QA 4TQGA 4DRXB 1N10A 2F54A 2ZATA 3MPOA 3ZD9A 1VOTA 3W11D 1XL4A 3RY6C 2OPBA 1KJ2L 2XI4A 4P38A 4UVIA 4IMLA 4NBTA 3TK1A 1OU4A 2GDZA 4BCXA 5FGBC 4PJ5A 1RRFA 4RM3A 2AXGA 3BILA 4IMPA 5AHWA 3FDJA 4IIHA 3QQDA 4KKPA 5GZ1A 4GY4A 2ZWZA 2CKNA 3EGEA 3GXMA 4FZ3A 4TSRA 1YDPB 2PVPA 2EL9A 4UASA 4JLAA 5EFOA 4M61B 3FTNA 3P2DA 3WD5L 1FG9C 4UIMA 3UJCA 2PL5A 4MA1B 3NYQA 2WUDA 4P06A 5C8DA 1TPYA 3P5BA 2G5TA 4CFYA 4F0JA 2LU7A 3BVXA 2HA2A 1T4MA 4G82A 1XMOB 1JB1A 1XIWC 4TLSA 2VL5A 5TDPA 3SYAA 2VQTA 4IRSC 3RVKA 3QITA 1QGUB 4QUDA 2LAAA 5GINE 5C08D 1KY2A 3MRQA 4XUEA 2EIDA 1RACA 2B0CA 4WY7H 4C55A 2E7LC 2FSEA 4TOYL 4BQFA 1YPZE 4GZ5A 5DBGA 5LYJA 2F74B 4DMRA 3TCXB 5GRVK 2E59A 4AYBA 1C9YA 1KI4A 1J2RA 4K46A 2O5VA 1H5UA 1ZV2A 3RX9A 3NA9H 3GI9L 4LPXA 2MWMA 3MX0B 1PKQE 3MBWB 1TU2B 1UVQB 4I9HA 4UAOB 2WLKA 1JKFA 3JVUA 3TVMA 4GMGA 4PG8A 1BMQA 1TM1E 1G7IB 5H4ZA 2QADB 4B32A 1DRJA 4L28A 1KIQA 5L2KE 1JVNA 1MFVA 5AKIA 3SWWA 2ORBL 4OQNA 3AC0A 2G07A 3M4ZA 1YCDA 3PKJA 4IV5A 4PYQA 3VR5D 1EBBA 4YHML 5G1OA 2FMHA 2UZIH 4P4SB 3GX1A 3DOSA 4XE5A 3RADC 3SO3C 3O8QB 3WSTA 3QE2A 4HNUA 1JG4A 2FG5A 1IATA 2UVFA 1IHYA 1P4LB 1N1DA 2AK4D 1VJDA 5I17B 2IYXA 2JAPA 3ARRA 4DWWA 3ZJ5A 4BGIA 1K6XA 2C4FU 1UQSB 1ZE3C 2CDFB 1Z32X 3I2FA 4YXHH 4YFDB 4JMXA 2VLRB 3NSFA 4BE5A 3MRFB 4IW4C 1TKBA 4FOOA 3ARFD 3FBQA 4YB8A 2H4ZA 2RI6A 1TDJA 1FUUA 3ROLA 2O50A 4UPVA 5DJZA 1TXKA 3MTDA 2G71A 4OV5B 3R6DA 1UT9A 3IUSA 1VADB 4DLUA 4YREA 3MFFB 2H59A 4LCYB 3OURA 3L4YA 2FFQA 4QUOA 1F60A 1J8HB 1SF5A 3LQ1A 3DT6A 4GEGA 1M7BA 2GITA 3U1SH 2X15A 3DXFA 1L7BA 4KV5E 5JOPE 3ONFA 3WGGA 3FYUA 4JXZA 1XDWA 5MEOA 3PFGA 3WNPA 2HRRA 3WUWA 1R6UA 1XLVA 3TNLA 1S8FA 1YJ5A 4WUUE 2X70B 5B3KA 3VXNB 4WVLA 5JS6A 2P2NA 5THKA 4KTDL 2D7TH 1AI1L 2F9MA 1MZZA 3MNZA 5KBYA 3JQGA 4DZ8B 1DQDH 4M56A 2AX3A 4I5DA 5LDSA 5DBEX 1CUSA 1JVSA 3A4DA 2AOXA 2AR7A 3EH4B 2O2YA 2X0FA 3TZBA 1NIFA 2Q20A 4MVJE 4UDUA 1CFNA 1BJ1H 2FQGA 1Y80A 4CC1A 4ZUVA 2I1QA 3T94A 2UXFA 1KHTA 5BZXA 5GGRY 2IH1B 1QEWB 2WWXA 4DGIL 3JV4B 1WSAA 2B20A 2G28A 3R0QA 1NCAL 4LASH 2ASEA 3RD5A 1CYEA 3JTTB 1XQWA 3NJHA 2VJMA 1SA0B 3MSXA 2J4FA 1N0HA 4UUJB 4OOFA 2FR1A 3V4RA 1OTYA 3SCMD 2ONJA 2VH5L 1W6UA 5DMGC 4BFEA 3ZH9B 2EGGA 3KO8A 1ZT1A 3HG2A 1DRWA 2OVBA 1U0QA 3AJ9A 3L4EA 3ESRA 3WKAA 3BN9C 4D97A 1EXDA 1OFTA 4EBBA 2RB4A 1YEKL 3LCJA 3DX7A 3CX6A 3HRZC 5GSRB 5KEIA 3WAKA 3CB4A 2I5YH 2ZBPA 3PR1A 2NZ9C 1WD9A 3GHEL 4G4SO 4NNXA 5KSAB 4PX2A 5LOVA 4OZHA 4IK6A 2JARA 1E2NA 2JEZA 1Y7IA 3TBYA 4UD2A 4YXWA 5T3ZH 4BFLA 3GLDA 5KYYA 1LNQA 4AQAA 3OR7A 5ESAB 1M73E 2XUPA 3MMSA 1EM8A 3D6VA 4OGAC 2YL2A 3T4UA 2XCOA 5FEUA 1M1YB 4EFMA 1DQQA 4U1KB 4Z7UF 1RV6X 3EXIB 2EEZA 3B3BA 1T13A 2YCBA 3IXAA 4YP0A 1F8UA 1H2ZA 4NJAL 4ODUB 5FKAA 4KHXH 2WYZA 1FGNH 5EO0B 1JGVL 2FR4A 3H1AA 3SBWC 4ZKDA 2I3BA 1NQBA 4OM7A 3PXGA 1FX0B 4QFDA 2Z5LA 1CLZH 4GBXD 4R4BB 2F19H 4NWUH 4NPCA 4B0OA 1OEZW 2QD2A 3HYNA 5EO1A 3REWB 3W11C 5AOLA 3RUGB 3S88H 1QYWA 3HZRA 1M34E 4ZQKB 4CETA 3AL8A 1IC0A 1N6PA 2QX8A 2PUAA 2Q21A 1SVWA 3L3BA 3NAGA 4CSSA 4CM6A 1J0IA 1WWKA 3VU3A 3UAOA 2W48A 5FT9A 1CXFA 1TCVA 4S0XA 3UJDA 1TSHA 4Q0MA 4XBEH 5BWCA 1HKLH 3ZWAA 1ACZA 5E51A 1ORDA 3RU2A 3EOAI 2HIAA 3PDWA 3LY5A 5B36A 4WLFA 1CQIA 5I5GA 1G9ML 1R74A 5FAAA 3APFA 1FP6A 1D2MA 3TBBA 8FABA 2R5NA 5MFZA 4UBMA 1BZ7B 2IDTA 2GZHA 1NIPA 3KPPB 3LM8A 3OHMB 4GSQA 4JQXC 4ADSG 3HZHA 3ECBB 3FU9A 1EWTA 3TJEL 1N2HA 4X0KB 5MP6H 3KPUA 3UMTA 3GFFA 5I1IL 1AS6A 4D79A 3FTQA 4R7VA 4PHCA 1CFQA 3IU4H 3HE7D 3Q15C 1ZHKB 5EBLA 2R1UA 3KWVA 4MGKR 2N7AA 3K72A 3MLEA 4P4RA 2XZQL 3OXRA 2TRYA 3LA6A 5AJHA 5KTEH 3NU1A 4OBWA 3VU2A 3L49A 4Y4KA 4DMFA 5B1DA 3UMGA 1K97A 3IAM6 2PFKA 5E6SB 1T6YA 3QFJD 3EMKA 4R1NA 4LHQB 1AS2A 2ENQA 3KVQA 3KE0A 3P9XA 5FO9A 5B55A 2PZEA 1PFYA 3FMIA 2R84A 1YPZA 3F6YA 1K4MA 2GFBB 4XN4A 4OIIH 1X5YA 1O9VA 3OPMA 4Z7NB 1PNCA 1GTL1 4PQFA 1V5JA 5LD2C 4P9HC 4LCWD 3H1GA 2ROXA 4G8BA 3U9PH 4EQ6A 4GFTB 5F3FA 3CJJA 1G41A 2D54A 1FJXA 5T5NG 1I82A 2JWHA 3ZTWA 1UH3A 2HB6A 4CLHA 3ULVL 4XIGS 1YS4A 1DN0A 1PKQA 2OPHA 3BKCH 1BQLL 3LU1A 2QDXA 1SZJG 3RHZA 2AGJL 4L73A 5E6RA 5D1ZA 4UM9A 5CBEB 3RBXA 1RZJH 2FIKB 3F7PC 4A0GA 3OF3A 4PPNA 3GYRA 5L2KA 3V8EA 2WO3B 3RAJA 5DXAA 4PWKA 6ADHA 1JZ8A 4FYMA 4GYJA 1MZVA 4Z78A 1T2XA 4WESA 4F57H 2XF8A 2B3RA 2YN3A 3V1LA 2CBOA 1V10A 1E8NA 1KKUA 3ARFC 1P2GA 1C7JA 4GRIA 2KZ1B 1ZUHA 4UMSA 3HJHA 2X2OA 4C0LA 3PNKA 1INQB 3HVUA 5CAEA 4WBSA 3WKYA 1C5CH 1P7CA 3F3YA 3WKEA 3TN0B 4R8MA 1H9VA 4ETNA 1EXHA 2ZZUT 1QPKA 1S7GA 4LLDB 3D3NA 3SKJL 2JLLA 1Z07A 3RQIA 3NH6A 4F97A 5LQBL 4WFED 1X86B 2FXIA 4PIPA 1LLAA 4AROA 2BXYA 1Z5ZA 4IEFA 1MQAA 1DAKA 1F3DH 4C2AA 5E0KB 1UBOS 1X0XA 1TVKA 3HCVB 2MDTA 2ZB4A 4GOMD 4B6JA 2WWRA 4EK9A 1ODUA 4FP8H 1DZBA 3CLEL 3P9MB 1WXWA 1RJ9B 2EG5A 3DLHA 2OCBA 3N2NA 4Q4AB 2WCPA 3IDZA 5FHRA 2QLTA 3W5IA 4WUUA 2V7QD 3INRA 1TMYA 1OILA 4NE2A 4QYMA 2W0KA 1S7SA 4V0SA 3GXDA 1FCGA 4N1CA 4YHPB 1SQMA 2AYXA 4BQIA 621PA 4HVTA 1JJUA 2PKDA 4BD4A 2FO1A 3GG2A 3ZJ4A 1ZOSA 3A3NA 4GX1A 4PRNB 2JJ1A 4MP6A 1BECA 4F4IA 2Q5JA 4D0CA 1N5IA 1T8RA 4GKNA 2R56H 3D8NA 1WZAA 1FVEB 3MYJA 5E2VL 4QRSA 5DE3A 2BHZA 4MVJA 3D7KA 1QVWA 4EQ3A 3D85A 5A2GA 4GP8B 1EX9A 4CEIB 3AINA 3HDJA 3RVMA 1Q0UA 2J9YB 5BN5B 1KYAA 2XLBA 1U3VA 1CLOL 3SCMC 5LUBA 4DFHA 4JUBA 3CFYA 1MB0A 2P69A 2YOFA 2FNWA 1GFZA 3OLZA 4OKNA 2N3ZA 3B7UX 3INOA 1T9GR 1FDUA 3MZGB 3FPGA 4R96B 1U8IB 1J1PL 4OM0L 4BMZA 4L2LA 5L45A 4R7LA 4QSMA 2DDQH 4QRDA 5CMLA 3EXG1 2H4HA 5AK0A 4HFMA 1JQJC 4M2LA 3CBRA 1O7VA 4LSVL 1KCBA 4FXKB 2XETA 2WYWA 1HCYA 4FWBA 1GZUA 4DWOA 2ECQA 4I1PA 3LPOA 3ROXA 2NXZC 1EJ6A 2JHCA 3VSEA 5D1XD 1DUIA 1K4YA 4LO9A 3LQFA 1MRSA 3THXA 1UD5A 1Q0YL 1KAGA 1OCWL 1BSVA 4NOKA 2PCXA 1LO0L 2FPWA 1S9VB 1YEEL 2AS5M 5AQ1A 2GD2A 1E9OB 2CFSA 5DZPA 2FLKA 2HADA 5JIIA 4DGVL 5EULV 4B3GA 4G1EB 1U7OA 4NJEB 1YYLH 1M4KA 3TSAA 3VZPA 3QPBA 4ZA2A 4CA4A 4GBXC 3BMOB 4LXHA 4QUKA 2G4VA 2VHZA 4ZMBA 2Y1WA 1G20E 3AR2A 2P46B 1EZZA 4X0EA 1SEBA 2BIMA 5KQLA 4TKWA 2Y1FA 2LT9A 4ONGL 1P9OA 2II6A 3D0QA 4MI1A 1RJCA 5IVHA 3ET9F 3MT7A 5HPMA 3FUCA 1ZJZA 4E31A 4YL4A 2V74B 4KO6A 4PTTB 1MT0A 3L0ZA 3JBG7 3L3KB 4D56A 3H7BB 2HMYB 2R9VA 3T0XA 1OXBB 4Z0XA 5JMWA 3GHBH 1PYGA 3E3LA 1CDUA 2IX9A 1M34A 2CSUA 1W8OA 4R68A 1VKOA 3DTVA 2PLTA 5HDQA 5ESQA 2MWCA 4OZGE 5CP8A 1TCUA 1UM9B 2X7LB 2IU3A 1JS1X 1GLNA 1DX4A 5C6PB 3DGGA 3VA6A 2CRIA 1BAWA 1SU8A 5ICZB 2AFIB 2JZOA 1HSAB 3CZ5A 3EUWA 3H0KA 1LO3H 2BLFA 2XQ0A 4HAYA 3W1ZA 1BDIA 1MX5A 4KO9A 4N0YH 4V0NA 4JAVC 1U3TA 2DIJA 5IVDA 2PETA 5A4JA 1UB5A 5ARDA 3HE7C 1FFXA 5HJDA 3V4VH 5GM1A 3IPEA 4B60A 2FGWL 4OF5A 4MQTB 2J31A 3BKJH 3LE8A 3ZDEA 4L8GA 1AH1A 2N0KA 2ZS8A 4G0VA 1OP9A 4FZRA 1YR2A 1M1NA 3TEZA 1S7VB 1QYRA 4LLQB 4TVPD 2ZJ5A 3VR4H 3AKYA 4DJDC 3OESA 1UC8A 3WFHA 1L5GA 1F4YL 2PZAA 3QEBZ 3TO4A 1JDUA 3ZSSA 5INTA 5F72S 1ADQH 1Z5VA 4KRNA 4HOWA 4MFHA 2WQUA 4KI5F 3HE3A 2PWYA 5REQB 4RTJA 1BN7A 3GSWB 4EABA 4KVCL 4HIEA 3LKSB 2G4CA 3K74B 3U17A 4GLLA 3APCA 2Q5OA 2QPLA 3ZCQA 3M81A 3B9EA 4HDCA 3WNDA 3UC0H 4BYHA 2A94A 3O8OA 5JV5A 1X7TA 2VXOA 3RKUA 1BQHB 4EAAA 3NFYA 1FJ1A 4R0LB 1TL7C 3NBAA 1FL6A 3C08L 1W0JD 1PSDA 1Z3GL 4ZFOA 3L92A 2DH5A 2FMIA 3LPDA 4DTGH 4BKLA 3ULVF 3OLQA 4UTCA 5DO9A 4TYMA 3PV7A 2FOXA 1R3KA 2X41A 4LV6A 4B35A 2Q46A 4AU1A 1MAMH 3CH6A 3CVHA 3O6LL 1F97A 3HUEA 3R3JA 4CDGA 3S40A 4ARBA 2ZOOA 1XCJA 1ET5A 4XP4L 4BFYA 2ZQZA 3PQFA 3DJFA 4P2QD 1A9RA 4HFUL 2J1WA 5J9FA 4XRCB 3IF1A 5CZXD 2WUEA 3VRJB 4R9NA 1I9RL 5CN1A 5HBBA 2GPZA 4H8WH 1YS2X 1K5NB 3H6GA 1A3LL 2CG9X 1RYBA 1XDGA 5IP4A 1Y1PA 2R1YB 2PK3A 1GC1H 3L3DA 4NKDB 5GGRA 5FOVA 5L7XL 4KQMA 5TQ2B 3PKIA 4HQOA 2R6FA 1YCFA 3TH3T 5C7XH 4LGSB 1IYZA 2JPDA 1EGHA 3CG8A 4NZUH 4WQOA 3PG2A 4E07A 3FHEA 4WKNA 4BMXA 3M7OA 1L4UA 1EAOA 5FTMA 1EJOL 4Q05A 4PSVA 5HGDB 2FX2A 4QDTA 1CRWG 1DLFH 1AP2B 2VPPA 3QPVA 3SBRA 5ANME 3WEXA 2WIAA 4TSFA 2YOAA 4Y8DC 1QJCA 1YR8A 2FH6A 3AW5A 1EFXA 3OL2A 4YP5A 1W75A 4Z95L 3M89A 4C78A 3DMMD 1SBNE 3WLKX 3U7YL 3HVRA 3UO8B 1SIBE 5BV7C 5HDBB 3PJFA 3ROGA 2JB6A 3UC2A 4XHQA 2YWGA 1U99A 3EMBA 3DL4A 3OF2A 4MS1B 1D7OA 2O3QA 4QHKJ 2CMRH 4P6VF 4QDJA 2JCCB 4CKQA 4ONEA 1UMCB 1V4NA 2YC2C 4OB5H 3CFJB 3KXFE 2OHHA 1A2YB 2Z35B 3LGXA 4MX7A 5CEYB 4FIDA 4CT4B 4JKYA 2WNXA 4F27A 2HT4D 2QRUA 3SBQA 1V3KA 4QJBA 2FN4A 5BSWA 3K5HA 2AC0A 5G1NA 4MZXA 4AMKH 2FQWA 2C4NA 5CEEA 3G04B 4K9DA 2LXNA 4GOND 1P4JA 3FPHA 1V2GA 3NW9A 3VXUE 1A1OA 4HJRA 3U61B 3FCYA 5G4KA 5COAA 3FGOA 4OZFA 1NLBL 5MGBA 4V3BA 2G0NA 4TQAA 2FT6A 4PRLA 2I3AA 1XQ1A 3NTUA 3LUCA 2ZWPA 3IX7A 2XQYG 3IP8A 2YSSA 2V5MA 2MOKA 3V4LA 5I6DA 1Q84A 2P2DA 2RAFA 2WIMA 4ZDJA 3UHFA 5EJ8A 4PM1A 1Z4LA 4BU0A 5FNZA 4UNRA 1CLVA 1IMOA 2VIIA 5BMVB 1DHTA 2ATCA 1PZ5B 2NU7A 4HOMA 2NTNA 2X4PB 4W81A 1NIJA 4DA4A 3OTOB 3CKMA 2VLJE 2XV2A 3EH1A 1AQLA 2WSBA 4HJXA 2JHAA 1PEKE 4KPHL 3MNFA 2QKIA 1PD1A 4MJIB 2P77A 3GGDA 4KU4A 3RVLA 3A6BH 5TX7A 4R8WL 5FV2A 1Y89A 5BN1A 4M00A 3EUFA 2QU8A 5DQJB 1F2UB 1KCVH 3FB4A 5CNJA 4W4OC 3PJRA 4Y9BA 1UJNA 3RODA 5D1XC 1R0WA 4DDWA 1D6JA 4KMSA 4AQ1A 1IAIL 4EHFA 2ZUXA 4DABA 3Q5YA 3N8HA 1DWPA 3C1AA 5CYGA 3RTLA 1UJ3B 5SWQA 3Q3EA 2Z8WC 3RVUD 1KDRA 4RLQA 3VFTA 4KP7A 1QABA 4MKFA 4JN1L 1W4CA 2PO6A 4MRPA 1R33A 3FWNA 3FQTA 1B76A 2AOWA 5CDHA 4LKCB 3EIEA 2YR3A 1QUNB 4FMPA 4XT1C 2P48B 3PUUA 3G9VA 3U4QB 4Y0VA 1GY1A 3OLGA 2BGUA 3B36A 1JZ5A 1FNCA 3CTPA 1LILA 5A2CA 3UMSA 2BVTA 1CGXA 4URKA 2ZRDA 1G9NL 3AMLA 4NPJA 2OQJA 2QYOA 4EPTA 1NHGA 1HSOA 1NEZG 1T6BX 2FB4H 5ADWA 3O4JA 4YGYA 1M6YA 2WLSA 3KWJA 3GCWA 1S6YA 4UZFA 5EPUA 2WHYA 1DJSA 1ZC3A 1WF5A 4L5FL 2HMID 1II8A 2JF0A 1JPTL 1G20A 3OXSA 1U1CA 3N3AC 5CK5A 3HPJB 2JLSA 5DWUH 1C7FA 4MYTA 1CUZA 5I19H 3U4KA 4ELMB 1RULH 1E5CA 1GGCH 2EG9A 3ZMRA 5NLLA 5GJCA 1UEIA 2XWCA 1GO2A 5KJRL 4FQXA 2NTSP 1ZVSA 2AUNA 3P77B 1EP2B 2VDOB 5IUKC 4Y9DA 4N0EA 1P81A 5FM8A 1J0KA 4R1QA 3U80A 3BKYL 2G06A 4GW3A 1P4BH 4OZGA 4BVGA 1ITZA 4WI0A 3RJMA 3KUCA 4JHAL 1HC1A 4HKZB 4K28A 1QTYT 1W93A 1RZPA 2IADB 4GG8B 1Z26A 5JZBA 1EUCB 2XCLA 3WFJA 3T1TA 3DAGA 3MT9A 4RJTA 4M1MA 4OUDB 1ZK5A 2MFNA 3PXDA 3I6LD 4ZTUB 3A4VA 3LQKA 5DA0B 3QO0A 4MKZA 5EUCA 2IP4A 3NTRA 5EDSA 4MJJA 3MBEA 3WHIA 1XHFA 2VTBB 3OKCA 4LNHA 4YUVA 1KI7A 1IJNA 2CHDA 1R17A 1AHWB 2GIXA 4YDHB 3ABKB 3UIZA 3D6TB 4C7JA 1FNEB 2PL9A 2NADA 4MWTA 5LU9A 3QZWG 1QEXA 2G7MC 5E70A 4R1OA 3JR3A 2YJ6A 1TA0A 4QVKA 3M7FB 2YVLA 2B8EA 5CJ2A 1GS8A 4QQ8A 1T0PA 1N6VA 3QPQD 1H8EA 1QP0A 2ZFUA 4FEEA 5AKLA 3UQZA 4EXPX 1UINA 2WU4A 3JWGA 2DWEA 3AY0A 4KTVE 1EINA 3G2PA 1U2EA 2CYBA 2C3UA 2A9NL 5D7IB 1Y1LA 5JORA 2C7UB 2FWOB 3I6GB 4R2GB 2D59A 3DKKA 4PRID 3WNQA 2EDJA 1GAEO 5DURB 5CZXC 2QZ5A 2FG7C 4DJFC 4X7TA 3R5JA 3ROOA 2ZS9A 1HRKA 3VFSA 2QVXX 4OAWB 4R7DA 3RANA 2CGRH 3GGWB 5E3HA 4YHNA 4LYEA 3VFGH 3NUKA 5ENWA 3UMVA 3U7GA 2JLVA 1WP4A 4P4TA 3VFVA 5JW4M 3QC6X 3SE4A 2QE7D 4TV8B 4G1VA 3SZ3A 4N0PA 1QD0A 3PQ8A 3WMGA 2VP4A 3P4XA 4D96A 4Y4FD 5LA6A 1NEZB 5EBMA 4E42B 4H27A 5BV0A 1XKLA 4MHHG 4M1SA 2NVOA 4MKGA 5AALA 3T7DA 4KE9A 2YGPA 3KGSA 3RWIA 1DL7H 3PNWB 3SDYL 4Z7OF 4L0YA 1CDJA 4MMXB 1GEEA 2YJQA 3DR3A 5EUMA 3IE2A 4LBAA 3KLLA 4HU2A 4NBYB 2BLLA 4YRFA 2VLMD 3HS3A 3JVDA 3IAHA 3D3VE 1Q0PA 4MJ7A 3KCNA 2I80A 3DMMC 4BFBD 3CHQA 4BFIB 5I16A 4YDKL 4K2HA 3I75A 5E5MB 3HC3L 1KB3A 3QO1B 2MH4A 2A73A 2C2OA 3DWEX 4HF7A 4NCJA 1ZS8B 2OPCA 1WETA 5ANMA 1K3ZA 1E4JA 1GDHA 5IDYA 4GBGA 4U5QA 2VHCA 1VENA 3PL6A 2VLRE 4IYKA 2YWHA 2HSEA 3MQIA 1C9DB 2R0ZH 1CDZA 3SXJA 1YJCA 2HT4C 4J94A 1M2GA 2O05A 1NVWQ 3ZXYA 1YQVL 3S68A 1TMGE 1UCBL 3I64A 4Y7DA 1OGTB 3UGJA 2G9VA 1BXGA 4IMRA 4CQNA 3KGTA 3HAEA 3QLTA 3TRJA 1AKPA 1P5VA 3KXFA 1CG9B 4U1LB 2XRAH 2AH5A 1VE9A 4WZBE 3UPDA 2E27H 2JLWA 2X28A 3IV7A 1W85A 1Y4ZA 1L6XA 3OOYA 1ZXLA 4HPOL 3NG1A 1P19A 4JFRA 3ZU5A 4FRWA 3UWKA 3QZWB 2BAGA 4G5SA 1JLHA 3IHKA 4MQ6A 1M7GA 1WIPA 5CA1F 3NMUF 2LHAA 3V0VA 6FABL 3KKNA 3HU1A 3ZC3A 1E0SA 1BIHA 3VXUA 2WXPA 1S9YB 4HWPA 3TLKA 1UM6L 1HYQA 2W8ZA 3GJRA 3AGWA 4P2OB 3WIDA 4ETIA 3FUUA 1S01A 1GTNA 1HZZA 4HFWB 4MB5A 2YBRA 3IN2A 4TLKA 5G5DB 3HKFA 4XQEA 4NDMA 1DV2A 1R4XA 3VFOA 4JGNA 4HNQA 2FW0A 5DHSA 4NMLA 4UV4L 4WACA 3TGXA 3P02A 1EDZA 5A43C 5AI4A 1R4NB 3ZDYF 3SDDD 4XN2A 1L4MA 3ZWPA 1E2PA 1TTAA 1TU0A 5AVWA 2XYHA 2DKOA 4RWHA 4DCUA 4QTIH 2VAAA 4D1YA 1UBRS 1WMSA 2NSLA 1Q9WB 4F92B 3M6IA 3RIGA 4JQIH 1MWAA 2V9RA 2BGIA 3UK1A 2VLJA 4E9VA 4ZAVA 2XQBL 3PHOB 4JFFE 1RKBA 1I01A 3MRPA 3GFQA 3HJNA 4CEJB 2ZT8A 3V7UA 2J8UF 4GXNA 1E69A 3BIAX 3CZJA 3PLRA 4PZ9A 2QD4A 2DQEL 3LYUA 1GW6A 1V8OA 3CSYA 1XIWB 2V7UA 1ZGLM 5K4HA 2I4RA 3RVUC 1TG8A 5DFVD 2H1XA 4H7PA 4TSBH 1DLHB 4IRSB 3ESPA 4AURA 4ZI7B 2JLYA 4NN7C 4HEHA 3Q8BA 1D03A 1WWCA 4B7UA 3GARA 3GKWL 1CLYH 4G42B 4AENB 1IAQA 3GWJA 3S2IA 3G2QA 2H1SA 1NKGA 3CRZA 4BAGA 1PZNA 1QBKC 1DC7A 4ZAXA 4J1TC 1JHLL 4RMRA 4F46A 1FZMA 1GSIA 1NW8A 2YOHA 4PINA 1X1CA 5I7WA 1LBSA 4LLVA 3A6OA 5CD1A 1CCZA 2HMIC 3B8EA 5K45A 3QXHA 5DQDH 2DR2A 5TMEA 4QEGA 3RKRA 2E21A 3QEQE 2Q3AA 2ZVPX 1T0HB 2FKNA 4H6XA 4OD3L 3ELBA 4KK5D 2IELA 1TPXC 1IU1A 2IVFC 4FI7A 2DY0A 5F1IA 1JG3A 2DTMH 3NSCA 1U3WA 1O7SA 3ZQXA 2XE6A 1JRLA 3RI5K 4I2NA 3ZV7A 4KQHA 1MO2A 3RAEC 1RCYA 3LNDA 3THWA 4NYLB 2QPEB 4ZCPA 1D9XA 4FEYA 5EMYA 2CMDA 6Q21A 4U6XB 3SO3B 3ISWA 5E1AA 5EVJA 1FVFA 1W2GA 3AG2B 3A6DA 3ZV6A 1Q7EA 3OA0A 4H4DA 4R5VA 1E32A 4Z8FH 4F45A 2EYTB 3VZDA 4Z4CA 3THOA 1XF3A 1OBFO 2ZF9A 1XF9A 5FK9A 5E08H 4IYJA 4AKQA 2Z1KA 3LSOB 5E2UH 4YSEA 2H3EA 1O6SA 1INDL 1NW4A 2DQ6A 4L4ZA 3VI3E 2RGAA 1T7WA 5C8VA 4TROA 4E5XG 4QELA 4TQHA 3PQ6A 2YTZA 2G67A 4AEHH 4ZVTA 1V11B 5AAWC 2O7RA 5B38G 5A0TA 4FGLA 2DM4A 5B7MA 2YDYA 3BH7A 4CR6A 2R87A 2GPYA 5J4MA 2CHWA 2VK4A 1FO0H 1G8AA 3R3VA 4RVUA 2BIHA 3PFCA 1L4IA 4NZTH 1UJMA 2B1JA 1HNWB 1HI9A 3S2UA 3S37X 3OC5A 3BS4A 4N5NA 4YRNA 2YKGA 1EEYB 2JKNA 3J7AC 2E9JA 3QPQC 2CPCA 4PY8J 4F2DA 3GS7A 2CXTA 3VXTB 3FO9B 4FLEA 2HSWA 1A88A 3H84A 2O0MA 5D1QE 1TF5A 5I7VA 1G3IA 2YGQA 4UQ9A 1CLEA 4XMUA 1UZ6F 2O5ZH 1GCYA 1K7EB 3VAAA 4I8DA 3CUPB 3PF2A 1CR0A 3FB8B 3CMGA 2D03L 1V1RB 2CYAA 3V48A 4F1KA 4YSQA 3RZCD 3FCGA 3KJXA 2AR9A 2WTMA 5LDGA 3WFDL 4PREB 2OYKA 2GJ4A 4LVCA 2JKZA 4LZLA 1MJUL 3RFZC 3H42B 4O2BF 1E8XA 4EITA 1FO0A 1NZFA 2DPKA 5CIQA 4LAFA 2OG2A 3G9TA 4FDUA 4CM4A 1J10A 4OQTL 1MMFB 5FO0A 2NTVA 4HRAA 1CZOA 1VFMA 3MRNB 1K9VF 1LWOA 1P4AA 4AEFA 4YMTA 5CA0A 4Y4FC 1LK3L 4LGCA 4LPUA 3HVDA 1X9IA 1RQRA 3IBEA 4LJLA 3BSFA 4H1LA 2ZBGA 4GO6B 4N0QA 2NNAB 4WGGA 3ZYOA 1A6PA 3IN0A 3B3GA 5BZWB 1GYPA 2R4UA 3H85A 3O26A 2JJ8A 2YPLE 2YRXA 1DCMA 2YWXA 4U7MA 3P2TA 5FUYA 4HQNA 1QLRA 5A6SA 2PPCA 2NUAA 4X8MA 2DWDB 4NZ9A 3VXRB 1Q9OB 5C0DA 1EVUA 5BRZD 2EYSB 3MWDB 4HC1L 3ZIYA 3NBXX 4FQQB 2ZR8A 2F48A 2UXGA 3ZTJG 1TVEA 1UEXC 3BBPA 3NGBC 2VR1A 3OKLB 5HHMD 5JNLA 3KQMA 1FRGL 4I2XB 3WTBA 5FS5A 5LGHH 5I2IA 3RRNA 1GGNA 3P4NA 2CIIA 1ZWIB 2XRFA 1HLDA 4PG2A 4HU8A 1YIDA 3D3VA 3HRZB 2XB6A 1JU9A 4JNCA 3COZA 1L7TL 1P4LA 4EZIA 4UVDA 4L8SC 4LPWA 3ABLB 4REOA 1PLKA 4YJ2B 1NGXA 4FZJA 2H00A 1F51E 4LOAA 4FR0A 2H54A 4WNQB 4OY3A 5IQLA 2YYYA 1ADGA 3RRFA 2CDFA 1JD9A 5GRWA 4E5MA 2CDNA 2XYCA 3OKEA 2WFZA 2PGJA 3UFBA 2VLRA 1LE5B 1PFOA 4ZOCA 1A9SA 3IPYA 1XH2A 5EHZA 4K23H 5SYMA 5B38B 2D7QA 4MXQD 2Y25A 2QMUA 2JIZD 4YAOA 4RGND 4QRUB 3SE9H 1SAYA 4IK7A 5LQRA 4YHYB 4HWOA 3O3DA 4PV7A 4PW0A 4RV9A 2C7RA 3JV6A 2A9AA 1KWGA 3QULA 5J0BA 3PA6A 4JR1A 3AVUA 2ICCA 2WNIA 3WNIA 2B21A 5JAPA 2GCPA 4WZBA 1SM3L 4J0FA 1ZK9A 1F8XA 5DYFA 2YR0A 5CILH 4YR6B 3AESB 4NUJA 3D43A 3GEPA 4X62B 2EEFA 1A1SA 4WIQA 3RIYA 4M60A 4HW6A 4KN5A 1GOFA 2VUKA 4HWRA 2WLYA 3LEYL 4G89A 3B8YA 4UUNA 4U2ZA 3SDDC 5H16A 4LEXH 3BHNA 1W0WB 6ABPA 4LLYA 4W8OA 2R66A 1N5LA 1KTLA 1BP3B 4Q1DA 2R2BB 5IJKA 3L3IB 2XBDA 4LVNA 4MR7B 4XIYA 5DLYA 4AZ0B 4RBPH 2YA1A 4P59L 3FMGH 3PD7A 2OC4A 2AOTB 4DRZA 4OI4A 1SPDA 3S4YA 3GVHA 1C3OA 1CSEE 4B4OA 3RTQD 3VWKA 1PFGA 4XP5L 5HJGA 3C43A 3U0WH 4WUKH 1N9GA 1F4PA 5KNDA 3E6AA 5ISZE 4TLEA 5JXIA 5TE7L 2LCFA 1A9OA 4F7CB 3TM6A 2XV3A 5DFVC 5IYZA 2QQ5A 4JM2F 2EAEA 1SGWA 1WO8A 2LABA 4RM2A 4N65A 4JFFA 4L8VA 3OF5A 5C08B 1MRDH 2I9LA 3PNYA 3I6QA 1NDQA 3VWJA 3LT5A 1FNSL 3S3TA 1EFUA 4G0NA 2VXTH 4C4RA 4JWKA 4LP4A 1EANA 3K0HA 5BXFA 1P1ZA 1ZGCA 3HXKA 2VL4A 4LJSA 2PN5A 3MXVL 3DSFL 1XBDA 4NOFA 1BWPA 1NGYB 4NCAA 2J9XB 4YYEA 2GFIA 5JPMC 3TBTA 3UJIL 4DPRA 2BVOA 4J8RA 2A30A 2UXTA 1G291 2H1WA 1Y1RA 1YNLL 3U9LA 4WI7A 3VSAA 4GXRA 3Q11A 2AMJA 2C2BA 4U6TA 4WL0A 1BX1A 3MRGB 1DCFA 1TKWA 5LD2B 2P42B 1U1IA 2B8JA 2W90A 3MOIA 4LJ8A 1Z2NX 1SBBA 1I7UA 1E3FA 3ME5A 4KK5C 2AEQH 2PWBA 4E5VA 2WNSA 2EJTA 2BFDA 1DUZA 4PRHE 1YZKA 4XMTA 4BINA 1TQSA 3PDOB 4G6KH 3GSNB 1EAJA 1ZSDA 3DJ9A 2X6RA 3TFWA 2B5WA 3G0BA 3TF5A 3QXUA 4AP9A 2OK7A 2FOIA 4LOHA 1X9LA 2HBRA 1PGNA 2HDHA 3QEQA 4BFWA 2OK8A 5L6YH 1KENH 1QG3A 3ARVA 2OV1A 1ZHBA 2Z9DA 1F4AA 4IBWA 3KLNA 5KSUB 1N2OA 2R69H 4ODUA 3I50H 2AK4B 4CTOA 2M1ZA 3NBYC 3DTXB 1L1RA 4NXKA 3MJFA 3K6RA 1ZXXA 4JGJA 4F7TB 4Y5YC 5DRXA 4B87A 5DZVA 3X2EA 1OXUA 4CMHC 2YIJA 1N6KA 3Q8MA 3OHXA 4DCVA 5BWLA 3I37X 1FSGA 3RYTC 2HFEB 2Z4QB 3H5VA 5AH0A 1TVHB 4DM3A 1UBTS 2VFAA 4XPAL 5C8YF 3EISA 1MJ7L 5GJSH 5DUBA 4A1OA 4FEIA 3ARFB 4ZYVA 3HEBA 3C3YA 2XEDA 1BTOA 2FHSA 4IBLT 3P4OA 1M5RA 5AVQB 2BSTB 3WXBA 3IKLA 5I18H 4IY1A 1TI7A 2WJPA 2NT1A 5GGXA 3VZCA 1F6DA 2ZAOA 5FR1A 2BJWA 4N9WA 4AIXA 3VI3A 3IJRA 4CV3A 2OM6A 1P7BA 3F6PA 4HEJA 3G6WA 5D7JD 2OHFA 3IK2A 5THQA 3IEAA 2DERA 1D2PA 3LS4H 2G0KA 4P3CH 4YDZA 5LWYH 4B0MM 3F8UB 1W5TA 1FZKB 3ND6A 1MCLA 3FSWA 4WHYG 5BR7A 5KAQF 1RIHL 4ZU1X 3BEWA 4LQFL 4C58B 4FHDA 4PSAA 2VHEA 3MOAL 3RZCC 3I34X 4DSUA 2YN5A 1KL7A 3LRHA 4M0KA 5ANHA 2XG5A 5IFKA 4JE0A 5D1QA 1ST2A 4KUCD 3ABOB 3NOOA 1M05B 1YL6A 4MCZA 3TLXA 2HBQA 4QPPA 2CMKA 1HDGO 2AFNA 4ZAKD 3RYIB 2NSDA 3MVEA 2WXOA 1EJBA 1VXRA 3S7GA 1DTWA 1WXDA 3A4MA 3EDKA 1CR2A 5FWAA 2XE4A 2DFVA 4V0KA 4MGEA 3R06A 1WMAA 5C09D 4HNAA 1QPZA 2AWNA 1HL7A 3NEEA 4X6BA 2BSRA 2DI8A 3FM9A 5A9TA 1DWUA 3FY4A 2B25A 2A1WH 3CZAA 1T83A 2Y0PA 3B5GA 3QWRA 3ZY6A 13PKA 5FX3A 4AZWA 3DROB 4CSZA 3PXUA 5JDSA 2WWGA 3I01A 1EERB 2JAWA 5AVTB 4PJHB 4JKPL 3SCMB 2LDBA 1EH5A 2WA1A 4Y2OB 2WD7A 4KUZH 1CG6A 1Q72H 1T4CA 2D5BA 4RTMA 1DFHA 1BHO1 1DJYA 1PAZA 2YPLA 2PV0A 5FYKE 5HYQB 2Y0BA 4E12A 1DZ3A 1R0SA 5AVZA 4G4IA 4JO3H 1I1QB 1JSYA 3MELA 5IVXE 4BZXA 1YHPA 1ZD1A 3E15A 3TOZA 1PS0A 2V2WA 4EX6A 4XR9A 4UE3S 1FSZA 1K06A 3O45B 1ADBA 2J46A 1SMKA 3HN5A 3AVPA 2Q49A 2YIDA 3DMRA 1JGIA 5JZOA 4H35A 1NQTA 4N2HA 1R9NA 1RQ2A 2ZKXA 1HT0A 2VXUL 1BX2B 3AUVA 3FUTA 3ZHZA 5LBVA 2BIQA 4YRAA 4G5XA 3GEMA 3PC8C 4MXQC 3QPWA 3Q2OA 4GNKB 2C5FA 1MW0A 3TOCA 4L8LA 4X41A 4RGNC 2VERN 1ZD9A 4HLZG 4AQ8A 2E4TA 3TN0A 5CFHA 4C0HA 1G7RA 1T8WA 3MNVB 2I8CA 4RKYA 4B7ZA 5CEZD 5IM7B 4GBXB 5JWOA 4HS3A 2JA2A 2DUWA 3DV4B 4DCQA 4ND8B 2WF9A 1YEFH 2ADJB 2XVAA 3GH1A 3UVEA 3PIIA 5ENZA 3PGDB 2JEOA 3MGAA 1BLIA 4NBVA 3TR0A 4IOIA 5DC4B 2O2IA 4UDYX 2EUZA 1CFVL 1QS0B 4EWLA 1F4XH 1YVPA 3NP3A 4A2HA 4EG5A 1V5GA 3JV7A 4Y1FA 2VRQA 2JCBA 1QE0A 5F9WC 4G67A 2BGJA 1NYRA 1ZLSL 2I9TB 3RURA 1XWFA 4W9IC 2QAJA 3E84A 3S29A 3RTQC 1AGNA 2PWAA 1TF4A 4YX2L 3BFQG 2BRUC 4IDQA 3LH9A 2HG5A 2LFGA 2YN0A 1B8OA 1DQSA 1E60A 4U1IB 2J12B 1O9ZA 1JJBA 4GVXA 1CF8H 3V4UL 5MERB 2AZUA 3WGNA 5KOJA 1VECA 2HLDA 4OGWA 4QGBA 2PZBA 3RI5F 2SCUB 3SGJC 3ZCUA 3CFNA 1W9MA 3WDKA 3ZUCA 1CUUA 3CPLB 3HE7B 5B1EA 3BVPA 3QP3A 2V5TA 1IZ7A 5BN5A 5T3XL 5ISZA 1PG2A 3QPXH 3DUWA 4IJ6A 4W5NA 4HPYL 1G7TA 3DAFA 2Q5FA 2NIPA 2GIMA 2JZNA 4RCZA 5JR1H 4PRDA 4AP5A 3QFJB 4HKJA 1KTJA 3TZ6A 1I1FB 4LLMB 3FT1A 4PX9A 4ABTA 3IGAB 3W37A 1NVMB 2QU7A 3QLJA 3QU9A 4IMKA 4YSCA 3FR7A 1KCKA 1UBGA 3T4XA 5ECYA 1HIMH 1NULA 3IKMB 3UG3A 4RAOA 4G59C 4LCWB 3ZWDA 2B39A 2O61B 1TLTA 1KTIA 3FR8A 1JFSA 1F6AA 1UT2A 1QWUA 2E9GA 2V7XA 3C7AA 2VZSA 1XN1A 5EORH 4ZVSA 4A2MA 1LNZA 3RK4A 3PUWA 1EFVA 2B94A 4WEOA 2MPVA 3IBCA 2JA1A 4DR2B 1VESA 2ZE7A 3MA0A 4UEOA 3P0EA 4L3EE 5AKJA 1PZAA 1ISGA 3H3JA 2ZT5A 2IWKA 3RS7A 3PE4A 3HK2A 3VAZA 4TUUA 4W9JC 1JPGA 3VDNB 2FSDA 4X4ME 1J88A 2G4GA 1V3UA 1AGXA 1MJHA 2Y0SA 4OI0A 2FX7H 3CZLA 2X19A 5IBCA 4FFMA 3DOCA 3W81A 3ZXUB 4X80H 3W2TA 4XPGH 4AUMA 4TOIA 3W9EB 2EBUA 1RVFH 3WYDA 3H1FA 2OAEA 1Q7BA 3FF4A 4QKQA 3AT0A 1JI1A 5LUAA 3QUXA 1T9GS 1Z7GA 2QRQA 1QVRA 5TF0A 1KPVA 1X80A 1IXYA 1HHGB 3SE8H 4OSUL 3DCNA 4BGVA 2LR4A 3G5YB 3QUSA 2ZIAA 4JRYD 4RA9B 1VZ2A 2Q5CA 1IC7L 1VPLA 1NC3A 1NNI1 3KWTA 5FOUA 4OOEA 3S6JA 2Q4TA 2JLAA 2AZAA 1A02N 1AGFA 5D7JC 5KW9L 3T2OA 1Q1AA 3KMDA 1Z0SA 4F60A 2E5LB 1Z88A 1DFIA 1EZUA 1SUWA 3VI4E 5JTTA 1QK5A 4AJEA 2X7LA 4JO8A 2NTEA 4R54A 2BGGA 1IEHA 3OX2A 5BV7B 3P4MB 1HDIA 4DP0X 1SUJA 1DKRA 5KVGE 2UYCA 2IBTA 1KYTA 3BQUD 1V1MA 2C0PA 4WEQA 2QPFA 5DZNA 1YE5A 1Z2DA 3F7MA 4HUXB 4NRDA 3VSBA 5ELIA 3C3PA 1CVRA 1D5XB 4FXPA 4ME6A 2WLIA 4OB6A 1R16A 3D39D 1X1BA 1ZXBA 1EQ2A 3GFTA 4MNGB 3MUGB 5LZ4A 4IDJL 5HS4A 3UPTA 5FB8B 3CMOH 4JYAB 1XHHA 2NM0A 1XTMA 3I1IA 2UKDA 1Q0RA 4ZAKC 4KDCA 2GD0A 3TT1H 1KI3A 2AP2A 3H9UA 4GXVH 4K40A 3IAUA 3L7FB 4MHTA 5DX0A 3PG5A 1OM9A 1XYYA 2ZSHA 3ICCA 3BAFA 4TMVA 3UIEA 1I3VA 1ADCA 5I15H 4PHXA 5GGYA 2P1YA 3GJ7A 1W4RA 2Y1KA 4LW8A 2Q3HA 1T1WB 4JO1L 1UA7A 3N44B 3H18A 4OIAA 3N9GL 1D0VA 4MO9A 5FL7D 3JYCA 3H1EA 5DRNB 4YBRA 2Q3BA 5T1LD 5K9KA 3AACA 5D1NA 3I6MA 4JVOA 3GC6A 4ZOLA 3R1GL 2GT9B 3DIDA 2FRDA 3D4YA 4C54A 2F3TA 1I4DD 1K6MA 4MWSA 3ENZA 1VG0B 5KUMA 4UANA 3T9FA 1AIFB 4QXUL 1XA3A 1EAYA 3FOWA 3MJ9L 1PLJA 3MCLH 4XB8A 4GOJA 2OXIA 3GEDA 4BO1A 3H4VA 2CT8A 1NCWH 1O95A 4HJEA 2O3SA 4JKLA 4M98A 3JVVA 2E6QA 3OOHA 2YZ7A 1Z5PA 1VACB 5EZPA 1ZG3A 4S35A 2UZ1B 4N0DA 5IW6A 4RVSA 4BN4A 5D1XB 4KTGA 1PJ8A 3ROFA 1M0EA 1KB5L 3I3SR 5IVXA 4NKDA 4RSHA 2WKQA 2ZOTA 5T1KB 1ABEA 3GLHE 1T4GA 1HT3A 3B8HA 4PWZA 5JNWA 2MU1A 5JG7A 5IXYA 2BJMH 2AKYA 3SEFA 1OE0A 2AIRA 2V9UA 1ZS9A 3DO7A 1JGUH 4JQZA 4QYWA 2DWSA 3CZEA 3A28A 3UC5A 4FGSA 1ZNYA 3BL6A 4YLBA 1K7XB 4RANA 4FYXA 3G9XA 5E1BA 2PQ0A 2YFKA 4UINH 2JIQA 2BT4A 5J5CA 4HQQH 1MRFH 4OJCA 3DEHA 5AYVA 1XH0A 4MUAA 1E9PA 1BQEA 4TT3D 4LSTL 3DYIA 1EWHA 5EHNA 4GLRH 4Z5XA 2HLNA 3FX2A 4JM4L 3H8WA 3X3FH 1AZLA 2YV3A 4MWGA 2P8PB 2ENYA 1H6BA 2JI8A 3GUHA 2O5YH 4KWIA 3OUZA 1AMXA 4BKMA 3L7EB 2DFDA 2RAUA 3DYVA 4YXKL 3IQFA 3IC5A 1LJUA 1BRMA 5IG7B 3DUSA 1C5BL 2A9FA 1Y3FE 1ZN7A 4KOBA 3TUJC 4DV0B 4MCYB 2A4KA 5LBTA 1CICA 1J0EA 3OOWA 2L7UA 2DQKA 3Q2VA 3DW3X 1LO5A 1KMHB 1DSWA 3T8MA 2GABA 3WHKA 3DJRA 2FTKE 4PGDB 1DUSA 3SKUD 4QGYA 3G04A 4XP9L 1F4VA 4XGZB 5KWJA 1IM9A 2J2ZA 1GSOA 2EDKA 1YEWA 2C77A 1A6ZB 1I8LA 3IXLA 2C82A 1FUNA 3WGIA 4KJPD 2PSSA 4PLCA 4HS4A 3RS5A 2G1UA 3DVRX 5EHGA 3UTQB 5DGCA 2PMFA 1WOMA 5BQ7B 1XZBA 1CU4L 3NASA 1FB5A 4Q6YA 3GUTB 2XQFA 4Q4DA 2W4QA 2ZETA 3HR4A 1NCCL 4ZU3A 1BWWA 5AW5B 4YBHA 1N2BA 2FDBP 4UU8A 4UFPA 5JAHA 3ARGD 1FIGH 3L0SA 4OG2A 2E82A 4R5HA 1AGDA 1PZ5A 1UWGL 2XPYA 4OQLA 4NBKA 3WBFA 1NU8A 4NKOA 2X4PA 5DZJA 3A9UA 4PSDA 5CSZA 3FSGD 1L1EA 1V9CA 3ZDCA 5KNCD 2CNDA 1HO3A 4F06A 2ZXFA 2OBBA 1E2FA 4PJ7B 5J1AA 5LDUA 1OQOA 3RROA 5DGIA 5JADA 4AY3A 3WQRA 3C6ZA 3H0EA 3T1VA 4FWTA 5KYXB 3L6EA 2ZPTX 2OMYB 4OBXA 3RSGA 3WTSA 4JFED 2GK2A 4X5WB 5DQJA 2QRHA 1U1FA 3DX6A 1H23A 4Z1MA 4FKHA 5KSVB 2OBYA 4GYYA 1EQUA 2XQVA 3WYCA 2IBMA 2VHVA 3DTTA 1MC1A 4F5CE 3NHBA 5F3HA 1J5PA 1IBGH 1U8PB 2HA3A 4XC3H 2W58A 2EDTA 2YD6A 2WSLA 4ZREA 4YP6A 2WXNA 3IKKA 1KDTA 4L1KA 3BOSA 4EATA 1F0NA 1NXOA 4P2QB 1ZGBA 1ZLUK 1UM4L 3DB2A 5EVCA 3HCCA 1COZA 3TBHA 2CUZA 1Q11A 2C9QA 4IIJA 3ILQD 3IH5A 1GZPB 4NVRA 4AL8H 3KPRE 2J3LA 5D6NA 2AF4C 3D5TA 4WA8A 1XAIA 5IAAA 4XZUB 3LH2H 4L3EA 2FBJH 1OANA 3KYAA 5CT5A 1FXSA 3D69B 4BQ6A 1USKA 1N6OA 2PAFA 1OJLA 1KF9B 4WQMA 3UAEA 2FX5A 4X4MA 4F2HA 2CZCA 3TGWA 2DN7A 4AUYA 4JC8A 1CS4C 4JB9L 4C87A 3R24A 3BXPA 1LK7A 3X2QB 1S9HA 1U8LB 1V25A 3W9DB 4OLFA 1Z3IX 4CN4A 3HUTA 1IZ8A 4YVFA 3UYRH 3DMMB 5EQDA 4TYPA 1UL1X 4OCXL 1E2HA 1FVDA 5HGHA 4A1RA 4LY9A 1CJBA 1Z6PA 4IIQA 1R3JA 2I5PO 3BQUC 4ZV7A 3CD4A 1TYEB 1CUFA 4NRYA 5JJIA 5GSVA 2AQ2A 1DVRA 4LJ6A 2ZKHH 1I9IL 5GHWL 3FLEA 3NJKA 1DS6A 2C7BA 8GPBA 5ALQA 4YDQA 1JEQA 3R9XA 1T0MA 1LXCA 2DEXX 2JVIA 4U3HA 4OA8A 2ZCLL 3VI4A 2XQYA 1HOXA 5CB4A 2YQBA 3CBQA 2PRSA 4H13C 1J0JA 1UKTA 4JPKL 3E5HA 4UEWA 5FLYA 2R2HB 1KGSA 2WU1A 4IMJB 5HWSA 4F8TA 3ITNA 5D7LE 4PGHA 2C2WA 3SZMA 1N0VC 3BRDA 1TJMA 5I47A 3WO1A 1ACYL 3N70A 3FXIC 3OCYA 3QEKA 4XH9B 4D3CL 2RONA 4YWHA 2Q50A 1NSNH 2BHRA 3R7RA 1H5NA 3AK4A 4FZ5A 5I1KH 2PRJA 2W2OA 4QBIA 2WTBA 1JNNL 4XO4A 1NKVA 4X5RA 2RALA 1U4SA 3WNZA 4M37A 3CLVA 1KIPB 5L6LB 1NMZA 3PWSA 2WTRB 5ALUA 1OLUB 5A04A 3T1QA 2HO4A 4C5CA 3MUUA 4AGQA 3ZV4A 3TO2B 2NU8B 2F55A 3VXPB 3ECVA 1A7NH 4GRAA 4BUGA 2J7KA 3FBKA 5AKTA 2EVGA 2VDMH 3G5AA 5MGNA 3BP4B 2XA9A 5I8PA 2HCRA 5ALKA 1NINA 5E4OA 4YAKA 4DK5A 3SY6A 4O2CA 1WR8A 3DZJA 1JMXA 2FGJA 3SC6A 2FJGB 5E23A 3QXAB 1FG2B 2V65A 2C9SA 1Z36A 1G5HA 1DZIA 1YHZA 1P2VA 1SQGA 3C5XA 4RCYA 4DA0A 2DFNA 2MYPA 1KC5H 1M7XA 2AI3A 3MA7B 4GEKA 3VZBA 4RADA 3SG0A 3OE5A 1X5HA 3AG4B 1UOPA 3O8DA 2FW9A 3JVIA 3KVNA 4OL9A 1T8PA 3IFPB 4H59A 4EA8A 2JBWA 2PLNA 3QK0A 1M6VB 4D9LH 1H15B 2YYSA 1AZZC 3TZVB 3N85H 3IM1A 5F4BA 4Q37A 4JRXE 1NEZA 3Q5TA 4ZFGH 1RVV1 2ZWIA 3QG5A 3AY4C 3TW8B 1EK3A 4RAHA 4Y2DA 2Z1PA 4CMKA 3SQOL 4NN7B 5A5GA 5FYLH 4QIHA 4PJIF 1AVAA 3QFDA 1A1NA 2RGBA 1N2RA 2IYEA 3GLHA 2WINB 1WMEA 1MOQA 4EN3A 3SC3A 4JITA 1QR2A 2CXXA 3WXWH 4J3TA 4K8RH 1A5FH 2YS4A 1N9KA 3C5JB 1JDPA 4LTNA 4KQEA 4YJZL 2IZ0A 2CSPA 1KH2A 2VQ3A 2RHOA 3O82A 3U5TA 2YZMA 2WVTA 2WM0A 1RJYB 2EFHB 4HDAA 4FD3A 2HGSA 2V7VA 2ZAGA 4LVEA 2Y92A 5IHZB 2R6GA 1ZMBA 3VD9A 1MXGA 1XLWA 2GZMA 1T0JB 2XA8H 1SCBA 4PJGE 3JD0A 1KSJA 4UREA 1NBVL 4EB0A 3JYLA 2NXZD 3WB9A 4MYCA 4FHZA 1NBHA 1QHYA 3NHZA 1IXKA 3ZH2A 1U4FA 1MC5A 3KPQA 2VXQL 3HADA 1QZTA 1TPXB 4RJKA 4CKEB 4RDXA 3SEQA 5EIFA 4RZ2A 1X7YB 5C4MA 4P04A 2QTLA 2ZI3A 3B5TA 2IOQA 3K96A 4EUNA 1L9RA 4UQIM 3ETTA 3OEEA 3VPHA 3FOBA 4KJPC 1ZPLA 3S8MA 5CBAA 4OF3A 4LRNH 3AFIA 5T4FA 3OTQA 3MINB 3O2DA 5TARA 5IAEA 4XNUH 3FOZA 3ARZA 4DZBB 1FXWF 4K2UH 2Q1SA 4CADB 3RUAA 4I1OA 2EIBA 3MV8D 1E8DA 2M6SA 1X8JA 4PVCA 5JHGB 2ZQYA 2ZXCA 1IM3A 4JC5A 3ARGC 5CHEA 5COBA 2LRHA 4X7DC 4JH0A 5GRVL 2G9KA 2O0LA 4M0MA 4TZ0A 2VS1A 3FT4B 2WSYB 4WU5A 1ZRUA 4QVIA 3ZDWA 4HFWA 2QVLA 4EB3A 5DGTA 4RZUA 3PLAE 1U6AH 1FBIL 2AJXH 4GOXA 4AJYV 2YKLH 3OECA 1KPUB 2W42A 2CBTA 2HHAA 1ZJBA 3MTBA 4JVLA 3JQ8A 1AGCB 1XD1A 1YYML 4M5ZL 3PGCA 5JYMA 1CNFA 3BAIA 2WAQA 5F9JB 3GVCA 4HGNA 5T8KC 2F68X 1SOSA 1E7VA 5BSUA 4MK4A 5G40A 5DQ9A 4XN7A 1I0ZA 2IQ9L 4G09A 2GPAA 1QSVA 3JYBA 3CZPA 3K9FC 1G94A 4G8EA 4UU9B 5T4EA 4NO3A 4YSPA 5ID1B 1MX1A 1JQEA 4LMQE 2DL9A 2Q9AA 2FJUB 1G63A 1XZHA 2OL3L 1HE2A 2DIEA 5CP3A 1MNAA 3G7UA 5AJWA 4V1CA 1LDPH 1B4LA 3HZOA 1DLHA 4PRIB 1PTKA 3CX4A 5L3SB 1L8XA 1GRVA 3OB0K 3AWEA 1C9EA 4PHTA 1W44A 3ILQC 2A6PA 4NNYB 1S4IA 5ES3A 1EXVA 4UNUA 4F5CA 2X9LA 3WMRA 3HDGA 3KKLA 1SDDA 3RFZB 3BC1A 1AQ8A 1BS2A 1CUAA 1CRZA 4CG2A 5HI4D 4LBVA 3X1KA 4CQLB 1KJWA 4AL4A 4PUBH 1CL7H 1PHRA 4MWBA 1RC1A 2EZ8A 3OAUH 5E0QA 1QVOB 3RAJH 3GMSA 4DV4B 1NCHA 1FORH 4Y4FB 1KI2A 3H5AA 1WYJA 4PF1A 3IMSA 3H5TA 4TKMA 5JSZB 3KPRA 1W49A 1BG1A 3HS9A 5TF4A 3GSUA 5AI5A 3CQFA 4A6PA 2J5XA 2KLBA 5C0OE 1O87A 5I82A 5GRXG 1JYVA 1KXVC 2C4HA 4DGSA 4O4IF 4NKIL 3QKRB 1RZGB 1GZQA 3FNRA 1YEHH 3PTAA 5J9PB 3MRBA 4IDBA 4DOMA 3IRVA 2CFOA 2C1XA 4CXMA 1GHTA 1SHWA 3GIWA 1XCMA 3DFZA 3BQMB 3DE7X 3CURA 1V8PA 3NGBB 1G8PA 4YUXA 3NDZE 1VHTA 1QHXA 3RWCB 5JLZA 4NYLA 4XPHH 4EF6A 1X7WA 3C7DB 2VCEA 2FN7A 5GQBA 3A9SA 2VZ8A 3DF7A 3R6WA 3H1PA 4YRMA 3AEZA 2V7NB 1XKTA 12E8H 4BH7A 1CJUC 1YB6A 3GBLA 3LKNB 1ZITA 3C6BA 2HTFA 3KZNA 3BP5B 4PJEF 1CTOA 1LDBA 4OQEA 5JS7A 4FFSA 1QZZA 1SHSA 1JNJA 1N5MA 1BVLB 3EW7A 2QLFA 5MF6A 4GKAA 5ECGA 1P75A 3ICQB 4ZAWA 2HH0H 2DTEA 1U8OB 3MODL 3MNWA 2A74C 4EYOA 2UUDK 3DUHA 5D7LA 1KN2H 1YEGH 1I9CA 2BEUB 5JHLL 5E4AA 1E0OB 3OSUA 1WJGA 4LDQA 4UB0L 3HN3A 4LNRB 3ID6C 5JIMA 3WGUA 4AZ8A 4QTTB 2NUTA 4E3ZA 5C52B 4Q16A 4AF7A 2PW2B 5AKHA 4QG3A 2JXMA 1R3IL 3AF4A 1MCWM 5B4TA 2Z93A 4UAGA 3FRUA 3NIBA 4H2DA 4W1SA 1I7DA 3ZDXB 1UEMA 3LHFA 4PRPD 3TPUB 4MVJH 2PKYX 5F7MC 1ZCAA 3E03A 4UJ3A 3RU9A 5EEYA 1JHQA 5LPNA 5FHAL 3CRMA 1PFCA 5IZ4A 2TYSB 3Q5EA 3HBPA 3C5HA 4BLPA 1DBKH 5COQA 1UXJA 3FB8A 5AVUB 2F5AL 1U7WA 3H4MA 3S36X 3AF3A 3JTMA 3ZHXA 4BZ1H 6TAAA 3RL1A 5I30H 2J5KA 4LSPL 4A23A 4RGBA 3AF0A 1XEWX 5LXTF 1UPAA 1YECH 3LEXA 3HPRA 3D3JA 1YGPA 5ABAA 1GR7A 3STLA 4M1YA 2XUWA 4PJHE 4YT4A 1NMAL 1E1YA 4QWMA 4YCLA 2VE6A 4PWHA 2AJZB 1V8DA 3P45A 2JH8A 2H1LA 3KBOA 3KWWA 2CF5A 3MLXH 2JFXA 3T8VA 2QXTA 1XK6A 3MSPA 1WZLA 4K7PL 1ISPA 1TJGL 1K9SA 1QG4A 3U13A 5CEFA 4AK2A 4BZ1A 4PJXE 3HI6L 1OLOA 4MI3A 3CFUA 2WIIB 5JY6A 4JRXA 4RQQA 3PFBA 3OZKA 5JVDA 4HDRA 1NAML 4FQ2L 5JW3L 5J12C 2EYSA 3MWDA 4XGNA 3AHEA 1B3BA 1U5AA 1YUKA 3JVFC 5JPMB 1S7XA 1F02I 3N75A 4R01A 3RWBA 2XT0A 2WP3O 3B3IB 4A1FA 2QIPA 1MQSA 5FNVA 1KGCD 1DRVA 3O8RA 3HRZA 1PFVA 3TAXA 2DLTA 4UMDA 2G9ZA 1BQHG 4NMXB 3CRVA 3OZBA 3HFGA 1V4BA 1CXHA 3QVGB 4BNMA 1NCTA 2Z2IA 3NBQA 4CC4C 4WSKA 3LX9A 5HUHA 4EGSA 4Y1AE 2RHTA 5EZIL 3ZOAA 5EWLB 2HWYA 1XEAA 4E5XA 1OKKA 3KVVA 4PJGA 4FFZL 1LE5A 3DBHA 2QGEA 2D9QB 5CIWA 4JGBA 2YEZB 5HDQH 1VCIA 4NRXA 4TXVB 5JO5A 3VJKA 1XKQA 1B43A 4N6QA 1CKEA 4Y5YB 3MGOA 4AXBA 4EY3A 4POYA 3ESDA 4CMHB 3SX4A 4KKQA 4LJKA 4BO3A 2C59A 5JIBA 4BEWA 1NBWB 1SN5A 4ZEMA 2AXNA 2XD9A 2GEQA 4PSRA 3UW1A 2WYOA 3B9KD 3EBPA 2XOTA 2Z31D 2QD3A 3ZNOA 1DQML 2AF2A 1R5VB 4MWEA 3EFDL 3BFXA 4NEHB 4BO9A 1R6VA 1DN2A 3ZZMA 1W0WA 2XSZD 5BSRA 3WJJC 3WDIA 3Q0IA 5HI5D 4GI1A 1XU7A 3QYFA 4OCYL 1BGWA 4A0HA 1G6RB 4MR7A 4AZ0A 5K03A 3TBVB 1ZGGA 1M6WA 1MLCA 1WAAF 1FZQA 4J16C 3OQIB 3L77A 2I60L 4WFGE 1K2DA 3QEMB 4UQBA 5L3QA 1PZHA 3GU3A 4A04A 4RYDA 2ISQA 4B9ZA 2VDPH 1GZVA 4PTZA 2M1KA 4NWIA 1UZAA 3E80A 3H3PH 3RZCB 3J27A 1VCAA 2EVIA 4YMUA 3G5ZA 4UT6H 2M1XA 3QEUA 5ICSA 4W70A 1UENA 4LY3A 4GAYB 3QKSB 4OJEH 4EDWH 3RWJB 3Q9QA 5HI4C 4AKPA 1U95A 3CVHH 3OKMB 2IH2A 1GYRA 2I2CA 2YARA 2WTAA 2FZ4A 2CD7A 3IAFA 4MCMA 4ZBJA 3W5HA 1Y7VA 1ZM4A 3WDLA 3WMWA 2X9NA 1IXSB 1G19A 2ZJBA 3FHCB 2JDIA 1YSOA 1PT5A 2W2VA 4FYKA 5EZJB 1P0QA 4Q58C 1U8HA 3A9VA 3DX4A 1EE2A 2YRLA 3FB5A 3RVTD 1XO1A 4CKCA 3KVPA 3ABQB 3QY9A 3SHVA 3F7RA 4NUPA 3GZNB 4AYID 3T71A 4GX0A 4GE3A 1CTNA 4FJYA 3O9VA 5F2OA 1WISA 5L3RA 4UT6A 3RWEB 2NY7H 4BNUA 3SK0A 5EFZA 5BRZB 4MGXA 2MPAH 4BFOA 2WVVA 1HILB 3KL2A 4KIGA 4FBMA 1ZBDA 3KT8A 1RXCA 5HHMB 3BX1A 5I73C 2ODTX 4KFUA 2WP3T 3PC4A 2UVPA 4EHKA 5AWNH 1D6EB 3BF7A 2E0PA 1LC0A 3UPUA 3UBGA 2Y4OA 5KSUA 4ARUA 4GPTA 4JDVB 2H3HA 3HC4H 1U8QB 3VMPA 3E48A 3FKSA 5BS0E 3UN1A 2CNWD 4RZIA 1L9KA 4EBQH 5C9ZA 3OWHA 2H5LA 2GOYA 1G8YA 1TAHA 3VXSD 2AJYL 1GILA 3FQRB 4NOBA 2VQFB 4KQ2A 3RGWS 1XCWA 2QLVB 5C86A 4EVSA 1ZEJA 3HXTA 4D8VA 1CU1A 4Q6WA 1GTMA 2ODHA 1D5BB 5IW1B 3HO6A 3NWEA 3W8EA 3FVVA 5DJ5A 4FCCA 4PVDA 4TPKA 2K8QA 1IEXA 4RGNB 3UAFA 2EEAA 4J6RL 5C0IA 1UXOA 4UATA 1FYTD 2ZGVA 1M2OA 2RIKA 4JC4A 5JZMA 1SHKA 4FFYL 2Z2XA 1KBGH 1OGPA 3O2NA 4OZFH 2IGTA 3NC0C 2QRPA 3X3GH 1E8WA 1T5IA 4DQVA 4P5DA 1JI0A 1YQEA 4JLRA 1LL1A 4J3WA 2CAKA 2C3HA 3HA0A 2D1RA 3T5CA 4ZZIA 4U9UA 1HHHB 1FE8L 1RKUA 4RGOH 4ELDA 2B9VA 3F6EX 3S44A 2ZJAA 2MCPH 3F67A 4FQJH 4QOEA 4Z0HO 5F9WB 1QAOA 4I4TA 3G68A 3P2EA 2H1OA 3OV6A 1DIBA 2ATPA 1M05A 2OV2A 1F17A 4MCHA 5C0CE 3GUZA 3RTQB 2H18A 2W71A 1IDOA 4RQAA 3EZXA 3D31A 1XEUA 2OQRA 1WGOA 5KX5B 2V6FA 3M9WA 3VH1A 2CLRA 3DXAE 4RY8A 1WTAA 2IXGA 9ABPA 3OX8A 3S4SB 4JY6B 3LP5A 1VYUA 5EO9A 3W1VA 1OKEA 4AE1A 3FTXA 3LY9A 5DD0H 3SKMB 3U7QB 5A3RA 3G08A 1WG8A 3DBRA 2X6CA 4YEEA 3FOLA 3ETBJ 3F6CA 5BPFA 2I85A 1Q38A 1CYGA 2KT6A 4O63O 1A9YA 3FFAA 3Q3CA 2VN8A 3JWPA 4PJHA 4RK5A 2HY7A 4Y1EA 3W82A 1WLYA 2FRGP 3NBKA 1P9MC 4I4WB 2QJDA 3N6RA 4LLUA 4Z6KA 1FCJA 4MUKA 3GDBA 3TBSA 1KIAA 3U62A 3ECQA 4QWWD 5MDHA 4BB9A 3Q10A 4C0QC 5ALRA 5HYQA 2JSFA 3CLRD 3QVKA 4Z18A 4RHYA 4PJXA 3FCBA 1ND6A 4LZWA 2EH8H 5C2JB 1N3IA 1PR2A 2B82A 5KTMA 5GS0H 1M53A 5JAOA 1BZEA 2B8WA 5EHQA 1M7IB 3PS6A 4G0XA 2DJSA 4MWFA 3B2VH 4DJAA 4IJUA 4L9LA 2BUCA 2HTLD 3W2EA 3NIDE 1A27A 3AHFA 1PT7A 1HHIA 4AGMA 3PSHA 1K8IA 3C3BA 5AW2B 3BZWA 1RZIA 1W52X 5A0VA 3K1AB 4P3WA 4HWEH 2I07B 1E3QA 2CVZA 1Y1DA 1B6DA 5IXJA 3Q2CA 1XYVA 1A9TA 2UZIL 4Y1AA 1P6AB 5IVKA 4UFOA 4HBZA 3X44A 5SZHB 3O4IA 2ZZKA 2UXBB 3GZKA 3K2UH 4RIFA 2R7NA 4N28A 3IQWA 1LPAB 4MVJP 1I1OA 4JM0A 3D8TA 3C8HA 3B9KC 5FWNA 4X24A 1VA9A 4FU0A 3LPCA 2Z31C 4ATWA 3LN4B 2JKXA 1FNAA 4M62H 2BS9A 3UF0A 1USQA 4K3UA 4UTBA 4H5SA 2QROA 4GAAA 5LLDA 5HI5C 3OKDB 4HS6B 1MIEH 1TNNA 3FTWA 3P73A 1F8GA 4EJSA 2ZBRA 3N2GB 1OX4B 3RZWA 3FNFA 2FEMA 3QGMA 5GONB 4OD2B 1Y4SA 5EJ6A 3TEWA 5D7KD 5D7JB 4ZXBA 5DEGB 3DFMA 4GQIA 1ZIXA 2WLHA 3AP3A 4LCUB 4N85A 1Q94A 2O1AA 1OH5A 4U1IA 4G43A 2BMJA 3FPSA 4DF9A 5B1AB 5C6TH 3TIFA 5MERA 1H1DA 5IW3A 3U1SL 3QJSB 1GYQA 3FQNB 2GHWB 2Q41A 4HB4A 4G8IA 2C94A 4ERSH 3U7FB 4MS4A 1A66A 3HM2A 2RB8A 1ZKDA 4A26A 3RKSA 3EDFA 3CPLA 3L7OA 1M8JA 2YIMA 1ONQB 1ODAA 2IUTA 4JU9A 5HYSG 2D7TL 3C6SA 5JS1A 4PAZA 4W5OA 1G5FA 5PCYA 2OKMA 1DQDL 3PQ4A 3Q7TA 1XV5A 2I6XA 3E8SA 4LVUA 1OAYH 3UEOA 2WAXA 3KX2A 4ED9A 2GO1A 1Z63A 1S02A 3KBHE 1A1MB 3MC1A 2YAMA 3IGAA 3RVTC 5IKMA 1QFUH 2IIJA 2ODAA 2VOEA 3KPWA 3COVA 4DE5A 3ZE0B 4D0BA 3PQCA 3EQ7A 4Z9KB 1DC4A 5I0YA 2QQEA 2G9HA 4XNXL 1RABA 1IM8A 4R0NA 1ZT7A 1QR6A 5HRAA 2PWGA 2BRQA 2M26A 2VPWA 1CXIA 1VJ1A 4WN9B 5IK2A 4NCC1 4LASL 1RFDH