3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
4Z7QB 4G1MB 3OL2B 4NEHB 1QC5B 2XWBF 3EH1A 2UZYB 1UEXC 2VDMB 5E6RB 1M1UA 1RD4A 1JV2A 3BQNB 1MJNA 5KYYB 3OL2A 1QC5A 1L5GA 4MMXB 2VDKB 2VDRB 1RRKA 3T3PB 3ZDZB 1SHUX 5E6RA 5KYYA 2IUEA 4MMXA 3EOBI 1SHTX 3PPVA 1N9ZA 1CK4A 3F74A 3T3MB 4C29A 3VI4B 5BV8A 1DGQA 1XDGA 2ODQA 1ATZA 1JEYB 3RAGA 4MMZA 4UM9D 3V4VB 4IGIA 3EGDA 1CQPA 2ADFA 5KYNA 4FWWA 1JEYA 4Z7NB 2I6QA 4JDUA 2VDLB 1ZOPA 3HI6A 1IJKA 3HXQA 4GZ8A 5HDBB 2B2XA 4NENB 5KYUB 3IJEA 1FE8A 1V7PC 4Z7OB 2P28A 1ZONA 3EGXA 3TW0A 1JV2B 3NIFB 4NENA 5KYUA 3AL9A 3NIDB 1L5GB 3EFOB 3QA3E 4WK0B 1AOXA 1IJBA 3PPWA 3ZQKA 3ZE1B 1SSLA 1IDOA 3EFOA 4CN8A 4UM8B 1XDDA 4WK2B 1PCXA 1MHPA 3K72B 3ZDXB 1IDN1 3NIGB 3E2MA 1T0PA 5E6SB 3K72A 3K71A 4IXDA 1SQ0A 4MMZB 2XGGA 3EGDB 1PD1A 3FCUB 3ZDYB 4O3UB 1JEQB 3BN3A 4FX5A 5E6SA 1FNSA 3M6FA 1QCYA 1RTKA 1JEQA 5E6UB 1BHO1 2VDOB 1M10A 3IJEB 3ZE2B 2VDNB 2NVOA 2NUPB 2ODPA 1Q0PA 1MQ9A 2X5NA 3EGXB 4M76B 5E6UA 1MF7A 4PN7A 3TCXB 2NUPA 1PD0A 2XWJI 1PT6A 1OLZA 2I91A 4HQNA 3F78A 1YUKA 1AUQA 3AL8B 1N3YA 3PPYA 4UM9B 1XUOA 5KYXA 2VDQB 1M2VB 5HGJA 3FCSA 2WINI 3K71B 3V4PB 3VI3B 3AL8A 4K3JB 2WW8A 4WJKB 4BJ3A 3AFCA 1M2VA 3HXOA 3OKWA 1ZOOA 3TXAA 4C2AA 1RS0A 1BHQ1 2I6SA 3PPXA 2VC2B 4F1JA 1M1XB 2M32A 2VDPB 4DMUB 3BQMB 3EH2A 1U0NA 4G1EB 2NUTB 3IBSA 1M1XA 5KYWA 3K6SA 1LFAA 1T6BY 2O7NA 4G1EA 2NUTA 4C2BA 1NA5A 4HQLA 4G1MA 3GXBA 4O02B 1MQ8B 4WFQA 5LN1A 1MQAA 4HQKA 4O02A 4F1KA 3EG9B 4WK4B 4XW2A 2P26A 3Q3GE 3TVYA 5KYXB 1SHYB 2ICAA 4HQFA 4MMYB 3FCSB 3NVQA 3EG9A 4IHKA 1DZIA 3OKYB 4MMYA 4JX0A 1M2OA 4HQOA 1OAKA 4A0QA 1U8CB 3N2NA 5ES4B 5HJ2A 2QTVA 1U8CA 3ZE0B 1TYEB 4O3TB 4CNBA 1U0OC 3K6SB 5KYWB 1JLMA 1YVRA 1YVPA 4CN9A 3EOAI 1AO3A
chains in the Genus database with same CATH superfamily
4C7JA 2AEJA 3OHPA 3U80A 5J4KA 4D3XA 4MVJD 4IHJF 3DTXB 1OQOA 2B59A 2IOYA 1Y1TA 3B9KA 1SHMA 4HWZA 4A2EA 1R24B 3QQDB 3MYYA 2BS71 1MJ8L 3O93A 1FVFA 2NT1A 2JJTA 2EZ9A 2L18A 3IDJA 1JXGA 2VZ1A 3AINA 4QOKA 1DO0A 3BTSA 3CH1A 3ESBA 4X4XB 3CLVA 1HHGA 1T0PA 2WAHA 1UURA 4B6GA 5I30H 3B20A 1S7WB 4H5SA 4NOBA 2X7LA 1AR1B 2EAEA 2JKIS 4FFWC 3Q1KA 3PRKE 4JCLA 4QRAA 1RAEA 4UEWA 1HIMH 3STZA 5B38G 3PUZA 4JY4B 3CZMA 1XHHA 4PTTB 1HSBA 4M9QA 2A6IA 2R86A 4WNCA 1CFJA 5DGRA 4KI5C 5BZWB 2ZX7A 3KCNA 2A3RA 2JZCA 2LE0A 4Q05A 3RFVA 4U2YA 4BL5A 1ML3A 4FQXD 1SKBA 1ED3A 4YHML 3ET5A 5C3IA 4AZ0B 1CBUA 5G1OA 1TE2A 4Q9NA 3LSTA 3QW2A 4YSEA 4RWYH 3SOBL 1SN7A 4EHLA 3FFTA 1OAJA 5ICXB 4YXLH 3TNMB 2QSVA 2GPBA 2UX7A 2G36A 1DHRA 4BEWA 4U2EA 2BT4A 4H8WL 1C8KA 4FG6D 4L4UA 4AYMC 4P1ZA 1LK3L 4URHA 3R5KA 2GK3A 2I1VB 1JD9A 3O4IA 1E4VA 4DOHE 4GRMB 1JSLA 1MCHA 1DBRA 5LP6B 4K1LA 4MS3A 5DS1A 1U6KA 3JWOL 2IHTA 5HJ3B 1Z6PA 4J3UA 4MRMA 4O2EB 1KPUB 1CR4A 5ACZA 1H3VA 4GF5A 4ONEA 3WHIA 4P80A 4QFDA 3TVMD 5HF6A 3BRFA 3RVTC 4HGWB 1COWA 3RHWK 4NNYA 3NIGB 4JI4B 1QYCA 2FZVA 5E24E 4PJBF 1MAUA 4ERNA 3C1OA 2YPLB 2BONA 3GFPA 2GT1A 4HDSA 2QKIB 4DCGA 4R2GC 4TL6A 4JK0D 1WOYA 1OYYA 1EHYA 1XRJA 3RZCD 5G4KA 2FT8A 3RYIA 3R7LA 4CM8A 4K23L 1I1AC 4CGZA 3WU1A 2LQRA 4HNAB 5JW5B 1GARA 4CBVA 2D00A 2X2OA 3H5TA 2DCUA 3OCVA 5FO9A 1A3LH 3G6DL 4S1OA 1D4FA 3PDIB 3M1OA 2ZXQA 4OZ4A 1NULA 4MX8A 2DF3A 1B93A 3U2QA 4MW2A 5BYJA 1QCZA 3QYAA 3V4UH 4G5GA 2IANB 4N5HX 2XG5B 2Z91A 2R87A 4ZCSA 5D9SB 4R3SA 1HT1E 1V2GA 3A0UA 4L72A 5HE9A 1MFBH 4M7KL 2H63A 3LDAA 2OL3H 1EBUA 3KOUA 4Z7VA 2DFNA 1YOBA 5ISZA 3GRUA 4WI6A 5DC9B 1EG7A 1G19A 4E5UA 5DHUA 4DV3B 3M6VA 4RQUA 2D8KA 2IODA 1CK0L 4L3WA 1EWQA 3AITA 4ZTPL 5CHNB 4QWWC 2Q3EA 3HRIA 2QGBA 4WZAA 4WKZA 1SVZA 3FX2A 5AVVB 3PD1A 3WYAA 2BVQA 5IEKB 4MYDA 4Q1BA 2GN0A 4NENB 1GGJA 4LYJA 2JFNA 4QXQA 1IAKB 4C6SA 2QPOA 2IPUK 4DEYA 5JDSB 3O8OB 3LECA 4XNXL 4E68A 5BSEA 2HFGL 3QVUA 4I5IA 4AKEA 3GMLA 1AD9A 1ZJBA 5IHUH 4LVCA 1LP9F 3IULA 4AWXA 1AS0A 1PZ5B 1NF8A 4R1PA 3W3AH 2VO8A 1XDZA 3EGXB 3CLTD 3U79A 4NSKB 2YUZA 3H1AA 3OF2A 1S5IH 1GCYA 2NNWB 4R8KA 1MEXH 3RS3A 1AA9A 1T4GA 3B2QA 3GUUA 2BCMA 2C7UA 1PEDA 4HAYA 1YOVA 4UHJA 1TTHA 4EAQA 1MHHA 2QK4A 1MAAA 4P7FA 4PSDA 4A67A 5JH7F 2QTCA 1O75A 4ISVB 2XUKA 3FCAA 3AL0C 4TYPA 1G8JA 5A4IS 4J4TA 3EAGA 3K9CA 3UVEA 2GQHA 1QCCA 5FPHA 4KKCD 1N5YL 4PRBA 3SAJA 4JKOA 2B08A 3WLSA 2NR6A 2WQWA 2F48A 2R9VA 3QVGA 1VHJA 4GPEA 2H0EA 5T5FL 2XXAB 5C7XH 2VRCA 2O5XL 3BWSA 5HJDA 4JLWA 4NFBA 4K9LA 3MERA 2A6PA 1K6JA 4YJHA 3ILEA 4ND7A 3VH8G 3ZHUA 2YFNA 2G1JA 1A6ZB 3QH3A 1E27A 3EZNA 5D5MB 1F97A 4F7PB 1U0HC 1QS0A 1VFOA 4GW5A 1I9CA 3M6XA 3HI5L 4L8DB 1IYZA 1S3SA 2XUFA 3LT1A 5B1KA 1KSFX 1KDOA 4LP4A 1JR3A 4BMDA 4FU0A 4MQFA 4QVKA 3ARXA 4FGJA 5B38A 5JXAL 3L13A 3WNCA 4PJDF 1LDBA 3BT2L 4RJKA 3ULVC 1QNIA 1T04B 2XRAL 2YD8A 3S99A 4DQ0A 3FSEA 1D5ZA 4BBWA 3CT6A 5KS2A 3LLUA 4PJFE 4TKVB 3QPQC 1E1YA 4BFRA 1ZDMA 3H04A 1SURA 2XLLA 1H22A 3GHYA 1QXSA 3QK0A 4FGSA 5LWHA 4RJ2A 4FT2A 1G20E 5LP1A 2BY2A 4BQPA 2E7CA 2VT0A 2WKRA 2ADGB 4X7PA 3R23A 3GJ3A 3TCLA 3CVOA 3MLWL 4WI5A 2FO8A 3QVJA 5IZCC 5DJCB 3WY2A 4MA0A 2O6HA 4ERSL 3UZVA 3RCBA 1JMVA 3GXNA 3SG0A 3LXMA 1DBBH 2O2XA 1JT2A 4DT1A 1FCGA 1MO3A 2EO7A 1WA2X 3QK7A 3DEHA 1ZU5A 3HMWL 4X9GA 4LRTB 5C8JB 2VJMA 2OYCA 4FYKA 2ZWZA 1AHWC 3D18A 5D6CA 1WDWB 1U9JA 1OTTC 4UHEA 1RI2A 2OFFA 1M34A 2ASVA 1FFYA 1A9TA 4G6KH 4HMQA 4W9GC 1BEUB 1V16A 1X3DA 1HH9A 3QIBB 1I3NA 3MV8A 3WFBL 3K9WA 4C0WA 1AKWA 4LBEB 5C0RH 1QPGA 5TH2B 1FFGA 3KT0A 5K0SA 1EBPA 5JQHC 3TM6A 2GCNA 2CYCA 5KN5B 3KQWA 2HCFA 1RERA 4J16C 4GMDA 5A7FA 4IX9A 3LGXA 2H7VA 1R3KA 3VZRA 1CL7H 1X87A 1JEDA 2WZBA 4XNMA 4OHRA 3T1TA 2A14A 3TESA 2Z1DA 4UUPA 1E9RA 4OHCA 1T2XA 2BM8A 3HS3A 4HHEA 2GJ4A 2J85A 4JUAA 4S11A 4WSGA 4KPHL 3T0EB 4C7OA 3Q44A 1JGEB 2X3UA 5E6YA 3V8VA 2FG7C 1BJ1H 5TVGA 2IV3A 4KI1A 2LW7A 3JQPA 3FUXA 4KTGA 1ZJ5A 1JGLH 2PS1A 4WWKB 1GCOA 1R5VB 2LAAA 2NXJA 2FWNA 5EIBC 4C58B 1QW8A 4OFDA 4LHSA 1VE3A 3RYHA 3A1DA 3C5EA 1YG9A 4XDYA 3GH3A 1RYYA 4AKSA 4I2NA 3WE7A 4G7QB 1Y7IA 3EHDA 4E5YA 1B2LA 3L9RB 4XIJA 5K2OA 1I9RL 3NA9H 4EKEA 4CKZA 2ZWVA 2OT3B 3MRDA 5IH3A 2IK8A 1R6AA 4IRJB 3T1NA 3P0VH 5EJ6A 1S7UB 2EHDA 1CK4A 3WA7A 4Q4DA 4UAJA 3SXUA 3QXWA 2JLRA 2VN6A 1L5KA 4D9MA 2NTYC 1VACB 2YIMA 3LCVB 2VZVA 3LIIA 2VDQL 5LXGL 1PYDA 3MBKA 3UJTH 2G17A 1XZ8A 4HUQB 3CMGA 4E0RB 3A6LA 2X8LA 1EP2B 4BN4A 5FB3A 1RRVA 3A3YA 3ZHBA 5AKGA 5EU6A 4XMTA 5DVKA 4E42B 5IASA 1YEDA 2GBGA 2XIQA 2XITA 1UXSB 4RM3A 1CP3A 5J9PB 3H9SD 2Z34A 1RJEA 2VRBA 3GAAA 4IXWA 2AK1L 4EB6A 1KIPA 4QLOA 3CFEB 1DQJB 1WDLA 3PP8A 3DGFC 4MS8C 1IJFA 5E0KB 5C0CA 4MQLA 1KCUH 4MJJA 1X9LA 5AM3A 3O7WA 2V45A 3GCXA 1GZUA 1ZICA 3PFKA 4L74A 2XPYA 5JNYA 4FG2A 1T4WA 3CLSC 3O47A 4XC1H 1PAUA 2PUAA 2C77A 1XX9C 2FA9A 5SYNA 4D3ZA 4S05A 3TQFA 3FOMA 3DX2A 1IEAA 4I6JA 5EWLA 1DBSA 5DLDA 4LOLA 5L40A 4XVQA 3QYPA 4HNHA 1MJNA 3U62A 3IR5A 1H9AA 5KYYA 3AJRA 1FW6A 2R83A 4F8YA 2Q6WB 2NZ9D 1IBHA 1FP4A 3FN4A 1SFHA 2HH9A 4L1KA 4B5KA 3RX5A 4XPBL 5JHDD 3HUDA 1GUBA 4PRIB 3VH8A 2I1WA 1IC7H 3N42B 1PAZA 2FQQA 3PYMA 2PA0A 4FR5A 3BD7A 1EWRA 4K9PA 1BJKA 4YFYA 3GKWL 3LA6A 4P5TC 3RVWD 3A21A 4AGMA 1NCCL 1AB5A 4ZAFA 3E9MA 2CF5A 1HBJA 2ATEA 3O0LA 3HG1A 4H77A 3D81A 3RK0A 5KNLA 3L4CA 5TV2A 2YVLA 2Z9DA 1DQRA 1JLRA 4U33A 2J9ZB 4P7JA 1VMDA 1AVTA 3ME0B 5A6IA 2OPHA 2FG6C 3ZY3A 1L4UA 2KJQA 4ZNEA 4XRGA 3U0VA 4LQDA 1SUSA 5IABA 3MHTA 3EHEA 5ERGB 4CR8A 4XI9A 2WB2A 3LHAA 1DAKA 3OP1A 4YVUA 1KDYA 3DVSX 2AQ1A 3L7BA 2DQTL 4OB8A 1EP9A 1WRBA 4LEEA 4JQVC 3A58B 4JM2B 1P3DA 3AJ9A 4KQKA 1SG0A 1AGXA 1P2BA 4PNZA 3CDGA 2EXYC 2JGAA 4P3CH 1RHUA 4OLBA 3TLMA 2GTZA 1B16A 3T9EA 1P61B 1OYWA 1U6JA 2AVNA 2HT4D 3U1QA 5D87A 1OAUH 3ZOKA 2ZT5A 3EOBA 1EXVA 2ZNXA 4L6IA 1K97A 1P4LB 1IH8A 5CM1A 4CIYA 1DCFA 3PF9A 3AR5A 1EK2A 3EWAA 4Q1VA 3HN8A 2EBFX 3HL4A 1SOAA 4KK6C 4XNZB 1T22B 2ZIGA 3MLVH 1UMBB 1Y4UA 4JFDE 4MW5A 2OW7A 3TQRA 3PITA 1QR6A 4K2UL 4ZDWA 2MINB 3LT2A 5EPOA 1A04A 5T33L 3PUCA 3FKQA 3BFVA 4DV2B 4EN2A 2OXFA 2A1WH 3IE2A 3ARDC 3S88H 5GONA 2Q5FA 3Q11A 4KHPB 15C8H 1KXTA 5U1PA 1J00A 3EBHA 4HQQL 2FFAA 1FTSA 2AG1A 4J1SA 1B8OA 2E4VA 4Y7CA 1FYVA 3F78A 4R96A 3OFSA 5B4VA 3HHMA 4PHHA 5LZ2A 3H9UA 4RFSA 5E8NA 4K3JB 2ZJ5A 4HHAB 1B7GO 3TXAA 2XIDA 4ZI7B 2MDTA 4IDJH 4F37K 3GYBA 5AKSA 1T1YB 1Z6TA 3V33A 4P2OB 1WXHA 3O2DL 2FX5A 4D9JA 1UK6A 3C6KA 5CG1A 3G6JF 4G3XA 1KH1A 5CP3A 4US0R 1NAMH 3X3FH 2XYQA 3BXZA 3M8KA 3LEVL 2IQ9H 1UH2A 5ALLA 4RGNC 1RI3A 2YYZA 3GBNH 3ILYA 4QHNA 3TSYA 3ZWPA 4QU0A 1O54A 4YV1A 3OWHA 1ZTMA 1VSQA 4F6LA 3P30H 5DVNA 1UBRS 5CPFA 3SXPA 5DLEA 4CCSA 3D7LA 4XNDA 1O8CA 2IZ1A 3L2MA 2I32A 4OP3A 2BSCA 1GTRA 1BCRA 4PJGB 3BQUB 1TGYA 2YPVH 1PJ9A 1B8VA 5J56B 2GZDA 2J31A 3JZ7A 2FHSA 4M6NL 1EJ6A 3PL6A 3G89A 4LY0A 4YPGB 2V6FA 5CAEA 4TMVA 4RD2A 4FDUA 1F4YH 2BVUA 3PHSA 1L5QA 2DYPD 5I15H 2AI1A 5KTPA 1ZHBA 3FCOA 1ZK0A 4PGZA 1Z6YA 4PVDA 1NQWA 5LAXB 4KK8D 1E77A 2FX3A 1RTKA 2MIIA 1DC4A 3QMWA 3UMMA 4N5EC 2XETA 5I82A 5JIPA 3FCTB 3C6YA 3I2GA 3IMKA 3W2EA 3L1IA 4GSDH 4NI6A 1X7GA 4DLAA 5BN5B 1CDYA 1V4VA 1N5OX 4M1ZA 1LFAA 5EG5A 5JO5A 3CLHA 4ZRGA 1FL3B 3BHJA 3HP4A 3MRXA 1T5SA 2WG2A 3KO8A 5TDOB 3ZCVA 4GP5B 3SCMA 2YZMA 3G2OA 4N2DA 3RX7A 3UV6A 4JFUA 4AYWA 2VQ4A 1VFPA 3I8XA 4UE3S 4ZQIA 2WABA 4W9EC 5EEYA 4LPVA 1KYOK 1GKYA 5AI4A 5CXXA 3OL2B 1CXZA 3C09B 5FGBA 4OCYH 4NEQA 4XOEA 5KNCD 1BOGB 3ID6C 5TEVA 2BZSA 4QFCA 1E4XH 4YUEH 3F62A 3WXBA 2YRWA 2QUHA 2XMPA 1YB1A 4RAOA 5AHRA 1H8LA 4AKTA 5FOJA 4DCCA 5BV0A 2B4CC 5AJZA 2YJ5A 3V34A 4KKVA 4H1UA 1NZRA 5KYUA 1OAKH 2Z1KA 4L4TD 3C4QA 5AKHA 3K9GA 4JJKA 2LV8A 3AR2A 2YWRA 3NVKI 4KZEL 3RW9A 4CSTA 3NIGF 1A9ZA 2DWDA 4XNUH 1AJEA 1W44A 4OCRH 3LQ4A 1P1BA 4MNGB 2FB9A 3WGJA 2NW3B 4J3OD 3WS6A 1ZE3H 2O48X 1GPWB 4GKNB 2WV7A 3FT2A 2HU7A 3BUDA 4AIOA 2WA1A 4KKBC 2QA5A 1F4VA 3UTQB 4M93C 1Z22A 2HFEB 3ARVA 2IWHA 4OK3A 3O11B 3Q8LA 1PS8A 5KC8A 4IRSD 3P52A 3EVCA 3LVRE 4W1TA 1WZCA 4MRCA 4IMIB 3L8EA 1NM5A 4W6ZA 4DCNA 4UVDA 3AJ8A 4L8FA 3HDJA 4N2IA 4JR1A 4HUJA 3RNQA 4RTPA 1WP4A 2BTQA 1XIWD 3RS8A 3I04A 1DVFB 3WDMA 2XN9E 1WKVA 4WV1C 2C0CA 1ASOA 4ZOBA 2JH9A 3CEMA 3P71T 3EDJA 5GRZA 3RFZC 4ZDHA 3CSFA 3EGCA 4O2BB 2H7XA 1AUPA 4ZHQB 5BMOA 3W7AA 1UP6A 1JEYB 4IIBA 1DDGA 1QTPA 2JFCA 1RWXA 2KLSA 2IQIA 3HE6D 5KSAC 4W6WB 4Z6KA 2GK2A 2YWZA 3ESNA 4JDVA 1QG2A 2GEVA 2F4VB 4JQOA 5FF9A 2FTKE 5FGSA 2AEMA 3DM5A 1VCMA 1Y6JA 2JKWA 2L8AA 1U8TA 1JYXA 2AKRB 2R7MA 5KSBA 1ZSDA 4KYVA 1GG8A 4N2FA 4JXJA 1Z5ZA 2GYWA 4P2RB 5B39B 1E4EB 1X5ZA 1SXJB 3Q48A 2Q6OA 2Q1WA 5E7QA 3U1SL 2QTHA 4A1FA 5HHQB 1ZRSA 4MPJA 5FB8B 4D82A 1I8AA 4HX2A 2AJVL 1ZBQA 1R50A 4UTPA 4BZ2A 2QMHA 4TRNA 2O8EA 5ED4A 4TSKA 5K4AA 3T5GA 2DWQA 4E9QA 4AECA 2VLKA 3MCG1 5DEJA 3QQ3B 1X2EA 3CZ4A 2VJQA 2GFBA 5BUPA 2CBPA 3K8LA 5AXBA 4EHHA 2CRIA 3LN4B 2AQIA 1ZGLB 2TMYA 2D7QA 2NZ1A 5LFAA 1FLAA 1OY1A 2ENYA 4M4PA 3VXRD 2YJQA 2TMGA 4TQHA 4LCWD 1QMPA 3SF8A 4DLKA 3Q7EA 1E9AA 4OGGA 5H83A 1T9AA 1QNLA 3PEVA 4YAOA 1VMAA 1JZGA 1WPGA 5KU7A 1M8JA 3N1UA 3STWA 5B1CA 5J6HA 4LHVA 4GINA 2WBJA 4Y5XB 2ZWOA 4MINA 2GITB 1V3KA 1KXZA 1GWNA 3UJ9A 5CITA 5AXDA 3DL7A 1JXKA 2NOAA 4JJFA 3UJJH 4LIQH 1IBGL 1IC4L 2EDHA 3RY6A 3O9MA 3OPZL 3PJRA 4C07A 3PX3A 2VUHB 3LP6A 3OVUB 3FUJA 4YAFA 3KDPA 3QS2A 5GRXG 3UTSA 4DR7B 1GDTA 5D5MF 4G5OA 5T7BA 4L5IA 1FRZA 2BP8A 3RJ9A 4DLBA 1BKYA 1I53A 5J4LA 3KQQA 3KEMA 2MSNA 2VDNB 1O7VA 3W5MA 2CJSA 1W85A 2NX5A 3D39E 3PYCA 1LX6A 1Q2UA 5K09A 4KR7A 1N18A 1DFHA 5D6NA 2CFOA 1BA3A 4WFFD 5TMDA 2PIDA 4KX7A 3CRMA 3DMNA 4PAQA 4RK1A 4BJ3A 5FWXB 3VD4A 5DIFA 1JQKA 3RJOA 3H84A 3NZHL 5GGVL 1JF5A 1F4XL 5BRZD 1Z35A 2WWRA 4X41A 4ZUSA 1CI5A 1NUUA 2PUCA 3UO1L 3UG7A 3IKVA 1JL3A 2HCRA 3MLUL 1H0HA 1EZSA 3ENWA 4Q8BA 2W5PA 1LO0H 4WJ5B 5FR3A 3JWPA 1SN0A 3DVFA 4DKFH 1DVSA 1BKSB 4B7XA 1HINH 1J49A 5GOZA 3SDAD 1HFKA 1TA9A 2CVZA 3OT1B 4NU8X 4HUXA 5BJTA 5LQJA 5LUAA 3PNKA 2IXFA 4JSYA 1FZKB 3VE0B 3F7RA 5EWJA 5TQ2B 1GZHB 1QBLL 3LXUX 3IDYC 3JYOA 4FOSA 2C7QA 4IFTA 3ARBA 1CN4A 1U30A 4QIRA 3HUJB 4X1IB 5CEZE 4OYRA 1L5RA 3D85B 1EEHA 3ZQKA 4X80H 1E90A 1YL7A 5JR1L 1CIJA 1KO1A 2Q5OA 4QKXB 3H5WA 4EGJA 3AV3A 2XKUA 4I87A 1BQSA 4ZK6A 3BCHA 4OFPA 2WUEA 3UGEA 4L85A 1G7LB 3A9VA 2JIDA 2DYSB 5F76A 2OM6A 1J8YF 5AKKA 2P52A 2OKGA 2G0TA 2O2IA 2GLXA 2Y92A 1FSPA 1FXSA 5CURA 4UUMA 3FQWB 1D6JA 2I24N 3GGWB 3PL5A 2D7JA 3ZYZA 2XMBA 3PFHA 5D7JD 5ICZB 5CB8A 3UUEA 4HAVA 2F18A 4NF2A 3M07A 2FWSA 2ZPAA 2FR4B 5K0GA 3OOHA 3SS7X 2GUGA 4JUTA 3T54A 2E5LB 2O0LA 4I18A 1YS2X 3Q3CA 2QTVB 1CQJB 4Q4JA 3AFHA 2DH3A 4PBVC 3LUJA 4OHVA 4I4TA 4EMZA 5KHOC 3C7TA 2JKZA 3LH2L 3WNIA 3CK0L 1GUZA 1YEFL 3D3KA 2BI7A 2PXHA 3FB7B 2BEKA 3DHJA 3GHEL 3H6GA 4TMPA 5KTKA 2JD1A 4KKQA 2DWOA 5EP2A 5FOVA 3W1VA 2H65A 2GEQA 1WEKA 4Y4KA 3TC9A 2DQJL 4X1YB 3MNWB 4KR2A 3IUBA 1TITA 1VADB 2OFWA 1V2HE 3UMJA 2ZCKH 5JAZA 3DE5X 3ALXA 1N0VC 4KX5A 4Q89A 3O3EB 2KMWA 1KY3A 1CUOA 1M6UA 4ZCMA 2AJLI 3UOGA 2QT6A 1Y8RB 2A74B 2ZCHL 4P5EA 2OMBA 2X4RA 4PB9L 2MJLA 4DKJA 1FZMB 3V7AG 2Q8AL 3QXVA 1J99A 3RU8H 2OHFA 3A25A 1U65A 2WTBA 1AIZA 4YHZH 4MIEA 1ECBA 4WA7A 1D5CA 4PG9A 1MCIA 1U2EA 4OFQA 4K3DH 4DSZA 1FA9A 1N1MA 5ALZA 3IPXA 1RK1A 3KCWA 5ITFA 3DX0A 1ZOSA 1S9YB 1P6WA 5BVPL 2FUCA 2ZTUA 3E38A 3HPJA 2BFOA 1QIFA 3QHFH 3ZH2A 3QI9A 2RMKA 3BP4B 1QFZA 1X5JA 5CF3A 3WEAA 5GM2A 1RC8A 1U8CB 5JMOC 2R5WA 1YUBA 1KGXA 2XMCA 3B78A 3ZUPA 3AVXA 3NHPA 2RFXA 3H1TA 4KOAA 5D4IA 1BD2B 1UZAA 4OF0A 4Q03A 4DC9A 1YS7A 3GVIA 1I7QB 1HL8A 4UMFA 4KFRA 5AI0A 2VHJA 3E3MA 1J5HA 2IY9A 3A9SA 3KQVA 5FM5M 3VQ1C 4TXLA 1KBQA 5L95A 2XV3A 3V2AR 3GDHA 3MV9A 1U7XA 4MA8L 1VLVA 4BM7A 1B8NA 1ZT4A 4XOIA 4JXKA 1X7XB 2A9FA 3N42F 1NN3A 2HTKD 2AANA 3KPQB 3P27A 3MJ7B 4P2AA 1TZHB 3V9EA 4U1HB 4N0CC 3VGGA 2A6DA 3LY6A 4KDTA 2BFBA 3W5SA 3MJSA 3N9IA 3K6KA 4UOW1 1STOA 5F3DA 5DZNA 1T8WA 3HBJA 2HG0A 5TMEA 1UZ8A 3FAXA 1U63A 1EJ2A 1YNKL 4GRIA 1LPAB 3TDKA 1Q0RA 4XMKH 2MSLA 3OMWA 3F7MA 2IX3A 1WHTA 3JD2A 1C81A 3H7AA 4L1DA 1KYZA 1C4WA 3Q8BA 1I0LA 1O5DT 1P1ZA 1Y8QB 4P4KD 2ICWI 5J43A 3KV3O 5ECDA 2RHBA 1JZ6A 5L4FA 2FL5A 3B8SA 3TCNA 2ZOLA 4ZQBA 5L6YL 1MI5D 1A6TA 1DP0A 4X3OA 1E6OH 1RIHH 3OQHA 1PTJC 1MHTA 1KBGL 2WPDA 5IAOA 4EGSA 1Q1GA 3KPRB 4Q6IB 3GVPA 4M4SA 3ZIUA 3RUPA 4AJIA 4N2OA 3E3NA 4JG0H 1SDAB 5GY7A 3DAFA 5FO8A 5BV7C 1H4SA 3BCRA 1RAHA 1ORQB 5AJYA 5IS2A 4Q48A 2YN2A 4F4HA 5T1LD 5CGTA 2QP9X 1BQUA 4AMKL 3ZU5A 4IJWA 4XXCA 1ATZA 2PUFA 4I7EA 2XBMA 3CC1A 3GCDA 5C4GB 4OJMX 5CGMA 1HNWB 1FBIL 2V33A 3OSZA 3HPRA 1U7DA 5EIWA 1V8OA 2DPGA 5CCDA 4N20A 3NYWA 3CR7A 4FM9A 4TLKA 2ATKB 1Z2OX 3EJSA 4F21A 3ZQXA 3A05A 1JTEA 5T57A 3BKMH 4QPZA 1A9PA 3N75A 3UICA 3ZDYB 5IANA 2W0PA 3H3XA 3BSZA 4MRSA 3L9YA 4U1KA 1CNEA 1YN7A 1OXMA 2FWJA 4M76B 3IIKA 4C56E 2IGFH 4ENTA 4HH9B 5HBBA 1A9EA 4LF3A 3WBKA 1OJLA 5I45A 2DLDA 3S2EA 2YUXA 4HMDA 2VITA 5CVJA 2ZM5A 2OUIA 3OCJA 1RL1A 5JZ9A 4NHCL 4ZJPA 3QDJB 4QBIA 3GGDA 3CVYA 4PIRF 2IEAA 3RV4A 1F8GA 3IJ5A 3EH2A 5IB1B 1NM9A 1EE2A 1E2FA 3OZIA 2F8TA 3VFSB 5E4IA 2NSJA 3QLEA 5ITZA 3ZGVA 3C5ZC 1TLKA 5B1JC 5BW7C 4NJEB 3GF4A 1POWA 3OI7A 32C2B 4ZYKB 5TSDA 2J21A 4I89A 4F7WA 5B1DA 1R5BA 1FMCA 3PNBA 4DHLA 1YIAA 2BN4A 3WX0A 1ES0B 5ANME 1B74A 2FH5B 4Y5VC 1H2AS 5J2UA 5ERYA 3EWSA 3IETA 1BXUA 3B2VH 3WIIL 5HHME 1PV4A 3GJFB 3FO0H 3CJQA 2O0JA 3BAKA 3PT9A 4BNHA 3DMFA 3GNMH 2JEZA 4QDOA 2MSCB 4OQ4A 1BE8A 4ZVNA 1UR5A 3CFDB 3W82A 3B6SA 2NXCA 4TMZA 4XIGS 2AV7A 1A2YB 1M42A 1NT4A 1VYVA 2EYUA 4ZFFB 2XA9A 4GE3A 1TVHB 3IOCA 5BRQA 1SM3H 4DGYH 2QD3A 1M5UA 3H9BA 4ILEA 1V8ZA 1SOKA 4HOWA 1ECFA 1UBJS 2WJVA 1N6PA 1EA5A 3S2YA 1C8PA 1CFQB 1OYOA 3LA8A 5F2OA 5H37G 2RH8A 2YBEA 5K4GA 1ORWA 2PT5A 3MNZB 1Z2DA 2CB0A 2VDWA 4G8BA 2QGZA 1KP2A 1NCWL 2H54A 3ZWVA 3RZWA 4S1TA 2C3OA 1H4TA 1Z3CA 5BPFA 2ZE0A 1RBYA 3DSNA 3PIDA 1M2OB 2YARA 5FV1L 3QUMB 1NMZA 4YP0A 1A8QA 2CDFA 2F1EA 4PV7A 4A0GA 1GZVA 2RBLA 1IVNA 4E12A 2R6HA 3HRHA 2QJRA 3DTVD 3O3AB 2Z9CA 5AD1A 2FOIA 1OP3H 4QT5A 4CDHA 3WMGA 3ROKA 4AC9A 1YVDA 3RAFC 3LNFA 3OB0H 1YDHA 4EYQA 3FZNA 4YQZA 3IDMB 3HVUA 1FAIL 3D0KA 5HHXH 4M98A 1EP3B 4TLDA 3F9IA 2WOYA 3QJFB 1DQNA 1FLRL 4F92B 4EN3B 3LG2A 3EVGA 4OHZA 3ETBF 4PB0H 3VPXA 5GIRA 3JQ6A 1OE0A 4BO6A 2P6NA 4XJSA 3EKCA 1GVHA 3ARSA 4ODTL 1LILA 2ZU6A 1P7QA 1QO0A 4YCLA 3SFVA 1CCZA 1TENA 3O45A 1KFCB 3B5GA 5DRYA 4WVLA 1GW0A 2HT3D 4IU2A 1THMA 3UJ6A 4OM7A 1PJAA 4OHUA 4FC3E 2GN4A 3QJYA 1RXIA 2K3TA 3DZIA 1JNYA 2MOVA 1PLKA 5D1QA 1KV7A 4I2XA 3DR3A 2A7BA 5D2LA 4II2A 3SKJH 2XYPA 1QASA 4A3SA 3P97A 2ZZUT 1NNUA 4JDZA 4ZKDA 1A95A 5A2GA 3ZK9A 2VDLL 3NIWA 3BGFC 3LZNA 1QRAA 4IX1A 5AVKA 2QPEB 5AQ1A 4TSFD 3RWMB 3ZVVA 4MZRA 3K6JA 4RA6B 1IWBB 3QORD 4DVBA 3I09A 1F58L 5SZKB 1NKOA 3TQIA 4O2BF 4MR7B 5B1BB 5JZSA 3AU8A 3K6OA 5IF0B 4LSRH 2E4WA 1Y5NA 1E6UA 3HNVH 2Z31B 1OD7A 2DLFL 2OMTB 2XN2A 4BFFA 3G17A 3AM4A 2HXSA 1R9GA 2JGIA 3BMNA 5KVAA 4INPA 2EX1A 1F11A 3IM1A 3P1VA 1B0RB 1Z4OA 2XTAA 3FQ1A 4MWTA 2A9NL 1YMQA 4QKQA 3NCWA 3OAYH 1A7KA 3G08B 3DFFA 5JJBA 4RF4A 1CLOH 4CIWA 1NLYA 5KVDL 1J8HD 3FHQA 3NGBC 3MG9A 2GYYA 1KIRB 2NVUB 1M67A 4N18A 2F7QA 3V8RA 4URFA 1YUMA 5IESH 1S7RB 2YKLH 2WY3B 4LOFA 3SR4A 2XWXA 1TF7A 4LNUB 4ERXA 4TOIA 3SYCA 1RLWA 4BVEA 1EVIA 2VTBB 4Y4FC 1KEVA 1NMCC 1ONNA 4P3OA 4OTXL 1USIA 2IPAB 2P9JA 4C22A 1K63A 3OHXB 4BV1A 2WLYA 4MW9A 3LHIA 4AVKA 2BE7A 5F9MA 5KAMA 1N2IA 1NIDA 3ZXSA 3WQHA 5I7AA 1VA5A 4POAA 4CV3A 2BFGA 4IRZA 1QTSA 1DMSA 1XZDA 3BE5A 1USZA 1SJMA 2E6QA 1QH1B 2D31B 1CKEA 2WFAA 4PW3A 2Q3DA 4YHHB 1F7VA 1WZ1H 1DUYA 5FJIA 1CG9B 4LRXA 1JZTA 3LBYA 5J6GB 2HPHA 3RK1A 3BK1A 2V3WA 1KBPA 3PD0A 2XFXB 3REWA 4MJ6B 1OFTA 5I7RA 3PSAA 1V7PC 1FTGA 2AMJA 2ZI6A 3B1YA 4QTFA 3MT8A 5AW7B 1QQDA 1X74A 2I7CA 1V7CA 3GBDA 2QFPA 1BMGA 4ALJA 3VRLF 4KTDH 3FM9A 1QABA 1U28A 3LEXB 1NN0A 2DQIL 1EFXD 3NACH 4LOUD 3KL3A 3RL1B 4ELME 4H1HA 4BZYA 1JH9A 5H37A 4XWOA 1JYSA 1FH2A 3GSWB 4WNYA 5FPYA 4LSVL 2KB0A 4MYHA 1HPLA 1I0IA 1J42A 4M5TA 4CMCA 4D81A 4CF7A 1H94A 4XTRD 1FDUA 3ANSA 3NG1A 1S7XA 1EFCA 1C1XB 4N8EA 2NTEA 4YHOL 1Q19A 2ITCB 4TXNA 5C7IO 2R9HC 4PJ5D 3B1KA 4H1VA 1W1UA 3RURA 3CPSA 1YA4A 3WWCA 1PLCA 3CSBA 3WLRA 5HKAA 1RULL 5E6IB 4WCYL 1VIAA 1JZHA 3E9NA 1RUQL 2JIXD 1JNNH 4GKJB 4TMYA 2KLRA 1YKFA 1AR1C 1AKRA 5DURD 3DOEA 2ESVE 4LHUG 2ENQA 4E13A 2HCBA 4B44A 4O4LB 2YVQA 2ZP1A 5EJ4A 4DR4B 3NJNA 3LRLA 4G01B 1KGDA 1TZGL 2CHEA 2VQ1A 2DL9A 4LMRA 2BKEA 3ZWYA 1TETL 1CBVH 1GGMA 4ZQKA 2MSKA 3PXAA 2EDQA 4FFYH 3C6BA 1WV1A 4L7VA 4PRPA 2J45A 3IB6A 2VLJA 1XQXA 1Z3RA 1OHZA 1L8AA 4E2XA 3G85A 2G0LA 4OW6A 1MXFA 2QSYA 3HUJF 3EZLA 1JWMA 2YQ5A 4DIUA 4R8VA 4RFOL 3FQYA 3O6FA 4H88L 1Q91A 1J1UA 2JARA 3QCVH 4JLDA 1NFFA 4PMFA 2HF2A 5FI5A 2C1PA 1NBIA 2FEOA 3UK0A 2WVSA 3M46A 1W2KT 1PFCA 3L92A 4CILA 4O4IA 2WKOA 3ZZMA 5EAIA 3UCEA 4NPKA 4BWTA 5JHLA 2C3UA 2HM7A 2J88H 1KBOA 4B45A 1JI1A 1KENL 2XWJA 4BDVB 2YK1L 1NGQH 3QKRB 3PR1A 4GXTA 1C16B 3RWCB 3VFTA 2M2IA 1FAKT 1WA0X 2GVDC 2F1HA 4OMCA 2OK8A 1NW6A 4Z1OA 1NONA 4OY3A 4XN8A 4FYHA 2OV8A 3F73A 2QSCL 5D2CA 1CVRA 1BD4A 2G7ZA 4WOJA 4W1PA 4QWMA 4OZIF 3ZX4A 3EFDL 1E7QA 5AW5A 4C9BA 1NTDA 3JZYA 4RVUA 3ZS8A 4DF3A 3B53X 1MP0A 1MO2A 3R0JA 3IEIA 2QKIC 2BNQE 5ID0B 4RPCA 3F8WA 1QTIA 1CPUA 1XR9B 2QENA 1U95A 2OQJA 4HBCL 2C94A 1Y1RA 3IAFA 2QXYA 1MJUH 3QGMA 3KZVA 3S2GA 5K9QI 4GW4A 3VR5H 1A4IA 2GJ9A 4BGDA 4LZZA 3T1WA 3MJFA 2CLOB 4WW0A 5KVMC 2O1WA 4BC0A 2HK9A 2QHRH 3OLXA 3X14A 3NXSA 1M1SA 1BX0A 1GZDA 1CFSA 2R97A 4KZCA 3N43B 3R0IA 2BNUA 3ZJYA 3UTTD 3MROB 3DAYA 4BJ1A 2PFSA 1PEKE 1CETA 4EH1A 2NT4A 3N2KA 5IMBA 3NORA 4UQDA 3MTEA 4TXMA 4Y6OA 4R71A 5K3DA 7CGTA 1U41A 4EHNA 4CTOA 2ICCA 2P9TA 4IG9A 5CZXC 3H1GA 2XB8A 4H8QA 3DFUA 5DJYA 3OJXA 5L2KB 2ZKWA 1V8DA 3DKIA 4OSUH 1TX4B 5CZRA 1S7SB 2CO7A 2ZUBA 4WFHE 3AFCA 5I47A 5HGHA 2NU6A 4RFNB 1AO7A 3ZX5A 4EITA 2DQFA 3GJEB 3CW9A 3VACA 1TQSA 3I5UA 4HWEH 4KQ0A 3FHAA 2OJZH 3NRFA 4QODA 5F21A 1MJ7L 3FNBA 2B37A 4NNOA 1KJQA 2HDHA 3WJLA 1SCUA 3FT4A 4ZODA 2A77H 2L3BA 1QHSA 1UOLA 4XPFL 1TECE 1NNEA 1S7TB 3IVGA 4F04A 4U6VL 4DK3A 1S89A 1II0A 3GD1C 2IDCA 4XBGB 5AESA 2WFLA 7AT1A 3D7RA 5KJRL 3NABL 3IE4A 2RDMA 4AG4L 1P1FA 1OTXA 3V5DB 4RD1A 3GT3A 4DMLA 2PWEA 2ADJA 3QOWA 3S29A 3V1NA 3QUYA 2R5NA 4Q52A 1G5PA 3JYLA 2TSAA 4ALNA 5A2FA 3JQ7A 2D3JA 2NVWA 3LUHA 1E1NA 3X3HA 3V2HA 2NW2A 3A1TA 4HOXA 4KUHA 2XV6B 1WY5A 5GS0L 3KOZA 3V6ZA 3CPLA 5CCHE 3STBA 4H3SA 5BR4A 1N8NA 1Q7EA 4PV8A 4LZJA 1DT5A 2DQKA 1FL5A 1G8PA 2C9CA 1N68A 4G9DB 4LO9A 3EJWA 5L45A 2BGLA 4YEFA 3MCKB 2ZUUA 4TVBA 3D4BA 2NU7A 4BKRA 2Q9CA 2C99A 3PU6A 4KXXA 1QOKA 4YRJA 4JQSA 4DP6X 2O5YL 4I1YA 2WHEA 3AL8A 3U7JA 5L7XH 2XQFA 1ZOOA 4G0MA 2YV5A 4X94A 4IOFC 1KYUA 3BVXA 4DS3A 4WVRA 1ZD6A 2WWKO 2X2HA 4FXKC 4S2SB 2ZU0C 1OSNA 2V9ZA 5KZCD 1A2KC 4OXYA 1RWMA 3SGDH 4B50A 1PFYA 2PAAA 1JI2A 3GCGA 3I3DA 2WA2A 2ERJB 4LHUA 2E7LC 2J7PD 2MMXA 2XX1A 2RIRA 1GH7A 3SOPA 5LQAA 2IH8A 4QRQA 1J1IA 3KWJA 3PGXA 3D2UA 5F7KC 4R5TA 4JI6B 1X6LA 3RJZA 3QEBZ 3HUUA 4Y6SA 3UDWA 3W04A 1WP6A 2WAYA 2GVZC 4MQ7A 3LGAA 3T77A 4TS6A 5PAZA 1ZM7A 3A8TA 3PNWA 3QKTA 4MAYA 3TKLA 3W8RA 3GUFA 2P8PA 5EESA 4XX1E 5I1JH 1NZJA 5SWZB 3DLAA 4R0LA 2FPPA 3ETSA 3OWXA 3U9TA 5CZKA 1QVAA 1KFAH 2VXSL 4N2KA 4DBLC 4H08A 4ZYWA 3QPCA 3T5DA 1IKNC 4X8JA 1CJTC 2C4UA 2H1LM 4A7GA 2ZYWX 3R5TA 3JY6A 1BJMA 3F6PA 2VIRB 4M87A 2WZPD 1VGKB 5FL7A 4PN7A 3MZTA 5AXAA 3DLCA 2O8NA 3PEYA 3GLGA 1WVMA 1KC5H 3F83A 2C4VA 1Y18B 1A3CA 5J5VA 43C9A 3CMOL 3QUXA 2DWPA 4FMVA 1I7SB 2VQ3A 3AY2A 1WE2A 3JQ8A 1ILEA 1OAOA 1LBSA 3QIBC 4TWZA 2A5DA 1Z9NA 1J8QA 5JNRA 4EUPG 1KPRA 2QV0A 2N0SA 3H8SA 1DKOA 2J09A 1JRHI 2WXFA 3QUTA 2PR9A 2C9VA 4JRXB 4KYUA 3RRQA 2JI7A 3TBKA 3GDFA 1DLFH 5FYJL 2EDCA 2NSXA 2EQAA 2XEXA 1A4JA 1SQ6A 3T9FA 4QXGL 4P9NA 1DJQA 2FQEA 2PR2A 4EI9A 4ZUUA 3IS1X 3DX8B 1OX4B 2VBIA 2WBLC 1K4YA 4Q9AA 1HSAB 4FB4A 5BUQA 2Z1PA 4FEMA 3EZ8A 4G8GE 4MXQD 5DLMH 3PC2A 3T0EC 1E2NA 3FTSA 4PXSA 4YSSA 4WAUA 3B3BA 3L1OL 3RUHA 2WQVA 4GGMX 5CCXA 1V3MA 4WWKC 1U3HD 4DHWA 4M8VA 1XELA 4EEKA 1LY1A 1Z5LA 1RPQA 2H2AA 2RIKA 4KK5D 3ZC3A 1YPZE 1UC8A 3UAVA 2OW6A 4ZI2A 1NCJA 4ZXBD 4BMYA 1BMDA 1G6KA 2XB2A 1ONQA 1J25A 1MWAH 1TQWA 1WUIS 5CD9A 4PX3A 3MRRA 4CUZA 4LZLA 2ED6A 2APVA 3QIWD 3WIHH 4ZDJA 5I8OH 1P7KB 2DR2A 1UWXH 3LOWA 3VD9A 5G0VA 2BEUB 5TQ0A 2WLNA 5K3OA 4DNXA 5LDUA 4RTSA 4ZI3A 3FPYA 1II4E 1MXGA 1SQGA 4U6YA 1ZRHA 3UTZB 4LZAA 1VE5A 2IAMD 3LDUA 1UDXA 1U8YA 3PIQB 4MQ5A 3Q8KA 1MHPH 3OTQA 3OPNA 1VP9A 1E3DA 4ZCIA 3UGKA 2AW3A 4R9SA 4CKBA 2VK4A 1AE6H 4N1HB 1A7PH 2V3VA 4AF7A 1EO7A 1WTLA 4BNXA 1MDFA 2PF6A 1NEZB 3FUWA 2GK4A 2EX0A 4YCDA 4Y2GA 4U1NA 2WSLA 3E5MA 2Y06L 1QC5B 2WJIA 4FSDA 1CR9H 1DOAA 2XKAA 1Z6AA 3S37L 4MUFA 4G80A 1Z6GA 3L3KA 4I4NA 2WTOA 5SX4I 1UIMA 3SP1A 4ZBJA 3VH2A 1J05A 5CS7A 4IMJB 5DULA 3KLHC 4RZKA 3THXB 1QANA 1QSFD 5JUEH 3RKDC 4BKTC 4DR1B 2XWBA 4XZ4A 4ZO6A 4K9EL 5K0ZA 3V97A 5F1NB 3HYLA 1FP6A 3WEXA 4DZTA 4FTVD 4IS6B 4D94A 2G3XA 4PGEB 1OXSC 5CYGA 3SICE 4PJXE 4UHBA 1MF2L 1A2QA 3WCYA 1K3TA 3ILVA 5CFNA 4MA3A 1PKEA 3CGGA 4I81A 4ZHSA 3KPPB 1P6AB 1U93B 1HETA 2VUYA 4BB9A 4FTWA 4NBRA 4URWR 3B7GA 4GBXA 2BUBA 5EE3A 3VD7A 5TGTA 1E3JA 1FMFA 4MWFB 2J5LC 3AHGA 3UWDA 4Q39A 2FMFA 5KJ7E 4Z9BA 2JQZA 2OL3B 1W9MA 5JMPA 1TJHL 3L3OA 3FLBA 1N78A 1HKLL 3SIPA 5B21A 3KHKA 3CIOA 4LXHA 3ZDWA 3STVA 1N1DA 5AEAA 3KEQA 2DQCH 4PG2C 5KQGA 3KR1A 2Z0MA 4OXRA 5J1SB 1Y81A 4IXNA 2HWUA 2COEA 3V2GA 4XT1C 1GN9A 2PH1A 5C8VA 4FADA 3ZE1F 3D5EA 2X1PA 3I0NA 2GERA 3U6RB 3TD9A 4YBQD 1GO2A 2WM9B 5D7HA 2OBLA 1JV2B 2BPOA 1WAAA 1DJYA 3BKWA 1DBKL 3NLLA 4Q7MB 4I0PB 5PCYA 5DHTA 1SRDA 2WNWA 4MJIE 4OGXH 5ECGA 3MM4A 3APCA 1JG2A 3WN5B 2B83A 4UDNA 5F44A 1EUTA 4OI8A 4PJCF 2NY5H 4IJQA 5AVXA 3VWJB 1QEWB 4L1HA 1C5KA 1CFTA 1Z4NA 3HJ0A 1BJRE 1EI9A 1Z9BA 3TB4A 4BH7B 4NC1C 2BNRA 4LLYA 1ABEA 2R2BA 2R8YA 2W07A 4IH4A 1YZNA 1KXHA 5COQA 2FT7A 2L19A 3H86A 2C26A 4XNZC 2JCCF 1C50A 1Q0XH 2ZRAA 1T0MA 4IDLA 5C2UB 3FPHA 4RXMA 2KL6A 4EUPA 4BLWA 3A4YA 2NT0A 4JFHE 2NYVA 4ZWNA 5ULLA 1CZ8L 1AO0A 2Q0HA 3FTWA 4NP4H 3LKSB 4Q7LA 5E1BA 4OAWB 3AAZA 2O7RA 2X4UA 2EJTA 1LK2B 4NATA 4RX4D 3M17B 4CN9A 4FD2A 3DOFA 3HS0B 1HY3A 1XX6A 1M56B 5AVUB 3HY4A 1JG9A 2OYLA 4U4AA 3AS1A 3BZ5A 3T3PB 4FUQA 1KVRA 1VPDA 1TIUA 1IN8A 2FD6L 3CX5J 3IT3A 3WL9B 3E58A 1NGYA 4PRAB 5ESAB 3SKNB 2Z30A 4EB8A 1CF1A 2R59A 4Z8FH 2WOOA 1NVBA 3NK4A 4FHEA 3N07A 1OASA 5BWBA 2R5FA 5HHVH 4S1QL 5KSWB 1DL7H 4I7ZC 1G17A 5IVZA 3URKA 3MVEA 3AVVA 4DN4H 4EFDA 5A05A 4E2WA 2L42A 4KMQA 4FX2A 3F6IA 4XVUD 3QFJD 1KCRH 3VI4E 1YB6A 5EIIA 4X92A 2C1EA 2NZJA 1MIEL 4N7BA 1TCCA 2V5TA 2HK6A 4FXGA 1PF3A 4RGOL 2Y6VA 3ONFA 1BW9B 3RS4A 4BXOB 3VA2C 4N6OA 4O1MA 5HYJB 5CT6A 1MAJA 2VSQA 2KZ1B 4NDZA 1K3UB 2YAOA 4N2GA 2VF7A 1S8FA 3HDHA 3T7CA 3BTUA 1MVLA 3K6SA 2VABB 4MTLA 2FDBP 4C4PA 4CIVA 1H93A 1H5BB 4L3EA 2QIPA 1K5WA 3D9AH 2K6ZA 1USKA 4CDRA 2GEEA 1EM6A 2HWWA 2YY6A 1IFHH 5HCNA 4D26A 3BFPA 2BMVA 1I36A 1RJWA 3LLMA 1XTLA 4K94H 3H13A 3P9MB 2X09A 3SD5A 3FQNB 2EDAA 3SGJA 2O9JA 1OGTB 3OA2A 3T3MB 4UAOB 4G0WA 3BK2A 4W9CC 1ZM3A 1Z4QA 4HS3A 3WLQA 2RSLA 2PQMA 1LZKA 3KETA 2VJCA 4PH8A 3MRSA 5LQDA 5E9DA 5IB3A 7FABL 3PWSA 4ND8A 4HFUL 3S8FB 2VSYA 4GR5A 4KWUA 1GOFA 1WS6A 2XDWA 4DQOH 4IU3A 1XQ6A 2VYVD 4WASA 4J2TA 1MAWA 5I6PA 5AP9A 4P3YA 5IW1B 4M0FA 2WSDA 3C09C 4C04A 4V0LA 3G7SA 4HXAL 5IFLA 3MBOA 4PC1A 3BM5A 1GOTA 3QP3A 4HDRA 2GXSA 3C2QA 1CVIA 1TW2A 4L27A 5IHWA 1IEQA 3IHWA 2AERT 1T1SA 2XTJE 3ODGA 1MUJB 1G21B 4HKBB 3OZ9L 5KTRA 1V26A 4MCNA 2A9QA 4BEIA 4EPYA 1Z4PX 4W5TA 4R1UA 1OGAA 3Q2CA 4JO1H 1XF2B 5F1IA 1YNLL 1VXRA 1IWOA 4LBVA 3SBQA 1GGNA 5E8RA 1SUEA 3U26A 4IWYA 1P44A 4M1YA 1GD1O 3K9FC 4QXAA 3IQXA 5ENVA 3KAKA 3RVLA 4BFIA 3LXAA 1RP1A 1WQVT 1Y9JA 1K86A 3R7AA 1DSFH 3A1VA 1E65A 1HQCA 4N0YL 4Q3CA 1BWWA 4CC0A 1XCPA 3Q6FB 1IGJA 4ADSG 1SEVA 5EO9B 3UAAA 1MG5A 2GI4A 5F1KC 1MA3A 3VNYA 1BFKA 1C3XA 5E6ZA 4WI9A 4Z7NB 1QE3A 1F4LA 1AXGA 3F71A 1BIFA 3Q9SA 3LBAA 3C5JA 4XCFL 3T8YA 2ITEA 4I8DA 4LLDB 3HB7A 3NWJA 4P59H 4I1NB 1RUAH 3H6AA 2C31A 4PLPA 1N6OA 1JHYA 1WZLA 3N43F 4YX9A 1DVFC 1XC7A 1ULHA 3HBFA 1T5IA 3EEYA 1KU6A 4GP7A 4UVHA 1TMYA 3CG8A 4WENB 2CSXA 4RD0A 2CNZA 2HBZA 2I76A 3LC1O 1OLXA 4X99B 1UBGA 3JVVA 4F3NA 5B7NA 1ZH4A 3I73A 2WB7A 1IAIL 1V5GA 5T1MA 3W0WE 3IQZA 1NVVQ 2D5CA 3VQ2C 3IBSA 4R8SA 3S4SG 4K9RA 1NFKA 1K4KA 3F7QA 1BAFH 3RANA 3AR9A 2YYAA 4QO8A 2BX5A 2C2OA 4XX0A 4ZMXA 5JAOA 4OGLA 1T0HB 1Q15A 3BPLC 3OQVA 2ZIUB 4N8CH 5KX5F 3OUTA 4B0MM 2L7UA 3FIJA 1OSZA 3VQMA 3RSCA 3L5XL 1SXJC 4HRXA 4PLVA 4KRPC 4YQXH 1OWRM 3RNKB 2BVNA 3CFIC 2IDQA 4GBJA 3BWDD 1R8QA 3LLVA 3FH0A 2XPZA 2NXWA 4KL8S 2K9UA 4HF5L 4NYLB 4AT6B 5JW3H 5G5DA 3MNDA 2Z8WC 1TEHA 5TARA 2P49B 3HEIB 1T5TA 4BBJA 4D79A 4D4KA 5I1HH 4GZ8A 2B2XA 1V41E 1N6HA 4OQDA 3MLXL 3R5FA 1HAUA 4YVFA 1UM6H 1MZZA 1WQ3A 3S5YA 5C3UA 3SKUD 3VRJB 3R6WA 2UWEB 3VFRA 4QE3A 3CVJA 1TQ2A 4ENPA 1TZAA 1XZNA 2KYIA 3P4LA 3NPSB 1R5IB 1AGEB 4LWPA 4M9PA 4XCYA 3D5TA 2BXZA 5MENE 4LQ1A 4YHPA 2N46A 4NJMA 2DPYA 4OLWH 2I9LB 1NSTA 1DVXA 2EW8A 1SKMA 3ORHA 2I1LA 2A83B 1C12B 4Y5XC 3SSGA 1UM5L 2R2AA 2HJKA 4X5WA 3W06A 5CBAA 5IH7A 5CLZA 3T6ZA 5TF4A 5LQUA 1E1RD 3L3HA 1XZEA 4MW0A 2ED7A 4LSSH 4AMBA 4LPSA 5DNAA 3PHOA 3TAHA 4Y5YA 4WW1A 4KRFA 4Z76B 1LWOA 4MLIA 4Q34A 1VL5A 1LLFA 1R19A 2BIHA 2FX9L 4UU9B 1YDEA 3OF3A 3WLTA 1JPEA 1ESCA 2CM6A 3JASA 4J7UA 4RPLA 2W8BB 5T41A 1SHSA 3LZFH 5JWHA 2IW1A 3FBKA 3IBTA 2XVAA 4L9LA 5CLYA 1HK7A 1L5LA 1UJ6A 4QRSB 1XJCA 3JV6A 1E2KA 1LLAA 2DOKA 2CM5A 4NQDA 3ZKQD 2XDAA 2UV8A 4CN1A 3QZWG 4NSNA 2XKNB 1YJ5A 3IKCB 4JPIB 3WJJA 3GQBA 4PGBA 4XO4A 4FTDA 3X1EA 4XWKA 5DD0H 2CKNA 4YBLB 3O8RA 5KQMA 4MVWA 2AVFA 4PRHB 5DUML 3O03A 1FO0H 1HHHA 2P43B 3VXSE 2FPUA 5IRCD 3ONVA 4N6QA 3SQRA 4E14A 4PIMA 4IJTA 4LYAA 4TKUA 3FBGA 2FPGB 4G4IA 4PHCA 1UM9B 3KXFB 3GMIA 2P8LB 1HKFA 3LS5L 3WGGA 3BN3B 5I6DA 2VLLB 1WD5A 2Z8RA 3BHBA 3WNDA 3G2LA 3C39A 1H2XA 3TRDA 1U8IB 1WMSA 3QYCA 3TIEB 4PWKA 1ZD1A 3LTEA 4PJAB 2WLJA 2G28A 4URKA 1S78D 4R0NA 1LVUA 2WHYA 4X6FB 2BIOA 3ZE2E 2A2QT 2WAQA 4KE8A 5KNDH 1IG0A 2DWXA 5DTFB 3SDXE 1J9ZA 3GD5A 1DDTA 2P2YA 3FCCA 3RVVD 1AX9A 3QZLA 4TUYB 1UUFA 3D0VA 1F6BA 5C0EA 1LF5A 5DJXA 1NUPA 3D43A 3WHPA 3U82B 4G9FA 2BW0A 3SD2A 1GFZA 3DCYA 5GGSB 3TR5A 3GEHA 3E70C 4CU6A 3A36A 3KCQA 3MTQA 2NZUG 4HAKA 4D4IA 2HKFH 4RHFA 2CLEB 3RX9A 3T3IA 4DXAA 3QU9A 3KS9A 3C87A 3X3GL 3V1KA 4EIGB 3IDUA 2VWGA 4BZ2L 5HHOE 2Z93B 1D04A 5DRZB 3IN0A 5CCKH 5DD3L 4HLUA 4DZZA 3IP3A 5IBQA 1RPKA 4NKDA 3ZVRA 3MRJA 5BVGB 5INCA 2A3NA 2WXQA 3FMGH 3LHDA 5J3JA 2ECKA 1WMAA 2WAOA 4FFDA 5DHQA 3L4WA 4ONFL 1N4XL 1H2YA 4BQNA 2VP6A 3S4SA 3CSDA 5C80A 1RUPH 4ZEWA 1YRBA 1TFPA 1W36D 1GZ4A 2WKLA 2HR1A 3JYBA 1G9NC 3SYLA 4RIEA 1A4KB 4U1LB 5JORA 3U4MA 3RIFK 3V4RA 5C1DA 5DQ9A 2QJOA 5D7IE 1X8JA 4FFTA 3DVQX 4OLUH 3H4TA 3FJYA 4C2UA 2A74C 4JZNA 4GI7A 4EEEA 1VPLA 3FJTA 4AJNA 2J9FB 2PRYA 4D44A 4DK5A 1N6UA 2YFQA 4P93A 5AM2A 5LU9A 4RLFA 3W5VA 8FABA 4M4RB 5DPMA 3UTCA 2ZCLH 1R0CA 1WJGA 4DR5B 2NTFB 5B4MC 2WWMC 1FYDA 3TP4A 4ZVKA 1V48A 1L7QA 1V1MB 1E18A 2CO6B 2IU3A 4OLHA 4ZU6X 4P23D 5FNVF 4PJ8A 3H5OA 1FRGH 2BV3A 3QPBA 1UDCA 1CJMA 5CA0A 5BVJA 4EVNB 1HZLA 7MHTA 1R3JB 4FN5A 4KZPA 5JROA 2CDAA 2QR2A 4TRPL 2WC1A 5FXMA 3Q2VA 2FIRT 4LYHA 3VXKA 5CFRA 1VLXA 1U3VA 2OB1A 3V6OA 1GG5A 5EXPA 4R2LA 4J4HA 3BULA 1XTBA 2QQ5A 4GRLB 4ZT6A 4JL5A 4A66A 5EUBA 1DBJL 1CGXA 4CETA 4IICA 3BCFA 3K9LA 4JI5B 1UWFA 3NH9A 3EOTL 3AUXA 4O3MA 4KGLA 2VSKB 2ZSWB 1WFMA 1MO6A 1RYZA 4M6WA 2QT0A 1DT3A 4IQ8A 2E86A 1UJ5A 5C07B 3AXHA 3FYUB 2A6JA 3QFRA 3C16C 4POZD 1I3RB 3HADA 4KO8A 3WAJA 1LDPL 1E4WL 3EYSL 2YUTA 1L7DA 3DPBB 3TJEL 3IQWA 4TNVF 3G7TA 5CJ2A 5JSYA 1IARB 4EMSA 1KDPA 4NE9A 4D3FA 4KQ4H 1BQLL 1MRCL 3QZWA 3NFPA 2GFHA 1BG9A 5CP7B 3MRCA 4P57A 2O8DB 5AW9A 4ETQB 1L4LA 1COWD 4H3HB 3W37A 1NX6A 1F3DH 3O4JA 1XTRA 4BEJA 1TK3A 4A15A 3UZQB 3D0QA 5GJWC 1CTOA 3II6X 3AFNA 4ZJZA 2DEYX 2ANCA 4KPUB 3U7AA 3MLTA 1U9CA 5JO9A 5FLEX 1RJYB 3S3CB 4J4PC 3TJHD 2Z6AA 3EXIA 2ZRMA 5FI0B 1YIOA 2JI1A 3I0ZA 4NFDA 3JCZA 4HO1X 3H9HA 1T4DA 3D3QA 4XRCB 2DQUH 4HUMB 3RPIB 1R6BX 2AF4C 3DSRA 3MYJB 5ADOL 3K35A 1B76A 4UMDA 2Z09A 1OLOA 3OU6A 5CWSA 3CSYA 3PWLA 1MY5A 4I9WE 2EE0A 3ZYIA 1BIIA 3PCTA 3VFUB 3BDYH 3OTTA 2W6JA 1IIIA 1JKXA 3PKIA 5TF1H 1GEEA 4A7VA 4FLHA 2FI1A 1KCVL 2W1NA 2I3DA 4LC9A 2EQ5A 1QLFB 5F2NA 4MGZR 3L0YA 2YXPX 1RLOA 5G4NA 3DUFB 3IXAB 1YSCA 2R25B 3QENA 3AQXA 4APXB 3B37A 3L6CA 3EDYA 4NXNB 4J8RB 1HYHA 2IH9A 4O63O 4Z95H 2FOLA 3VC3A 4YHIA 2AJUL 2HLHA 4BS9A 1P3Y1 2Q5HA 3WHLA 3VH1A 3PWJB 3MLPA 5FYJD 5GJTL 3NB0A 1P9OA 3T1YB 2NIPA 3TTWA 3B9QA 4JEIA 2N1MA 4Q7JB 4CKCA 2CPUA 2M2DA 3F67A 2C1OB 3WMRA 3NEAA 1WZIA 3PK0A 3ENQA 1QNZL 5C1MB 3RB5A 3MA0A 4RLQA 1DQMH 5IBUB 1GR0A 2QUZA 2XG4B 1DXOA 4WEMB 3OJDA 3ASZA 3G9VA 1AQ8A 2ATIA 4FJYA 2D2VA 4L4YA 4K4KA 5C08E 1KDTA 5KMGA 4GAAA 4DV6B 1IQUA 2X8BA 1I3GL 2VNJA 2FX7L 4LVOB 4RZXA 1SM4A 3AT8A 1KJNA 2EUWA 2K6WA 5FBLB 4JN2B 3FPKA 3NKFA 4ODXB 2QD4A 2E76C 1JHAA 4DCJA 4RZUA 5KTTA 4KMTL 2CJUL 3HCVA 2EL9A 3DVAA 3W4JA 4HLZH 1LI5A 3Q8EA 3IAM1 4L8BB 2PMBA 5LWYL 1U8QA 1MSPA 1OOWA 4L2IB 3B2UC 1BXRA 2VCEA 5DCUA 2NAFA 1IBBA 1JDPA 3UB4A 2XVKA 1YAJA 3GVHA 4GL4A 2NR6D 4RPIA 2FECL 2BSTA 4JPWH 4QRPE 1GYUA 3UP6A 2P41A 4Y7OC 1C1DA 3M6AA 5LP6F 2VRCD 2R85A 2ZBUA 1IM3A 3CXFA 4OBSA 3TBHA 4Z5RA 1SBYA 5GRWA 2VLRE 5I17B 3TBVB 1ICIA 5TT0A 2CBTA 3RWHB 2Y1WA 3ELAT 3X43A 3M6DA 5DYTA 1XU4A 4BZ1H 2ZSFA 3BEVA 4R9NA 4QPCA 1FGVH 3C24A 4XAQA 4XEUA 4JHXA 3BQVA 4PRLA 1T80A 4M49A 4NZUH 5IGXH 5K99A 4HAGA 3GMQB 1WNTA 1XEXB 2CGEA 3DKPA 3KXPA 3P3RA 4WY7L 1TRHA 4EGFA 2GETA 1YI1A 4TL5A 2OQVA 4DV4B 1FIEA 1LBIA 3EGSA 4NQCA 5FFLA 2JRCA 3UJ3X 3LQZB 4KHTH 1D1SA 3PGMA 2JGDA 2HK8A 4L76A 4N5LA 1TKAA 1YDGA 1IC6A 5D1XE 3OE5A 2CIIB 1JNLH 3HN2A 3IXMA 4RZQA 1FMLA 4PRNA 4PJ9A 5AOJA 1PUJA 4HPJB 2BWQA 4FQLH 5FUZL 4BUQA 3NTOA 3RWDB 5F9AC 2B16A 4RZSA 2W92A 2OSBA 5G3YA 1O95A 1ADQA 4JDTL 5DBGA 4AEIH 3RKSA 2F90A 2FEAA 1EANA 2CBZA 4G1EB 2WQAA 1MLBA 3HQ4O 1E0KA 3VJMA 4NCIA 1YLBB 1U1DA 1OFIA 3X1BA 4DWJA 1G84A 1U9YA 5DNWA 2EZTA 1VJTA 1WZKA 1E6JH 3KBHE 2BF4A 1DO8A 1CY8A 1ACJA 1KMIY 3QGVA 1DEXA 3QA3A 3DMPA 3ESCA 3ECBA 3ZRSA 1MXHA 2QQLH 1DAGA 1GAEO 3IUYA 2Q3CA 3RBAA 1HXYB 4KQEA 3COYA 1JAYA 2ALJA 3BSZL 4QY8B 2EVHA 4B5EA 4ANXA 3U40A 4Y7DA 2V2XA 3FY4A 1VCIA 2UX6A 5IVNA 3MSCA 2DS4A 4CCYB 1US8A 4XQCA 1UXOA 1ITCA 1AMNA 1HFWA 3R74A 3GMPB 5JPMA 1ZM2A 3UC2A 1YD7A 3FH5A 2WKPA 1IMOA 4IHBA 1IM9A 1E50A 3VR2A 5LIPA 1GL3A 3DFIA 5BZXA 2RGEA 4E5XA 1UEJA 2EE3A 2HY7A 5E8PB 5KVEL 4DW2L 4NQVA 4YAQB 1E6CA 5ILQA 5HOQA 4QT4A 3EYVA 1I9GA 5HY9B 4PZCA 2JFGA 2OQ2A 2HF8A 2CXTA 1KTCA 3DO6A 1OU0A 4XMLH 1TT7A 2BFEA 4OLZL 2R6R1 3ACCA 5IYZB 1BVZA 4BAZA 5H35A 3DYVA 4N5DA 4EZJA 3VYVA 2F5AL 1E2LA 3CO0S 3AKCA 2YPKB 4KAAA 3PB3A 3Q5OA 2PKDA 4M54A 1GIAA 2Z31C 5AVRA 2VE6B 3UFXB 3WMWA 2VHUA 4WNSA 5J12C 4JA2A 3ZGIA 4I3SH 2Q9BA 1E9QB 4HJJL 3MPUA 4UNVA 2YV3A 3BD6A 5BSMA 3AVWA 1SBZA 3WYBA 4NO5B 4PWFA 2VLBA 1N7GA 1QJ4A 3GYRA 4JJAA 1CD0A 1E32A 3VWKC 1JG6A 3WTCA 3ZCXA 1ECPA 5ERWA 5CLIA 3DZGA 1AQIA 1LPPA 2XYVA 5HJGA 2CK3A 4QOIA 5FHBH 4RSGA 1PE0A 5GGXA 5K8CA 3K80A 3IPRA 5MN4A 1N9ZA 4YAIA 3NAAL 5ALWA 3SBEA 3UACA 1MCQA 5K9OA 4PG6A 4F57H 2ZJSH 4C14A 5BR7A 1TZOA 4FFVC 3WE6B 1L9RA 1AHKA 3F58L 2IVFA 3B1WA 3O2VH 2LGNA 5EU6D 1FJ1B 5LJYH 2JEOA 5DRWB 4UNIA 4HIIB 1L3WA 5ARBA 3OHXC 3BEWB 2FWAA 2R0KL 4FFWA 5I18L 3PV7A 2PHZA 2GUWA 5T64A 1GJRA 1R5JA 1P33A 4W9JC 2UWEF 5DHVH 3ORSA 4BVGA 1GAQA 2ZSAA 2KLHA 3IN2A 1I85A 1FGNL 2H1XA 1G38A 1T2EA 4JKPL 5KBPA 2ZIVB 3DE6X 1U0JA 2ZOUA 4B9CA 2FRDA 4QRRD 3N2EA 4ESKA 5YASA 5EJGA 1JZEA 4J6IA 1EZ4A 3GUCA 1IOLA 2BS8A 3SZOA 4JN1H 2CVOA 3ADOA 5K0EA 4X6CE 1J2JA 5HILA 2RACA 4JVNA 1W0WA 2WJ4A 1HQYE 4DOHB 4BFOA 2HL6A 1YJ8A 3O4LE 3ULUH 3Q6IA 3JWIA 5F9JA 1UZUA 1KLGA 2Q7AA 3R09A 1GVNB 5CM8B 2FP4A 4B60A 4F3RA 5IAAA 1BEYH 1E8MA 2FSHA 1NGSA 5DBEX 2UVEA 2GJSA 4YA6A 2VMCA 4D9NA 1YFLA 4IUDS 3WENA 4DDUA 3RY4A 4LEXH 2EKQA 3FFBA 1MCEA 1CLZH 3EHBB 2AT1A 1A1SA 3I76A 4PU2A 1GU1A 3JQFC 4ZJYA 1LEKB 5CBPA 2YHBA 2ZSKA 2H1OA 1ELOA 3SU8A 4R97B 3PG5A 5A06A 3ZSSA 2V1UA 3E6HB 4XN1A 3ND6A 3UJIH 3OA0A 3PEWA 5I4KA 1SZPA 5BO1L 2GXUA 5FW7A 1EINA 1L7TH 4DGUA 2JCBA 1RFDH 3TFQA 5E6IC 1WMDA 2VC2L 3JD1A 4KR6A 2ZP9A 4OSPA 3HDGA 4HQ6A 4FLFA 2QNIA 4LARL 1UT6A 1I1AA 1EWTA 1GPJA 1U2DC 1O7DE 3WLLA 1PVHA 4GOXA 1GYWA 2ZIXB 3NP9A 1RV6X 1XEWX 4QBHA 4V3CA 2OZPA 2XZAH 2VPYA 3DHVA 1MCSA 3U37A 2AEPH 3HCWA 1QFOA 5K9ZA 1AUQA 3FETA 5I74B 1IAOA 2GT9A 1RHHB 5K9KA 4IVPA 5HDOA 3EDQA 3KZOA 2VOJA 4P6VF 4W5HA 4CQNA 2DUMA 1RI5A 1B43A 1XKLA 4PO1A 3GSVB 4WFGD 2DEXX 2GJRA 3TN0B 4UBMA 5JYMA 2YAHA 2ZVQX 4N9GB 1QX4A 3C41J 1HILB 1BXKA 2XZDA 5IDWA 1XMIA 2ZROA 3L4BC 2AD5A 3D8SA 1GOGA 3F8UB 4UQ3A 5F12A 1HZZA 2B1HH 4KPYA 3PKZA 4BP3A 3K3QA 1V35A 1DU4A 5F3BB 3B3IA 4Z3OA 2IFFH 2MNWA 1NANH 5L7WA 3D1VA 2YOCA 4LAFA 3QKWA 3NJIA 2OQRA 3GFOA 1U21A 4W81A 1A7QL 5JMRA 3G88A 4X3CA 4MR9A 1UD5A 3KR3L 3JQGA 3VR6D 3ZPDA 4GMXA 3KE0A 3I6KB 3UENA 3H5RA 1G8GA 4FPXA 5AW3A 4HIEA 4D9RE 1PYWA 1XGYH 2E5WA 5FORA 5DK3A 2P9GA 3PUVA 3L16A 5CW2A 2Z65C 4GLOA 5TDHA 2HVJB 3QJUB 3TV3H 4F2MA 5KWVA 4PQXA 1P9MC 1PEWA 4GKSA 4JU8A 1HH6B 4P34A 3T09A 1CRQA 1P6XA 1XZJA 1T8PA 2WO4A 5AW4A 1YHPA 3VSDA 3ELDA 3U09A 2ZAOA 3LT4A 1A7OH 5AENA 1UUNA 4QUDA 5EFOA 2E7DA 4JWTA 1Q77A 4Q00A 2JKXA 2JASA 2BDEA 1JKJA 1MH1A 4HDAA 1XKQA 3MQ4A 3NYQA 3KD3A 4MEJA 2IZ5A 2CWWA 1DTEA 4JEUA 4JUCA 3VCLA 3RYCB 2AJSL 3L4SO 2NMSA 4L37A 2G75B 5IZ4A 3IT0A 4PVMA 1AYRA 2P6OA 1TD1A 3E53A 1ASQA 1EPFA 2NDFA 5EINA 5TGBA 3PL6D 1HXMA 4RQTA 5TFSL 4DREA 1SCJA 4EFKA 4UTAA 2J2ZB 1SRQA 3G5VB 5DWVA 3GSUA 4L3CB 1BF2A 4RFNC 4M6OL 1CMOA 5FK9B 4L23A 4N7JA 4H7FA 1INDH 2F43A 3OOEA 1S9HA 3ICQB 3BG5A 3HP1A 4M00A 3MMXA 3I6LD 4PJFB 3MJCA 3QNXB 1QGUA 2X41A 2ONKA 1AKYA 3OLVA 1G20B 1GHFH 3PHLA 3TT3H 4MP8A 4FQ5A 3ND9A 1IU9A 3TNLA 4Y2DA 1SC4A 4R3UC 1ZC4A 1BHO1 2MKLC 3GD7A 3W2GA 2W65B 4RF2A 3FGNA 4Y6PA 2HHLA 4F2PA 1DDHA 1UCBH 3QG6B 2IBSA 4PJEA 5JS1A 4GUOA 4AWAA 2ON6A 4JM2F 1DB3A 4YJFB 4ZAYA 3Q5YA 2AMFA 2VZ9A 1VL6A 4LEOA 5B58T 1ESDA 1G3QA 3PICA 3I3EA 4ICWA 2FW8A 5JWOA 5F5XA 1DUSA 2YZ7A 3P2BA 4R1MA 1OHHA 5LGJB 1W87A 3I4CA 4X8OA 1MWOA 2BIQA 3O83A 1VCAA 1RJ9B 3QQ4B 2I9TB 4Q3DA 2A0UA 3PFIA 3ILXA 1MHCB 2IWRA 4HDNA 1SHWA 2E8YA 4M0MA 1RXEA 4R16A 3VSEA 4J3VA 2YFOA 3O81A 3FKSA 3WJMA 2UZYB 5EMKA 4ZICA 1QRRA 4AYFB 4KFSA 4V39A 1YCGA 2J9XB 2NNFA 3CUUA 1VLQA 3VU2A 4B7IA 1MU0A 3WKBA 2QLLA 4EPWA 3GLTA 4MJ5A 5IWLC 4D5GA 4A7SA 1T3HA 1TFUA 3TZLA 3IDQA 5GZ6A 4F3KA 1GIGL 3VSVA 3RRNA 4WKXA 1VIMA 3UQYS 2P80D 4JGJA 2YQ4A 2BCKB 1W72H 2JV6A 4LTMA 1EHIA 4QKTA 1OF2B 4NDAA 5I8ZA 3TL2A 4Y19A 3FTGA 4ZYUA 3FFDA 4FT4A 4DZRA 4LF4B 4R84A 3T04D 5DI3B 2H32H 2HRLA 4ZI7F 2DQ4A 3BB3A 3HFJA 3CNLA 3UJNA 4ARZB 1XTZA 1DC8A 3FUUA 4ND1A 3OLQA 1M1ZA 4IDNA 1QWSA 1ZIDA 3AO0B 1J56A 4CCWA 3NONA 3GRWH 2JB6A 4OU3A 1UWLA 3MLZH 2WVTA 2AQPA 2BFVL 3CCCA 4HI0E 1WZAA 3D1JA 3AT1A 4V1DA 3U4CA 2OMXB 2D0GA 4UBDD 2XNCA 2PW1B 4PJGF 4KQ2A 4U5QA 5JHBA 3NSCA 3AEKB 1E2IA 2YL2A 1KLUA 4N0QA 2E9GA 5DNDA 3REVA 1T9KA 4LGVA 5G3ZA 4ZRMA 4UILL 1FDIA 4HK0B 5E1MA 1XAHA 5AWFC 5CXPA 1IY1A 4MMXA 1NYRA 2PPAA 3TGXA 2PT9A 4B6RA 4YONB 4JKLA 1IHDA 1U7PA 1UATA 3N91A 1KR5A 2D1YA 1J9GA 1SZCA 1H8NA 5D1ZC 1OCWL 4JFFE 5I6MA 2O4EA 3LQKA 1FHGA 1Q1AA 1TJGH 1B4TA 4JM0A 1N7JA 3B7RL 1W5AA 3M34A 1Y8CA 1C14A 5IKOA 35C8H 1WUYA 3V5NA 3PV6B 1H1LB 3GELA 2D7OA 4BQFA 1JYNA 3H9JA 4XN2A 2VK2A 4D7AA 5GZNA 3SYAA 1SA0A 3P4OB 3VJ6B 3SPJA 1DIBA 5PGMA 3MCLL 2YWGA 4GX2A 2R56L 4MWGA 2J8UA 4M7PA 3AROA 4JJEA 1VESA 1VPOL 2KERA 4L1SA 3FPFA 3T3DA 2LNDA 4U0JA 4G6JH 4BTEA 4OM8A 4F9EA 2R0WH 1VEMA 3KAAA 3LUDA 3FN3A 3LIZL 3IT8D 4YEEA 4OT1H 2YO3A 3ZY7A 1R3LB 2XQKA 3TMKA 3WV5A 3LSOB 5BYAA 4PN6A 3L0CA 3MR9B 5CTJA 1R9JA 2VYNA 2KZWA 3F12B 4XQ9A 4N5NA 1U8OA 5DR5L 3E6FB 1A82A 3HBLA 2WBJD 1E3LA 2D8MA 4D9EA 4D3DA 3VXMD 4LCIH 1OB1A 2XVXA 2P1DA 4O4JA 1C8BA 1EDQA 2X2PA 1NP3A 2EDDA 4GG6E 4FQJH 5D4HA 3K1ZA 4H1WA 4LXFA 1FJGB 1VHTA 1JPTL 2IUEA 2J41A 3W39A 2JA1A 4WECA 3WR5A 3UTSD 1FSGA 5CH8A 3ZYJA 1CS0A 1GTSA 2HSEA 3I37X 4J0JA 3V4FA 2F19H 2VJOA 3SO3B 4I0WB 1G8YA 5EOVA 2G04A 1P29A 5I4CA 3RFTA 1FTNA 1M1YA 3FCEA 4WO0A 4WPGA 3L5OA 2G06A 3JARB 3ZWCA 1JTFA 3KELA 3BZBA 2I8AA 4BNWA 5C7YA 2C2XA 1CICA 3MT0A 3RVXC 1SGWA 3VO9A 1ADCA 5IUCA 3AIKA 5ALBH 1HEZB 1JX6A 2GF9A 3CZCA 3RG2A 4DDMA 3L0ZA 4CU8A 4OFZA 5ICYA 3PRJA 1W16A 5FAXA 3D8MA 2CYAA 1JXAA 4M6AA 2R0ZL 3BGSA 5I23A 3CE9A 3M81A 2RFLA 4IKOA 1YR7A 2H9GB 1JQLB 3C60A 3QVOA 4P5MA 1EXHA 4F7CA 4RMBA 3WGVA 1BX1A 2JK1A 5AKJA 3CT4A 2AHRA 1QI4A 2GTWA 1Q6ZA 4J0KA 5CUSH 1I30A 1HU8A 4NQEE 4RWZA 1QWUA 1QRND 4E5NA 1GMIA 3DC0A 2Q7YA 1EHCA 3DM9B 3R7FA 4PYKA 1A21A 3YASA 4EFLA 2AWOA 3ITDA 1LE5A 2X9YA 3OT5A 2F54B 4JFDB 2Y6SD 2J7KA 4ZHQF 3N8KA 1T15A 5I1EH 1PVVA 3VX0A 5C0AA 4QO7A 2Z3ZA 4P2QD 4YMTA 4MAFA 5FTJA 5HGDB 1T6VN 5IHZB 2JH3A 5AZ2L 3WLWD 2A9MH 2P5WA 1JWLA 1NCOA 4CC1A 3TKAA 1E63A 4YDIH 4S1DC 3VVBA 4HR7A 3OZBA 3SD7A 4UHFA 4JR9L 5SWSE 2D1QA 3SJAA 2IKSA 2EIZB 3TNNA 3QQNA 2C7VA 3SZMA 2O4UX 1C5DA 2VRWA 3HVDA 2JFOA 3FVQA 1T8TA 1DQQA 1UACH 5I5EA 2IYVA 5IMKA 1INQA 4JZJC 3ROEA 4YP1A 4L8CA 5T8KA 4PY8I 1R47A 1EAPB 2ZULA 4ZD6A 1DE4A 3MGTA 4WN3A 2PX4A 3MV7D 2V1XA 2G7MC 2RG7A 4HWBA 3EXJA 1UXJA 1ZFNA 3GLHE 1TTTA 1ZSVA 5J1SC 2BM3A 3VUAA 3OCYA 3G1UA 1I5RA 4XDHA 4KDCA 5DXJA 5TQVA 1XMXA 5E1QA 2D3LA 1JGUL 4MS1B 3GP8A 4YBHA 3CNOA 3H83A 4LECA 1V3QE 5JMWA 1YR6A 4POYA 5JUWA 4YR6B 2LRHA 5GJBA 3COJA 4W99A 3V5KA 1QVVA 5IEJA 4I50B 4I0PC 2WJZB 1A6VH 2C9DA 4CQLB 1G1AA 4Q7EA 1A1MB 2B1AL 3D6MA 4CL7A 1VKHA 2Y1LA 4XEHA 1HXKA 1VKXB 4F5WA 2PYED 3REQA 2PANA 5AK6A 4LPTA 5B1IA 2NG1A 2PJUA 3WJ1A 1T66D 3WHXA 2REOA 3VWJC 621PA 4Y4KD 1JD7A 3N40F 3OJVC 1KEML 4E9YA 2AQKA 1K4CB 2KHAA 1Z17A 3DO4A 3ABSB 1LDMA 1W1IA 3FNRA 4QT0A 4QVIA 1L5NA 3IMWA 1PNCA 5E9JA 2IF0A 2OFXA 1ZN9A 1BQHB 4CL0A 1WC7B 4BN5A 2NU8B 3ZXYA 5TQ0L 1KZ6A 3ZWDA 3P9ZA 1MFUA 4X93A 2WYWA 4BNLA 4LAJH 4EG8A 4EOGA 1TTBA 3QXCA 4WWOA 3GRPA 2YUIA 1YZZA 4ONOA 2FW1A 1XBDA 3TTUA 4OJDH 1Z4KA 3IRVA 5E6SB 5MEPA 3LVFO 1Z83A 4HWKA 3WL5A 3HXPA 4RAHA 1UXKA 1T9GS 3SX4A 1DX6A 2CALA 2OYRA 2AXGB 3HS0C 3U1TA 2P28B 4FXLA 4RA0C 4NWTH 3AVYA 2BI8A 3V7MA 3LNDA 3ZTNL 3AQIA 3AABA 4RJTA 3QDMD 2NXZD 2E4ZA 2H5IA 3R7SA 2Q07A 1U3NA 2L82A 3OZGA 4G3YL 1R0AL 4TVPL 2QN1A 3TGPA 3QPUA 3A23A 1TKWB 4DFIA 2VHCA 3LPOA 1IIBA 5CH3A 3DEJA 5DJDA 3QCUL 4FGMA 3VDAA 3BWMA 4IIEA 3HR7A 5U4XA 4TMTA 3CNBA 4WA8A 3QJQB 3MO1A 1CWUA 2QRQA 1PEZA 3QUCA 4I6GA 4XMZA 2ZTLA 1N6QL 3DBOB 5F97E 1UBSB 1FNEB 2WSMA 4CMEA 3V0VA 1XI2A 3ZJAA 4OGYL 5JXJA 4X7SH 2WRZA 1IE4A 5C1IA 3CJRA 1LO4H 2E47A 4NVRA 3KFVA 5E6RA 1JZ2A 4XCNA 5LA6A 3F2IA 5JARA 2DLTA 4FNLH 3GG9A 2O1XA 2MH4A 3B3JA 6CGTA 5C31A 4PQRA 3QT2A 1G18A 4DIBA 4PRDA 1Z9OA 1ZNYA 3ZKAA 2EQBA 1HTTA 2JZNA 3QHZH 5FIUA 3TX6A 4EF5A 1J2TA 1F2UA 1GNPA 3GIVB 5CNIA 5LP6C 1MO4A 2P5PA 4QHMA 3LD8B 5H81A 5KAPA 2HH0L 1D5MB 3BUPA 5MEQA 1JFVA 2YJ4A 4IIJB 5AWNH 2EVGA 1C7IA 2QJTA 5E7BA 3SKOB 4X90A 2O8FB 2XN9B 2X3FA 4XVOA 1S2NA 4KCGA 4ZYYA 4D9BA 1SJEB 4IIFA 1YF3A 3LWNA