3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Cell adhesion/blood clotting
source organism Homo sapiens
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
1JV2B 4JX0A 4FWWA 3AL9A 3F78A 4C29A 1PD0A 3ZE1B 2VC2B 3BQMB 3EGDA 2XWBF 4MMYA 1AO3A 3EGXA 4O3TB 1ZOOA 3K6SA 2P28A 2VDKB 4HQFA 4IGIA 1M1XB 4WFQA 4XW2A 1XDDA 1XUOA 1Q0PA 1QC5B 1MF7A 1YVPA 1SHYB 3TXAA 4JDUA 1PT6A 3IJEB 4NENA 5E6RB 3K72B 2P26A 1BHO1 1NA5A 5KYUB 4F1KA 4G1EB 3PPXA 2NUTA 3K71A 1PCXA 1SHUX 1RRKA 1QCYA 2VDNB 2NVOA 1MQAA 3NVQA 4MMZB 2ODQA 2QTVA 1SQ0A 2NUTB 1JEYB 3NIGB 1JEQB 1JV2A 1MQ9A 1N3YA 1ZOPA 3BQNB 5E6RA 2B2XA 4C2AA 4WJKB 5KYWA 1RS0A 3K6SB 2VDMB 3Q3GE 4MMXA 4WK2B 1T0PA 3AL8B 3EFOB 3N2NA 4CNBA 4O02B 1FE8A 3E2MA 1M2OA 3OKYB 1ZONA 4CN8A 3GXBA 4FX5A 4G1MA 2VDPB 5HDBB 1MHPA 1LFAA 1M2VB 3T3PB 1AOXA 4O02A 2ICAA 4PN7A 5KYNA 1M1XA 1CK4A 2I6SA 5ES4B 1QC5A 1UEXC 3PPVA 3NIDB 5HGJA 1M10A 4Z7OB 5LN1A 1OAKA 3V4VB 4DMUB 3K71B 1MQ8B 1RTKA 3VI3B 2XWJI 4IXDA 5KYYA 2UZYB 2M32A 3EOBI 1M2VA 3EG9A 3TW0A 3K72A 1AUQA 2O7NA 5KYUA 2WW8A 3QA3E 2I6QA 1L5GB 2ODPA 4MMXB 5KYXB 2WINI 1FNSA 3OL2B 4MMYB 3BN3A 3EFOA 3EGXB 3EH2A 1M1UA 4HQOA 4F1JA 1L5GA 3HI6A 3IBSA 3M6FA 3EH1A 4Z7QB 4HQKA 1BHQ1 3F74A 3PPYA 1N9ZA 5BV8A 4WK4B 3T3MB 1YVRA 3AL8A 1JEQA 3EOAI 3AFCA 4A0QA 1DGQA 1RD4A 1U8CB 1SHTX 2VDRB 1JLMA 3OL2A 1U0NA 4IHKA 4CN9A 5E6UB 4GZ8A 1U8CA 1T6BY 3HXOA 2VDQB 3EG9B 2NUPB 5E6SA 5HJ2A 3PPWA 5E6UA 2XGGA 2I91A 1PD1A 2VDOB 3FCUB 4G1MB 3ZE2B 3TVYA 2X5NA 3TCXB 4MMZA 1TYEB 3FCSB 4Z7NB 4NEHB 4HQLA 1YUKA 3EGDB 3ZDXB 3ZQKA 4G1EA 3VI4B 1IDN1 1MJNA 3ZDZB 1IDOA 1U0OC 2IUEA 5KYWB 2ADFA 1IJBA 5E6SB 1DZIA 2NUPA 3IJEA 4NENB 2VDLB 1JEYA 5KYYB 4UM9B 4O3UB 1XDGA 3ZDYB 1OLZA 3OKWA 1CQPA 3FCSA 3NIFB 4WK0B 4K3JB 4UM9D 3ZE0B 1ATZA 4M76B 4BJ3A 1V7PC 5KYXA 3HXQA 4UM8B 3RAGA 4C2BA 1SSLA 4HQNA 3V4PB 1IJKA
chains in the Genus database with same CATH superfamily
3VTFA 1X8XA 4HYQA 4LPYA 2X1OA 5CEEA 2W2LD 2WHYA 4BMVA 1YVPA 4Q00A 3KLLA 2JF1A 5TQ0L 1GHTA 3E8UH 4QASA 2N9UA 1EX7A 4ESVA 3ECVA 4TOYL 3HR6A 3EVBA 1KV7A 4D9LL 2HCRA 3GLSA 2BM9A 2X0JA 4FQXB 2ZRNA 3UG5A 4RMJA 1MRFH 3UGTA 1OKEA 3EPKA 2BLFA 4P0DA 4AZWA 2FGWL 5JZMA 4YDKL 5ADVA 3VRLE 4DTCA 1AY0A 1HT1E 4EKGA 4ZHQA 2FCBA 5FBKA 4C7JA 2D13A 3VC7A 3W79A 3UC0L 2OV0A 3KIPA 4KJWC 2WINI 4GMGA 3EH2A 2CRYA 1KI6B 5DMXA 5MI0B 4JY4A 2G4VA 2QM8A 2OD7A 2WVVA 1I51A 5LGYA 2ID7A 2XACC 4GUCA 4U0QB 3CCCA 4Q3DA 1QRRA 4KKRA 3Q0EA 1OAUH 1HFWA 3PPWA 4TROA 2RGNC 3VX0A 4HWNA 3FVRA 1M34B 2HH0L 1QDEA 4ENQA 1PNTA 4OZ4B 5MEOA 2YN0A 4BPBA 2R68A 3GRAA 3KEOA 1P6AB 3RF6A 3ZDYB 4YL9A 2H1SA 2AQSA 2HG5A 4P4KA 3QVMA 4ELKA 3C60A 1ZANH 4X8GA 3AV3A 3RVMA 3SNHA 1F4WL 3GF4A 4YXKL 4P4NA 2C4TA 1ZGLM 5B6IA 2HQSA 5IRCD 4C56E 2RGWA 3D34A 3QBTB 1HINH 5IYZF 1NSYA 2Z8WC 1KIPB 4MXVE 1JFFA 4AN0A 4MA1B 4IXWA 3NM4A 4BEBA 2XUGA 2W90A 4UU1A 5HI3C 2TS1A 3EK2A 4JQZA 2H0EA 4N8SA 1WA1X 2FUCA 2G75B 5CURA 5JPNC 3WE1A 1L5YA 2VL4A 5I1LB 1F00I 3GLEA 1FE8H 4Y9CA 2NVUB 2WBJC 1UH5A 3D3WB 3U7YH 3HE7A 2YDYA 3JZDA 4IDHA 4B73A 3RP1A 1XROA 4CLEA 4KPUA 1SXGA 1JPTH 1S6NA 4KPUB 5GADl 4KO4S 2X9YA 4X91A 1T2QL 5ALBH 1OGTB 1CY0A 1LZKA 3SHSA 1CLYL 4K3EH 1N0XL 3W3ZB 5C1MB 1TZCA 4IRJA 2ARKA 3ORHA 3F2VA 3G5VA 2QEQA 3P40A 2X8BA 4QOKE 1Z75A 2A5YB 3SG0A 1CZUA 4GH5A 3X3GH 2FH8A 3K2BA 1K5PA 1KARA 1NLFA 3CUVA 4HXAL 4G8GD 2V45A 1AZUA 3O8XD 4NZ9A 1GPOH 1M6EX 4WNAB 1ILEA 4LSUL 2HA3A 1T4KB 2EWVA 1KF0A 3DHWC 2X42A 3VXOB 1HJCA 3U6XA 3L4ZA 3FLBA 5JH7B 3V4VA 1LLCA 1G8YA 4DCJA 4Z95L 1I8MA 5I6DA 2NY5C 4NPYA 3KQVA 2OMXA 3ARVA 2DULA 3C8KA 2SKCA 3HI5L 4EVQA 4F2HA 4ARIA 1KC3A 2PMBA 3PT9A 5AK3A 1V5WA 2ODBA 4PB9H 3QE5A 3ZY5A 3T7CA 5FB8B 2YWFA 5J1TB 3LZOA 2XKBA 2Z8YM 3NVQA 4J4PD 2ODQA 3MBXL 3ZKMC 2XQKA 1J9ZA 1O0SA 3N2KB 4TLBA 5E8NA 1TUGA 2LLNA 4NIMA 2HLPA 5ITBL 2R29H 3ILEA 1LDNA 4ZZFA 4F85A 4CL0A 1XEDA 2FWUA 2P9JA 3B2EA 4H8HA 4CEHA 2E6QA 5AUOB 1W2HA 2WMPB 2PYZA 2F3RA 3F5FA 5DHVA 3QXDA 2BVOA 3LZLA 1Q7TA 1LD3A 2ZYUX 2WWMC 5F1SA 1O6ZA 2QL7A 3KWLA 3LKDA 5K8IA 4E3WA 4DUPA 1CFVH 1YOVA 4B7ZA 3LLSA 2IF0A 1C0KA 1MJGA 2Y22A 2YS4A 2BSSB 5T1DL 3MNWA 3DBIA 5K0SA 4BFSA 1A8ZA 2CK3D 5I7VA 5DQ9A 2VNCA 2FEJA 1JEDA 4LIQH 4KYUA 2Y6UA 1M2KA 3ZWAA 4DRXB 2W4MA 1CEEA 4OV6B 1FSFA 2DPHA 2DVMA 5HE9A 1KDYA 3RIAK 4DP8X 1HNNA 1O8BA 3HWRA 3P4MB 2C5FA 4M8SA 4FM9A 2CHXA 1VI5A 2HW8A 2AV1A 2BCKB 2Q3XA 4POAA 3I62A 4GPD1 5EP2A 3QZNA 1Y6JA 3FZYA 5DH9A 3ZCTA 3B3JA 2PJUA 3AL9A 1XDWA 1UFKA 1E5AA 1Q17A 5E1MA 1A97A 4OGWA 2R2BB 1U91B 3SVLA 3AADB 4AJHA 5JPCA 3B36A 5CHEA 2VCOA 4A4DA 3ND5A 3ESRA 3T6WA 4GBED 3DLCA 1CL7H 1L7TL 4LFCB 2H7CA 3IOEA 1D2AA 3EG5A 3TO2B 2CSUA 4QKTA 1MHCB 4AV4A 1T5WB 2EINB 1CUUA 2X8WA 4JUSA 5D1QB 4ND5A 2IDUA 5I30H 2QFPA 1ZE3H 1T1EA 4K07A 5ABAA 1KXZA 5HGDB 5KZCB 2XYGA 3L0IB 4F9FA 5JDIA 3WXVL 5D2NE 3PL6D 3EYQD 4L2YA 2ZWYA 4A2EA 4QU0A 3I85A 4K8RB 3T8XB 2QAGA 2WMPA 4YHBA 1Z0DA 4HCFA 4HQQH 4M1GH 2RH8A 1KE1A 3FB8A 3FN0L 3R06B 3VW3H 3AL8A 3D3VD 3L2MA 1ZWLA 3R8QA 3KWWA 4N7JA 1P0QA 3H5NA 3MLXL 4NLLA 1OCRB 2GKSA 2NY0C 5DMIH 4MCZB 1U4FA 3QYAA 2C83A 4O0LA 1Z06A 2OO5C 1SXQA 5K59E 4N2LA 3BH9B 3JZIA 4NRYA 3A5VA 2GJZB 3ZBTA 4HQ0A 5TGBA 3T9AA 1EXMA 1A47A 5KSVA 2A83A 5F7BA 2AH5A 2JCBA 4YMGA 2RGDA 3MELA 4AQ8C 3BAKA 4P0QB 2R7KA 5CM9C 3OEED 3DMTA 5AVVB 5E1QA 4MA5A 4PJDA 2XEDA 1QE5A 3ZTNH 1Q15A 3CZJA 5A3JA 1OSYA 4WO0A 4MQXC 2OMVB 1H6DA 3DO3A 4JQIA 3BAYA 2F2HA 1RYHA 5ACMA 1AD0B 5GIPE 5ECDA 5KBLA 3CRRA 2QELA 5I1HH 1FU8A 1JZ7A 1E4WL 5CCXA 4ZSOB 3U1VA 5B8CC 3SHOA 1EK0A 5JYCA 1KIUB 3UANA 2CNYA 3I9PA 1HHGA 3MWFA 2JGAA 2WSSA 5DJ8A 1XA3A 4AKIA 1DIBA 1HDEA 2WVGA 5C1DA 1M2VA 4GXFA 4KZEL 1AF7A 1N59B 5BRQA 1P3JA 1GC1C 4J3OC 2AVNA 4PZ0A 3T99A 3DL2A 3FTYA 3M17A 4QC2A 1II8A 4AY0A 5I1LA 1BU8A 4AJWA 4B9YA 2HT2C 1DE0A 4OTXL 1C5CH 5BOSB 3PG2A 2K2QB 1B0ZA 2ORIA 1JIXA 5KTPA 2KYRA 1NOLA 1C7FA 5ES3A 1NAML 2NY6D 1G20A 2IHVA 2D8AA 1T9HA 3NFYA 3G23A 3K7EA 4U6HB 4JVPA 3CXUA 1KXJA 1RJDA 2OMKA 3CR7A 3CTMA 1O5TA 5TX7A 2AJSH 1RR6A 2RC6A 2B5VA 2WQRA 2FSUA 1P4GA 4JLDA 1HE8B 4WFQA 3AU1A 4K6CA 4LVNA 3ROQA 4L4JA 4FP8H 3VFWA 5SV2A 1OROA 4P2YA 4Z7WB 1DU4A 2C9MA 3U56A 1P62B 4TN1A 2YOGA 4IRXA 2R69L 4QGHA 3UPUA 1E2GA 3ZOKA 3FBWA 3OU2A 5ELLA 4M7OA 3MRNA 4OZGA 1S7VB 1QAQA 5LG6A 3IS1X 1SR8A 5EN3A 2HOQA 4O2AF 3WEMA 4C7KA 4GRWE 4M1CC 4MNGE 2UVEA 4HLUC 4RZCA 5T41A 2ZSBA 4NL4H 3ZHRA 4QRBA 1D0VA 1YA6A 4L8SB 5AI9A 4XGRA 1NGSA 5DDHA 2FX2A 2QHLA 4NAUA 4FYQA 4DY6A 1FBIL 1R0BA 4P2AA 2Z93B 4IOSD 5EWMB 3GIZL 1N6UA 5JAUA 2PSDA 4UTAH 1HZZA 3CN3A 2FGKA 1NAMH 4ZSOE 4R1QA 4H8WC 4QULA 1EAPA 4UZEA 4XCCH 4BECA 1FFDA 3IOMA 2X4NB 3FYIB 4RFEB 4PRNB 1IRAY 4PGGA 2O0KA 3CU1A 4DSUA 4EZMA 1U81A 1JHOA 4UT9L 1S8FA 3R3YA 4P57A 3LB6C 2Z4QB 1UK9A 4FSDA 4PY2A 4QUKA 1DQTA 4MCYA 3KXIA 5DCUA 2JIZA 2MQ0A 5J13B 2ZBRA 2C9BA 4BRUA 5EI5A 4QL3A 1RULL 3ZUCA 2K8QA 2B4CL 2X6TA 2VABB 3FKJA 5HG0A 1M73E 5I15L 4RKRA 2WZ6A 3QEQB 3WI9A 2XBDA 3P9MB 4GRWB 3U46B 4C4BA 3RTLA 1PFGA 2FDRA 1K92A 1H94A 1JE0A 4BNDA 4TTIA 3KDMA 4WOKA 3H65A 3VA7A 4I7EA 3GWJA 4MW9A 3EBHA 1NQUA 4GBJA 1HWYA 4PNHA 1NYLA 1NF8A 1O6VA 3B6SA 3HVIA 2AJVL 1U1GA 4M8IA 2OPHA 3FCCA 4OQTH 4CEJB 2H65A 4Q0XL 2KLHA 3UMVA 3LS5H 2XBTA 4P48A 1J0BA 1U7WA 1FZMB 4F5CE 1Z56C 2BFVL 2HA4A 1QG2A 3MUZ1 4XPFL 4XB1A 4MD4B 1GY8A 4UMVA 3H11A 3MYRA 4I9FA 1ZESA 2G80A 5FDYA 5BY2A 1OYOA 5B3LA 3NIFE 4MV8A 5TVKA 3G5YB 3WDIA 1LO5A 2MINB 3MS7A 2HHAA 2WUBL 3AM5A 4GS7C 2EJCA 2GTQA 1JLSA 2XV6B 2O7RA 1U2SA 1VHPA 3LPFA 3TX4A 2V2XA 2Y7LA 3PC3A 3TXXA 3NPMA 5FFMA 4PI0A 4AS3A 1RXCA 1ZHLA 5CSZB 2BVPA 4NKQB 3RREA 2YHSA 1MIML 3FUWA 1XDGA 4XFDA 5DSXA 1X7QA 4E2YA 4U1NA 3EAKA 4R96B 4LLYA 5JBNA 3T7EA 2BFWA 4QBFA 3VMMA 2OJZH 1KZYC 2GSDA 1IBLB 4I19A 3CX4A 4NNXA 3WTVA 2B39A 3MXVH 2HVJB 2DLFL 1OBVA 2JFGA 4GMSH 1CT8B 1JDCA 4G1EB 4JB8A 2NMVA 2IITA 3PHQB 4EPTA 5EUOA 5HHXH 4K5PA 1Y4DE 3T4YB 3ZDFA 4RIEA 2KMWA 1IBDA 1QZXA 2QV7A 3PDIB 3IPBA 1U7OA 3FULA 1U3WA 4YAUA 2JCYA 4X90A 1GZ4A 3HCFA 2VRCA 2XUOA 2EDMA 1WXIA 2E5WA 2NYYC 4LYEA 2EDEA 1RTKA 4X92A 4LMBA 4MA0A 2YN3A 1LK0A 3AG2B 4MW1A 4PZDA 1RIVH 2CLZB 5JSQA 2DFNA 4GXVH 4F5WA 4P5DA 3PCYA 4IRZA 4ATTA 1EEYB 5ESQA 3HG5A 3RUGF 1GFWA 5D5PA 4MDIA 4LJ4A 2VZUA 3QEMA 1IGIH 2WBJD 1I6WA 1PJBA 1HETA 4BB6A 5IM7A 3MRPA 4M5YH 1NGWA 2QTLA 4FNPA 4KXWA 2CNOA 4HLQB 4ND2A 3VFSA 2QTGA 1DKMA 1V2HE 4QQNA 1MJNA 1JYFA 4LXYA 1T9GS 4Q93A 2POCA 4KK5D 1I30A 4EYGA 3O38A 4DQAA 3WJ2A 3RWHB 4PJ5E 4I1RA 4HF5H 3GC6A 1OARL 1E9OA 3OFSA 3BEDA 2IWKA 5ITFB 1NGZA 3BH8A 2P6UA 3DHEA 5FUOH 4W5QA 4YZFE 4BFZA 1ET7A 5IW6A 1NWHA 2HCFA 2XWTB 4MRCA 3OOSA 3VWJA 2WYWA 3V4FA 3TSAA 1F58H 5FUVA 1VIYA 5JW3H 3MSXA 1J8HE 3BBLA 3EIQA 2C1XA 3GJFK 1G0XA 3KO8A 3M6AA 1V35A 2CQVA 5A6LA 3P11L 4EB6B 1DOHA 1RU9H 3DOHA 1ACYL 5KQLA 2Q5LA 4AC9A 3U1SL 4TXHA 4PHZA 5LP6A 4RRPA 5KSZA 2CLVA 1H9DA 2E46A 4UBMA 2E9BA 1SU7A 1U8XX 5JQGF 5LGJB 2Y1VA 4H8UA 3RC8A 4MJXA 4XEHA 3BVVA 2A0LD 4M0CA 1EGAA 2VYNA 3PI6A 1DMRA 1KDZA 3Q10A 2LT9A 3BKYH 1OOAA 1YWGO 3RFZB 3BJLA 1J9QA 4Q1DA 3AVTA 2XXBA 2VYND 3GSOA 3RHFA 4L4UA 4J3UA 1E8MA 3PICA 3H3PL 1H3EA 2K7QA 3N41B 4RK6A 1N2RA 1P1CA 1LW6E 3MKGA 2R1YA 2HFEA 1DBKH 2VAPA 3U4BL 5BSEA 4KK4A 2H2DA 5K8JB 3DV4A 3V2AR 1MFAH 5CKGA 5E9DE 5I5GA 2OCKA 1AR1B 1RJYA 2X4LA 4CVZA 2Y2YA 1LNUA 4BZ2L 3P11H 1S9VA 1WV0A 2DR3A 1BWPA 2B9VA 1HZHH 4MDJB 4NNYB 1OH5A 2HBRA 4KO3S 5GQBA 1MCSA 3MFFA 4RE5A 4AK1A 2AK3A 2JGEA 2K2WA 3L4UA 4PHXA 1NU8A 4E11A 1UXHA 3EODA 1VXOA 4F2MB 1Q90A 1A8QA 2WWGA 1IEQA 1Z2OX 1VL2A 1MOPA 1T7XA 4KKAD 4X6CB 1IE5A 4X5WB 3K81A 3JZ7A 3DTUB 3CVHH 3CQ9A 2O6HA 5F35A 1I36A 1WAAA 1DVZA 1UZ6F 3SZGA 4G07A 3QP9A 3IMFA 5JROA 4J7AA 1KOAA 5C3LD 3TNFA 2ORWA 5F71A 4L3OA 2C99A 4BYGA 4XP5H 3MBEA 3ARFD 3NAZA 3LLCA 5ESVB 3LN5A 2KDYA 2ZYGA 3FPGA 1JJAA 1IMHC 1OP3K 3W5SA 1ISJA 4OCRL 4AJEA 1TQWA 2O6FA 4ABQA 5EU5A 3QQDB 4J0QA 3W1VA 3HM9A 3IJ9A 2B8NA 1NQOA 1QPPA 1G6VK 3D1JA 4WXYB 5A4KA 1ORSB 3OOJA 5I8ZA 5JDCA 2Q3LA 3PQ3A 2HWZH 3TVDA 3TCXA 4GM4A 4A91A 2DYRB 3NHPA 1NN3A 1SB9A 5KS9A 3RSFA 3GLZA 5DLPA 3H2JA 2BFCB 3BN9D 2I60L 4FGWA 4JM0A 3E84A 1WK0A 4TVUA 3OH8A 4M7JL 2AXNA 3CDGB 2K8MA 3TYGH 2PX3A 3QQ4B 3R20A 2DEUA 4L0CA 4E41E 1EUQA 1U93B 1Y07A 4TNEA 4PZYA 5BNTA 3NIGE 1BMGA 4CV2A 3HJCA 2PSEA 4DNOA 2IYWA 2W2MA 3KCWA 1A5ZA 4AJJA 2AJXL 4GBXD 5I7HA 4N82A 3TZCA 2LRHA 1NVGA 4JFHD 2E59A 4M0FA 4PONA 5FI1B 2FPIA 2D0GA 2JCCA 4OFKA 3OXSB 1P7QB 4KVPA 2C2OA 1T3FB 2WC7A 4PUBH 1N9GA 3ZDEA 5FNZA 3QYNA 3O9MA 4YUEH 3ZKWB 2OCPA 4OGYL 1JPVA 2B4KA 3HCAA 1A7OH 3WUWG 1HYEA 2JH3A 3AK4A 3MUUA 5D3MB 5IK3B 2NQ3A 1U1IA 5IK3A 1DQDH 4I5FA 1Y4ZA 1WO2A 1ECYA 2YHGA 2YRZA 2C4XA 4IM8A 2YN2A 1M8GA 1K4YA 3Q4GA 3ZK7A 2P3OA 3E7WA 3WFDH 2JEOA 2GUOA 5LJIA 2R4SH 5TMPA 3ZYZA 5H80A 2CVPA 2G9QA 3W5AA 3VR6D 2ZWLT 3OX3A 1ZPDA 4ROSA 5ALIA 2AXPA 2ICCA 5KKAA 5JAMA 1HNZB 4XO8A 5ILTL 3HYLA 5IEJA 4DJMA 1BO6A 3LK6A 4BUHA 4E5DA 3O3BA 2ADFA 1E64A 4XB6B 2IY8A 4N5NA 1PR6A 3BWVA 2GUGA 4LE0A 4F3TA 5AVQB 4FDWA 1XTJA 3T5BA 1G3QA 1G8SA 4UJ5A 4ZYWA 3DJ9A 1CXHA 4AL8C 1S6YA 4NZFA 1XR9B 3CX2A 1CICC 3EVEA 1RAHA 4NGHH 1U2DC 3BDBA 3T5DA 4OU5A 4YDSA 2BZDA 6NULA 2EBFX 1T7YA 4A55A 3EYFA 2ZT6A 1NDMB 3REWB 4RELA 1RLJA 2C0PA 1WCWA 2AV6A 3RSZA 2F61A 4DKFL 5CCGE 4I55A 3ZZSA 4MD0B 3FTWA 2Q4OA 3CFBB 4P81A 4E46A 3R7NA 4BA8A 1XNGA 1GLGA 1JKFA 1QVRA 3LX4A 3WE7A 2Z4SA 2C34A 2I5YH 3BJIC 5JCZA 4IDPA 5JWRA 1BG9A 3O4FA 3BQUB 5LUMA 3FMIA 1CYDA 5KQSA 1U5BB 2BIMA 3QWOB 1WVMA 3BL8A 1WOMA 3OEEA 3R9XA 1E77A 5KVMC 4I1UA 3EIFA 2I9TA 2F1EA 3NSCA 3TTYA 3LPMA 3F3HA 4KDEA 1W4ZA 2N0SA 4LSTL 5E8DL 3ZS8A 3DK0A 1LGYA 4I4NA 1WC7B 1XVLA 1XIWD 4FG2A 4J6EA 1FQOA 3BGMB 1TZIA 3OKLA 2O7QA 3KW7A 4N24A 4V0OA 1N34B 1QW9A 1ZTXH 4MAUH 3E5MA 1DVSA 1VAHA 5C18A 1NSTA 3QS3A 4IJKA 4EQ2A 2QZ5A 5JUEH 2AVGA 2YJ4A 4C4KO 1YJDC 5AVWA 2CG9X 2FWLB 2VYVD 3QJTB 4R3SB 3OAYH 3MFGB 1DRJA 4H2DA 1F9AA 1P2TA 2QLTA 4L8VA 4RMQA 1CJKC 2H2FA 3V5DA 3FTQA 4YONB 4AUMA 1MUJB 2Q8BL 4QTIL 5A6SB 1Q0SA 3AWGA 1K6JA 4I3RH 2WAYA 2VDNB 5D1QD 3UBXI 1FVHA 3MRMA 1I9GA 4MS8D 1HKLH 4AH2B 3V8EA 4K71C 4LOFA 1FFOA 4Q3BA 5LNK1 3ZE9A 4Q21A 1WMFA 1Q9OA 3RWFA 3ONWA 4DSOA 2JH8A 1IHPA 3I73A 5IEKA 3RG1C 2WBWB 1HH6B 3LYUA 3P0RA 1W15A 3RTQA 1JAIA 4IGFA 3O3DA 3QPQD 1GGBL 2EIZB 4PR5B 4E9WA 1H42A 1RW4A 2NSLA 5F3BA 3PRKE 3LHSA 3K0WA 4NAJA 1BX0A 4ZTOH 1Q0UA 1SG0A 3ZGNA 1BQLH 1DQNA 4XNYH 1EFKA 1X5MA 3EZYA 1OAJA 3Q9SA 3PF8A 2WTOA 1I80A 5EH1A 4LMAA 4UB0L 2WHXA 3OEHD 3ME0A 4BATA 3UWOA 3HEMA 3OL2A 2OZLB 3RG8A 2OSXA 2W43A 4XGKA 1ZJBA 3H2BA 1YR7A 4HC1L 4BFWA 5DS8B 2Z64C 1SLUA 3UENA 2J9GA 2W0FA 4P93A 4AKEA 2YD9A 4FYXA 4ECEA 2C7PA 1NBOA 2FGZA 4WKBA 4K3UA 2Q8NA 4GW1B 5KVFL 1RCYA 2RGBA 2UV3A 4A16A 3TQOA 3BSGA 3GV0A 2DQTH 1Y6NR 4L76A 4L7VA 2D7TH 5EA0L 3ONFA 1VJ5A 1Q0YL 2GJ6D 2QPAA 4GI1A 5EWIH 5F1OB 1UOPA 4JL8A 3FNRA 2YARA 4EUPA 5EJ2A 2P28A 4L5FH 5JZSA 2YMXL 3KPSE 3RV4A 4C21A 5K3FB 1P6WA 1Y1PA 2JKXA 2Y1LA 3IU3A 1F6DA 2WNKA 1GZ5A 2QQ5A 5KC9A 4LZLA 4KXFB 4CDGA 2X5XA 4LF9B 3HV2A 1TU2A 4KRNA 3L8ZA 4ZXPA 5B2FA 1Q72H 4ONHB 3KXFD 1OVGA 1LWHA 1TQUA 3PHHA 4FKZA 4LE1A 5AWFC 1XL6A 2RHRA 1K6QL 4TQPA 4N2DA 4CR8A 2JLVA 3B2PA 2HT6A 4P0TA 2GJ6B 4R1PA 2QUAA 4YH1A 3UCRA 1EGHA 2BUBA 1FPMA 5JSZB 2BXZA 1B0GA 3L3OA 3Q6IA 3E3NA 3NXSA 3OE5A 1IH8A 4HFJA 5DXWA 4J16A 1F1DA 1U21A 1SN0A 1NW4A 2BP0A 3HC4H 4EA6A 1DCTA 3RYHA 1IM2A 5CM1A 1MVOA 3CIOA 2Z2JA 3QPAA 1MRNA 4ZTEA 4NABA 2PDAA 3CFEB 1OMOA 2YJ5A 3TM4A 3RQIA 4BSVB 3IMRA 3W5VA 2ADFH 4IQGA 3GJ0A 3QZMA 2HT1A 1VGEH 4YSEA 3HUEA 4PSRA 4M7LL 4KU4A 4WXRA 3SQOH 2WK1A 4QYTA 2FJHA 1URIA 2F55A 4IJ3B 1QONA 4L4XA 2VJXA 4TMXA 5B55A 1C2YA 3HS9A 5JE8A 4AY3A 4ONHA 2ZSUA 2NYZA 4MICA 1S5HB 4R1NA 4BNGA 3EH4B 1M66A 4EP1A 3HG7A 1YDPB 4PP2A 5K9OB 2VDKB 1O5DT 4IIJB 4BP8A 1UOKA 2AQ3A 1QRNA 3QUZA 4IICA 5I8PA 3MTQA 3ETJA 3U82B 5ABDE 4NSKB 1MQAA 2XT6A 2PD3A 5JO0A 3U2SA 4GBXB 3NRQA 4OM0L 4JFOB 4YR7A 4OV5B 4KAJA 1P81A 3MCVA 4YYZA 3OTTA 1GL4B 3U39A 2PCPA 2WCPA 2EARA 4ADJA 4O2FA 2WNIA 4HAOA 5TR9A 4FE7A 4CQLB 3F64A 4NN6B 1PEDA 2DQCH 3V34A 3ZEAA 2N0KA 5JR3A 5DQDH 1TVBB 2BGLA 5FA3B 4Q9BA 1NATA 1F6AB 1VJDA 2CA3A 1T43A 1PZAA 4BXOA 4RXMA 2DHCA 3L7EA 2X1XR 3ZR6A 4W9DC 4WLCA 4YPFA 3ZW3A 2OE2A 4HFWA 1OT4A 1UWGH 1A7OL 2RHMA 1JTOA 2WXMA 5I0YA 1XTRA 4N3CA 1C2TA 2R8PA 3DE4X 4BBZA 1Q94B 1QZ1A 5D7SL 5IF3A 5I9QB 1T6ZA 4Q6KA 4WXMA 1MCCA 2CKBB 2VLJE 4GGMX 4IDLA 4AMWA 5A5FA 1BE0A 3L84A 3KB6A 2E0PA 5ESXA 4Y5XB 1X7WB 1A9PA 5EEHA 1JA0A 5E00B 3MCKB 4OGZA 4F8TA 3I50L 1LVUA 3BM5A 5IBLC 3MAGA 2F7QA 2CJWB 4JQXA 4XWTA 2RHCA 3ESPA 3OKAA 4CGYA 3IB3A 4TMFA 3MBOA 4X6LA 4MHSA 4LVHC 5T8KA 2CJFA 4RVCA 3WLEA 1KP2A 3MNVA 1PL8A 1DVYA 2ZCVA 4JFUA 2AKAB 3IHLA 3N58A 2WMYA 2ZWNA 3L7FA 2QN9A 3YASA 1OE3A 3UUGA 3K2QA 1AX9A 4MVXA 1J8RA 1HXYB 1JQLB 1Z6JT 1CCWA 1FX0A 5AUPB 2G70A 4BFLA 4XC3L 3HWSA 3MA7B 1YZKA 5TRTA 1Z5YD 4TYQA 5LP6F 4MKFA 2XF8A 4ODUA 2XT1B 2M6RA 4D94A 1HNYA 5E3IA 1BBDH 5IREA 5KI6A 1NLBL 3CWQA 3V32A 3FMGH 4YMPA 3WWCA 1H3WM 5AOKA 4MDFA 2ZBVA 2H7XA 1CLEA 2Q0ZX 5BRZE 5DEFA 1I1OA 3ARBD 2V5AA 2XA9A 5E1BA 3JYNA 2F5AL 2H1FA 5LXTB 5HW0A 4MV1A 3U80A 1K8ZB 3MO1A 4GKSA 1DDGA 3QOXA 1AKYA 3EVDA 1QHFA 2IBTA 3C60C 4X7DC 4P2QE 4CRPA 5EORL 1M33A 1P73A 3AR4A 4QJ4A 5THKA 4Y6LA 3QUTA 5FPQA 2JVKA 4Z4IA 1H0SA 4MJ5A 4YE0A 2Q3HA 2YWJA 4NFDA 2CZQA 2FYYB 4Y0NA 3QUKA 4XPHH 3D18A 1RBMA 4TSFD 5LZ2A 1Z9OA 1KR5A 2A1TS 5A05A 1G16A 3EY4A 3I32A 1M2GA 4LOUD 2P45B 4UEJA 3IE4A 2ZT7A 1NW5A 1SIWA 4D8TA 4DLWA 5IHWA 1CE8B 2CU9A 3GLQA 5BJTA 3D4PA 5CFZA 4BCBA 3MRQA 2IQ5A 3LIZL 1U0HC 2X4RB 3G59A 3GLFE 3UFIA 2B0SL 3B9VA 1KDOA 2BX5A 4TSBL 2OPCA 1CF2O 2XJ9A 4V39A 4Z78A 1PIFA 1UJ4A 5DTRA 3TR0A 3A3KA 3F1LA 3OZ9H 3LX9A 4F24A 1CD1A 5LXGL 1VLHA 2L4OA 1S7TA 1MLBA 3LT0A 4R7VA 1N59A 1FORL 2QKYA 4NI6A 3V0JA 1N6IA 3KS0J 4KK5C 3ZHDA 4XMWA 1E0JA 2HLDA 1HYRC 4EN3D 2HTFA 4JZYA 3ADBA 1QPXA 2XN9E 4Z0NA 5K0TA 4P2OB 3MV9E 4EZIA 1TQ2A 2HMUA 1QTPA 3IJ5A 1ZHHA 2CMGA 4XVSL 1YMME 1MO4A 3HS8A 3MRRB 3I52A 4ITVA 2VF5X 2PQ6A 2KQUA 4N2EA 1JFQH 1OK8A 5M94B 5FT9A 3L3OB 4RAQA 3U4CA 5COAA 5HNKA 1OHZA 4MULA 4M7ZC 2OHXA 1W75A 3O3AB 2XUDA 2IOOA 4IKEA 4RLFA 3GLHE 4XBGA 2IANE 4WTXA 3VM7A 1FFHA 4LF6B 1WB5A 5JYBA 2RGGA 3JW8A 5JQIB 4F8LA 4KFSA 3WE6A 1LQ2A 2OXTA 1D9KD 3QQ4A 1NJ6A 3WY2A 4EIBA 2IYZA 4IMKA 1AK9A 3WYFA 3MTEA 4GXTA 2PO7A 1OAOA 3T0BA 4LMQI 1U1EA 3RODA 3NIFF 1JLHA 3OAAA 3UBTA 1BOYA 3VXME 1L7NA 3AR7A 3AETB 3KBFA 4Z7OB 3ATDA 3C09B 3A4MA 2G3YA 2A84A 5I6XB 2IYUA 2A7XA 4EKDA 3LTVA 1O3YA 1ZWIB 4HDSB 3NCCB 5A3QA 3EZLA 4DR1B 4RZIA 1HT2E 1NZJA 3D3EA 3A23A 1EMTH 1T3ZA 7MHTA 5C1BA 1CDYA 4ZAKB 4FLSA 4PPYA 5A2GA 2H5UA 1A4KA 3PDGA 1JQJC 1HQDA 1UM9B 1MABB 3KJFA 2BBWA 1INDL 3HG3A 2Z65C 3RB8A 3ET9F 3QDJE 3UEZA 5AW3B 1PZ2A 4EUPG 4MUJA 2UU9B 3LKBA 1AR1D 3D08A 2MOGA 4LFBB 4BUCA 2BM8A 1JXJA 3THXB 2VZ9A 4PIRF 1PSDA 1SA0A 3TVMD 4XRRA 2O5VA 1CULC 2I9KA 3UXFA 1Z37A 4E15A 4BQ6A 3LKNB 4K4KA 4A2MA 1A2YA 4G8IB 1MR3F 2E7HA 4UXHA 4FDAA 3DUUA 4YX2L 3FYHA 4MZRA 2BGGA 5IQ7H 1EVZA 5SYMA 3AT0A 1KN2L 3WKQA 1KK0A 1D6VH 3K6DA 1TOXA 3FQWB 5FD8A 4BFFA 2JIBA 5F5XA 4OCYL 4TSCL 4LVHB 4U49A 1SEQL 3RRMA 4GPEA 4ORZC 4D6PA 3IN0A 1RDFA 1RP9A 3HC0A 2C9ZA 3IHKA 5K51A 5F7UA 2ADIB 4MO2A 3CSDA 5B64A 1HYSD 5F7DB 3UWPA 1RCTE 3S3JA 5E6ZA 2F8TA 2JNZA 2DLNA 1LNUB 1XHEA 5I75B 4DVGA 3H9YA 1BM3L 5IP4A 3C3AA 3HH8A 4OQTA 4YRDA 4F5YA 1QRKA 2HFEB 1RLUA 2VHCA 2EF1A 3RFUA 8GPBA 2I6QA 1KEKA 4OLZH 3U2IA 3MI6A 5IB5A 1A8UA 3PNSA 4DANA 1NBMD 5DVPA 9PCYA 1E5VA 5D00A 2G6BA 3U25A 3SDXA 4N6OA 1ZLSH 4LJ9A 4X3OA 1WCV1 43C9B 4QT0A 5E5LA 1U95B 4JN2A 1EWVA 5C8JA 4WFHE 1G17A 1LI5A 2W8BB 4UZUA 1UBCA 3QE2A 5FJJA 1G8KA 1XDUA 2X0WA 1HFEL 4DNXA 3NACL 3DDCA 1VGVA 2QT0A 2WLSA 2XTJC 1KJ2B 4F06A 2XBZA 4D92A 3FFBA 4TLAA 5J4KA 3IFPB 2XTJB 1BHGA 1Z3GL 2PWDA 2LFEA 1W80A 2V7VA 1ZGJA 3DIDA 4XVCA 4NJAL 1Z73A 4MS3B 4EKIA 3A4FA 3GC3A 4PWZA 1F8XA 4B53A 3O7MA 4N2NA 3K80A 1FC2D 3HN2A 1PL3A 3JASA 1U3VA 3DTVA 1R5IB 5KJFA 3L3GB 5F89B 1HI6A 5E51A 2UXDB 3H4HA 4Y88A 1XRLA 1X80A 4FGUA 4HNHA 4QUIA 1K68A 4HXBL 1RS0A 3DEZA 4KWUA 1E3JA 3MLPA 4U6VH 4P2OA 5J43A 1SEBB 2AG0A 2OG1A 4JGBA 3HUJE 4JRYD 4DLPA 2UZAA 4GE3A 1XPRA 4MI6A 4EABA 4DGYH 1TJHL 1NC4A 4G2TA 2YD4A 4BLOA 3S8MA 3MQ2A 4B33A 2D5LA 3CVHA 3RLFA 4YP1A 3NIDE 2G07A 4DZRA 5E2AA 1TU2B 1YDMA 2XTNA 3SSGA 121PA 3LQMA 2V7HA 2Y5TA 3IETB 7ADHA 1VM6A 4QYIA 5EF1A 5FO7B 3H9SD 4KIJA 4O5OA 1Q7BA 2J41A 2QP3A 1NEZA 5CHNB 1T0MB 5ARDA 4KWEA 4B8ZA 3CKKA 4LGMA 1KI9A 4FLHA 3NWBA 3NUQA 1EDHA 2CHVA 3ZKWA 3UYPB 1BFDA 2PO6A 1MLBB 2VJNA 3GA0A 3N0RA 4M86A 4Z8YA 4Z4QA 2WBKA 1FW8A 2NTNA 2FH5B 4CDNA 4JLRA 3VNSA 1KSRA 3JZAA 4ND8B 4PBWD 4C58B 3UJIH 2WA2A 1CY8A 3HC4L 4JS0A 4S0SD 4K0KB 1PLGH 2FX3A 3FI9A 4Q37A 1OLOA 3DWIA 4NEQA 1LO3L 3UABA 5DFAA 1KQFA 3LE8A 5KVCA 2VTKA 3IUSA 1FNSL 4TKUB 2AQPA 3D07A 4F57L 3OUZA 2RCSL 5AVXB 5D2NC 2BE9A 4YJ3F 1UKEA 5EKUA 3DARA 2XZZA 2NNAA 1KA9H 1EJBA 2X1QA 5J4MA 3F7TA 3UMJA 4N0UA 1V43A 1MAJA 1MQ8B 3RVPA 1MGPA 3COJA 3MRFB 3MACL 2FK9A 4URFA 5L95A 3EARA 3BKYL 3F6JA 2FK8A 3TC9A 5INDB 4WADA 1W0KA 2B21A 4DNQA 2I2XB 2FX7H 2CRMA 3FPAA 1OXTA 1ORSA 4N65A 5DTIA 1EUDB 2GEJA 3HSKA 1PHRA 3L2NA 2CVZA 2ICEC 1VJGA 3IQWA 4LPKA 3LKQB 1T5BA 3BGOS 3RTQD 2Z2XA 1CFZA 3ABIA 3FOZA 1H2HA 2ENSA 5AJTA 2Z7YA 5ALTA 4YHOL 4D5GA 3BHNA 2WAAA 3SIWA 2G9ZA 1UD4A 5IJDC 5G40A 2ZXBA 5LNDA 1I8KA 3LZDA 4GKOA 5GZOD 2IYSA 5FYJD 4PRID 1QDUA 1G7MA 3IU4H 2V4UA 3B1KA 4H7KA 2OGZA 3DURB 3Q6FA 3PWPE 4YMIA 1R74A 2IU4A 4EGFA 2BSTA 3WWEA 4DK3A 1MQ8A 4MUBA 4UHDA 3VXMA 3B8HA 4X5WA 2XBMA 1JG9A 4G11A 4HAYA 3PNQA 4NU8X 2PUWA 3OR6A 4NBRA 5HFAA 3OB8A 3PC7A 4GZMA 5DF0A 4O02B 4ZPVB 2P6OA 4TKUA 5EZLB 1I1AC 4MARA 4IBWA 3C7TA 3CZPA 4NFSA 4GI9A 4MS4B 2H08A 4E22A 4NBSA 1KFCB 4WIQA 3DXXA 1ZCRA 2PIAA 4GX5A 3ES6B 3S36H 3TO4A 3TRHA 4YFDB 3A6CH 2Q21A 1WIOA 2FPWA 1SELA 3CEJA 3FWZA 2ZOTA 2SECE 2WG1A 4TXJA 1VFMA 1T3HA 3EUFA 3RJ5A 2C07A 2WYOA 4M8QA 4M1YA 4RAVB 1YJAA 4P04A 4ZO6A 1EG7A 1DL7L 2OQJA 5D7LB 4H6VA 3MRTA 4RD3A 3RFZA 4PZ9A 2NZJA 3PQ5A 3V5HA 2LXNA 5H3CA 4S1VA 1YL7A 5L7XL 2F8XC 4PBXA 3T38A 2AK4B 3G02A 3W2IA 2GZ1A 4R83A 2V0CA 4ZW5A 1R0YA 3PI7A 1QBLL 4LT7A 3KXPA 4R2LA 4CN1A 4N2CA 4OZHE 3VKWA 3S2IA 4LSVH 4OATA 5KWEA 1TZGH 3NSJA 5EWJA 3WA6A 4N8VA 2XJLA 2Q6LA 1ECZA 5DRNB 1YMMD 4BNKA 2YSSA 4LJ6A 1LLAA 4FG6C 5AW4B 3ESNA 2HHLA 5DURB 2YVUA 3W9EB 3F96A 3H2WA 1HIML 1NMAH 5TY0A 4JFOA 1YZLA 1LRJA 3OURA 3I75B 3LO5A 4HUWB 2VDOH 1L7OA 2EDHA 1R4MA 2E76C 3THRA 4WVRA 2ZIFA 3Q13A 4MJ7A 3TLEA 4JM2A 4EPWA 2CXSA 1ISIA 4MHOA 4L8BB 3S2ZA 2WIGA 3JARB 1IY9A 3Q3VA 2AEPL 1PZEA 3M34A 3C43A 2ZI4A 5FO1A 3JASB 1TLMA 4JVLA 2XITA 5IW1B 3SEPA 4LOIA 3TIIA 3HFML 1G94A 1GSOA 3S68A 3W6PA 4E07A 5GZ3A 4EYOA 4CV3A 3W2FA 1E63A 4ACTA 2SODB 4YFLI 1CLVA 3QELA 3T3HA 1YO4A 2ET6A 4G4JA 2K6YA 1Q9LA 3B5IA 3EJWA 4MV0A 3E4CA 1BZ8A 1TAHA 2RCYA 1E89A 3N5AA 2G60H 4GW5B 1DBBL 2RTTA 1A9XB 1PZFA 4XCXA 3DDFA 1BIHA 2D3TA 3GCGA 4PANA 3NO4A 4TL7A 2RKOA 4JPIA 3BWDD 2ODNA 3KHQA 4P98A 4BLTA 1BH6A 5EVCA 4G6JH 2QK4A 3U2JA 1J20A 3F46A 4B4UA 1P69B 5CT4A 4PD4K 2HEGA 3HUJA 3MLEA 2X7LB 1VSTA 3PQEA 1TUPA 4N2BA 2YMLA 1YQQA 2G30A 3BZEA 4GRWH 3MUGB 4C4XA 1JDBC 3PKZA 1NJ8A 2A73A 4CIBA 3ROOB 1C5BH 2FFBA 2HMYB 4OPMA 3JAMA 3DRTA 2YK1H 5L51A 1N3NB 4L8GA 3VG9C 4JQCA 2XQBL 3UZUA 2BN4A 1U8PB 3IDAA 1AA6A 1EANA 4PJ7F 4UCWA 1C7JA 2WXRA 2PZAA 1UM6L 2IYYA 4YPGA 4WUUD 1US8A 4A6XA 1HEZB 3KXKA 4A6PA 4MO9A 3IQFA 1DTSA 3CBQA 4NQZA 3KP1A 3EJRA 1UM5H 1TB4A 1DRKA 5FIEA 1GL7A 2FHBA 3UX9B 1QRAA 1ULUA 2YWRA 2ZG3A 3JRXA 4UTVA 3QVLA 4HKXB 3Q05A 3TSCA 2XVGA 3VVVA 3FIJA 1OPXA 4XCNA 4QUDA 1A22B 4I5IA 1J05A 2FNAA 4PBRA 2H1XA 2ZYIA 4MXWL 1C5DA 1MMFB 1NE2A 3EIUA 5IC5A 3VXSB 4PJFB 1XTKA 3CWGA 4WAFA 4MYUA 1Z08A 3C7CB 3QFJE 2WTRB 4ZOCA 1YBAA 2C4HA 2HSZA 3CMGA 1U8NB 3B5TA 2OSLB 4D9IA 4F93B 5TDHA 4AWJC 5I5RA 3ESMA 3L04A 2CPCA 3LS5L 3BZFA 4MV5A 3CH6A 1ORIA 1EAOA 3TR6A 1ZUNA 5KW9H 2FP4A 2Y1ZA 3M89A 4W7SA 1AHIA 2YAOA 3P1VA 2ZSEA 2HZBA 4G2AA 4GP5B 4YSCA 1GY2A 4HKZA 4KN9S 4PWKA 3EFFA 3K46A 3QVWA 3C8DA 3DONA 4C07A 2ZUQC 2DIBA 4C55A 4M8NE 4P83A 2DSTA 1X5AA 4Q9QH 1P9NA 3I92A 1NWCA 4AIZB 3H4TA 4EHNA 4EJSC 1GRCA 1QHOA 1GZHC 1OP9A 2EH8H 3L7OA 2JXMA 1TGYA 4TLKA 4LPSA 1KMGA 5C7IO 1I8KB 1I3LA 1B3IA 2YZGA 2JSFA 2ZREA 2V7WA 3VDQA 3WS6A 3ZJTA 3TYGL 2QJOA 5I2IB 4Y9SA 4DF9A 5DLQC 3KWVA 4PO3X 5FUMA 1WXGA 5DN9A 4NUPA 3NETA 4KBGA 3SHTA 5KYYA 3FQRA 2JJTC 4ZFGH 2ICEB 4XMPH 3ASWA 5E4EB 1VBNA 3QA3E 1L5GB 4OD1L 2RGCA 3E58A 2VBGA 2IHTA 3T6QC 5ECWA 5T1LD 2VP6A 5DN6D 3RFZC 3NI2A 1GR0A 4KQKA 2HUHA 2VWGA 5FW6A 1BGXL 3TOSA 4Y4HB 3PT5A 1NTOA 4AVIA 3QKWA 1M6OA 1Q21A 5FTWA 3PDOA 5D7JD 3AT1A 4AQAA 1SJEB 1U63A 5LDGA 3WIHA 4BQQA 1NLMA 3LIIA 1X5KA 3R7AA 5CLFA 1EZZA 4L7QA 3VHQA 4TKVB 1K5WA 5BYKA 4RZCB 2TMKA 5E2BA 5D1ZD 1X1CA 5G3ZA 3NVKI 1U02A 4RBNA 4GLLA 3BQMB 2GDJA 2J1WA 4OP3A 4WEUD 3K1AA 1NFIB 1U3FA 3IALA 3D30A 2CVQA 1OLSB 4OJYA 2EKDA 4U00A 4U0JA 3G0GA 1F4AA 1J1OH 2EYSA 1MQ9A 3WLIA 3PJSA 4MBRA 3ZHBA 3PV6A 3WDLA 3T77A 2PS9A 3RKDC 2J5XA 3E9YA 3L6EA 4D9EA 4OSUL 4Q9KA 3T1FB 1RIHL 3GPDG 5EZIL 4R0NA 3IAEA 5ALXA 2PKEA 2HU2A 4AO8A 3ARBB 5KMGA 2NW3B 4KQ4H 1OGAD 4HI0E 4KMMA 3NDRA 2WWYA 1EWKA 3RDPA 2VSDA 2MWMA 1N6KA 1S7TB 1KP9A 4N5LA 1B8UA 2XN1A 4LYJA 4PLPA 1RERA 2AJ3A 4RL4A 5E6UB 3PP4L 3DH0A 3EUWA 5FYKL 1MVYA 1R75A 1J2UA 4I1SA 1SOKA 4R71A 1ZTXE 3NV9A 2G9HB 5E9NA 3CPHA 2IS2A 4I18C 2H3EA 2V3DA 3CVBA 1CUWA 1T25A 3ASUA 2Y36L 1PL0A 4DIFA 3HK2A 5E3JA 1Z5LB 1J0DA 4S05A 4U1NB 4Y1SA 5D3MA 1SBSH 1DAIA 4RLHA 1E9AA 4XPTL 3Q3IA 1FPTL 1JJUA 1PUJA 2XH8A 3P0JA 3TRKA 2IYTA 4F46A 4KK9C 3DIFA 4AG4H 3CSUA 4RK1A 4MXQC 1YCGA 7ABPA 4IH9A 2AI0L 4NYMQ 3V6ZA 2AIRA 1KGCE 5J2UB 4YX2H 3PRZA 1YZFA 3T1NA 3ZV4A 1ZK2A 2IWGA 5EMNA 2IZ0A 1U2QA 1KXQE 3AONB 1RZRA 4KQ3H 4V1DE 2C20A 4PZEA 3COSA 1DRWA 4Q7JB 5DHVH 3DVGA 2EIJB 3GBMH 5BV7B 1J2TA 1I8UA 1P5VA 1XXHE 2X3UA 1PNQA 3GSVA 4J75A 3OZDA 3UBXA 1FRVA 3OTIA 2CLKB 3AI3A 4J3SA 3O2QB 4NE2A 4WH0A 2M83A 1SCUB 4RK5A 1QYRA 2C59A 4DR7B 3DGGB 1BLIA 4AU1A 4ZD6A 5A3RA 4L3FA 4HG4K 5HMMA 3NBYC 4ZVRA 3DHJA 1UT1A 2J4WH 3I76A 1TSRA 3ZU4A 3WTSA 4MTLA 2WSYB 2HH9A 4IHJF 1CUHA 2AJDA 3ZZ1A 4K3HA 4GQPH 1W5BA 4JE0A 4Z7VA 3D8RA 2HX1A 4PNPA 2ZRFA 5K8UA 4ICIA 1MHTA 3LQQA 4U33A 3WHPA 3B56A 2EFYA 1XF2A 5FTJA 3GG9A 3GGDA 3FGNA 4LLWA 4NZMA 5KJRH 1EFHA 2E7DA 4HJ0D 1IILE 4L5FE 1I3KA 3ZHQA 2G4LA 3D5OF 3CXHK 4DGSA 1LV7A 1XU4A 2QM3A 4NDNE 4XI5D 2O5RA 5I8EA 2IOMA 3GEPA 4D4JA 4LEBA 1TF5A 2QTVA 4TS6A 2P2SA 3PV0A 5CBPB 1U90A 1C9NA 5IMMA 4JLBA 3LQZA 4MVBD 1YRAA 3A4VA 3BXFA 3SLKA 2W95A 1CR0A 4C6RA 4O8ZA 3SVTA 2X4OA 2JMRA 2GXQA 1QNIA 5EZYF 5I0WA 3FFCA 3CLVA 4NNYA 1QR2A 5FORA 4QHKJ 4PJ7A 4AGLA 1NURA 2JCSA 1XLTA 2P8JA 2QPUA 4YLEA 1MDFA 2CT8A 3D02A 3ETTA 4EATA 4DC1A 2AEOA 1XD2A 2FSEA 3WO4B 1M7UA 1F4XL 1YR2A 5GGVL 3UCXA 3ZTDC 1CLCA 2VR1A 4X7SH 2O1SA 2I24N 3ESDA 2HEIA 4DN3L 1MEXH 4BGDA 5A7GA 2QJDA 1EBAA 1YQVL 4LLQB 3QG7H 4AIOA 4PTYA 4B9PA 1YRQA 4M9QA 1IC7L 3B4NA 4MKZA 1L6IA 1PGJA 1SDAB 3HE6D 4CF5A 2ZIVB 5HVHC 3DDOA 3A9SA 5DLYA 4AUEA 4IKPA 4K03A 4L0MA 1RXEA 5ICEA 5C5IA 1XIWA 3OGCA 4KJQC 4D8PA 1TNMA 3IURA 4IIJA 2ZSVB 4FI8A 3NAMA 2RAMA 2NTVA 2JLLA 4O51B 3E23A 1XDDA 4ILEA 5BQ5A 4TS3A 2GN6A 1DEDA 4J4HA 2N7AA 1Z4PX 1QIMA 3OAWA 4Q4EA 1TTAA 2EFGA 1M3JA 4XP6H 4CMGA 3AU0A 4OGYH 1G9MC 4PGBB 4Y2GA 1IHUA 4HMQA 3K35A 2IVFA 5EJEA 1NIJA 2VQ4A 3O3AA 2AZAA 2QE7D 4HGZA 4R0LC 3I9IA 4RF5A 1BVZA 4LEXL 3HGTA 1E6KA 1TF7A 3QRFM 1KLFA 4TN9A 3SX0A 5JG7A 1QMGA 2XEXA 3HCCA 4QLOA 1KYQA 2OSYA 3G5ZB 3E5NA 4NQVB 3HEIB 1GGIH 3ZGHA 5EXSA 2G76A 4FD2A 4PYRA 1XG5A 2XGMA 1NLDH 5A7BA 5JQGB 1LD9B 2OP4H 2DJMA 1W8OA 4INPA 5AW8B 3BH0A 1K7XB 3GYRA 2WDPA 4UV7H 1BQRA 4HMPA 4X20A 2D3WA 1U0JA 4F9LC 2KLRA 1AN0A 3AKYA 3HVRA 1QBLH 3QI7A 2G3MA 1Y1DA 1UDRA 3B8SA 2J9FB 4HAZA 3PWUB 3PHOB 1TUEA 1CUSA 4RH4A 3NUGA 3RO7A 1E2QA 2WY3B 1NUAA 5TQ2A 1TCRB 2COVD 1OY1A 1BYUA 4AE1A 4DHWA 1L7AA 3R6TA 1JG6A 3B1WA 2BOLA 3M07A 2YGNA 3WFCH 5CN3A 4D0BA 1LV8A 1CXIA 3K5SA 1UPTA 5AALA 3UKDA 3FO9A 4B7CA 2NCMA 1TYCA 2VJMA 1X7ZA 3STXA 5C07B 4HTAA 4GM0A 4BX8A 5A71A 4LVEA 3HU5A 3CLWA 1FV1B 2GCNA 3TCKA 4IRSD 2OBBA 4YI5A 3BKCH 5BSUA 1CY2A 1J1PL 1N5KA 2H06A 2WUEA 3K6IA 3N91A 3RUCA 1BBJB 2FYTA 2BMAA 4XCEB 4O2CB 3DQPA 1T0NA 4PP1C 4KR7A 4NQEA 4P58A 4LLDB 1Y1KE 3GIVA 4TTPA 1A9EB 3WAJA 4LKCA 4EEZA 1WHOA 1IC1A 5DWDA 2Y0DA 1ZTXL 2FVXA 3AF6A 2VAVA 2IIQA 2J1XA 4JG9A 3R3UA 5IJXA 3OICA 3LLUA 4EY6A 2QW1A 1IGML 5BZZA 2LVCA 5CAYB 3O2WL 4DCSA 1CFTA 4M7LT 3S4SB 4ZMLA 2YQGA 3DXAA 4KKPA 3ZTTA 1AG0A 3VRLF 3TLKA 3PUYA 4S2EA 3QV1A 4ZVVA 2YWHA 2OMWB 4AIXA 5KYKA 4C7MA 2WUGA 2JHCA 3AFOA 3IJPA 4FCWA 2OCLA 4GZLA 3DX3A 3VDXA 4IOIB 5IIEA 2C2WA 3WV4A 3BMVA 1XYYA 2PS0A 1SJ9A 5IJAA 3ROPA 2ZX8A 1U3HB 1KGJA 1W8NA 3LBFA 3NBQA 1E62A 4KFTA 4NCJA 5D01A 4XP5L 2VHJA 4P7KA 2BTEA 1ZVMA 2JHPA 4E51A 4R97C 2Q5EA 1I1YB 3MPUA 5TLSA 5NULA 4KAAA 2QLBA 1OGAA 3VZPA 2H0AA 2RK4A 4XPTH 3UGQA 3MAWA 1IT9L 3NP9A 3EOTL 1QBML 3SYNA 5I7SA 1ZY2A 1FFNB 3OEWA 4M02A 2X0KA 4KVNH 5I1KH 1LC3A 3SOBH 4QI3A 5D1HA 4JZOB 5T4HA 1PL6A 4Y4FD 1KJQA 3ARGA 5DYOA 1BZQK 2OLKA 4HYTA 1EO5A 3AEUA 4MUNA 3BRWA 4I89A 1NGYB 4DEVA 1KI1A 3T3MF 3L43A 2GZ3A 2WJHA 1IK4A 2JI9A 4E9LA 4QCIA 3WMXA 3O3CA 2V17L 2D4DA 3TSZA 2DI7A 1Q1BA 4YRRA 4TOIA 4L1SA 1V11B 1Q1GA 1SF3A 1YC8A 3O0RH 4P49A 3T0WA 5LWHA 4B3MB 4WHYG 4COOA 3OJWA 3EULA 1ST3A 2CLHB 1C50A 3QIUC 4KRGA 4JNKA 2YYZA 2O8DA 5DT1H 1YNTF 4CTNA 4M88A 1U0EA 1LPPA 1LWNA 4JR0A 4CM3A 4BTVA 4AJ1A 2YPLA 3AJRA 3DZBA 4CKBA 1O57A 1X7HA 1MI5B 1K7CA 3FQUB 2WG0A 4CIYA 2O0LA 4DC0A 4HCGA 2ALWA 2C3HA 2F3SA 3D4OA 4NUJA 4MA7L 2HJRA 5C3IA 5J4LA 2KMLA 5I6PA 4JO1L 1KE2A 3VI4A 1XBDA 2NX5A 3C6SB 1TK3A 5C70A 4O4IF 5KSUA 1MXFA 5HHVH 3KWTA 1FNGB 2WINA 1GGVA 3EGEA 5I1DA 2JJVA 2IHBA 1UEMA 1RRMA 2IP1A 1U6JA 4UHHA 1RKBA 3MV11 3IP5A 4I0KA 2QQEA 3RK0A 1KTDA 4CMIA 5JSUA 5JXED 4ND1A 5B22A 5ILTH 1KYIA 1XD1A 3E3QC 1NV9A 3V0HA 1PFWA 2QVCA 3IN2A 3DOEA 2OR9L 5IUNC 2EZ0D 1RKXA 3H5TA 4A8TA 2GH1A 3K1YA 4MINA 5JQWA 1QIIA 5IB1A 2VM9A 1EB9A 4D0CB 3F47A 1UDCA 1U8OA 5HIAA 4BEWA 3ML9A 1PSKH 4FABH 3VYVA 2YZNA 4L1BA 1NPJA 5AIAA 3IDIA 3KJXA 4KXAA 1IAOA 2MPAH 4YHYC 3QIVA 4FFTA 4JRYA 4C8XA 2FZCA 5GONA 4Y18A 3ZJVA 3VH8B 2AGJH 4FGKA 3VFGH 4YWHA 4OHPA 4KN8A 1JPJA 4B7XA 3INYA 2IXBA 2X3AA 3AS3A 3OKWA 4H2CA 1A8HA 3MTXA 4KAQL 4PGEB 1LVHA 5JPNB 4KXLA 3H9BA 3AEYA 3KQMA 5AVZB 4RFOH 4X7CC 3P4LA 3BTOA 2GIMA 2GK7A 1YPZF 4AGNA 4RVDA 3FH5A 4BGEA 1DJHA 4F2EA 1KH3A 3GGOA 3FTCA 2AFHE 1W0WA 1DVFA 1VADB 3K2IA 3MRIB 5KVGH 1BOGB 1YAIA 3A1DA 4OD0A 4PC7A 3KBOA 2EQDA 4PG8A 4FAAB 5CLGA 2E7LA 3KZ8A 3MK31 1KDJA 3CG8A 5IABA 1YEFL 4G82A 3BMQB 1IIKA 3TTVA 2BZGA 5K3SA 5AYUH 3B5JA 1RZ8A 2OMEA 4OB5H 1FMLA 4CSSA 3PNKA 5KBYA 1IUNA 3WRXC 1LJ8A 3G2OA 5IKPA 3K8YA 1KIRB 1AHWC 3T0VA 2IXQA 4JMPA 1IEVA 3TO2A 1Z26A 2FPLA 3ZKMD 3UZVA 3F58L 3DXYA 1JWMB 3GNMH 1XQYA 1XL1A 1A0QL 2AEMA 5JLJA 5DKFA 3G8AA 2WV9A 3OOWA 2VPWA 4CM7A 4DYVA 1MWAB 3LDGA 3ZYOA 5JPMC 1BXAA 3ZE6A 1FFXB 3UJ3X 4I3FA 5ISMA 2AYZA 3SE9L 1OM9A 3T8XA 3G5AA 1ZI6A 2NY2D 4MQ7A 1C9DB 4CF7A 4P23B 5M3BA 5GINE 3EHDA 3T7DA 1JV2B 5LJYH 3A1SA 5KQRA 3VNVA 2QUIA 2CYCA 4XARA 5E9DA 3B37A 3AZPA 3A10A 1F11A 3GK8H 4JFYA 1VB3A 3FN4A 3SE8L 4M9OA 4LOAA 3LC1O 5IC4A 2P1YA 3PYXA 5B12A 3NASA 2ECQA 3ENVA 2GXSA 3NHKA 4MMZB 1EBFA 4K88A 3KPQA 1T2FA 3QW4B 3ARGC 3F71A 4B46A 4Q03A 1QFJA 4LQFH 2OXFA 4IO1A 1GZ3A 3V1NA 3KPRA 4FW9A 2GNPA 3W9YA 5THXA 5I1IH 5FLUA 2XZAH 4JRXD 4D9RD 2XYPA 5U1PA 3MHTA 3D7SA 3T5GA 1RPKA 3KVQA 5DS2A 3A1UA 2J88H 3DX2A 3BSSA 3V1TC 1NXQA 5IWCA 1YOVB 2G1UA 2XG4B 5JNWA 5J7CC 2D7TL 2YYAA 1P5UB 3BZDA 4U8GA 2D4HA 2AXWA 1WHSB 1XQ9A 3AGPA 2F54A 5IW6B 3LXAA 3K3QA 1UJ2A 1YXMA 4IS2A 3LZPA 3IT0A 1A98A 5C9JA 3H0EA 5CG2A 5EZYB 4HAFA 3E9RA 4EIWA 2OCBA 4GO9A 2DXIA 2N1KA 2XUZA 4RD4A 2FBRA 1U7ZA 3U6RB 3ZPXA 1W49A 1J8QA 2DFLA 4XDHA 4DSNA 1HF3A 4MYCA 4BVJA 4ZCMA 3LHKA 4X4XB 2Q7AA 3QKSB 4Y2SA 1JXDA 1ZJAA 3P5BA 5DK2B 4UFPA 4LP5A 1VESA 2F53B 1SWVA 4I55B 3TTSA 4NPYB 2R1TB 2IEGA 3OE7D 3CFJB 5FUZL 4R2MA 1G2PA 4LQDA 3V0WH 4P82A 4R8LA 5EXTA 4QAQA 2XWTA 1J5CA 3JQ8B 4M1WA 2GYVA 3ZDXE 1YB1A 5KQPA 3KZOA 3NSDA 3D64A 5LXGH 1DYZA 3O1IC 1L1FA 4YFYA 4WJKB 3VYNA 3V6OA 1VOTA 4JFFA 1ADGA 1G2IA 1RZKC 4A38A 5DYTA 3MRPB 3COWA 1QHEA 3V9AA 2X5JO 2QRGA 3KLHD 4ES6A 1SO8A 2VSYA 1ZD8A 5GP1A 3T3GA 4EG3A 2BFEB 5B7GA 2YAEA 3MLWH 2AS0A 2IGLA 5EHZA 4W93A 3E27A 4II2A 2FE1A 4HJGA 1E2PA 3PR3A 1HG0A 2GN9A 1JWBB 3VR3A 5CUSL 3ZO9A 2H4JA 4IRJD 2NW2B 1X0XA 3QDGD 5AM5A 4KHXL 2ZIGA 4ZFOA 1RI2A 4RS4A 1LE9B 4JFED 4OXQA 1MCOH 3E2IA 4BQSA 4ZI5A 3ABGA 1G0OA 4CC4A 2X9XA 2HYDA 1QS0B 4Y6RA 1MFCH 3I28A 1XD0A 4ZMQA 4GDMA 4H18A 1FVCB 1G3UA 2FATL 3KM2A 3CFCL 1YNKL 1QK4A 3BGVA 1O6SA 4I9GA 1ZN9A 1DARA 2BT4A 3D3VE 2P35A 2LBPA 4XYMA 4U3JA 5C3UA 2XQBH 2G09A 2BGRA 2W42A 1H9VA 4M0LA 1CBJA 3H8SA 2IVZA 4HP8A 1J07A 2C5AA 1UPUA 4L5CA 2ZWOA 2BZSA 2HLAA 1A4IA 2UZ3A 1K8DA 3I01A 5I0VA 1NVMB 2BHYA 4XW2A 1VGQA 4F7TA 3VD9A 4Q9HA 4CL3A 4FMFA 2FQYA 5JD3A 5MEOB 3DZKA 1CO1A 3RNKB 1I7LA 3H2PA 1H6BA 4JDEA 2Y1XA 4BWWA 5KX5F 3KELA 4WNSA 4JFVA 2KB0A 2ZXWB 4HPOL 4K9OA 3K6SB 4M0EA 4DIBA 2IAMB 3F8WA 4E68A 3U7RA 3N43B 1RACA 1SHLA 3IWVA 3WNMA 1U6AH 3BKMH 2ZYWX 1J5EB 1WDMA 1TQ4A 9ABPA 3VDRA 5IZ7A 1KULA 2Q20A 3PUHA 4JMLA 5K0BA 5KN5A 4NJ9L 3VFPB 4Z3TA 3PQYA 2JKZA 1KGXA 4JOQA 5BRZD 3DE5X 3ZD9A 4BMNA 3MRLB 2IPMA 3BEVA 2NOAA 3CH7A 1ZVQA 2JCCE 1DJPA 4HETA 1HHKB 2XU9A 5E95A 1YBMA 2JLUA 1ITZA 4ENEC 2PX8A 3MM4A 2GHWB 3LZNA 3QXXA 3THML 4JKWA 2Z04A 3L5WA 4GW3A 2QHRL 1Q6ZA 5JOEA 4QOIA 2HRBA 4K6MA 2F54E 1M2FA 2AFIB 2CR0A 3MLRH 4IDCA 3VNQA 2XWEA 3ILHA 3JUYA 1RYBA 3DXAE 1H2ZA 1KP3A 4H25B 3JBG7 4KX7A 4BZYA 2X40A 4OD2B 1P9MA 1YJBA 3ZTWA 4ESHA 1LE5A 2E89A 2XSZD 1N9PA 4ZFQA 1QV7A 2X0FA 5DI8A 4N87A 2ERYA 3QKTA 4WCFB 1HXMA 4RJ2A 3ZQWA 4G0UA 1IHDA 4B4VA 3DEJA 3KQPA 5IKXA 3CPLB 1ZNXA 4HFWB 1ZK4A 3T4PA 2P47B 1A3RH 2HFGH 1TD1A 1FFNA 3F49S 2IEIA 1CUGA 1H1TA 4HK3J 1BDBA 1TOAA 1XXDC 4PV1C 4QQFA 5T7BA 1XJ0A 3RK4A 1M5RA 4GPVA 4U1MA 1NX6A 3OPYA 3KGTA 4U7HA 1NCWL 2Q7YB 5JHAA 5L6YH 3DBOB 3WK7A 5EJ7A 2G2RA 1YN7A 4TZ0A 1UJCA 3M3PA 1ZVSA 2KPNA 3HZVB 1X9GA 1ZV2A 5IROA 5ERYA 2BCMA 3A0RB 1IX2A 3EYAA 4BS9A 1LO2L 1KV3A 1H6UA 4TZKA 3ALPA 1KXTA 1PR1A 3M7OA 1LPOA 4FZEL 1G7HB 4EKYA 3Q3GB 4J1UB 1XJCA 4WVLA 2CNLA 3JZYA 5D1NA 4XKJA 4S0ZA 3DBLB 3BVNA 1WDTA 4C3OB 3T4XA 3SX4A 3MG9A 1V4NA 3BUYB 1JF8A 3ZLTA 1NUDA 1NP6A 5FUBA 3QFHA 4UBDC 3K96A 2YGOA 2Z9TA 4MZIA 5HM8A 2A9MH 3VA2C 2IKSA 2TMGA 4C4SA 2WR8A 2IH1B 1F90L 3RFCA 3V8NA 4K6HA 4OIBA 2OVBA 3E61A 1XRSB 1JSYA 5HHOA 2EX4A 4MROA 1VGKA 4GT7A 1FIGL 1AH1A 4J6RL 1FL6A 4QD2E 1J88A 1SBBA 4QBIA 2BW0A 4AUYA 4PJ9D 4FB4A 1DJOA 2VF2A 4UJ3A 3PFQA 4PI2A 3DB1A 4OQXA 1LNQA 3KFVA 4M4PA 1L3BA 1DFXA 4N0UE 3IVXA 5BWBA 4NJEA 5EYPB 2BKUA 3OTOB 5GRVK 1J42A 4A92A 4NO5A 3G2PA 1T2DA 3IBTA 2A5FA 4FINA 3S2AA 2QM7A 1LEIB 4YHYB 4IIDA 1QLRB 1YNLL 2R2HA 2QYSA 4DRZA 3TL3A 3D39E 4ZOEA 2VCEA 3P02A 4FP8L 1ZD3A 4K3JH 5SX4I 3QDJD 4XCFL 4Q01A 2G2PA 3QORB 3L6RA 1JKXA 1C1DB 3INGA 3ZTYA 1NGQH 4P23D 1OC2A 1E0AA 2WIIB 1OI2A 4KPHL 2V6IA 3V3KA 5B4MC 4X0EA 1E98A 2VP0A 3REVB 1LEKA 2XZQH 1E3EA 4Z86A 4DWWA 4X42A 1EVTC 1QE3A 1LH0A 5GGQH 3V7WA 3PBKA 1XAKA 3VMPA 1CPYA 3MN8A 5A2FA 5LYJB 5GS3A 2HTLD 2VHUA 4RHFA 4HOZA 4GUDA 1N5MA 3O47A 3WJAA 4U0RC 1H8HD 4L51A 4S2SA 4LBAA 3KWWB 4FT4A 2AD5A 2DV6A 4R4JA 13PKA 4N3BA 3PX7A 1QQDA 1BJ1H 2IBMA 4GKNA 4MLDA 4HH3C 3WGMA 2XWZA 3TW8A 5JD5A 4M55A 2LWIA 5B1SA 3S8FB 4LNVA 3H2ZA 4JUIA 2SNIE 1YEJH 3QQ9D 3QORA 1NA5A 2WP8J 3UICA 2J3IA 1GGCH 3B7SA 2CUTA 4AYGA 2ZRQA 1UWXK 2GERA 1NC2A 4XQ9A 4GMFA 4E41A 3K0SA 3DNKA 4MVJG 4BKSC 3FAXA 4KGLA 4QAWA 4NC0B 3GU3A 1WGVA 2AHOA 2VRAA 3S7GA 4ZXFA 3MVSA 4TUJB 1AV6A 4OQYA 3C6ZA 4F60A 1WWCA 2J33A 3GYBA 2FVYA 4RMNA 1MEOA 4G83A 1VSVA 3KLAB 1E7RA 1GUZA 4QO7A 3S5LA 4PWFA 1E1MA 1A25A 3G6WA 4KAQH 2V97A 4RETA 1IM5A 4ZV7A 4UUNA 4NECA 3TPFA 2FFRA 3HRIA 4B6ZA 4HZUA 4YMTA 2GGSA 1F4VA 5D1XD 2EL9A 4JX8A 1DPGA 3M0EA 3FT3B 4UINH 3RT1A 2GN4A 2F48A 3AVPA 4YDJA 5ILGA 4KNUA 3OJDB 4JCCA 1GZ6A 1WEHA 2XUFA 3H4IA 2P5UA 4WZ9A 1MJ8L 2W71A 2D1TA 1N2CB 1DQZA 2WQAA 1UXSA 3LH2L 1ZVSB 3GJ6A 4MQFA 2NP7A 1U36A 3LEYL 5AHRA 5GQSA 3V5DB 4OFIA 1A04A 4IDBA 3U7IA 5HDQA 2WY2D 3AHFA 4IIYA 2K70A 4CQJA 3BLPX 5AKYA 1NAIA 5JNLA 3D6MA 2YBRA 4WZBB 4CTJA 5I1JL 4WZ6A 4YV7A 1ACJA 4E2FA 3E03A 3BP4B 3H1BA 4B3CA 1K98A 2NY0D 4DCCA 1UXJA 1HQRA 2BJWA 5ERXA 3D9QX 3UXEA 5D6CB 2VUTA 2YV2A 3L0SA 1PFCA 5IFLA 1KYOK 4O2LA 4B4DA 4Q2ZA 2JJ1A 4N76A 3E9TA 1VFAB 3F12B 1F0PA 4R2XA 2AVDA 3S3SA 3ETCA 1T22B 3L1FA 4YQFA 1O95C 5KNCH 1SLXA 4DP0X 3M7IA 4MITA 4NCNA 4NESA 4LJSA 3D4LA 2HREA 2I9TB 3WJJA 2PH5A 2BOBB 3V0EA 1NNSA 5T3ZD 1BZ7B 2JBWA 2AXGB 3GMLB 3BREA 3SEAA 5B1IA 5KINB 1DQQA 4ZAVA 1TFPA 3PWPD 3EYOA 1WCIB 1IUKA 4F12A 2BP8B 2OJEA 4AW4A 3WX0A 1I3UA 5IROC 5BW6B 2EO1A 5LN1A 5JCOC 1W6LA 2J6IA 1ZGHA 4A9AA 3VXSD 4A2QA 1K86A 3A6DA 3EOBB 4RQBA 4YRBA 4GZ5A 2WQUA 1JB9A 3SCMA 1R3UA 4J07A 3QUHA 3H42H 4DKXA 5LDHA 5JDIC 3JV7A 1EI9A 4D7AA 3HFRA 2V8BA 3QPQC 4BSWB 1V25A 3NAGA 4YHIB 3BL6A 4U1LA 1DIHA 4ARZA 1MEXL 5FQOA 4WLUA 1WMBA 2WXHA 4HY3A 4BVHA 4BFOA 3PQYB 4U7GA 1BX1A 1XFAA 2ZJBA 1X0VA 1CQIA 4BBJA 4L0YA 4R6UA 2GAJA 2BFNA 1Z22A 4JJKA 3BMNB 1D2EA 1P4IH 3OF6D 3QDGE 1C1EL 5CVVA 1ZKMA 4Q4JB 1TYDE 1WBBA 3MRNB 4OZGB 4HDOB 4HHEA 4RVFA 4ZKDA 1NOJA 2ZTVA 4KL8S 4FFOA 3H6GA 3RADC 1FSZA 3OQPA 1N2BA 2O61A 3VX4A 2ZDGA 4TVBA 1II9A 3WNDA 5JVDB 1KELL 5KYUB 3SYPA 1MRDH 1T10A 4LGPB 1FDUA 1SCKA 3PUCA 4RVHA 1WICA 2OYCA 5KQGA 3UEOA 5FOSA 2P7TA 3WSVA 2QTRA 2LR4A 2ED8A 1FNLA 3H1GA 2CF6A 5BMOA 3ACCA 3NMUF 4UUJA 1FDRA 4YXLL 3B6MA 4X6FA 1G0DA 4ACAA 3RS9A 4G42A 4URTB 4E5SA 1TVKA 4NOKA 1QFYA 5L3VA 1QH1A 3N0TA 1KLGA 1I3NA 3OZEA 2GD1O 2NZ2A 3MJ8B 2C88A 1QH1B 1O7DE 4U7MA 3MTAA 5JJ5A 5BT9A 4L8DB 4YP9A 5LXTF 4CGUB 4UT7H 2AYXA 2BO0A 2OTUB 5HGHA 1OGTA 1QSVA 5ICZA 1TA0A 4WSOA 3QJHB 4DGQA 1OGPA 1C3LA 2P9FA 2A9RA 3MN1A 1HH9B 5HPMA 4RTQA 5LQUA 3DGFC 4PRZA 1OTUD 5IVZA 3SPCA 4JFDB 4PRDB 1HEJC 2XX1A 3C15C 4N48A 1JZHA 1NPUA 5E2TH 3QMVA 4PVCA 1TAGA 3TLRA 2I03A 3SBOA 3PUZA 1F58L 5BSFA 4MWFA 4W9KC 3GFUA 1DVQA 3NP3A 1GTRA 3BWXA 3W0WD 3VSVA 1PEWA 2RCSH 2GO7A 1JXMA 1PUXA 2R00A 4DC9A 1KLGB 2UWEB 1E4YA 1ACYH 5E03A 2PNJA 4TSRA 1IU1A 1HL9A 1FG2B 3STWA 3BMNA 2FQWA 3ETBF 5LVEA 1QEWA 3OY7A 2YQ4A 1KIAA 5JIPA 4HH9A 3ZQ4A 3V6BR 4HOMA 3FHOA 4B6GA 3QEGH 3IJEB 3L95B 3GFFA 2FV8A 2GM4A 1KCUL 1WSBA 4DMGA 3I42A 5MEPB 5HZHA 3DEIA 4Y4FA 1IHOA 4J43A 3MUJA 5HGBA 1OREA 2J09A 3GB9A 3LPAA 1DHTA 4MP3A 5EQFA 3IODA 4KKZA 5B57C 3GK8L 1DDHA 5KSVB 5HVHB 4R4FH 3WTCA 3ZOZA 1GKKA 4NAVA 4NYLB 5KZCD 2FWIA 2E6KA 3F6SA 3ZWCA 4X4XA 2R48A 4K9PA 4YBQC 1XGQB 1ORVA 3BD5A 5B3JA 1A8SA 4YN3A 1ZQ1A 1JG3A 5H4ZA 2CGZA 4JFEA 5EC2A 4GO1A 2DHEA 3W5UA 5FYKD 2UVDA 3QZBA 5JDCC 1GL6A 1P9RA 2EV9A 2V0GA 2AUTA 1MJUH 2E27L 1E6OL 4XWGH 2PTUA 2VNSA 2ILTA 2ZQZA 2EC9T 1RZ7L 2A9JA 3BIKA 3BUBA 3PC6A 1HG1A 3O6FB 3DJYA 1DMSA 2IADB 1LBTA 2AV7B 1A4AA 4HLZG 1JXQA 1ETB1 2J5RA 4X1OA 4PYNA 2WTNA 3E6HB 2RQEA 3KLDA 3TN0B 4ISCA 4R1SA 4PZZA 32C2B 4LDOB 4QRSA 1Z4MA 2VJBA 2OJEB 2VA9A 1O7VA 4X4YB 2GHZA 4EDWL 2JLQA 3I83A 1WAPA 3EXLA 1UMDA 3T6KA 1GTG1 3FOLB 1DHRA 5CINL 3P69A 4RNDB 5CJOL 2CEKA 4M1GL 3UYRL 4YAQB 1KVSA 3VNAA 1LPNA 5KU7A 2VAJA 4NS4A 1E4KA 1OTTC 4YDMA 3BZUA 1VIVA 2H4FA 3VGGA 4NI5A 1ZICA 3BGFB 1ZHFA 1W25A 4NXKA 2OPBA 5CJQL 3D2UA 3WL5A 1KAHA 5EMHA 3D9AH 1WP4A 3DTYA 2DQFB 2Y05A 3DT6A 1J49A 2BMKB 4EK9A 2YPKA 4GPAA 1BXRA 2GZDA 1SD1A 2BISA 2WKSA 3FJOA 2BELA 1JWAB 3HBQA 2V5YA 1N36B 3IQZA 4ESOA 5J40A 3J2PA 3UPRB 3WJLC 3IRCA 4AN4A 4W1PA 4OHCA 4HDCA 1MQKH 2UYLB 2E4ZA 4IIFA 5CP7B 3Q9PA 1IBRA 4KYVA 1T3GA 3CAFA 3GXTA 5BPFA 4NNPA 2OGWA 1Z6PA 3VXSA 1SHKA 4RZQA 4AG5A 5B7PA 1QLEB 2GM9A 2B3RA 5JWHA 1PD1A 5EB9A 2JEYA 4MVJI 2EW8A 5KWVA 3AOEC 3D09A 3O84A 3ZZMA 2IKQA 3V4SA 1DQLH 2WVTA 4CU2A 3KCPB 1WEKA 1ZCFA 4TTDD 4P99A 1G9SA 2BEWA 5MI0C 3K4PA 3LQ2A 5I4IA 4UHCA 4XH2B 2VK1A 5JCJA 1DJNA 1SOWA 3ET4A 2AJYL 4XPGL 3URMA 3FKSD 4M1ZA 4A66A 2GZSA 4M56A 1T03H 4IY1A 4RC9A 5EIBC 4KJPC 1IBSA 4NRXA 4BVAA 3QIUB 1SXZA 1R19A 5D1XB 1M4KA 2J5QA 4ND4A 1BXUA 1Z39A 3L7CA 4J4TA 4HWKA 1CRPA 3DEHA 2UY7A 5KJ4A 2VJ0A 4J9UE 1Y6MR 4UYPA 1JNJA 1LO0H 1P60A 2E3JA 4TXNA 3EOAB 3UTTE 1K7SN 3N8NA 3OZRA 4JYZA 2ZUQB 2PN5A 3EY9A 3EYSH 5E8PA 3GXBA 2LE9A 4JCWA 1KAMA 1XALA 5JC1A 5GGSA 3L0YA 4HH1A 3LUDA 1RQNA 3HC2A 4X9GA 1ADYA 4MRMB 4EUEA 4NIKB 4Q6IC 3C98A 1I7SB 4XNUH 4JUCA 4CHGA 1FCCA 3RNOA 4J0EA 1IATA 4KO6A 1V3VA 5HI5D 5IB1B 3AWEA 1DC7A 2AWNA 1DLIA 3L93A 3V8PA 1EJOH 1THGA 3IPLA 1IB5A 2ZVPX 5E6SA 2A4MA 4CL7A 4KQMA 3TD6A 3AWIA 1GT91 3FMVA 3BVPA 2ED9A 4EA9A 3EJTA 5JXEA 3VU2A 1OBHA 2VN8A 4IHJA 5J47A 2YHIA 4ANWA 4LZPA 1U0TA 2G71A 4R96A 4V0QA 5FBVB 3W38A 3VH8A 1CJVC 4YQEA 2C2HA 4M7LH 3UF0A 1CLZH 4JMXA 5L4IA 3T08A 1GQSA 4G23A 3ZH9B 1FGNH 3QO0B 5B3NA 3U5TA 3AVXA 4AN1A 3EDKA 3RIAF 2EIXA 2WZBA 4G0PA 1EAQA 5GJTL 4LCWB 4UQIM 2VPIA 4F3FB 1IHXA 2XCIA 1ZP6A 4J0GA 4NJOA 1CE1H 3EDFA 4DUGD 4L9WA 3C8MA 3MRDB 5E8JA 2EQBA 3IPRA 221PA 4XVHA 3Q7JA 1FNHA 3Q3GA 2W9EL 4Y9EA 4GSRA 4FHGA 2R6DA 1XTBA 3HCBA 2OFWA 3RABA 2NY0B 2ZYDA 4A1FA 3Q87B 4P8RA 3A6FA 1RU9L 3CE6A 4BVLA 2IH1A 3KVRA 2DMKA 5C0EA 5IJVB 2BS71 1HZZC 5IDXA 4N41A 4IKJA 4IDAA 3GO4A 3BFWA 1X77A 4KV7A 4JHWH 1RPNA 3GI9L 2OUIA 1IN1A 4ZWNA 4HU2A 2N7BA 4R2WA 3NJHA 1MB4A 3K9BA 5I9TA 4O4YL 1A7RL 3KM0A 4EB3A 3P54A 4BUGA 3BJEA 1PMYA 4FKHA 5AOJA 1ABEA 1X1EA 4J7XA 3Q9UA 3D85A 2PUQT 1FXWF 1J5OH 1WF6A 1UBEA 1AD9A 3FQTA 3LEVL 5J5AA 1C8LA 4ES9A 3PNWA 1G1OA 1V3KA 5AW9A 4PM1A 3ZCPA 4J5VA 1M7DA 2JELH 4IIZA 3T09A 3WNPA 1K08A 2P24B 2VAAB 4RZ3A 1YYMH 4YJ2A 4CBPA 2ZXEB 2R65A 3WP1B 4WXEA 1UC9A 5C6WH 3L1OH 4XPAH 4M89A 4WDRA 1RKRA 4PINA 4IGBA 3T5PA 4JO3L 2JGMA 2GAIA 3LKVA 1QTYT 5I76A 2QZQA 2HPOA 2VLKE 3CVJA 1BZ7A 4ZX3A 3TMKA 2PYDA 3DOSA 4B34A 5AIBA 3UOAB 3IE2A 3QNYA 3NA9L 4ZV9A 2HF8A 3KBBA 1J70A 1XGTB 3R3SA 3CK0H 1U8KA 3ESXA 3MRLA 5D7NA 1M7IA 3DG9A 5TXGA 3GJFH 1ZIPA 1WW8A 4MCAA 5AVJA 3GFRA 3HSSA 1BAFL 1WZKA 3V2HA 2WTPA 2XRAH 5CJXA 2MYPA 2ZIEA 5EWIL 4K7FA 2DQGH 4LCYB 2OLJA 1JR3D 1IAII 2YRXA 2JB9A 3ALXA 2EL7A 5DK0B 2IUFA 5FHAH 3OIUA 1HS6A 3WLSA 3GJ7A 5DEGB 2A67A 3O91A 3CXHJ 4Y2DB 3CZMA 4MJIE 1X1DA 1AN9A 3NORA 1E6MA 1WG3A 2B83A 2OUKA 1XRPA 2QQNH 2Y1FA 4WLFA 5H16A 2CMRH 3GLVA 3EXIB 3ISVA 3DX1A 5I71B 3L0DA 5IYZA 5G1OA 1PTJA 2O6LA 1G7IB 2VDLH 4ER0A 5AJVB 3V4LA 2W6ID 4PG4A 1WUTA 2CKBH 4ZDKA 3I6KA 3M33A 1U65A 4OSUH 2ZS8A 4JPKL 1ITCA 2OHOA 5D1ZB 4DZBA 1HMYA 2E49A 3LQ4A 2D7NA 2WOYA 2E74C 3BN3B 1SCIA 4LJRA 5DYWA 4ABWA 4B3EA 1S7QA 3B83A 4HRVA 1BD2E 1WCBA 1VCMA 3WICA 4CKXA 4LKCB 2B35A 5C0AA 5IG7A 1FJ1A 3VGDA 4FJYA 5BQPA 3Q2NA 2YXDA 3C6LB 3TCTA 4F3NA 5C1OA 2AJLI 1SG9A 1W0JD 1CB0A 1SGWA 1IN5A 3MRGA 1JF1B 4K3EL 4MV6A 1ZT4A 2UXCB 3BHMA 4G59C 3ZGYA 5HHMD 1I01A 3V5KB 2V6JA 2DJUA 4ZQFA 4XB2A 4R7LA 1DXYA 5G0SA 2DBZA