3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
4PN7A 2VDRB 3T3MB 1N3YA 1MJNA 1U8CB 1JEYB 1U0NA 1RTKA 2I6QA 3K71A 1UEXC 3NVQA 4HQOA 3PPWA 1SSLA 4IHKA 1MQ8B 3ZDXB 3K71B 3TW0A 3OL2A 5HGJA 1FNSA 4G1MB 4O02B 1CK4A 1OAKA 1QC5A 1RD4A 3EGXA 5KYWA 3EOAI 3NIFB 1XDDA 4CN8A 2VDOB 1JEQB 3V4PB 4WJKB 3OKYB 4UM9D 2B2XA 1M10A 4NEHB 3IJEA 3ZE1B 1AOXA 1LFAA 2VDMB 1ATZA 1M2VB 4JX0A 2UZYB 3EH1A 1M1XB 3BQMB 3EFOB 3ZQKA 3K72A 2NUTA 1N9ZA 4F1KA 1JV2A 5LN1A 5ES4B 3FCUB 3F78A 2I6SA 4Z7OB 1NA5A 5HJ2A 4XW2A 4IXDA 3EGDA 4BJ3A 5KYYB 1BHO1 1IJKA 4G1EA 5KYUA 1T0PA 1SHUX 3Q3GE 2IUEA 2VDKB 3T3PB 3OKWA 2M32A 1IJBA 1SHYB 4O3TB 3NIGB 3VI4B 4C29A 4HQLA 1ZONA 4MMYA 2VDPB 5HDBB 3FCSA 4FX5A 5KYNA 3ZDYB 3OL2B 4WK0B 1RRKA 1T6BY 3EGXB 1PT6A 1QC5B 3QA3E 4CN9A 4WK4B 1QCYA 4DMUB 5KYWB 4MMXA 2WW8A 4GZ8A 4FWWA 4WK2B 1XUOA 2VDLB 3AFCA 3TCXB 2P28A 3EG9A 4CNBA 5KYXA 4F1JA 1YUKA 1PD0A 3EH2A 1Q0PA 3TXAA 4HQNA 1OLZA 3IJEB 1SHTX 3K6SA 2P26A 5E6UA 1RS0A 3EOBI 4UM9B 3K72B 4MMZA 2NUTB 3PPYA 1JV2B 1MQAA 3AL8A 3PPXA 2NUPA 4HQKA 4Z7QB 5E6RA 3EGDB 5E6SA 3ZE2B 2XWBF 1IDN1 4G1EB 3VI3B 2XWJI 1MQ9A 5KYUB 3IBSA 2I91A 1YVPA 3F74A 3NIDB 3HI6A 2WINI 3HXQA 2VDNB 2QTVA 3GXBA 3HXOA 4NENA 2ODPA 4MMYB 2XGGA 1L5GA 1PCXA 3FCSB 3BN3A 4C2AA 1FE8A 1DGQA 4WFQA 1JEYA 1U8CA 3BQNB 4MMXB 1ZOOA 5KYXB 4IGIA 3RAGA 3EG9B 2NVOA 1IDOA 2X5NA 1M1UA 5E6UB 4G1MA 4O02A 3K6SB 1SQ0A 2ICAA 1V7PC 3E2MA 1U0OC 4JDUA 1JEQA 1MHPA 1BHQ1 2ODQA 4MMZB 4HQFA 3M6FA 4A0QA 2ADFA 3AL8B 5BV8A 3ZE0B 3AL9A 1CQPA 2NUPB 1MF7A 5E6RB 3TVYA 5E6SB 1PD1A 2O7NA 3PPVA 4Z7NB 4UM8B 1XDGA 1ZOPA 1AUQA 1AO3A 1M2VA 1M1XA 4M76B 1DZIA 3EFOA 4C2BA 4O3UB 1JLMA 1YVRA 3ZDZB 1TYEB 2VDQB 4K3JB 4NENB 5KYYA 1L5GB 1M2OA 3N2NA 3V4VB 2VC2B
chains in the Genus database with same CATH superfamily
2VTKA 1JVSA 4JP3A 4JLVA 2VRAA 4OLYL 2W4QA 4WHYH 1GW0A 5TH2A 2C83A 1X4YA 2EX0A 3KVRA 5CXPA 1XLVA 3LXXA 3LPOA 3TBVA 2Y5QA 4RGNE 1X7XB 4NO5B 1CS0B 4KMMA 4S1RL 2N4IA 2I85A 1NI5A 5ICZA 1NQTA 1PVOA 4HOZA 3WFCH 3D8TA 4MYSA 5TLSA 1IC7L 3EGDA 1UVQA 2WUBH 5CBPA 6YASA 1H3EA 3IS1X 3I2JA 3U4MA 1NP7A 2OK8A 4L1DA 3REFA 5G0UA 2OBBA 5LZ8A 4A37A 4A2HA 2G7ZA 4QTFA 3AP3A 3PK0A 1UT5A 5EESA 2QW8A 2LFEA 2YS4A 4U4AA 2VK4A 1YNKL 2IYQA 1E6CA 3I0NA 3IEKA 1TYJA 2YC2C 3GRAA 1G6OA 5D2LE 4TXNA 1E9PB 2A4ZA 5HX7A 2OSLB 1Z3GL 1TTRA 4AQ1A 1KG0A 1TQSA 5CIQA 4EY5A 2HEIA 5E95A 4GKZB 3NWJA 3ZBQA 4PZCA 1JXKA 2DT8A 1NFKA 1ESOA 4W6WB 3RPIB 3ONDA 1ESNA 1PHRA 3IPAA 4EHFA 4AITA 4RQUA 2R1XA 4R7GA 2V2WB 2MHAB 2VL5B 3IULA 3CU5A 1QTIA 2P47B 1FP4A 3WIIH 3VGHA 4TQIA 5SX4H 2XQJA 3TNLA 3DX3A 4XODA 3U4BL 4AF6A 4OIIL 1PTZA 5JASA 4OF4A 2JFOA 4XB8A 4H6WA 5HJ7A 3UUEA 3QQDA 3ESBA 4MZIA 1XCWA 4PB9L 1WPRA 2LGNA 3MUHL 3T4AA 2E48A 2F2TA 3HUJE 3E58A 4OD2A 2A9PA 3VFWA 1N5AA 4I14A 1PNQA 1DIRA 5IM4A 5IF0B 1K8YB 1X8XA 1FNGA 2XSZA 1FNNA 1WSDA 1XXDC 2Y2VA 2EUZA 4HAKA 4A3SA 5LO7A 2JKWA 4GBXB 2ZJ4A 1YRKA 2EACA 1ZHOA 5AJUA 1AJ7L 1C2TA 1T2UA 3FPBA 1T5LA 2H1RA 3RF6A 4Y1RB 1KAOA 3R9WA 4YJGA 1MVUA 3JWHA 5FK9B 2PYIA 1FQOA 1G9HA 1YCDA 1L9TA 3OEYA 3MD9A 4C7BA 4N0UB 2P7HA 2FUNB 4NT6A 5KANG 4FLSA 2HBQA 5B4TA 4XTRA 4PJXE 3C6KA 3JARA 1WCWA 1F6AB 2YQ2A 5IFKA 3RGBA 3P4UA 2AXPA 5EUOF 4CV3A 3EXEA 1PZXA 4LXQA 1X0VA 3LD8C 2XTAA 2AJVL 2BZDA 3CIOA 1GKLA 2PGLA 4WW2B 4G1MA 1ZC3A 3UMSA 1Q7EA 3AY0A 3GT3A 2Z31B 5KBDA 4JUIA 3H5LA 4CBZA 4OATA 4XJSA 2OX5B 4G6ML 1NVAA 1CFVL 2WLSA 3UUWA 2A7BA 4AKIA 3MJCA 2R9HD 1UXSB 2O4EA 5F52A 3U0TB 1E2DA 3S96A 2XCSB 2BZCA 2V1XA 2EL7A 3EQ8A 4YK7A 2XXJA 5CCJA 4O59O 1ODFA 3KSAC 5AQ0A 2GBFA 1B0ZA 2P6RA 2NDGA 2YGPA 2R6AA 3H9SA 3EY4A 4IF6A 4OUOA 1ZKAA 2B20A 4K9JA 3V6ZA 4IDGA 3N0AA 2XMZA 1G0DA 4FCHA 1ZA1A 3VGAB 4R8MA 4H20L 1RWOA 4I5IA 3U5ZB 2QVIA 1LDGA 2RK6A 1JK8B 3ET9F 2P5EA 4D0RA 3LDBB 4PJHE 2TMKA 2RJNA 5I1HH 3ZDDA 1WCIB 2ENYA 4OBBA 1RP1A 5C6PB 1X77A 4D0SA 5E7MA 5JNRA 1NKSA 4GAJH 3LCYA 3TAHA 2FTKE 4WI5A 1NCAH 2EIZB 1JG3A 2AJUL 4L4VB 5EAIA 2F68X 4UQ9A 1QP8A 3OPXA 3N0RA 4RBPH 2XF2A 4JVSB 2QQKH 1Q94B 4LQ4A 3H9YA 4MHTA 3CNEA 4Z23A 4Z3HA 3MAGA 3QEQB 1EV2E 3KSUA 3KL2A 4J76A 2YUWA 4FYTA 3BWBA 3HM2A 2QMUA 2IOYA 1PJSA 3FFXA 1KJ2B 1IC4L 4RTRA 2YJNA 4NQCA 2I6XA 3GEPA 5A7FA 1CICA 4PJFA 3D3QA 4JHVA 1DIOB 1W4RA 4O2AA 1YE5A 5EC1B 3J27A 2UZIR 4NFYA 3OC8A 4YBLB 2IYPA 1WEHA 3AGVA 1QAOA 5AYVA 1AUPA 5KSOA 2WG2A 4OB6A 4XPTL 4UTXA 1BD2A 3E0QA 4R1PA 1GZHB 4I3RH 3H2PA 5I1JL 1N6NA 3V0FA 2X22A 4UFPA 2BSEA 3FUJA 3LCCA 2EE3A 5FBZA 1XF4B 4PJ7B 4GYJA 5CM9C 1VLHA 2KZ1B 2JWYA 2DLIA 1KSFX 2JXMB 4LNHA 3WGNA 3HY3A 3G3EA 4L05A 3UBHA 1O94C 1FL3A 4KWEA 4D9QE 4RORA 3UK7A 1KFCB 1COZA 1DTWB 4HDIA 3QLUA 3SHOA 3GBMH 1JDNA 2C1PB 4R9RA 4JZJB 3SSNA 1M54A 4M38A 2Z9DA 1NEZB 4YBQD 4P2RD 3L8FA 4C0AC 4JUCA 4OPMA 5I8KH 3L5XH 3PFWO 3GWJA 4BCYA 1FXWF 4JLDA 1P2VA 3LKNB 2NYAA 1IGIL 2QG6A 4I3HA 2ICWJ 2HCTA 3UQYS 1HN1A 4IRZH 2PLWA 1UM4H 5LZ7A 4U00A 1LWJA 1N5YH 3U36B 3H53A 1LTHR 4BAGA 1TLLA 1WAAA 2CDCA 4RZ3A 4ENSA 3TTWA 1JZFA 1DAMA 3AJ7A 4CHGA 2CMRH 5H59A 2QL7A 3GIWA 4HRXA 1LJLA 3AR2A 2NYZA 1U3UA 3CF4G 3MWDA 4BQPA 3MYRA 4S1WA 2PR4L 1F02I 3GZTB 1M9NA 4ONHB 1YA4A 2SEBB 1ZVMA 4G70B 3SE8H 1NWOA 4PS4H 3PHJA 4HCGA 5LCVL 4NJEA 3HE7B 1O5DT 2R0WL 4NI6A 2ZXGA 3POCA 2I2AA 4XP9H 2QLYA 2QV4A 3JWDL 4U3SA 4U7GA 2Q5QA 4OT1L 1L8QA 4UU1A 1X9IA 4Z95L 3E7FA 5KDLA 2HGZA 4X97A 3H9EO 3EQ2A 1X9UA 3X11B 1BQRA 2C1XA 5TF4A 1TJYA 3ZKND 5LJLA 1KT2A 3KALA 1D9KA 4ODSH 3RU9A 3DFKA 2YAPA 5C0JA 1KJNA 1BEZA 4M8UA 3DOSB 2G80A 4EJ0A 5IDYA 3T7SA 3E6HB 2JA1A 1PI3A 1Q0XL 1UD4A 4C56B 3Q8XB 4IKKA 3IB4A 1MAML 1JHZA 5K59F 4NS1A 3CSSA 4P5DA 3TRHA 5E1DA 2O7NA 1ZSYA 2UKDA 4FG2A 4MAAA 1H2YA 2K6ZA 4I5GA 1R24A 1ZLUH 2O61B 3VXSD 3NCCB 3QPAA 4OZFG 2A57A 3D7MA 1LSSA 1KIQA 2YOGA 1UMBA 2H6OA 4V0SA 4U2BA 3M1BA 3ZWBA 2IHYA 3TA3B 4BEJA 1NBVH 3GD7A 3CNLA 1PW3A 3U81A 4LE8A 4PSRA 3OO1A 3I37X 4MJ6B 2JAQA 2ENJA 1YKSA 1SIBE 2XFXB 1LPAB 4NAJA 4AX3A 1H9DA 2IYEA 3VWKC 4RMGA 4ETIA 1K06A 3NJIA 3O2NA 2AVFA 5DYNA 3GKWH 1CQKA 1FFNA 3TU6A 3DBOB 2CDRA 3D33A 1NBWB 5DEFA 4Q66C 5DT1H 3GMSA 3R41A 3NZSA 1BU5A 3CZQA 1IATA 4W9FC 3CFBB 3EDCA 4NJAL 2P5WA 5HUQA 1TM1E 2JEYA 1WOMA 5DU7A 4Z7NE 3KWJA 4TTDC 4K9KA 1XMOB 1GL3A 1R46A 3ZCQA 5E1BA 3V95A 1JALA 1L5KA 1JE6A 1P1CA 2H1PH 3TV3L 1VI5A 2H1HA 4BUCA 1L3WA 3KR9A 1ZI6A 4NRZB 4N2IA 2QW0X 1LPPA 2JI9A 2HA6A 3FCTA 3GLGA 4XP5L 1ZA2A 1WD9A 5DBGA 2E75C 2YPLB 3CFIC 1FSKB 4TMPA 4LHSA 3U4HA 1PDKB 3CH1B 1RUKH 1BZOA 1QRUA 4PAOA 1ADQA 3BD3A 4XXWC 1MW1A 1GPAA 2IITA 4UANA 3TPKA 5TX7A 2BNQB 2D0OB 4J8PA 3FSEA 2R0ZL 4LHZA 3VYSB 1GZ5A 1U58B 3VXMB 5TB5A 1I3MA 3ZHNA 4K3UA 4OQQA 1ND5A 3KEFA 4QHPA 3NCBB 4X6DE 3VTAA 4V0NA 1FRQA 4UXJA 2LE0A 2UWEB 5JCZA 4G43A 3TEXA 3LLSA 3U49A 3QV1A 2ADMA 5TQ0H 4CMHA 1QWOA 2C99A 3PPSA 1MN6A 1ZVSA 1QI3A 5C09D 4Z86A 3AQXA 2AC4A 5A5DA 1TZGH 1GOTA 1O08A 4KDRA 3KKQA 1EGQA 2L18A 3A2KA 1NDTA 2XV3A 1VG9B 4IY1A 4BFVA 4OP3A 2J21A 5GS0D 3T6ZA 4HEA6 4DHWA 4WEQA 1DLFL 3BKXA 1EFAA 1VP3A 5ACZA 3D52A 3SJAA 1P9MC 1PR6A 2GPAA 4GI7A 2PX2A 1INLA 2I91A 4HDAA 4GL2A 4AN4A 3UMCA 4POOA 1T2QH 1OKKD 3DX7A 4PY7B 4AJ1A 4YXWA 3TW8B 4EI5D 4NC2B 3UWSA 2AK4A 2BZ0A 1YI1A 1QV6A 3CZMA 3RH0A 3B6SA 3VH8A 5F9MA 1U3GA 3U4GA 2X4IA 1GGCH 2AYXA 4HAWA 4EUFA 3TPCA 3QIUC 5JNWA 3DX6B 2D59A 2B2XA 3KXFD 2PXYC 1HT0A 3JASB 3AF4A 4BASA 4JKMA 2K8MA 1WP9A 2G9ZA 4WFHD 1NCDL 4WADA 4RJTA 3LPFA 5DI9A 5D1HA 2OA0A 4UDUB 2X2EA 5JWRA 5FYJH 4XCCH 4TL7A 2D3LA 1FYDA 4W4TA 3U37A 4LHUB 2XG5A 3Q9NA 1JTOA 3TL2A 1AM4D 4EAEA 3SBEA 5LBVA 3KL4A 3CMOH 4MVJM 5ADHA 3MB8A 2V54A 3CVVA 5LCVA 3T3NA 2ZSWA 3T2OA 2YUZA 3F4BA 3EJTA 3RJOA 4QQKA 5KTEL 4C0QC 3AT0A 3PCYA 1WXXA 2C4MA 1T0MA 4KYTA 4N0YH 3MACH 3NHYA 1SDYA 3E1SA 1NBCA 2QX7A 1Q90A 4RKFA 5LUMA 6REQB 3D6VA 1M1ZA 3ZJ4A 4YL4A 5DK6A 2NTFA 3RWHA 3V55A 3Q6FB 1X3SA 4K8RH 4IV5A 3VYWA 4P4RB 2JZOA 1YZFA 3RS9A 2WQXA 1UDWA 4FQXC 3TMKA 5TF1L 2RHMA 1BSIA 5HW0A 5FS5A 1J49A 3I3SR 5JS8A 3EJ6A 5LBUA 4UCFA 1U8KA 2BGKA 2R751 3B8HA 4LL1A 5U4QA 3PD1A 1ZU5A 1N2CE 4UOEA 1HQCA 1WQ1R 2Q6IA 4GW5B 4M76B 2FEXA 1JG2A 1GKUB 3W9UA 5IUCA 3JBG7 4DJJA 3LBNA 2AV1A 3DUSB 4BV9A 1WHSB 5KJ6A 1KSGA 4Y2UA 4EG3A 3G5MA 4QHSA 2PGJA 3SVZA 1QD0A 4RE5A 4CTJA 1Z33A 4P2AA 2HX9A 4IIQA 2OZKA 2PPAA 3S98A 1D5WA 4B76A 1PX4A 2BOCA 4L7VA 5D3MB 1YZUA 4PWIA 3IQEA 1SZPA 4I6EA 4BZWA 5HJ3A 4GOOD 3TS1A 3DGGA 4S1DC 1NA5A 2PRYA 1AHWA 1OHZA 3VSEA 4AYGA 5EWLB 3F7QA 3G7TA 4MJ2A 4G01B 3F90A 1SJEA 1DFGA 3IP8A 5I1DA 5AQ1A 4FQ7A 4PYGA 4GS5A 1YN7A 2VJXA 2DWSA 1WO8A 1IXSB 1FUKA 1H1LA 2NLJA 2GJ6D 3O38A 3FQNA 5LWYH 5D55A 3ZE2E 4NO3A 5J0BA 2HBRA 5THXA 5GRUL 1GUDA 3T4PA 2AABH 4B7XA 5AXDA 2AFNA 4PC2A 3K6KA 3OZEA 4QF1A 1AZZC 3FI0A 4OCXH 5DJYB 2BSAA 2AW3A 3RU3A 2XIQA 4B6PA 2YSTA 1N7ML 2AI1A 3BPNB 1VFAB 2QRQA 3CZRA 2AZTA 3V0IA 4BJ6A 5CGBA 1EJOL 1UATA 2VXBA 4PJAF 2GARA 3LNEA 3OOHA 3T7AA 4P4KA 1KZ1A 1CU1A 2HUEA 5AM2A 2G3XA 5GIRB 3RL2A 1X3DA 1KVRA 2N7BA 2AQ1A 3KDAA 2WLTA 1CO1A 3KQPA 3GLHE 2E4XA 4KQIA 4PUBL 3AEUB 5BXQC 1H1DA 4P3YA 4QOKD 1ILUA 2H6PB 2C9OA 4K71C 1J7VR 3VFRA 3GD1C 4KEAA 2J08A 3V4PH 4NWIA 3KPTA 4A7GA 5SYAA 4ELMB 1BMTA 3LN4B 3LGAA 1V11B 3OSUA 3OKOA 5IJXA 5C9ZA 1RHHA 4M3JA 2QTGA 2W6ZA 3WXVL 1X7QB 1FNHA 4MUAA 2QBYA 1AQLA 2LAAA 3L1HA 4XNZC 4L4TE 1T8SA 4MI9A 2EDHA 1XCOA 1JTVA 1PDWA 2HVKA 5EJ4A 2FGWH 4J3OD 3IVXA 1UP4A 1BOFA 4WLOA 2I9TA 4W5WA 2FFAA 2HM7A 3UIEA 2IV2X 1RXLA 5BS0D 4RHCA 1QE5A 3EPPA 1EXGA 1WXQA 1F4WH 3QZOA 2BKAA 2F59A 1IKFH 2GN0A 2PXHA 2HLFC 2WTXA 4KWIA 5C2BH 4DKFH 4OZFB 4PSPA 4MITA 4LDAA 3WLQA 4OF8A 3P4NA 1FY2A 5BNFA 3IXTA 1WHTA 1AZRA 3HG1A 3IDZA 1GTMA 5IQLA 2FAUA 2ICEA 4QYMA 1UJ3B 1NGWB 3VR5D 3BD5A 1P0IA 2R00C 2DAVA 4LRUA 5JJLA 5IQ9A 3SKOB 3CW8X 5HSFA 1M83A 3S2UA 5T33H 3TFQA 2YDYA 2PU5A 1WBDA 3ZGYA 2Y1WA 3OE7A 3KPSB 3I9V6 1M34B 2IPKA 3ZRSA 4PTTB 3BLKA 3MSXA 4ZZ2A 1U7WA 3SEPA 3SEQA 1UBUS 1IAII 3I9JA 4O0MA 3JT2A 4FZRA 4ZUSB 1XMIA 3KCPB 3HJTA 1R0XA 1EWRA 2FQQA 3R6WA 1EDYA 2PWFA 5D3QA 1NCTA 4UMFA 2BN4A 3HPLA 2XWTA 1IFGA 1Q1NA 5FTNA 1QFSA 2FK8A 4K9OA 3QK7A 4BJ3A 1MDFA 4S0ZA 4QDOA 1KI7A 4N2NA 2O5XH 3NVMB 4GG6B 1KBGL 1A4RA 3H8SA 4NO0B 1QUNB 3ZX1A 2A6IB 3BAZA 4CMEA 1Y5MA 1X5MA 2QM0A 4FLOA 2FO4B 3DEHA 2P40A 1SU8A 1TCUA 2VERN 4R5XA 4ZJZA 1FP5A 4LHEA 2O30A 3OZAA 4KTEH 1RNLA 2H8GA 4MD5A 1MLDA 1VDGA 5I5MA 4U3JA 4BNJA 1FBNA 2XIDA 1HOEA 3V0WL 2TECE 1X39A 3GELA 2TSYB 1SG6A 3IIEA 2QPDB 1RZ7H 2OMYA 2VLKE 5KINB 4JRXB 3E9CA 5KVDE 3HG0A 5D6DC 2X1WL 3DZHA 3T8YA 4PX3A 1ES0B 2NO0A 3IDMB 1JPFA 3ZWCA 4JDUA 3IDNA 4YDVA 4WY7L 3TZVD 5DFWH 5C3TA 4YZWA 1ZGLB 3GB9A 5LOVA 3ODPA 3V0VB 3H1TA 3RYFA 5J4LA 2NNWB 4L07A 5JUEH 4KKBC 4BRUA 3OR7B 4K6FA 4BWFB 4JLBA 1R0AL 1P6WA 3C4QA 3E7DA 5KS9E 4X4XA 3T3DA 4K73A 4J4TA 1D9XA 5DD5H 3BGDA 2GLXA 5F33A 1YDPA 1FDWA 3VFSB 4Z7AA 5A1TA 2HLAA 5EU7E 4ZUTA 1CQXA 5ERGB 1BZQK 5BP7A 1FU8A 3NWOA 4LT7A 4CHTA 1Q1QA 1L4YA 4UIKL 1AP2B 2FPXA 2ORIA 1G6Q1 1RZ3A 1ACCA 3UFIA 3B70A 1K8DB 3IBEA 4MNQE 1KVQA 4KO7A 2J6BA 1SFHA 1H85A 4X20B 3TLJA 1A14L 2O7RA 4OFWA 1CNFA 2GRUA 4ACTA 3M8OL 5KVSA 4AQAB 4X4YB 5AD0B 2FT6A 2H65A 2IWFA 3SHVA 4YMPA 4HUVB 2GJ9A 1KEVA 3T52A 4F8TA 3RVWC 4PYLA 2ZLBA 4X6EA 5CP7A 4EAQA 1SQMA 3NYRA 1Z5YD 4OFYD 2D7TL 3PGXA 3VJMA 1TVBA 4BO6A 3CKLA 4I9GA 1XTSA 2JGKA 3BN3A 2Q5EA 2BGWA 3VRIA 1BMFA 5A2AA 3IE0A 2FI1A 3QXHA 5EYPA 2AJ8A 3DXAB 2P9ZA 4EKYA 1HNZB 3ATBA 1AYOA 1VHWA 3BCSA 3PNWA 4IOSD 4BN4A 1U2ZA 5KTKA 4YI3A 1N7GA 3H4MA 3GDCA 1V4NA 3RA7L 1JEDA 32C2A 4L5FH 4EHDA 2XPGB 3JWNE 5G1PA 3P4XA 1SHMA 1A6ZB 4CG3A 1XPOA 2DETA 1SHSA 4OP1A 5TGDA 3H9ZA 4MR8B 1NAMH 3GGWB 4FHCA 4BNXA 1YNTA 4XVJH 1ODIA 3K3PA 4YFLI 3W3AA 1LS6A 2BIMA 3QDHA 1NMCB 3IGAA 1BDJA 1MAVA 5FA3B 3V4OA 2CO6A 2B4CC 2FZVA 4QTUB 5SWZE 4OIAA 2ONCA 4LYYA 3EG5A 3HNOA 1NKTA 2V0NA 2X4QA 3GEBA 1G8MA 4IFBA 3L7FB 4HNAB 1KPGA 2HFEA 4GNKA 2QMKA 4DMKA 4KRYA 1MF2L 1TK3A 2DQIL 3P9IA 3CLRC 1LPOA 3TR0A 4KTTE 2IGFH 5E2WL 5JIDA 4Z7NF 4DTGH 1EP1B 3S4SG 4I6JA 3TZ6A 4DRZA 5F7KC 3HC2A 3FKJA 1D6SA 1D7OA 4X5XA 3R8BB 1RCUA 4J3XA 2LRHA 4L8LA 3HKDA 3II3A 3KVPA 4PGDA 3MMEA 2CUIA 3ZKQD 2N0SA 4OCYL 2EXYC 2D03L 4TPRH 1QM5A 1KAEA 4RK4A 2JPDA 1CUJA 1K2WA 3CX4A 2IFGA 5F9AC 2ILTA 4C5AA 4MUBA 4CSTA 3EQZA 3P0HA 5KSWB 2BFOA 3HWSA 5JY1A 3S2FA 2GJRA 1Q17A 4KHTH 2IYUA 2QP3A 3TESA 3KPRD 1Z4MA 2H4YA 4W9NC 3NZ8A 3QOXA 1NLZA 3GJFK 3ORRA 1S9WA 4G6AC 5I6PA 5DMKB 1ULZA 1KY2A 2XXGA 5DEIA 2WVTA 2R0LH 3AFIA 1KCSH 3GMNA 2FN4A 3NACL 4PG2A 1CK0H 2B35A 1YZKA 1YEJH 3QULA 4RSRA 2ID9A 2BMKB 2OKCA 3LT4A 1YC7A 3PWSA 4XBPB 4PJEB 2FPGB 2H5IA 3IP1A 2H45A 5A4KA 2Y1FA 2PUCA 5DRTA 3B9KA 1CR0A 3U3XA 1E7YA 3VX3A 4PSUA 2FSSA 4Q21A 2P7TB 2ZYUX 5FB3A 5HHME 3RKSA 3ASZA 3EFBA 3G17A 3IIIA 5A9SA 1I0ZA 1IGTA 1RFDL 1IAQA 3VR4H 2GKIA 4EZKA 4LPYA 1MY5A 4QHUA 4FOOA 2Z31D 1N6KA 2QN7A 4U1GB 3NEYA 3OPNA 1P5VA 1M76A 5DNEA 3FWNA 3ELDA 2XVKA 1L5HB 2O6PA 4PHTA 3C8KA 3I1FA 1MQSA 4KDEA 2IL1A 1OLLA 2VJQA 3BFWA 4Q6IA 3QPUA 4BQRA 3L0DA 5F7EH 2BSSA 4A7PA 5AW1B 1FO0L 5TJWK 4I9FA 1JYFA 5GGSB 3E9RA 4LLDA 4Z7IA 1FP7A 1ZK5A 1GAWA 3Q41A 2MOQA 3KPPA 4FLEA 5A4DA 2J7LA 3H2IA 2GEKA 3MXWL 4ZMOA 4Z7WF 1HYRC 3ZK9A 2HG5A 3GRBA 3N2JA 4CMBA 5DD0H 5J89A 5D4QA 1KMQA 2HTLC 4NKRA 1C29B 1UPXA 4ZAWA 2OM2A 4WW2F 2W9DH 3KM0A 2HRGA 3Q1SH 3W1VA 5JHDB 2BKVA 3CK0H 2YNMD 1JIIA 4RU1A 1YQVL 3E84A 5GS2H 3U7RA 3P73A 5EMLA 6TAAA 4X45A 4L4VD 4FUTA 4KQXA 4XMLH 5KYYB 2YZNA 3G2QA 3P4YA 3R74A 5L4NA 1UIMA 3WIHL 3B60A 1YB2A 4RD1A 2XJKA 5JWHA 1P8JA 2F8MA 1BHSA 1ZRNA 4PC3A 1VLXA 5C8DA 4W9KC 5FL7A 4RX4D 4MNHA 1KIRA 4NHCH 4IVQA 1XUOA 3QEQD 4UUPA 2HJFA 4PRBA 1XCXA 3AM4A 2F1HA 2CFRA 3SGLA 3BSGA 2R4SL 1B8PA 4UQLA 2Z1MA 3WYBA 2YD7A 5EJEA 4ZEMA 4A04A 3NK4A 2YASA 5E7IA 1FE8A 2ZRHA 3K81A 2RG1A 4MXDA 4IU3A 2DQMA 5KI6A 1WZ1H 1BWRA 2OTPA 4X50A 4B6OA 1OANA 4J2XA 3UGUA 3PRJA 1VGKB 3MJ6A 2GAJA 1EESA 3VGEA 3WLWD 1KFAH 4R3WA 1UPFA 1K88A 3R7WB 4HMQA 3GLRA 4R1TA 4WNSA 5B1YA 3L6OO 3ARFB 3IUEA 4G8GB 5TGTA 2B8JA 1ZHHA 4FB5A 4K3EH 1WG8A 5FA5A 1EVTC 1ID1A 4KNSA 4FQ1L 3ZY4A 1MGPA 2F08A 3T9WA 1PFGA 3CSUA 1AC6A 3IO3A 4DWWA 3CS3A 3QE9Y 1BDIA 3M5DA 4BFFA 4YR9A 3KCNA 2CO2A 1SQGA 3IFLL 4HOWA 1FVCB 4BDSA 1MJUH 5ITVA 3WDKA 2DWCA 3G5LA 1E2WA 1C0LA 1PUJA 3C08H 1IM8A 1MPAH 4YGVA 4DG5A 3T6KA 1U7OA 2ZYIA 3GFQA 1U3DA 1ZWIB 1QFYA 5AICA 2VPIA 1VFMA 2ZXBA 1AVTA 3UAOA 4TT3D 3FUWA 1E9DA 3ZG6A 5CLIA 4TL4A 4ZIRB 1KNXA 1YB6A 3T71A 1MIMH 3HU5A 1YSCA 3IU4L 4PJ7F 2WINA 3R5TA 5I18L 3IXAA 4D25A 2ZUXA 4UVDA 4MVJH 1Y5IA 5H4HA 3VXUB 2IU3A 5IXYA 4MMZC 2HFGH 3DPBB 1S8OA 1E2IA 5BSFA 3JXAA 4I7EA 3BD7A 3ZE0E 3PL6A 1WITA 5E5UB 2CUZA 3K0WA 5F93C 4FNLL 5BMVB 5J7CC 4M1ZA 3BGMB 3JQGA 4Y6QA 2GILA 5IVHA 1KY3A 3HE7D 3WL9B 4JGMA 4LMAA 4BX3A 4YSUA 2IEPA 1ES9A 4X7EC 2VDKL 4RQTA 1DCKA 5FXMA 1JNJA 15C8H 5G4KB 3GSOA 4JLSA 1NDMA 4PLWA 3CFCL 1D3CA 1OCZB 1TPYA 2XECA 1W0WA 3W56A 4M98A 4EHLA 3LVEA 2CG9X 2J45A 4P98A 4F24A 3UTCA 1EINA 2Q4BA 3ZD6A 4XP1H 2P75A 3LC1O 4JFOB 1RVDA 1T4CB 2GK6A 1X4XA 4WUUB 4R7LA 4CVZA 4RAHA 1HE1C 1I7QB 1YWGO 2QJTA 1FMCA 1G21A 4FGWA 4ZZ1A 2GSDA 4YRIA 3MXVL 4KY1L 1QUFA 4C56D 1V3JA 1WTCA 4XPFL 4HXBH 3LPWA 3HRPA 1TZ8A 1Z2PX 1IPHA 1C0PA 1UACH 1JJAA 2PSFA 1IHYA 4EYKA 1A71A 4I1NB 1PLAA 1OAZH 2Y06H 2VZ0A 4BCBA 3IL2A 4AJ9A 3I4LA 3UBGA 4JC4A 4Y0GA 3PYMA 1IFHL 3A6LA 3TAXA 3BE1H 3TA3D 3OFKA 4NATA 2WWNA 3FOEC 3OJEA 3BSFA 4F2MB 1FO0A 2R1UA 1CE6A 1ZA3B 1M1UA 1GNLA 2IW1A 4YHHB 1ETHA 4NS0A 2Z58A 2WXNA 2PVPA 3ETSA 2JCCF 2Y0BA 2BVQA 1OARH 4M6AA 1T03L 2X3YA 3RK1A 4UT6L 4JFRA 3D1VA 1BE8A 3H6GA 4XC3H 4AKHA 3OPQA 2HRPH 1X7GA 3N05A 2DQHL 1NMEA 3GUCA 1FFGA 2JKSA 5DUMH 4NQXB 2K70A 1JPTH 3STVA 1QRKA 5LBIA 2GUGA 1UQRA 1YMMB 2B8WA 3V7MA 3WYDA 1BOGA 1NE2A 3G6KA 3S4SB 4WO4A 3AHJA 2KS6A 4YRMA 3HC3L 1KCVL 1VE7A 3HCOA 3NNNA 3HB4X 4UNSA 2YLHA 5B57C 3KJNA 4I77L 2P4EA 4IOIB 4AZ0B 2DY0A 1RMFL 5ANME 2CLSA 4YMLA 2IV7A 4DQVA 4CE6A 3D0VB 3OM1A 2DBRA 3UMYA 3KHUA 1HQRA 3I9GH 3UBXA 4Q3NA 4UBDD 4AZSA 3KXPA 5KBYA 3R77A 3X1FA 4PFEA 1QGYA 2BI8A 4LCYA 2BNQD 2VAJA 2OYLA 1EEZB 5EIBD 3UFXA 1URPA 1MQ9A 3MFFA 1W80A 3RFUA 2R1TB 3C3PA 5INDB 1BCSA 3HKBB 1YQ2A 1O6FA 3ZWNA 1FC0A 1JEOA 2J5RA 1XTQA 2CHVA 5FOBA 5F1PA 2XNDD 2E1RA 3EYVA 3I2KA 3QKSB 3V7AE 4FHJA 1UOPA 3F7OA 3ARVA 1AK9A 5IP4A 3TINA 3BDXA 3E23A 4QHYA 2UYQA 2IANB 4IP0A 5LYJA 4LF9B 3UG6A 1HE5A 2YN3A 2J43A 1EHAA 2XAAA 5GISL 3FM9A 2YWRA 5KS9F 1KELH 3S34L 4OCMC 1GZ3A 4X7SL 3ZK0A 3HEIB 4X0EA 2VUHB 2A9AA 1CBJA 3GSNB 2DU8A 2J6EA 4J0EA 4R9UC 2H29A 3HNRA 3D0RA 4MZDA 2OCKA 4EZJA 3G08B 5EJ2A 3WK7A 4ZQKA 5EVJA 1PY9A 2E5EA 3L7BA 4FYHA 4B7AA 3GK8L 3BULA 5IJBC 5EOCH 1Z75A 4KTDL 3H3KA 3DDWA 1SRRA 4O2BA 1AN9A 3MLTA 4JQIA 2CDAA 3SZRA 1PS3A 2ZUQB 5CSGA 4H1WA 4P2OC 5CFAA 1LQSR 1VEPA 5AUMA 1ETUA 4XHJD 5AESA 3O83A 4KI5C 1FJ1A 4QT0A 4MUEA 4PS3A 3QFSA 3CEMA 5AOIA 5T1DH 4YIQA 5EWIH 4RWYL 2ERYA 1YN6A 4QLAA 3X1WA 2XW6A 1ODCA 4F3RA 2Y36H 1H3PL 3V5KA 2GA9A 4NZ8A 1F8TL 4FDLA 1MB9A 3K0SA 1LSUA 8PAZA 4AQDA 4C6SA 2OENG 3IJRA 4M1GL 1YKFA 1FLTX 4X84A 3ZGXA 1G3RA 4R3SB 5E9NA 1FSGA 3RARA 4U1LA 1P2DA 4E5YA 4G1FA 3KSBC 4XRRA 3VI4A 5UKDA 4GAYA 2I8LA 4Z4EA 2DQTL 3P4OB 3B48A 3H18A 4WWNA 3KLKA 3OR6A 5D7HA 4DN4H 1OE1A 4GLRI 5AZEL 4PWZA 1XMSA 5I1CL 5JJKA 1K4MA 1U2QA 1A4BA 3H83A 5FIUA 4UQEA 3APMA 5AVZB 3WDLA 5FPTA 2P3SA 5SZIA 1Z4KA 4XUDA 4YO8A 2J8UE 4N2MA 2EYSB 4RQQA 5E4TA 2GTWB 2RFXA 1U7XA 3K4QA 1A5ZA 4IHKA 1R47A 1X5JA 5FB8A 3F97A 2VJDA 1A9BA 3QVGB 1UBMS 2W6CX 2FCRA 3NBUA 5C32A 5EZIL 1JPUA 2O8DA 2J25A 2PAAA 3ZL4H 4R7VA 1EP3B 4XXDA 3AEQA 3FSZA 3FPJA 2FQFA 4UV7L 5SV2A 3WLEA 2C3HA 1WBZA 3EMDA 2NQDA 4C4SA 3ESXA 2PKQO 4JN1H 3I72A 3I04M 4BVEA 3MCTA 5LZ4A 1YDHA 3ILQC 4F8PA 4EWLA 1QVOA 2OCYC 1PKOA 2PMZA 4FN4A 4INOA 5CLTA 4D74A 2WQ6A 2ITCA 4DREA 3ORSA 3JYQA 4C7VA 2OMKA 3LKZA 4QFDA 3FOBA 4NQDE 2PRZA 4GIBA 1MQ8A 4EELA 2CHZA 5HKBA 1RYDA 4R8KA 3IGKA 5C2JB 1JXQA 5HYVA 2FSDA 3H6AA 1OF2A 2OL4A 1IBKB 3REVA 1BDHA 3PWPB 1Y6RA 4DUPA 3LV3B 4LOKA 2HTKD 4NU6A 1TT6A 4NENB 1A7KA 2BXZA 2QV2A 4X6CA 4CCYA 4JFQA 2Q9CA 3X13A 2C2HA 2XB4A 3O3OB 4JL5A 3BLBA 1GGBL 4S12A 3OCYA 5L6LB 4JI3B 4REOA 1IM2A 3VDNB 2X3CA 1CUBA 1B15A 5EMJA 1G64A 3OESA 1XJ5A 3RREA 1G9XA 4AQYB 5AVXA 3PUVA 4OVKA 2WWOA 5JHLL 4LYGA 1J25A 2IIBA 1WH0A 3VD9A 2D0DA 3I92A 4C4UA 1JG6A 1IVYA 4YBRA 3FQXA 4NN5C 2P8LB 3SD7A 3RJ9A 4V1DB 3R3ZA 3SJUA 3FS9A 1UBTS 3L79A 2Q10A 5A2CA 2B98A 3SN6N 1GPKA 2C9ZA 3W0WB 2CF5A 4R0NA 4YJ2A 4C4PA 4FN5A 5LPNA 5H82A 4Y98A 1AC0A 5ER9A 2JK5B 1TU2A 2E7ZA 2FJHA 3S5LB 3OJCA 5BXFB 3N9GH 2XWJA 3O2WL 1GGFA 5HVFB 2IAAC 1WLHA 3TMYA 3SKNB 1G7RA 3O41B 1PGQA 4XDGA 5JLZA 2IU0A 1CY1A 2F90A 1CFQB 1KEKA 2CV1A 2CJWA 5HPMA 3UJ9A 5F6IC 3B34A 1BVHA 1N8ZA 3L7OA 1R3JB 5H3HA 4LLQA 2HLNA 1DQQA 3BVTA 2C4FT 4RXMA 1LMIA 1ZR4A 4LDCA 1ZHKB 1I85C 2YK1H 2XWBA 1UZ6E 5EUCA 4QYOA 4Y16D 4U05A 1HCYA 3SI7A 1F58H 4UDTA 5LGHL 2JJ8A 3PWNB 4HB4A 4TLAA 3W04A 4A23A 1MI5D 5F1SA 2OXCA 2ADGB 4R0LC 3ESUF 2Z4QB 3FSAA 5JLAA 3FVRA 4IQFA 2ZI6A 4GW4A 4XJVA 4GSLA 3U17A 3OE5A 4A38A 3OICA 5I6KA 1UQTA 2MQ3A 3VX0A 2ZE8A 3L17A 3NJMA 4TVOA 4NCXA 5EO0B 3EBLA 1SJMA 2YVKA 2EWWA 1KY4A 2NU7A 1NUQA 3BREA 3N9IA 1E5ZA 3B20A 3CBQA 4RGNB 4EB3A 4HPWA 4PICA 5AM1A 25C8L 2FPSA 2CMGA 4HWZA 1T15A 1SEBA 1LSOA 3NWEA 4FZEH 4OH1A 3WIFA 4RFNC 3PWVB 5IDQA 2M6RA 1GC1L 4KXUA 4ELMF 4QYAA 3RV4A 2IWHA 3KPSD 1RZRD 4HIHA 2WP8J 1O5TA 2WF9A 2DS4A 1KO1A 2AKRA 1KGIA 4RIRB 5J4KA 3WIUA 2CUAA 5HHPA 3VR2D 4S10A 1UMDB 3RSFA 1JDUA 4S1OA 2QKIC 1XMEB 2XZAH 2BHNA 1M5UA 4YV7A 4KUCD 4A6YL 1EFVA 4BXOA 1OPRA 4J3BA 4JM0A 4QGTA 2VDVE 3DZDA 3EEQA 1CF1A 3PGMA 4KL8S 4O1IA 5HUHA 3KJFA 3NKFA 1PGRB 1PEZA 1TE2A 1OAOA 3E5MA 4ADSG 4HFUL 3E0GA 1CW2B 3HHPA 2X9WA 3V8EA 4FZJA 1V9LA 3ZHZA 2C1ZA 5DX1A 3DI3B 4JLRA 4Z4HA 1EQ2A 2WM8A 1SPBS 3H0EA 2ATEA 2BIIA 4HIPA 4ENED 4RMTA 1OVMA 2A73B 3KLAB 3VU1A 3KPQB 3PV7A 4HUJA 3ISTA 2IHNA 3FE2A 4IH4A 4CU2A 2ORVA 4NU8X 2FQWA 4MUIA 3UT5B 2YWJA 2PZGA 4ZV9A 1TKRA 2OOKA 4DZRA 3HJ0A 2VS1A 5AW8A 1EJBA 1U4FA 5F21B 4OUUB 4FA6A 3NRJA 4YHBA 2UV8A 4JRXD 3VFGH 5DJDB 1HI6A 3BUIA 2Q0ZX 1E3EA 4ESHA 2GF0A 1NNUA 1CB4A 3O94A 4ORGA 3HFFA 1FFRA 5DK2A 3O2SB 3LRGA 2JH2A 2AFHA 2XUPA 5CJPA 4BFIB 2EX4A 3VNRA 3JTBA 2V8MA 5G2OA 3H5AA 1D2AA 5E4EC 5F6HJ 3VFPB 3B3AA 5IK3A 3V6OA 2XXFA 4GX2A 3BP6A 5EKDA 1Z3CA 2ODBA 1C7TA 2BINA 1C3LA 1GKKA 4LESA 3GCZA 2BEVA 1L7AA 3IRCA 5C7IO 3RL1A 4PG9B 1J2JA 2DQKA 1ONQA 1R4MB 5FLVA 3CPEA 3V97A 3VOAA 1BLNB 3AMKA 4MR9A 4J3TA 2M98A 3ORYA 1NU6A 1SYSA 3E2MA 4P23A 4RZ2A 4B9IA 5JPNB 2BVNA 4GPAA 4DCJA 4PJXB 4ABQA 1N5KA 1MRFL 4EG8A 1CPUA 4UM8B 4XCYA 3H6KA 3T3PF 1LXMA 3PNVA 2HHJA 1QSGA 1JG7A 1YE8A 3V8QA 5IEKA 3U6XA 4YSQA 1J8HA 1MLCA 3GSRA 3B7UX 3CHRA 4LCWA 1QNLA 3SSOA 2TRYA 1MHHA 2CJXA 4M0LA 1R74A 2CU9A 3GHEL 3LA8A 2EJBA 3DZGA 2Y92A 3C2QA 1T26A 4C59B 4IMJB 4W9ZA 2WIBA 2VAAA 4WKPA 2DZEA 2V7QD 1V7NL 1SCUB 4WGGA 4R6UA 3FB1A 4OF7A 5JHLA 5L8JB 3K53A 3BWUF 2BGRA 2PJDA 5JSUA 3VRHA 1BX3A 3DUFB 3PHHA 5C51B 4K3HA 1NI4B 5E00A 1UQUA 3FWKA 1ELOA 3L0CA 3DXAD 4JFDE 5JOFB 4IIEA 3AV0B 3FOZA 1U5CA 3RYCB 5D1XC 5LHDA 3A3PA 3L8CA 1VZ3A 4BKLA 2A4CA 1ZDMA 2VE6A 3LD9A 3AR5A 5GM2A 1CEYA 5GGRB 2CBTA 2NY4C 4NZPA 4TL9A 2YWZA 1AGBB 3BQUB 3GZOA 3CX2A 4PC1A 4TM9A 3GOQA 5D1ZC 4NZRL 3GBSA 4ND4A 3W06A 4DIDA 4PJHB 5IT2H 3DTXB 3DKHA 3TO2A 2HZ7A 1T6YA 3FDJA 1N0UA 4GO1A 4WLVA 4AZUA 1V5EA 1I1FA 4PW3A 4F9PC 3FMOB 3QM1A 1ZU4A 1OV8A 3PTLA 1SKUA 3CUVA 1RUPL 2ED8A 3DCNA 5J3HC 1R8QA 1TGVA 5FA8A 3RNLA 1G7IB 4FULA 4J2HA 3MJTA 3RAJH 1O95A 1PGPA 2CM6A 2YPVL 4KP7A 5HG0A 1LK7A 1XTUA 4QPEA 5IWCA 1AF7A 2QV7A 4QHMA 4YT4A 2OECA 3UAGA 4JRYE 1U33A 4GT1A 4UE3S 2J9GA 2A9ML 1CEEA 5FECA 1T80A 4EYQA 3O26A 4A8JB 3LUDA 3LW8A 1E4WL 3TLAA 4C4RA 3ONEA 4QSMA 4HG4K 3RUCA 1BHO1 2PZEA 4I08A 3H9QA 1BG6A 3BJZA 1Y0LB 3M6VA 1DFBL 5BQ7B 4AZ3A 4CKWA 4PR0A 2CCLA 4MMXA 4NMXB 1KEEA 5B3LA 2QL1A 1BGWA 2VIIA 1WD5A 4PIVA 4RXUA 5KOHB 4DXDA 1Q2UA 4MA8L 4WI4A 1F9AA 2LU5A 1Z4JA 1MQAA 2BEJA 1JR3A 3Q2VA 4RQAA 3VVLA 3A6CH 1DZ0A 4E88A 1WO2A 3RIEA 1XFDA 3BIFA 4O3FA 5DJ8B 4AEIL 4WO0A 5KVGL 2K7ZA 1E7UA 2DWXA 1BD3A 3HXPA 1VMEA 1H2RS 2FX9H 3RTAA 4F7PB 3DSFH 2C8VA 5DE3A 1BVKB 4BTVA 3KJ4B 4A6YA 3DYIA 1DQZA 4Y5VA 3VDBA 1I4EB 2XVYA 2C9SA 5TDOA 3T5MA 3TM6A 4ZMLA 1DEAA 2OR7A 5AVYB 3A4EA 1XT6A 3P9KA 4R4FH 3Q8FA 2ZIUB 2X8WA 4KBFA 2OBYA 3ZDAA 2WWWA 1JXGA 2Q8AL 1OZFA 5AOAA 4MJID 1QZZA 2X0KA 4GQIA 3KZKA 3FNKA 3TIVA 3TPUB 4GICA 5E4YA 3F5WB 1SYVA 4UOW0 1QC5A 2V6GA 1BZDA 4QPNA 4D8YA 2GITA 1N64L 2YXFA 5BNIA 2C4NA 3CU7A 2YPKB 4UUJB 4WU5B 1IUNA 1GNSA 3RRBA 2G25A 4GP4B 5C0AE 2JIRA 5EHXA 3NJKA 3IUQA 2C7OA 1VIWA 5FOQA 4JLJA 5JNSA 4FLFA 3V9FA 3WRXA 3TGPA 1EH5A 3QVVA 4GF5A 4WUVA 3GY0A 3QU7A 4N7RA 4OQLA 5L7YA 5K8UA 2Q20A 1DFXA 4PGJA 5IVZB 3HZMA 4DNQA 2V97A 3F7NA 2B5WA 4G7VL 2OW6A 3R4VA 5F89A 4JO3H 2O1AA 3HUFA 2NY2C 2ORED 2H3XC 4DQXA 1W72B 5DU2A 1R5VA 2ZPKL 1JEYA 1NEZG 3RAGA 1QFHA 2FEEL 3WNIA 5JHDD 5AB0A 3ZS9A 2V7WA 4MPJA 2Z83A 5E8EB 1IEQA 3AB0C 2BFCB 5DS8B 4QGYA 3PKJA 1TYAE 2R8SL 4TTPA 3OCXA 3UPRB 2BCMA 4RL6A 1LEKB 4RMIA 3BBLA 4GRLA 3IPLA 5TDPB 1GKIA 3G6AB 2A7XA 5BN3A 4KDWA 3WNZA 2MSDB 3FFDB 4CC4A 3P2KA 3OLVA 1CXZA 3MN1A 1P7QA 3GO4A 2ARWA 3MCLL 5MN6A 1G7TA 2VO5A 5DA0B 4MWFA 3SE4A 1M3IA 3ENEA 2FJ0A 4MW2A 4OMFG 3EDDA 5EPUA 2NO4A 4G6ZA 1O54A 5AK4A 1ZHNA 2R69H 3BPCA 5A3VA 2ADOA 2CNBA 1CP3A 4NWTL 3BKJH 3GFBA 3GXFA 1DVXA 5B3JA 3PQEA 2WT8A 3SGEI 1TM4E 4YK4B 1N0IA 3WMWA 5HYEA 4KJQC 2ORBL 4N5EC 1YUNA 1I9RH 1QZ3A 3SFVA 4I5BB 1N9GA 2H7CA 1O9VA 4EPYA 1W36B 4D9MA 4RENA 3PJGA 2ZSIA 2PYEA 4QY8B 5AKTA 3NCJH 3WU1A 2LABA 4G8GD 1OBOA 1JBEA 1O6CA 2Q1TA 1Q3KA 4N03A 4DFDA 2VRQA 1PEDA 1T1WB 3OJVC 4WPGA 3LQAC 4JDTL 2FATH 4HHGA 3HDYA 4Y6SA 4Q7QA 2RB4A 1ABEA 3SDAB 2Q1YA 3UCRA 4F2WA 4FFWD 5EZSA 3TFOA 1VL6A 3BOSA 4Z7NB 1MFUA 3X1ZA 1G6RA 4YO0B 1XTRA 4GRAA 2XX1A 3AL2A 3BWAA 1M7IB 2MMXA 2W0KA 4MLSA 2WJYA 1MFCL 4RGYA 2ZROA 4WN9B 3ORHA 5MHSD 1DJHA 2YPVA 1JRHL 4LDJA 5L0QB 1C0IA 9LDBA 3BMNA 4GGMX 4EL5A 1IM9A 1YQQA 1S3IA 1V4BA 2HEGA 1MCQA 2AXFB 1RT9A 3L1FA 4PX2A 4PS8A 1RJZB 4WFEE 3GJ8A 1E6JH 1A66A 2I9LA 1MHEA 4J0JA 1UM9B 1UHVA 2JQMA 2V6BA 4UU8A 2GX6A 4K9NA 3VU0A 1ISGA 1NCWL 1C8VB 3NUQA 4DB4A 1FBIL 4GXVH 3LMJH 4TLUA 2GS9A 1UOLA 4WZAE 4HUTA 1EEHA 2DM6A 4NOFA 3PPYA 3I61A 1N75A 4IO1A 2R8OA 2IYSA 2ZE6A 3QWBA 4KY2A 3O8NA 3LVBA 3C2AH 4U31A 5IDVA 1TIUA 4OQXA 4IJVA 4AEHL 5I47A 2PUVA 2X88A 2HN7B 4CU8A 4NCAA 4JUFA 4KBPA 5DHVB 2FIKB 4YSEA 4IUYA 4W5OA 1KAGA 5FOTA 4HXFB 1PJ2A 4DUXA 2PP8A 1WYJA 2LR4A 5G3ZA 1CL7H 5I30H 1BLIA 1TMQA 5FYKH 2ZQYA 4PNPA 2XCUA 3LKPA 4E5XB 1A04A 3WOVA 3C8HA 2QAGB 4OKVB 1Q1PA 3VXQA 2GO1A 1LW6E 3QFRA 2ZJOA 3FNGA 1RI4A 2RIPA 1JHOA 4BKPA 4Q3KA 4WJKB 1R12A 2X4PB 2BFFB 4RVBA 4JNCA 2PU7A 5BMVF 3I5YA 3S7TA 1AB6A 3SXJA 4DAGH 3MCG1 1CX9B 2I1VB 1AO7E 2EFEB 4LIQH 1BE0A 4YRPA 5I1KH 4RBNA 1KGCD 3ZVKA 5ECGC 5I74B 4Z7WB 4X65B 1YAJA 5F1OB 3LS2A 3BBPA 3WL5A 1AKTA 3BXOA 4DP7X 1QRAA 3PSHA 4CQMB 2NVBA 4UBKA 1WD7A 5BW4A 2IQAA 1HQ4A 1AIFB 5IW8A 1K7SN 3N74A 3SJ7A 2G1UA 4BJ1A 3WG7B 3BB3A 2PANA 5EBWA 5A03A 4N5NA 2DM3A 4CRPA 5DNYB 5AI8A 2C7VA 2ZKHH 2PPFA 1GSIA 2VAWA 1TJNA 5I19H 5IKXA 3RVLA 4CM7A 4G23A 1GMIA 5F1IA 1QR6A 3NAQA 2CNLA 1NGQH 4FYWA 3QW9A 5BN4A 1CIPA 2NY5L 2IE8A 3O2DH 5FTKA 1ODTC 5FPPA 4L9LB 3IK2A 2BIOA 4UQ2A 1Z6PA 4Q00A 5FGBC 3CZCA 1MLBB 4R5TA 3VJRA 4MA0A 3GL9A 5IOKA 3CWZA 2F54A 4U7WA 1WBJB 3QO0A 3KNBA 3BN9D 4R68A 5DTFA 5F3WB 4XBGA 5H83A 3PHQB 4G8IA 3AHGA 4LI0A 5C8YA 5CZXD 3TN0B 3UAJA 4K6OA 2QRJA 1JJIA 2C98A 3D7SA 1OK8A 2J0EA 1M1YB 1F97A 1N2CB 5BZDB 1N8SA 4LHUG 2Q6LA 4DO4A 4XB7A 3HO8A 5J47A 2R2BA 2ICCA 1Z6GA 2KZBA 3BLPX 4KREA 3CMGA 4ALLA 1HXYB 5KPDA 3DMFA 1ZN2A 3ZKXC 1G2IA 3FAKA 1KDOA 1PJ3A 3ZHQA 3P0IA 2IAND 3D39E 2K45A 3N7AA 1JJ7A 1FA9A 5DVOA 1MNAA 2Y0SA 1K5HA 2UVQA 2BC4A 1UKYA 3SPGA 3T7CA 3IJHB 2W6MA 1TTUA 1ZW1A 4NCKA 3BEVB 2G7MC 1U93B 2FWSA 3STXA 2J5XA 1B26A 3RBXA 2X4UB 3S8MA 1T1ZB 1ADQL 1MN4A 1GUAA 5A40E 5JIPA 1QHIA 1H2BA 3L2LA 2P3OA 2H57A 1RQ2A 3VPAA 1QIKA 4GM0A 2C9AA 1J20A 1MCJA 1N7JA 5CM8B 3PQ6A 2Q2OA 4RD2A 5I17B 3LZFL 4WHMA 2DFTA 3LSYA 3FONB 4TYQA 3X44A 4X99B 3T2LA 4HLEA 3GGCA 3OIYA 3KCWA 2I4OA 1S7UA 2ZWZA 3CE9A 4I66A 4MFHA 4B3VA 3PGVA 2GHQA 2JK0A 3JUYA 3APNA 4QKXB 4S2SA 2MSKA 2QGDA 3ITNA 4UU9A 4LXXA 2WBKA 5H81A 1JMXA 2PWYA 4GBJA 4CLRA 1M2VB 3UJDA 1RPKA 3F4LA 2HA3A 4QI3A 1U6IA 1R1CA 1CRQA 4LMQE 1MWAH 1BFVL 5G4MA 3OKWA 3K8ZA 1PS0A 2C84A 3GLHB 5D2NE 5EG5A 4F97A 3FKUS 3N40P 1MFDL 2GCOB 1Q74A 1QIFA 4MEAA 1G7MA 4ZMNA 1QZ1A 4B85A 5BW8A 5E8PA 3HWRA 4MWDA 4HL6A 1FJGB 3IPBA 3M82A 1ZGHA 3BAEH 3Q48A 2E27L 4B4DA 3MROB 4B46A 3LIZL 5BO1H 1AR1C 1G4HA 4L4TB 2R23B 5I1AB 5FWAA 2PO6B 2B2XL 1DFHA 4G6JL 1AHPA 4RISL 4FKMA 4JL6A 4HGZA 2EAUA 2DHCA 3C41J 4BNNA 1CBVL 2BKEA 3LZDA 5E51A 3L1KA 2CXTA 4MS4B 3WGTA 1O7DE 3Q3EA 1WFIA 3UZEC 1SBHA 5I0VA 2WBJC 4KQ1A 1DQMH 1K3IA 3S37H 2FJPA 1EFXA 3E9UA 4IRXA 1T5WB 2P8MB 4OHKA 8FABA 3HBLA 2Z35A 5GRVL 2IYVA 3L8DA 1E7MA 1A3ZA 4X7DC 2IW3A 3O45A 4O5LL 3CN1A 2EUVA 4FXGA 3VYUB 7MDHA 4CWAA 4X91A 4OM7A 2AR0A 3ZU3A 2JCCB 2A74C 1LX7A 3DD5A 3BP5B 3HB3D 1JHRA 4IYJA 4RETB 4OLAA 3RVDA 2MYUA 5JXAH 4I4TB 4PHCA 3WELA 2GXUA 4RD3A 2FWNA 3ISYA 4PWJA 4D94A 3VHQA 4KQ6A 5D84A 1U80A 1GCAA 5HYSA 2AJ3B 3CLHA 4TMYA 5HHXH 1PSKL 5T3ZL 4UMEA 1ZXLA 3PWPD 1GGUA 4NQSA 4H77A 2BEWB 3JS5A 2P0EA 5AKEA 3OIFA 2NOAA 2QAJA 4QASA 3L1UA 4FGKA 2W2KB 3ZTWA 4BFYA 4DV0B 3H0KA 3R6TA 5F9OH 1YEDA 3TWCH 4UHFA 1DQNA 5KYXB 1N0WA 4QELA 1AURA 4MKIA 4H0HB 1S02A 4P3XA 3BUYB 5IB1A 5I2IB 4MJ5B 2W6PA 1L7TH 3IF1A 4RTPA 4PE5B 3C9NB 3ESRA 1RBMA 1L1RA 5T1LA 2GNOA 1CLZL 4JFZH 2VLKB 4MUFA 1SVCP 2X53A 4FMVA 3FU9A 1OI7A 5DVKA 5KDDA 3C5ZA 4N6OA 4I0PC 3W0WD 3ROLB 1IPFA 1HL3A 1KSJA 3QENA 1KF9B 1UM6H 1D5IH 5KUKA 4AUJA 1RVFH 4U6VL 4X9YA 1FN4B 1FG9C 4JHWH 4AS1A 4IFIA 3KXLA 1XH3A 1GPDG 4OB5L 2OB1A 4HCFA 2J4WL 1UH4A 1JG1A 4BQQA 5KS9B 1TVHB 4ZD3H 2EU8A 2NZ9D 4U1NB 3HBAA 4M1EA 4D4HA 4ZGGA 3PFFA 1W0VA 4OZIF 1N3IA 4IVNA 1JWMB 2PL5A 4OD0A 2DR0A 1AVAA 1IC5H 1Z28A 1DG3A 1AGFA 1XYVA 3BC1A 3G2PA 4PRIA 4BIIA 3QFDB 4PGBB 3ILYA 5AVRB 2TAAA 5SY6A 1CLOH 3HZ3A 4LDLB 3BH9A 5EJ6A 4B0PA 2AIRA 3S2SA 2YSSB 3X1KA 1TD1A 4XAKD 1NFQA 3THWA 1LQBC 4ICXA 1XHHA 4P46B 1CG6A 3OEHA 5AW5B 2G9HB 2X3AA 4PNEA 3B3BA 1EGJH 1GDHA 5AW9B 3WL3A 1LM8V 4J0CA 3LFHA 2A0LD 3ULUF 4X3CA 5LXGH 2WMPB 5TS3A 4CFYA 3FIUA 4O2LA 4RGND 1JPEA 1QHPA 3ULSA 1U4NA 5HDQH 2BOVA 2I5YL 2E21A 5CTJA 1KS9A 1AGYA 5MEPB 2VUUA 4Y19A 2AG0A 2ZRDA 3O6LL 1JQDA 4BQ8A 3OZDA 2R85A 1NQWA 1W7AA 2VWGA 3ON5A 3QFGA 2Q5LA 5DLDA 3OP4A 1NBYA 1CUXA 2Y6VA 4OSUL 3Q9LA 2ISQA 4PAZA 4MB2A 4FZ8H 5DJ2B 4UPVA 1FIGH 1MIHA 4YYZA 2Q1WA 5I6MA 4GI1A 1B4RA 4B3XA 4NV0A 4JO2L 4X98A 5CBEB 1TK9A 2F7QA 4N8CH 3N1PC 1DEXA 1V7QA 1JJBA 1U4EA 3KFVA 2X1QA 4GSKA 4NQVA 3G2KA 1XKQA 2D2OA 4EKEA 4LGVA 2P9FA 2Y4OA 5SWZB 3LIZA 2BFGA 4F1SA 1KFJB 3HV2A 1HINH 4LLYB 3GGGA 1A77A 3SB3A 1T0UA 4XIJA 5IS2A 4M87A 1R4NA 4AYID 4GPBA 4TKVB 2XRAH 2HCJB 1A9XB 3DJYA 5ALCL 1L3NA 5HI5D 3OX2A 3G5WA 1JIKA 4Q47A 2VYND 2L17A 4DUGA 2OL3A 1T20A 1CYDA 2D62A 3EW9A 3F46A 2NXYC 1RE0A 2B0CA 3MD0A 1NXOA 3GRZA 4LNVA 2R7MA 5D1QA 2JE8A 3RANA 3G68A 3I6LD 2XNHA 3T0DA 1U8CB 4PRDB 3P8ZA 3BFVA 5EZLA 4MROA 3R7NA 4LF3A 2ICWB 2HCFA 2E7LA 4IBSA 1II4E 4PY8J 5D2LF 1HH6B 1WCV1 4EJSB 4LASH 5IJCC 1OB1A 3VTMA 3H1FA 1I7NA 2Y6SD 4AYSA 2IH2A 5SX5H 4NHUB 1R10A 3KR0A 1HPLA 1QPGA 3P9MA 1YQUA 2BY3A 3VWJB 2ALWA 2VXYA 2JELL 1KPRA 4PJ9B 1JTEA 4E12A 2A9CA 2ZIXB 1D4ZA 3W1EA 1RQ7A 2W0LA 2VT2A 3US0A 1IXRC 3H54A 1CGYA 2FR0A 3C85A 2R66A 2OMZA 4KQKA 4DP1X 3MRVA 3I8OA 1ILEA 3QITA 4LSGA 4KN5A 3D85A 3AYXB 5FA6A 5K20A 2PXAA 3RYHA 2X4NB 3IKJA 5DRNB 2ZT8A 3QUXD 1OLOA 3HUJF 2B14A 4AYMC 1ODSA 1IBGL 3GIZH 4BZXA 3O3DB 4RDBA 1QH1A 1A6AB 2VDNH 3ARDA 5TTRA 2VLRA 1K6EA 4F5YA 1TJ5A 2XMGA 4HUUB 3FWPA 4TV9A 1H8NA 4IDAA 1JZ6A 3IPYA 2WKGA 4GFXA 1WUKS 2CXNA 1RZQA 5FNVA 5BV8A 5LNDA 4F5CA 2B99A 1JVKA 3OMZA 4QTIH 1B3IA 1Z5HA 2ZUTA 3KSRA 5GRZA 3DT6A 1U4OA 4WGVB 3CRZA 4I3SH 5KPJA 4ED9A 1Z3IX 4XIFA 3B2VL 5EINA 4JM4L 4YVNA 4BLRA 3Q43A 3D3VE 4FABL 1DVYA 4PJXF 4I4IA 3F78A 3K1JA 1ODUA 3P3RA 2BWDA 2KUTA 4GKSB 2C3YA 3BQUD 3UMVA 5E9DE 1ABBA 5KKCA 4C5BA 4JOBA 5DISB 1ZHLB 1QFXA 5EJMA 1NX6A 1P31A 2RBEA 5CH3A 4W9HC 5C0FA 1KPHA 3UJTL 3WFEL 4JCWA 3T2NH 3PLYA 4ISVA 2CMFA 3L9RA 3RWEB 2KMLA 5T1MB 3I6GB 4LECA 4Q4JA 2MQCA 3OQMA 2BVPB 1BJ1H 4QWWD 3T1FA 1MMFB 5CYFA 3FH8A 3VFMB 4GI8A 5I9NA 1NULA 3SPXA 5BUZA 1PZCA 4PLHA 3EIWA 4ZPVB 2HB0A 3VAZA 3QVJA 4AENA 3FN0L 4NN7C 4RKWA 3MYZA 1V05A 4TKUA 5T7BA 1LD9B 5IEJA 3LC2O 3JAMA 3B5IA 1NQUA 3FMGH 1NVFA 3KQLA 3B5GA 3HBNA 3KELA 2BBWA 5HWSA 4XDYA 2Z7YA 1MCKA 2X8JB 1A1SA 1GZUA 1S9YA 4FLHA 4JW3A 4W6YB 5ALJA 4JYPA 3RSGA 2FK9A 1RXYA 3ILPA 3OT1B 3HC7A 3GEGA 1WZKA 1D2OA 4Q01A 4Q9JA 2XQVA 1YBVA 3L3KA 1U8TA 1P6AB 4X2UA 3JUZA 3WLJA 2FUTA 4LK2A 4W9IC 2NNRA 3U48A 4CW1A 4EUHA 1QAQA 4Z1MA 2HXAA 4LX0A 3A1DA 5KNLA 5D2CA 4WWKD 3T99A 4ZW7A 4PJHF 1T8RA 5LMUB 3HS9A 3U31A 4BX2A 4QYWA 3SCMB 2PSJA 3OPMA 5L3QB 1FW8A 1WIOA 1GAEO 1HSAB 1JVOA 1QB7A 3TF4A 3I8SA 4HKZB 1F8UA 4ZV7A 5J6GA 1DOZA 1UJNA 3PC7A 1H3XA 3IN2A 4IKIA 4KNQA 2VW4A 5CILH 1ZEMA 1B0GA 4RY2A 2AD5A 2H0PA 1XROA 3ZOAA 3WNQA 4H8QA 3HVKA 1XVTA 3NHAA 1XL1A 1MOQA 2HGSA 1XL4A 1A4KB 4UTCA 3D0OA 2G40A 3DUUB 3MLEA 2XJ9A 1NFFA 2CFCA 1EDBA 1G8SA 4KZKA 4UT7H 5EO1A 4HSEA 3A9WA 5CA1F 1EUQA 5CDFE 4XN8A 3C5EA 3KLDA 3GLZA 3IOEA 4MLCA 4C88A 4HVAA 4Q1CA 3NATA 2H2FA 5AYQA 5KSBE 1IHUA 2GJZA 1MFEL 3HPRA 2B59A 1EHLH 1NQOA 3P4LA 1DQKA 5AYTA 5A3IC 1T3TA 3IVAA 4CL8A 4OM1L 3ZHBA 2FJGA 1JEJA 1H6FA 2QTTA 2Q49A 2BZ1A 2AP2A 2Z9TA 5IHZB 2BCJQ 2JBAB 1SXIA 3MCKB 2JI8A 4IJQA 4FQLH 3P0FA 1JJVA 1V1MB 2G63A 4JPIB 3JV4B 1XCBA 4M7WA 3KPJA 3O4IA 2JB5L 1QFWI 2P8JA 4QJ3B 4LJYA 1UG9A 3D12B 5CZVH 1SQSA 3R5XA 2F1JA 1PFKA 2H4ZA 3CJJA 2O7QA 2VIRA 1MFAL 2VEOA 1YTLA 2JSFA 4GO6B 2WSMA 4P49A 4O4LF 5CGQB 1KTCA 3KNZA 4NFDA 1C3OA 5D93C 2UYGA 2XV0A 3T3PB 3VZQA 3L95A 5L7XH 3IQIX 1R9GA 2X8AA 2EDLA 4DLZA 1LLFA 3THRA 3DQZA 4AT6B 1Q2XA 3QPVA 4R7TA 3A70A 2RGWA 3IE1A 3OJFA 4CADA 1N5OX 3O95A 3ICQB 5EEGA 1VEMA 2MKWA 3SDXE 3KH3A 2FZCA 5ECWA 3R3HA 3D43A 4BTLA 2AFIE 4HCJA 3ARGC 5KJ1A 5CRIA 3AU1B 4IHQA 5D7LD 2Z56A 5LVAA 3CN2A 2WLZA 2ZXAA 2YJ5A 4LJKA 1EKXA 4ETYA 5CEZH 4HDRB 4OK6A 1HYHA 2P4QA 1YL7A 1Z8DA 1FV1A 1TA0A 5DO8A 1MEXL 1S4MA 3D7NA 3ILXA 1XTTA 1EK2A 1UXMA 1OAYH 2J12B 4MGYR 3H19A 3QQ9C 1O1YA 1T1YA 1GRRA 3DX0A 1U8UA 4D3DA 4YL9A 4B96A 4RZXA 2F8LA 2J5BA 3Q12A 3PKZA 1WMAA 1PJ8A 3BERA 4Q9LA 2G4LA 3PUZA 4DEVA 5LVEA 3K4AA 4XNUH 4QJ4A 1VSTA 4I3GA 5FO1A 1W36D 2GHIA 4KJPD 5D7IE 2XTJC 2RHBA 3DTVB 1O4VA 4CEHB 1FZOA 3AG1B 1UL1X 5C71A 43CAA 3RUHA 5SWSE 2VUSA 4ZXBB 2PL9A 3EDOA 7FABH 1BN6A 1SXJA 4PJGA 2G82A 3HN5A 5FDFA 3S7ZA 1B3RA 1T1XB 2BNRB 1JGEB 1FE8L 1Z2AA 2F53A 1NBME 1Z7YA 5IN5A 6PAZA 1O9HA 2EDNA 3IRVA 5E6UA 2PMEA 1PL3A 4YJ3B 3IDOA 5BY2A 2QADC 1I8KB 3KZOA 4XOAA 4GLOA 3THSA 4EY7A 3ESDA 4FHGA 2JIDA 4X8JB 3CX8A 3NGMA 1I7TB 1IUKA 3JCZA 1TJGL 1LRLA 5ANMB 3SAJA 3MCAA 1R3IH 1IWPB 4V33A 4UILL 1F3JB 4LDOB 3RGVA 3LBFA 3QQ3A 1TETH 4BH7B 2E7CA 2HN9A 3RHSA 4B79A 3P9RA 4IICA 3HDJA 4CVNA 2ICAA 4W9CC 4XPZA 4N8EA 1BWWA 3S3BB 1E9QB 1XZHA 4YUEH 3NSDA 1PW5A 3S3CB 2EWMA 5F88B 4QAQA 2C9MA 5LWQA 2EDKA 5E4AA 4WHTA 2C5HA 2GEDA 3BRSA 1F1GA 2VHCA 5JZOA 4M93B 2XQFA 1W2KT 2XNCA 3ZU2A 1XBDA 1XGQB 3FULA 4CDRA 2PSDA 3HE6A 3V4ZA 4RZSA 3WN5C 4PX9A 2WM2A 1USVA 2OGZA 4EIWA 4Z53A 3FBKA 2CDNA 2X9XA 3QXWA 5EE5B 2HA4A 3GSVB 2PKXA 5AK6A 1P7HL 1NY5A 1KJVB 3WB1A 3NFSL 4W1RA 2A0KA 3PNSA 1E3TA 3ICPA 2CL0X 4Q4AB 1A7UA 3ITKA 4HWEH 1B0UA 1NDHA 2X9VA 4KMLB 3N91A 4GZ8A 4D8PA 3JRWA 4LISA 3PQ2A 3RI3A 4PJCA 2GYWA 4BVFA 4AE1A 3DECA 4UDXX 4RDXA 4M9SA 5HQ3B 2IZOA 3GPLA 1A27A 5KYUB 5IT0A 5F7DB 3RNKA 4GBXD 1VAHA 1DKRA 3GFTA 3TSOA 2XQYK 3LVRE 4X6DF 3RK0A 5E24E 2Q4RA 1L4FA 3KAAA 4JX9A 4Z99A 5F7BA 2C58A 2GN1A 5D72H 5J6SA 5CIYA 1HHHA 3VFOA 2APXA 4ODWA 5IJKC 1UFVA 4EH1A 4LKCB 3NANA 1CDCA 1WMDA 3IDJB 5DEGB 2I2WA 3VZBA 1KUMA 3WS6A 3M6AA 1PJCA 3LP6A 2AEIT 1OH6A 1UXLA 3LQAH 2YWHA 5HTSA 3BH8A 4FQIL 1E2QA 3A0UA 3G9ZA 3OUTA 4DT1B 3BZ5A 2PW1A 3WV0A 3LIIA 4DQOH 4U02A 4QULA 1OF1A 2YWFA 2J09A 1OWOA 3MAAC 4WEBL 4HEQA 2H2DA 3VD5A 2AW2A 1TM3E 4TSFD 3M1CA 1YGPA 1I2BA 2DECA 1VERA 4QRSA 4MZXA 4HV8A 3H3JA 3U4EA 1K8QA 2OZVA 4AG5A 1E60A 1KC5H 5DK4A 2AVDA 4Y4KB 3MV9A 4OLHA 1R5IB 1YY8B 1Z0KA 3K2EA 1UQSB 2J8UB 1T1RA 3GEHA 4KAJA 1PQZB 1QIGA 5GHWH 2QL9A 5LQSA 3PNOA 2OLKA 1L5VA 5K1ZA 2WVVA 3A10A 3SBWC 2X28A 1NVVR 1YC8A 3HI1B 3VHLB 2HH0H 1NT4A 4FFSA 4B3MB 3T65B 1DBJL 5CT8A 1U8LB 1Y1QA 1BZYA 4NN6C 4W6ZA 3JTTA 5ALMA 4ZUUB 3U6KA 1XL0A 3I5MA 2CLDX 2OK7A 2EDWA 2G5GX 3ECBB 3BTOA 3UHOA 3TN0D 2FSEA 4WK6A 1K6JA 2V7PA 4A8TA 1D5BB 2GSIB 1MH5B 3F67A 4FSXA 2QGEA 4LXTA 3NMEA 3A9RA 1KE2A 1C7FA 4JFEE 2APFA 2J56A 4K81B 1VJSA 5MERA 2ZJFA 1IAOA 2BDUA 2C8LA 3HJNA 1AZTA 3MGGA 3E8UH 1VIAA 4J3NA 2FEWB 5BVHB 1VJDA 1ULTA 1QRNA 3TWOA 4F15C 1Y3IA 4NQDB 2FYVA 3NVQA 1UXWA 1RK1B 3QRGH 1KKUA 3NMUF 1VKJA 4FQ2L 3HN7A 2QKYA 4BSWA 3ZHLA 3FNIA 2F17A 4N12A 5GGVH 1X7ZA 3QLJA 1WF5A 2R7KA 1U8YA 2F6RA 4KHZA 2J88L 2WFZA 5ALYA 1DEOA 2IC2A 2I8CA 1W2WB 4XPIB 2PVCA 3TIIA 3G85A 3ZD9A 2NZIA 3HZKB 1E2LA 3SYOA 3SQLA 3MELA 4QD3A 2ODWA 1FA4A 3CUUA 2QU8A 4XVQA 3L6EA 3LT5A 2NP6A 2VQ4A 2D1SA 3IBOA 4I55A 3W5IA 4MDFA 3W4IA 2OUIA 4WI6A 1TMGE 1Z7JA 1WFUA 4L76A 4N5IX 3R7FA 3MLZH 3HRZB 2KSQA 3QEMA 2B6HA 3ULVH 4L78A 5FUXA 2R7AA 5EZYF 1PY0A 4G1BA 4HIEB 2QRUA 1QTYT 4C07A 4Z5RB 1GU1A 3IETA 1ENOA 3DMMA 1I8AA 4AJ2A 2J6EL 3NBYC 4JFFA 2QN8A 1SOWA 3I8XA 4LQDA 3FT4A 2DY1A 4XRCA 4OQFA 2BF4A 1TYRA 3FVWA 2YC1B 1SZNA 4YS6A 1ZANH 2A83A 1M9SA 4ACBA 2WB4A 5EMNA 3GXUB 4U2ZA 4LHVA 4JQIL 4YDJB 5TVKA 2J2ZA 1H5BB 3PUKA 3ZKWB 3HM9A 3TJEL 1Z8NA 3MWEA 4E5NA 1FPMA 1TR7A 4ZI7A 3I30X 3QU2A 2WWMC 3UH0A 2FJFA 4H88L 1WPGA 1HT1E 4G5OA 1VFBB 4KZDH 4J1TC 5EVCA 4J6EA 3A9UA 4ELKA 3ZE2F 1NHWA 4U1RA 1PPIA 4C1BA 5E7JA 3QBTA 3TN7A 4TZ6A 3QUKA 3S3SA 4JFXB 2PO6D 4ND8A 1XQ9A 3CFDB 3NAAL 2XGJA 2I60L 4G37A 4K94L 3BCDA 3C60B 1OWLA 3UZUA 3EG9A 4R2MA 4MQ7A 5EWJB 1ZNWA 3U7FB 4JI0B 4HALA 3O82A 4CM4A 2A3RA 1SBYA 4XD7A 1BQLL 1F11A 1K4DB 3IPCA 1UJTA 1A5SB 4YHIA 4PVDA 4QRFA 1VYVA 1K0FA 5TQ2B 1WNTA 3S5LG 4K0KB 3ZY3A 4ZUWA 1LQTA 2XD9A 1XHFA 1J90A 3GIDA 3AREB 2XJ4A 1RIVH 1QG0A 3AM8A 2GBCA 4M6OH 4GX0A 3TJZA 4YSSA 2N01B 4WI1A 1VPOL 1XX9C 5H35B 4M0MA 3L04A 4EEKA 3UHJA 4JM2C 4X7PA 3PPEA 1HZJA 1JLMA 3PDUA 4QX6A 3T3ME 3VW3H 1JL8A 3VDXA 5M3BA 3QWHA 1QQBA 4WI0A 1JF1A 3UK2A 5FYLL 2WU3A 1BOYA 2C07A 3JYHA 3WIDA 1CE1H 2H32H 4L1TA 1DIAA 3AEYA 1XIWB 4CVXA 2E4WA 2ONZA 3BXNB 1U6AH 3F5DA 1ESZA 3CR3C 5H1YA 3ZHDA 1KEWA 3FZUD 4KZCA 4CC0A 2Q6WB 4U7MA 1FORL 3TQCA 4TVPE 3FUUA 5B3SB 3RHWK 1AD2A 3VXOB 1T66D 4K7FA 3L8ZA 3DAYA 1JUDA 2E82A 4L8VA 4QECA 4P2QB 1PKQE 2LAGB 4KRLB 4N3NA 1DQVA 2YN2A 2XUFA 4LOVA 3RJ5A 2JJSA 2EBWA 4IU2B 1TQTA 3E3NA 5EXEA 1A4JB 2FG5A 4Y8AA 5KSBF 3GXBA 3A2LA 3ROZA 1Z0JA 3VPDA 5KSUB 3BL8A 1E3XA 4I4TF 3QQNA 3BEWB 2R2EA 2C78A 2G75A 3MXOA 1E79A 3FUEA 4WY8A 3W9DA 1TIKA 3ARXA 4OA5A 4H0FA 4L6AA 4Z7VE 2C5LA 3CG0A 4QOFA 1K72A 2PX4A 3TOSA 4MV1A 5GSRB 3C5HA 2C9QA 4E9XA 2P9CA 4L85A 1PW7A 1AY1H 1NGZA 2WQUA 3WQRA 1QORA 1OP3H 5GZ1A 4XX0A 3ZJUA 4HUWA 2O0HA 4AGOA 2XA8H 3EIQA 3FO1B 2LKDA 4NUMA 1S3FA 4UT9L 4LVNA 2YPLD 2NACA 5K0EA 2D7PA 4HLDA 2GG1A 4N90E 1P39A 1AANA 4B3SB 1DVTA 1KJJA 1SAYA 3U44B 3ZV7A 1C9JA 1R00A 3GJ5A 2WVGA 1DVSA 4CKBA 2OG2A 3W5NA 2REOA 3ZGOA 4O4YL 4FA8A 3VXMD 2O2XA 2X40A 5COQA 1II8B 2IYNA 1L7MA 3AVWA 3RVUD 1QR2A 2VHJA 1PRYA 5IMKA 4NUJB 3ME0A 4UAOC 2VDPH 1UM5L 2ZX8A 4OGAD 3RLFA 3DOOA 3PQYE 2QW1A 1W59A 3WO4C 3ODGA 1AXTL 1XVIA 3DSRA 2PUDA 4XCEB 4GW1A 1AQHA 3SFTA 3UYRH 2J5LC 2E6KA 5ICXA 2DRIA 1HXMA 2WXIA 4FI6A 3FO9B 3OZBA 3KBPA 2NSYA 5EFIA 3KYKH 4JDEB 5L45A 4IBYA 4OH2A 2XHEA 4GMSH 1L5OA 3DBVO 1KYUA 4TKLA 3RRXA 4DZBB 1CQJA 3F3MA 2B2NA 2C77A 1XPJA 3L4ZA 2Q3AA 3W2DH 3FB8A 2ODHA 4PJDE 1JQJC 2NTNA 3FTYA 4XCFH 4Z9YA 3M4NA 3DW1X 4YBZA 4FFOA 2F18A 3DUWA 1NONA 3WP0A 2JCSA 1KO8A 1L7PA 3DONA 3MJDA 2NUAA 3PFHA 4D41A 1RYBA 5HGAA 4OQZA 1VACA 3M5CA 4JEMA 4M7ZB 5B2ZA 4O02B 1A76A 4HMCA 5G4NA 2FWOB 2UVPA 5EOCJ 3TUZC 2MNJB 4K6GA 4O51A 4GP6A 2OEPA 4QNPE 2YEQA 3ES6A 1YDGA 5BV7H 5DMXA 1T36A 5FUQA 3QLTA 2HKFH 1QBLH 3S0PA 3ZE8A 1CFTA 2V7VA 4IAOA 4MA3B 1G5HA 3AB3A 3MZ0A 3THOA 3CAFA 3MJ9H 2ZRAA 2PSEA 3CVJA 4AG3A 3OX8B 2PE5A 1TCRB 3WYCA 5ADPH 5EIHA 3S36X 2UVDA 5C1MB 4D3FA 3QP3A 4BC0A 4A2WA 5DOZA 4JRYB 1MZYA 4AJOA 1DDHA 1EM8A 3NESA 1Z3RA 1SHTX 1V5JA 2HKHH 3QI9A 1VA4A 1H69A 2SKCA 3UY4A 1HKLH 3KLHD 2DBYA 2RGUA 1T29A 5GIOE 3NBMA 3WLBB 4LHUD 4Z9BA 5FAAA 2NDFA 4WV1B 4X8MA 4CCAA 4BV8A 4MVYA 3FDZB 2HJVA 4L1SA 1W1UA 5FWXA 3DKPA 2DKUA 2NPOA 4FYQA 3DLIA 3U62A 1F20A 3HI6L 4DETA 2YRPA 2JI7A 4Y9UA 1Z12A 4RA3A 2FEDD 1SVSA 3SXUA 3CLFH 3EZ8A 3KKLA 2ACEA 4PP2B 2ZZMA 3E6AA 2YS6A 5ETJA 3LPCA 4FR5A 1XTMA 1L1FA 3JYBA 4W1TA 4RK7A 2V5VA 2DQDH 4S1RH 3CFUA 1MNNA 2B39A 3EWIA 5LNK1 2FPPB 4FEYA 4XB2A 5AAMA 4C76A 4JC8A 3JAKB 1X38A 2OMTB 5EPMB 4IMLA 1HYSC 4E94A 3D6FA 3VWJD 1RABA 2DEUA 2OQJB 4PJ9D 1XV5A 3GOHA 3PR2B 4QLRA 2ERXA 4IXTA 1PJWA 1TEVA 4J4BA 2CNKA 3M70A 4ZFFB 4C06A 2MYNA 4EUPA 2JBWA 1XCJA 4OJKA 3V7WA 2Z64C 3QXAA 1GWNA 3ZRCC 4M54A 1YNKH 3CC8A 3UXHA 1U5AA 4N2BA 4S0HA 1AOXA 3MUGB 1KB5B 4MKHA 2NY3C 2B9VA 3F58L 4JLWA 2X14A 1KLFA 1Z3GH 3F04A 1X5FA 2KPNA 1BX0A 1CUEA 4KR7A 4DP0X 3L4SO 3OHPA 3GFGA 2IALA 1X9LA 4RJKA 3V6FA 5U9CA 4EN3B 2I65A 4RV5A 3MTJA 5KSPA 5FGSA 4L18A 2B61A 4A10A 4QOIA 3IMGA 4MAFA 1LDNA 3W8RA 1UKZA 5I1IH 3Q87B 3TVMA 2AX4A 3KEQA 1QP4A 4L74A 1BXRA 3U4BH 3B8YA 3L6FA 4OIIH 1Z45A 1SCDA 3JAWA 4BHUA 1HAUA 3DAOA 2R8BA 3EDJA 3HMXA 4PB9H 5C0AB 12E8L 3PC2A 5KNDA 1M2NA 1F6DA 4QQNA 4UYQA 3GJYA 1YAZA 2GK0A 4DGVH 1JZ4A 1Q1JL 4HKJB 5D7SL 3KHTA 3EFDL 5LDGA 5BR8B 2GBIA 3O74A 4H25B 4P2YA 3N0XA 4NNXA 3ZX5A 1FFDA 2R59A 4AIRA 4OZIB 3DYMA 3GSXA 2WV7A 1THCA 2YOAA 5D5MA 4O2FA 4NAUA 2PCXA 2CDGB 5MEQA 2FQGA 2ZUCA 1IY9A 4HQOA 1M7BA 2WY3B 1IHDA 1DAKA 5LB2A 1VBKA 5H80A 3E15A 5JNYA 3WGMA 5CKAA 5EU6A 2PIAA 3M9WA 3TCXA 4AI6A 3A6HA 4UT9A 4QDXA 5MFPA 3G2JA 2VR7A 5EY5B 1KXTB 1E9AA 4JMXA 4ODUA 4AL8L 1P29A 4MAYA 2YVLA 1YDMA 2G9KA 1J2UA 1F45A 2XUOA 1E58A 4RTSA 1OFTA 4HKBA 5JCJD 3QDGA 5EKTA 3OT5A 4PZ9A 1E7WA 3FKQA 5DW0A 1WY7A 1OFVA 2CT8A 1RQLA 2EC9U 4KKNA 2OJEA 1QFOA 2K7PA 1CFVH 5I4CA 2PX0A 4NLHA 2CVQA 2PAFA 1CXIA 1ZTXL 3LLVA 2PYZA 4TXVB 4QXPA 4JQXC 1RPNA 1INDL 5AUPB 3T0GA 3C3BA 4PGEB 1HEJC 1QJ4A 1EDQA 1E28A 1Z34A 4GQBA 1EMTL 3KQSA 2ZSDA 4FZ3A 3SYMA 1NC2A 1MU0A 1C3XA 3VG0L 1DI0A 4BBPA 1QTSA 1CVLA 2QPTA 3W7BA 1QK5A 3KD3A 3I1JA 1I1RA 5TQVA 2IYFA 4F1ZA 1IN8A 5EHZA 2GHTA 1E5DA 3EOBB 5CCEA 2B4TO 1N6VA 3BKMH 2NQ3A 3U9PL 5J57B 3ARBA 4FSHA 2JGMA 4OI4A 3NP3A 4OJDH 4O2RA 3T6VA 4DAOA 2FEJA 1TO1E 3BHNA 2BDNL 5CJ8A 3RI5K 2WU4A 1A5TA 5I9TA 4NB7A 2CNNA 2BGNA 5KDOA 2ITDB