3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
4MMYA 1SHUX 2VDRB 3EOBI 4F1JA 3TW0A 1JEQB 4PN7A 1OLZA 3BQMB 5ES4B 1QCYA 3PPWA 3VI3B 5KYYB 4G1EA 1CQPA 1LFAA 1TYEB 1RRKA 1XUOA 4CNBA 4Z7QB 1JEYB 1PD0A 3T3PB 3OL2B 2B2XA 1M2OA 3ZE0B 1SHYB 4HQFA 3V4VB 1RS0A 1JLMA 1SHTX 2ODQA 3EGDA 4Z7NB 4WFQA 2NUTA 1SQ0A 1ATZA 3NIGB 3K71B 1N9ZA 4IXDA 3EGDB 2XWBF 3NVQA 1PCXA 2VDPB 2XWJI 4XW2A 1U0NA 2WW8A 1YVPA 1BHQ1 2XGGA 3Q3GE 3FCSA 5E6RA 4WK2B 1IJKA 1L5GA 2NUPB 4MMXB 3HXQA 3K72A 2VDOB 2NUPA 4MMXA 3EFOB 3AL9A 1MQ8B 5HDBB 3ZE2B 3EFOA 4C2AA 4DMUB 3TVYA 4F1KA 5KYYA 3K6SB 5KYXB 3PPYA 3TCXB 4NEHB 4IGIA 3IJEB 3AFCA 1JEYA 1ZONA 3K6SA 1XDDA 3OL2A 1FE8A 2ODPA 3M6FA 5E6UB 3EOAI 4FX5A 1M2VB 1M10A 1ZOOA 3OKYB 4NENA 4HQKA 1SSLA 1NA5A 1CK4A 2WINI 3EH2A 5E6UA 1M2VA 3PPXA 1QC5A 1U8CB 4C2BA 4MMZA 1M1XB 1U0OC 4O3TB 4HQNA 5HJ2A 2VDMB 1V7PC 2O7NA 3HXOA 1U8CA 3QA3E 5E6RB 1DZIA 3ZQKA 3HI6A 1AO3A 1Q0PA 3FCUB 4BJ3A 3ZE1B 2VC2B 4GZ8A 4O3UB 3GXBA 2VDKB 3OKWA 2I6SA 2I91A 1JV2A 4IHKA 4UM9D 3V4PB 4Z7OB 4CN9A 1MHPA 3IBSA 1RD4A 3F74A 1MQ9A 3NIDB 5BV8A 3IJEA 1MF7A 1RTKA 1PT6A 4JDUA 2UZYB 1M1UA 4O02A 4C29A 1XDGA 1UEXC 2QTVA 2NUTB 1IDOA 3K71A 1T6BY 3RAGA 4O02B 2P28A 4G1MB 5E6SA 3BQNB 3BN3A 1PD1A 4G1MA 5E6SB 2ICAA 4A0QA 4UM8B 5HGJA 3AL8A 4CN8A 1MQAA 2X5NA 2P26A 1T0PA 1YUKA 4WK0B 3AL8B 2M32A 4FWWA 5LN1A 3TXAA 3NIFB 1YVRA 3ZDZB 3EG9B 3E2MA 4G1EB 3EG9A 5KYUB 5KYWA 2VDNB 1ZOPA 4UM9B 3N2NA 5KYXA 2VDQB 4WK4B 1JV2B 4HQLA 5KYUA 3ZDXB 5KYWB 3T3MB 2ADFA 1DGQA 4NENB 1MJNA 3F78A 1OAKA 2IUEA 2VDLB 2NVOA 3FCSB 1IJBA 2I6QA 3EGXA 1AOXA 3PPVA 1QC5B 1M1XA 4HQOA 3K72B 4M76B 1L5GB 4WJKB 3EGXB 4MMZB 1BHO1 4MMYB 3ZDYB 1N3YA 3EH1A 4JX0A 1IDN1 5KYNA 1JEQA 3VI4B 1FNSA 4K3JB 1AUQA
chains in the Genus database with same CATH superfamily
1K08A 4ZRDA 2KDYA 1EM8B 3JQGA 4DEPC 4M8QA 3OXSB 4R7DB 3ABKB 3UOAB 1QFZA 5EIIA 2XQGA 2I7TA 4YDNA 3JSSA 1Y0LB 4OAOA 1P1FA 5EU7C 2NZ9D 3UTSD 5T7BA 4KXDA 5K9KB 4CLOA 4PI2A 1B3IA 1NI4B 2WAMA 3GRKA 3LLMA 3H84A 5GS1A 1ZZEA 4ZQBA 4E11A 5AVTA 1SKBA 4JUFA 4JG0H 2CMKA 1RIHL 5EMHA 4U1MB 2C26A 2EX4A 3GEEA 1M1NB 2GEFA 3KSUA 4F2EA 1D7FA 3ZNPA 5E6RB 3GSNH 2I22A 4AT6A 2V6FA 2R87A 3V0FA 2AUNA 5HE8A 2YPKA 2RGCA 3H7IA 2QN2A 3P3TA 3ER6A 3CUUA 1MCBA 3KOUA 4CDRA 3T9DA 2WXQA 1WHTA 1ESMA 4BUQA 3ZZNA 2FEKA 3M7FB 2ICCA 1E79D 3NP9A 3R6GA 1LBHA 2WTBA 3N85L 4RJ2A 4UCWA 4NNOA 4WI2A 3C43A 2XCQA 5CEEA 1UHVA 5AQEA 4CTKA 5E95A 1IU1A 1CQWA 4QYTA 4QXTB 2CDEB 1QG6A 5I1LA 2ZRPA 4N9WA 3QQ5A 3H3BC 5FI5A 3N76A 3WGGA 2A77L 2DU8A 1CG9B 4MYPA 4F7PA 3FJYA 3TWOA 1HKFA 2AJYH 3RWIA 1MCOL 1BBJA 2Z0BA 4AUNA 2YFNA 5IMLB 3FVQA 2NYVA 4TWIA 2YTZA 5EF0A 3HCCA 2AF3C 1FL5A 2A5GA 5LWYL 3Q3GE 2XKNB 2G08A 4WBXC 1WT5A 2JCCE 4E03A 5HJ3A 3ZOAA 4ZFFB 3H9SE 3ICVA 4BMYA 1AD0A 4PLGA 3CVVA 3OUTA 3BUPA 2WIIB 3PCYA 4MJ7A 2EUVA 1XHFA 3NM4A 1ZBQA 3VGAB 3VGGA 1QE3A 1DHKA 2WGNB 5CLZA 4I1OA 5AZEL 4WW2B 3JRXA 5LB1A 4W7IA 4WTZA 4LZPA 4KH9A 5AJUA 2J3LA 5KANI 2EG9A 2VNIA 5EDSA 2HZBA 3KTAB 1NMQA 2P4UA 5I23A 3RWDA 2JFGA 4LBVA 2AR0A 2GIYA 2HHJA 3N0RA 2PTGA 1P7YA 1IIBA 4PWZA 4M7PA 3IAQA 3WELA 2F7OA 1A9SA 4OSEA 4W93A 2PSFA 1YUHB 3F9RA 3HBJA 1QQDA 2NQCA 5D3QA 3HPJA 1CJMA 1KH1A 1EDDA 1T5WB 4PV1C 1G6HA 4IQFA 3L3DA 2LZ0A 5IDWA 1PG7L 4I0PC 1USUA 4NCKA 1LO0L 3QUZD 2H5JA 2ZUWA 4CF4A 1QLFA 3VC1A 1MW8X 3CJRA 4RTKA 1K72A 4O51A 4RNRA 4Q3BA 4I6JA 1PSKH 2Y76A 3EJZC 3PWJB 1VCNA 2P68A 1HEJC 2ZWKA 1CBVH 4BHUA 5FNVB 2QZSA 4HU2A 4G9BA 4PLPA 3SJZA 1YK1A 1RJFA 3I84A 4RVCA 4DWWA 2XG5A 1DJLA 1OXYA 4FFWC 2G72A 5FHAH 3BVPA 4EIBA 4EFDA 3IE4A 4L75A 5L3SA 2QTVB 4UHEA 4H7FA 1CETA 1DO5A 4GR4A 3FQXB 3N1FC 3PUKA 1ZRHA 3PRKE 4CM5A 4BQEA 3WIIL 3EQ8A 2V7HB 4OO3A 3ZTJG 2ZSEA 4XQEA 2QT6A 3RPEA 5DNUA 3WUWA 1E94E 1XDUA 3II6X 4UVGA 2BSTB 3RJQB 2VB5A 2UWEA 3MLXL 1SZJG 1E5VA 5IDXA 5C0CB 2ZPKL 4IU2A 1C7RA 1JHYA 1GGVA 3DUFB 1AMUA 1JWSB 1CUAA 3NHPA 5DEIA 4YEEA 2R6CA 2JI6A 3SCMA 1YS9A 4MRMB 1WFIA 3M46A 3QVOA 5EXEA 4DSTA 2WQWA 2A86A 4XVTL 2HB0A 4D99A 5L0QC 5FYKL 5CRIA 3KTAA 1X2EA 2QSQA 3OZ9H 3QIUA 3EXHB 1X7QA 3TPKA 1JIBA 3PFCA 2JJYA 2EZ4A 5KMGB 5SWSD 1E32A 4MR8B 5K7SA 1F8TL 1PKEA 4W5WA 5B7NA 3RBSA 1L4NA 1N8KA 4KR9A 3BRQA 4BNMA 5G3ZA 1EWRA 1M57B 4W5OA 1YKGA 4HWBL 4F46A 5HI3C 1CYGA 4P2QB 2Z8ZA 3K2QA 3T3IA 3R09A 3W5NA 2FW1A 2NY4D 1FUUA 2OMYB 4PHTA 5DYFA 4OLYL 2AGVA 1CICB 1HT1E 3FPJA 4RLHA 1KPUA 3UJ3X 4ZI7A 5CB4B 5K4AA 4M5TA 4M37A 4LNUA 3T5GA 4A7TA 2ADYA 1JXGA 5C0AA 5JDJA 3OCCA 2EXWD 1N6LA 6PCYA 4O1IA 5ITFB 5AMXA 3WIIH 3IUMA 4LIQH 4PGBA 3OLXA 1C12A 1IUOA 3TOCA 4ANVA 4EJSA 1ZHOA 3FRIA 4C5BA 2FD6H 1KO4A 1XTUA 3RUIA 2AW3A 5IM4F 3MV8A 4O2EB 2BT4A 3NAAH 5F73A 1NZFA 4W5TA 3F6SA 2O07A 1K5DA 1HDMB 1DJGA 2HMYB 2E85A 1TTFA 4G1VA 2F5AH 3EJYC 5B2FA 5IW1A 1GTRA 3V10A 1Z9LA 2PFGA 4LEIA 4LF7B 2VYVA 3AG1B 3CC5A 4CIBA 5LPNA 2DFVA 3CISA 4ZW6A 1ZD4A 4BSWA 3O03A 3L8FA 1B2RA 2WUVA 4E9TA 4KTTE 5TLSA 1SXJC 2J2ZB 1K5PA 1JPST 5C80A 1TKWB 2K1MA 2YZGA 3ZY4A 4AQEB 4ZW8A 3PU6A 1DDHA 1BU5A 1VLXA 4DGUA 3Q6FB 2OHVA 3UT5B 1VLMA 4ODUA 1UJCA 4KTVE 5JE8A 5DSCA 1UWCA 5TPZA 1E0SA 1BGWA 3KYIB 1UKQA 4J07A 2H26A 2F54A 2VDOL 3K70C 4ZXFA 2YD5A 1M34A 2IU6A 3AB0C 3BWUC 3FOBA 1TZJA 3ZQJA 2QLJA 1N68A 1K68A 4YCCA 1DJWA 5CP7A 1OIWA 1TUPA 3EDCA 3T4AC 4BKRA 3DONA 4KWUA 1JKMA 3TO4C 3O0LA 1U0QA 3EJCA 5LGJB 5EIBD 1A1VA 4Z7QE 4L9AA 1XDDA 1FP6A 4QJ5B 1ZVYA 2OJEB 1MFAL 4JUIA 4MRBA 5B1BB 4TYNA 1F56A 5K99A 3FDFA 1I1FB 3ARUA 2H8GA 3MBEC 5FWAA 4IMKC 3PABA 1B0RA 3OPXA 4DM4A 1WCBA 3LVEA 1CJUC 2QZ9A 2J44A 3AL8A 3IAS1 5IVZA 2YRXA 2OYMA 3R3UA 3UJPA 3B1JA 2YW9A 1C9DB 2F9BT 2WBWB 1QIGA 1GRVA 1SU8A 3F0TA 2B14A 4C57C 3TIIA 4KQ3H 4G82A 3S2EA 5IP4A 4P4KA 3HWSA 3UZEC 5E4OA 1A71A 1FFQA 5I15L 1F2DA 1L5OA 1YG9A 2CFCA 1VJDA 3BE1H 1P7KB 5C35A 3FB1A 5DGXA 3G23A 4U49A 5DOVA 4Z7VE 4Y1AA 2Q2QA 4P5MA 2P9TA 1R3JA 2RFXA 3TASA 1GUZA 4XD7A 4TKZA 2PTTA 1FIEA 3Q6FA 3OKOB 3RJTA 2C9MA 4GSUA 1QU3A 4EEXA 3ZV5A 5HZMA 1P7VA 5TSDA 4Z3FA 3F00A 4GOXA 4L1KA 4BE6A 4MV6A 4J0FA 2VJMB 1YMMA 5TDPA 2Y6VA 1XZ0A 4FMPA 3CSFA 2IIBA 3MINA 1MX3A 1I1AC 2W07A 1SUIA 3WKYA 4G3YH 4J3UA 1JMYA 1ADFA 4A67A 4ZFOB 4G0ZA 3VI4A 1RYEA 3ZS9A 1EEHA 3PENA 3RS5A 3SX2A 2AK1H 3EDOA 5CSZA 3TO2B 3PX3A 2BHLA 1CT9A 1KGCD 3NHAA 4H8HA 2EKSB 3S36H 3IBTA 2GN8A 1DVYA 4P6VF 4FNLH 1KC3A 2ONCA 1E89A 3W5MA 4EF6A 4U9HS 4F15C 3U1BA 2R8SH 4GLRI 3JVGA 1U8OA 1WBYA 5ICEA 3LMJL 4QRUB 1JI0A 1T21A 3UMMA 3RWJB 3ETHA 1O6SB 1RXYA 4JC4A 3TW8B 4X7MA 3WNNA 1M8GA 1G9TA 1QQAA 3FMGL 4BZ2L 3I6YA 3PITA 1CFSB 3N9GH 3QEUB 2Y2YA 2Q3MA 3LQAH 3VFWA 1F58H 4R81A 1QE0A 3RAJL 4O5AA 1H42A 5GJVC 4F9LA 4QJ5A 4Q4AA 2ABWA 3HVRA 4TULL 4R8MA 1PR0A 2FHPA 2CSUA 3P54A 3CDFA 4BFTA 1G9MH 4M0LA 1KV7A 4GR5A 2NSHA 5FCUL 2Z8YM 4LPCA 4LRIA 3MUNA 1Z9OA 3MN8A 3VGBA 3NHZA 1DQZA 3SDZA 3N53A 3LW8A 3GNSA 4K03A 2OYKA 2OBYA 3WLSA 2LVBA 3UYKA 3MW8A 3NHMA 1UWGL 5K1VA 1U7OA 1ADCA 1M2NA 4Y2PA 3OX1A 2G30A 2E1PA 5JNRA 4ZOLA 3RVVD 1M8JA 4IMKA 3UJNA 3RVWC 2IHNA 3IKCA 3VXOB 1U7ZA 2VHVA 3PWPA 1FP4B 4O4JB 1YSCA 4WADA 1VJGA 2X5PA 5JXWA 1NFKA 2P46B 4Q9AA 3L5IA 1RW4A 1J09A 5DO2C 2XYVA 1C8KA 2YMXL 3WFEL 1G63A 2ZSKA 3HC3H 5E8EB 4OLBA 3BAZA 1DDTA 3SSMA 4PG6A 2B83A 2AKAB 1DGQA 1XGKA 3D4IA 5JRDS 1VGRA 4OQPA 3KHUA 1Z5UA 4C54A 1N59B 4BH7A 2KKQA 1WCYA 4U2DA 3CZSA 5FX2A 1Q7TA 4YHPB 1BLNB 1Z2AA 4IX1A 4UOW0 4FPXA 3BWAA 4A2DA 2AZAA 1QHEA 1HDOA 4N3UA 2ZBQA 3OTOB 4UZSA 3ROFA 1EMTH 4B4OA 5K1JA 1NEZB 2H2DA 4XVHA 5LA6F 2CHGA 3ZWYA 1XF2B 1J9EA 4P3CH 5L2KE 1YGYA 5A2FA 2IS1A 5EL0A 2H9IA 3G5ZB 1ONBA 4GW3A 2IU0A 2QG4A 2BEVA 2QRZA 4JKKA 4M5YH 1KJWA 3AAZB 4LESA 5JXEC 4PN7A 5F7EL 2GCYA 4DR7B 3GD5A 1QRTA 5A16B 2DLEA 3BC9A 4S0HA 3TPFA 4E5DA 5EIXA 5H2BB 3HI6A 1KERA 5EU7E 2BMFA 2OG2A 1GA4A 1O6SA 2H3XC 1WV7T 3WIHA 3PF8A 2VRNA 1PQZA 4BMOB 4Q19A 3E8UH 4LLVB 3QB7C 3L2NA 5AJTA 1YSOA 1KNXA 2W48A 4KDWA 2Z83A 4YUZA 5AHWA 5J5CA 5C9KA 4DUWA 2EKDA 5HKAA 2JV6A 2F18A 1V1MA 1NBAA 4OBXA 3UPRA 1QORA 5AI5A 1Q6ZA 2QLNA 3BK7A 5FTMA 4A8JA 4GM1A 1JP7A 3T0DA 1U21A 4LOFA 5H37A 2FZVA 3VMNA 2B8TA 3CHRA 4BMVA 3DI2B 1Q92A 1BDJA 2VSMB 4FLHA 3K2IA 2YUIA 5KSBB 5I4CA 3JAKB 3PVZA 5I8ZA 4BQ9A 1CUZA 3RHWK 3DEFA 4DCSA 4KFMA 3SIXA 1YQQA 3LZNA 3N5CA 2HTKD 3VWJD 2XCSB 2YEZB 1F8XA 3FI0A 3G2LA 2MOVA 2JBHA 5F7DB 1K6MA 3WJAA 1Z0ZA 4D8XA 1BNCA 4EDHA 4EZMA 1ULSA 5IYZB 1F4PA 2EZ8A 1P18A 2K6ZA 3HE7A 4GRLC 1G2QA 1HKLL 3CR7A 5LQSA 3MMEA 4G8DA 4J12A 3Q3HA 1WXFA 4KUZL 5B3KA 3RS7A 3LIZA 3DPSA 4C3VA 5EU6E 1F2UA 2L7QA 1OT3A 1ZIXA 5HDBE 3SPXA 3RT1A 3KPRB 1FNSH 3HBLA 3SICE 1KBKA 3UTTB 4OBRA 1ZSYA 4PVBA 4OMCA 5IR1A 3SSAA 2ZSUA 3K3QA 4N28A 2C31A 1G9SA 2AQIA 1X92A 2I3ZA 4A7UA 4R9NA 2AL7A 1VE9A 4X5QA 3FAKA 1G2IA 3PKIA 3OR7A 4L9WA 4DCCA 1OA1A 2QAGA 1GH7A 4KNYA 4ND2A 4FA6A 5KQGA 1UBFA 2XR1A 4JXZA 3OXRB 1T0OA 2F0CA 2TECE 2X7HA 1ZS8A 3D69A 3RVRA 1L3BA 5A2LH 1L4FA 3UV3A 3JXEA 2HHAA 3GMMB 4C6TA 2ED9A 2CZNA 4BGDA 3Q7RA 4TOIA 1H3TA 4HGNA 2OSVA 4IEFA 2X1QA 3C3BA 3PD0A 4HLZH 3OLQA 4TUYF 4NC1E 3IS0X 3QDJE 3CIAA 2AXFA 3L3OB 1S2IA 3LN4A 2AYZA 3EQ6A 2VLME 2YMLA 3LAWA 1HL8A 4AP9A 1JKIA 3HBNA 2FHFA 3U3MA 3B7WA 1QCDA 5TE6H 1KARA 1T36B 3DOSA 4PCLA 3QR2A 2IXBA 4PC6A 3MRJA 4RLDA 5F70A 1VFOA 4OH7A 4DMUB 1Q77A 1T1ZA 5DLDA 1H4TA 1CLOL 1VERA 3KFVA 2IYUA 4N8CH 4N2MA 2VYVD 4X54A 1I01A 2B9BA 2ICEC 3BEDA 4FTVD 3C3AA 1U4SA 3D0KA 1SPXA 1GGKA 4KQIA 4Y5VA 4Z7QF 4L0MA 3K4AA 3CKYA 5CLJA 3A1WA 3L4UA 1W72A 2VZEA 4Q6IA 3VXME 3CVHH 4XBGB 4EJ2A 1DMRA 1U7TA 3GGOA 3IJEA 2R79A 3P3RA 3ENQA 3GSXA 4JGUA 5JLZB 1JPNA 4BSWB 1SKAA 4TTGA 4IHAA 5EFIA 3H2QA 3S3CB 3H04A 4RAOA 1H6BA 3BN3A 4Q9BA 1KPIA 3S6JA 3TT1L 1R75A 1URZA 2BFEB 3C5CA 3TKLA 3QARA 4FTVE 4NCC2 2D0GA 5F72S 4DC0A 4DR6B 5KYUB 2RGEA 3ZK8A 2CL0X 2HD4A 4NUPA 2XA8L 2XLCA 4O1HA 4FT4A 4Z9AA 1X77A 3NM5A 3ESPA 2X19A 3Q8XB 3KEHA 3GXPA 5C0EA 5AVKA 3CZ5A 3TZHA 1KIPB 2QTGA 3EMKA 1NCNA 3FYEB 5F0JB 1R9JA 4GYWA 1S3FA 4P4NA 4CHGA 3CEMA 4C76A 3GBNH 4ZJZA 5AL0A 1J10A 2JHCA 4AZ0B 4MITA 2YNMC 5ENZA 4GAFB 3EDYA 4WOCA 1KYZA 3K1AA 1OSZB 4RD2A 4PXSA 4QOGA 2WPDD 3W7VA 4YHPA 5BR8B 5I2IB 3ANMA 3TFQA 2DV6A 4QMEA 2Q0HA 3SAJA 1M83A 2HFJA 4BNVA 4GKNA 1RVV1 4GXFA 1GV0A 3OP1A 2CAKA 1G4AE 4KTYA 1HBJA 4LE8A 2E8ZA 4GAAA 2PGLA 1LRKA 1F4XL 3P19A 1NW8A 1D5ZA 5HGAB 1V5FA 3GLKA 1IFHL 5I18L 3GRRA 1L9NA 3I04A 1UC6A 5IIEA 1BBDH 3IOMA 1YRHA 5CW2A 3EUEA 4WCFC 3WSWA 4HKXB 2RGYA 4WCYL 2BP7A 3UWDA 3MO1B 2D8KA 4KRLB 1BZOA 4HLZG 1I85A 4ARVA 1JYFA 1ZWIA 5DNDA 1W88B 2DLTA 3KPUA 3AL8B 1AXSA 2B8OT 1SZNA 3NH7H 2YYAA 1NDUA 3GN1A 4IFBA 5BQ7A 5C70A 3I4LA 4OLWH 3MJ8B 5E9DB 5F7KC 3V6MA 1H5QA 1AQMA 5EIFA 4HI0E 1HX0A 3EVTA 2VSCA 4MW2A 3RYIB 5F3FA 2Q4DA 3UTPE 3LUAA 4IX9A 3TBWA 2XKUA 1JE6A 1B00A 5HIKA 2OBMA 3H0KA 4D7BA 3LKSB 3PRHA 3V4VL 1UKTA 4J2TA 1PJCA 1TUBB 4PCKA 3F90A 5CG2A 1LTQA 3FPBA 1NQ5A 3A6DA 4LYDA 1EMTL 1HSBB 4NKMA 2GZ2A 5GV8A 4F9TA 3H4HA 5JSZB 1KC5L 4YT4A 4X6DE 4Y2OB 4YHYB 2Y0EA 3CNLA 3WAGA 5KTEL 3UVEA 4RXMA 1KFJB 4M7KH 2B98A 1JF6A 4REOA 4OCRL 4MJIE 2FYTA 4IJVA 2FO4B 3SJVD 4PYMA 2VP9A 3BKYH 3TTSA 3PNYA 1BBDL 2REQB 1U4OA 3BTSA 3ELWA 1Y3IA 4IVPA 1PBTA 3O2DH 3MHZA 2DFLA 1KVRA 3PQYE 2DMBA 3PUZA 4XWAA 2CCKA 5IWLC 3OG6B 1OU0A 4GIBA 2HK8A 4JR0A 3ACBA 5B3JC 1MAUA 3QMVA 4DK3A 1J8HD 5F44A 2HJHA 4XB7A 2FAXA 1QUFA 2HCTA 4PV8B 4MDRA 5BNIA 4OF5A 2FWNA 5DK3A 5F1NA 4ZQIA 3NCYS 4RL6A 2QYOA 1QPKA 4BOYA 2XCUA 3LPPA 3GD1C 1C3OB 2OPCA 3KYNA 4OCNC 4EAEA 4XGZB 5CILL 3I0NA 3N0VA 3OKYA 1TU2A 4PLNC 2F8LA 4HRAA 4WLNA 4JQSA 2R6ZA 4NXKA 5ADWA 1ISGA 2Y6SD 3QX9A 4QBFA 1YECH 2OPBA 2PV0A 2J7KA 1I4DD 1C3OA 1TVEA 2ZJ1A 2YCLA 2O8FB 4OFVA 1P7PA 2YHIB 1ZD3A 2ZIGA 3T8VA 4BE7B 3QNFA 4CG3A 2XMDA 1UXIA 3W1WA 4YXFA 3V7AG 5CBPA 2QLVB 1JZGA 1KZQA 2W8BA 3DMNA 2O2CA 1HZKA 1QMGA 2O14A 1HEHC 1IBGH 4G7VL 3HUJB 3D12B 5EU5B 4PY2A 2VT3A 1TIPA 5FWRA 4K7PX 2GN2A 2NU8A 1MJ8L 1JD7A 4AKSA 2ZT8A 2VI5A 3LUJA 1QB8A 4LYYA 2YQ2A 4OZGF 2G40A 4S1QL 2OAGA 2JELL 2Q5JA 4YRGA 5F89A 2JKLA 4AGMA 3D2LA 3QEQE 5CKGA 2IHUA 3FWNA 4ZYXA 4LGRB 1R19A 3QXUA 4W9NC 4A7SA 5IJCC 4HS4A 3KH3A 1ZN2A 1SN0A 1SPDA 4U05A 2FNBA 1PV2A 2WJ3A 1OD6A 5BV0A 1IONA 4M48H 3ABSB 1G20E 4IIGA 5CTJA 3W7BA 1SMOA 1CUHA 1ECYA 3Q0IA 1F58L 3U80A 1KXQE 1X86B 3GMSA 2QLMA 2XWTA 4F3CA 1ZZGA 1Z8NA 4LQLA 5LJIA 3BG5A 5DHEA 5K59F 1OVMA 3N2IA 4L4SA 4LCWE 4OLUL 4KXQA 4A03A 4NZTH 2EVJA 1CS0B 3PUCA 3W90A 3WWDA 1OIXA 1QP1A 1GOHA 5K01A 3ZDCA 1T4KB 3U19A 5J1SB 1FSKB 3A25A 2P4EA 5DCCA 1UK6A 1BVZA 3TNNB 3DJYA 3ZR4B 3CZMA 5L3ZA 1UM4H 5J13C 1P61B 3BPOC 5E2IA 2G04A 4M7ZB 1O94C 4ZO9A 1L8QA 4YAUA 4YBQC 2FQXA 2NZUG 1A6VH 4ETWA 4JVPA 1A2BA 2CUTA 1ILUA 2I7SA 1OH6A 4QXUL 3SC6A 4A82A 1N6QH 1T4KA 1ONOA 5DWPA 5BZZA 5KS9E 4LDEB 1FDSA 4ZFQA 2HTEA 3FZQA 4BJHB 4TQEL 1UMDB 1H2BA 5B38A 3GMQA 3CNBA 4JFRA 4TXLA 4FTDA 2DC1A 5JDCA 4PQYA 4GX2A 4W9DC 3OJMB 4EVIA 4A8HA 1YYLL 1PFWA 2KT6A 4EY4A 1UFUA 3FO2A 3P2KA 3HLAA 5HGDA 4AFNA 4TMTA 2R1YA 1C0PA 2ADIA 3PLYA 4RETA 4XOEA 5AM1A 2A3RA 4DCOA 3DEHA 1HNFA 2JAXA 4JRXD 3S0PA 3MV8B 1N1GA 1R0ZA 3BJZA 1HRDA 3KBPA 4QJ3B 4MS1B 1GNLA 2G07A 3VBEA 3GD7A 3SBWC 1CBVL 1O03A 3VYVA 4HDRA 2Y2WA 2RONA 4I3RH 5J12C 1KS2A 4KZDL 1BDIA 1XWVA 1WS7A 4BE4A 4LJ9A 4BFZA 1MWAL 5K6TA 1VCMA 2SKDA 2ICEB 4P5RA 1JJVA 2VJOA 5TPWH 1DB3A 1BWQA 4C4TA 1GZUA 4U7WA 3ER8A 3JU3A 1XCTB 1B1CA 4RGMB 4PJIB 2VAJA 3TN0D 3FUNA 1MCWW 3BIWA 3C5ZB 2OEPA 4KMMA 3H1GA 1OQAA 3KVPA 2YN2A 3D6NB 3EFFA 3CRMA 4ZKDA 5BN3A 4BZXA 3LPDA 2YJTD 4NCDA 3LX4A 1OGAE 1ECLA 2H7WA 5CILH 1KB3A 4C6HA 1A47A 3USES 1CGUA 3WB1A 3HNTL 3FKQA 1I1HA 1CC3A 4L1HA 1E5DA 1XJ5A 3TAHA 2IHYA 4UM7A 3VYNA 3BPCB 4XVJL 3PXCX 2R8XA 1YI1A 4KN6A 4AXXA 3FR8A 2I34A 1RRCA 3ZDWA 4KQ6A 1TZ8A 3H2WA 4YSCA 4WSJA 3V4UL 1G17A 4DP7X 1DO8A 3L06A 2NLOA 4R8SA 1KIFA 1KMMA 3IUBA 4KAAA 5FUCE 5AVUB 3GG9A 2QUAA 2YKKA 2R2BB 4XAKE 3U7WH 2IVZA 4KRYA 5JMRA 2D13A 1AZUA 4MWSA 4PZCA 2IZZA 3O8XA 3GKZA 4A4DA 1KJ2L 4NQDE 3NFSH 4W9LC 3F78A 2INGX 1T7ZA 5T1DL 1VIAA 4GLFA 5LZ9A 1I7PA 2P6RA 4K94C 1BM7A 2NACA 4NBWA 2WXOA 4LSGA 3UBXI 1SHLA 3FUXA 3VNYA 4GG6A 2ZM5A 3E8MA 4KO7A 4EAQA 2IC2A 2NQ3A 2VTBB 3ML8A 3DL7A 5F0LB 2BUCA 3D3WA 3W11C 4IIJA 1ABBA 2JLXA 4NYMQ 3DSFH 2OK8A 5E4YA 4EB0A 3ZCSA 5ALUA 2P8SA 4KR6A 2R68A 4YRNA 2B7CA 2VM4A 1XR8A 4OIAA 1Q7GA 1ZNWA 3C4QA 3MRGA 4HSCX 3C74A 1ESZA 1YZUA 4MUNA 4TM8A 1T8WA 3HN8A 2Q41A 4ZUTA 3NVDA 1JG9A 5AK3A 4WOKA 4I77H 3WHKA 1KTLA 3VMOA 2P1DA 1KYWA 3T3GA 1D4FA 2DECA 2HJFA 5L8KB 2QZPA 3P77A 4RPKA 3WNOA 4L85A 1S7RB 1KSRA 3NV7A 2FSEA 5C32A 3KSRA 1ZVVA 2ZF9A 2VEOA 4XMLH 5FYJU 4DJEC 1U2YA 3U7WL 4G85A 3BE1L 5I75C 1YONA 4CKBB 2ZG3A 1YIOA 1F3JA 5C9JB 1VSCA 3L6RA 3N3AC 1T4GA 1FW8A 2B1AL 2ERCA 1KS9A 1KRWA 3W2DH 5C0CD 1N2CA 3SX4A 1JHUA 1Y1PA 1YJAA 1FG9C 3TBCA 2ZBPA 1IPFA 2JI9A 3SQWA 4ASUD 2OQRA 4EQ6A 5KI6A 2BIPA 3K0EA 3I6SA 3GUCA 4M0MA 1NOJA 1OB1B 3C6XA 2VTKA 4P9MH 1YRQA 4NZTL 5F88B 2B0JA 1DOZA 1DANT 5IB2A 3RG2A 4XVSL 3HRIA 3VM5A 2XWBF 4D0RA 2QN7A 5EEWA 1GQFA 4EPWA 1N2HA 4FWBA 3BPNB 2CNOA 1E8XA 5DSCB 5JPMC 2B0SL 1BZ7A 1DXYA 4GG8B 2EBHX 1N3NA 2XTJC 5I47A 4Z7NE 4P92A 4Z51A 3DO4A 3BD6A 3AIMA 4ADJA 3HCBA 2G06A 4BAGA 4HUVA 1X42A 4I48B 5JAMA 3VRLF 5IKEA 2P6NA 1S7WA 2A58A 4HUXA 4E31A 2AJDA 4YDLB 1S96A 1H69A 1N2ZA 4DPCX 3E61A 2VH2A 1NCDL 3IUEA 5AVVB 5JIIA 5FUCC 3I6QA 1UZAA 3LYHA 3CSYA 4ZGBA 1E28A 1E3WA 1U8FO 3FMGH 4EPXA 3RS9A 3E23A 2XGJA 4KQ4L 3TL3A 5LNGA 5CINH 4OW6A 2D6FA 2FEAA 1V5EA 4JJGA 3X3HA 2WLKA 4HWUA 1LLQA 3EOAA 4RESA 2JIZD 2W2LD 5ECYA 1SZDA 3C15C 1W4RA 5AP9A 2DYPB 2C2XA 5CFNA 4EUPB 4WNSA 1A4AA 2VOTA 3L6BA 2OYRA 2CDAA 3IE2A 4QDTA 3LHPH 3VJRA 2E7ZA 2K6GA 4IJUA 1EX6A 3TESA 1ZJWA 4A26A 3DA0A 1BPLB 3UGUA 2VH5H 3FB7A 2EDMA 1WH0A 3VE0A 3H9HA 2B69A 4N0FA 3GMLB 1PV1A 1QHPA 4U1MA 2KI6A 2C9YA 3CFMA 1NC1A 3NOQA 4EVNA 3EXJA 2P3QA 1DRUA 4RZ2A 4FZEL 1FFBA 1TQ4A 2WANA 4OJFH 3G0BA 2NR6D 1UWXH 4WOJA 1E6OH 4XTRA 5CEFA 4JHZA 3N2KA 3R8BB 3CE9A 1SXGA 1XK6A 2P4AB 3HAEG 5HYIA 4FCWA 2PJUA 4N20A 1V71A 1B0UA 3MAJA 3HRPA 5B3SB 4Q3CA 3ZMNA 4G8EA 4P2OA 4U1IA 1Y6JA 4C56B 2G17A 5K8CA 4MRAA 3QJSB 4HH4A 4RD0A 4N0RA 3WFEH 2IDCA 3NTLA 4YHZH 4BQIA 1WD9A 2PWGA 1UOQA 1SEPA 1PZCA 2P0EA 4JY5L 4Z54A 1H0SA 1MF7A 3L5XL 3IJYA 1WRBA 1AI1L 3RARA 5C7LO 2FX3A 2QUHA 4ZDWA 3WGYA 5IB4A 3WNVA 2H3EA 1GNVA 2X5NA 5FGCE 4A91A 1BROA 4JASB 4PJ9A 4TRMA 3VO2A 3B5TA 5K9ZA 4PC7A 2FTAA 1ZGJA 4XMVA 3DX7B 3QIUD 3L4ZA 2YA1A 1M2WA 3C3XA 5CD5C 3PL6A 2P0AA 5CDFA 3HZHA 3OM3B 2DH3A 5TPWA 4XT1C 1D0SA 1EINA 1KB9K 4I50B 3IGFA 1VFAA 4A3SA 1CNEA 2E7MA 5EWLA 3BRSA 4HDAA 3WY4A 1EFQA 1WGOA 3C5JA 2YOGA 2PCXA 1UDXA 1QFOA 1E4KC 3RWJA 3P2YA 3U31A 3B2VL 1H5BB 3U7HB 2UZYA 3FFCE 1F14A 3AU8A 4B9YA 5LXTB 3I8SA 2X8BA 1PZSA 3BE5A 1E7MA 3A4EA 1L5VA 1QBML 4UU8A 5ALVA 4PGEB 2RCYA 5BXFB 1PDVA 2R2EB 3C3KA 1B2LA 1BXUA 1RP8A 1ZUIA 2GT9A 3KOZA 4OGGA 3DLCA 4CBZA 5AOCA 3QGMA 2JZOA 5CVVA 1B76A 1DZIA 3HS9A 4M6NH 1YEKL 3QR1A 1ZTXL 3IR6A 1D1SA 4X6BA 4QTUB 3ZHQA 3MLRH 4QG7A 2H07A 2KWIA 4II3A 3ICWA 2ARJB 1XF9A 3KW8A 3KQUA 1UKCA 3ARXA 4C4KT 5ELIA 4KJWC 5AESA 3R9XA 1CE1L 1ADJA 2GPTA 2JFHA 1ZIYA 2O3QA 1KC1A 5D7EA 2OV3A 3QAZB 1E5YA 3OVMA 2KLSA 6Q21A 1GOGA 1DG1G 1OGYA 2OZPA 3A8TA 3LQFA 3GQVA 2F53A 3IBOA 1XQ1A 3KYDA 5DVPA 4GNKA 4X6XA 3INOA 2L7UA 4WUUB 4L6IA 5I7UA 4IJ3B 1U9IC 3R4RA 1VM6A 3HAEH 4U3SA 1JBKA 1VJ1A 5B37A 1DTWA 5IF3A 4MRCA 4JREB 2P47B 3CX8A 4N68A 5DJZB 1DQNA 4F7TA 4AYID 3T3PB 3BREA 4V1DA 1FNFA 1U11A 2ZGVA 3QRBA 4OZHF 1EP3B 1DDOA 3VWJC 2NY0D 4HMPA 2QSCH 5TE7H 4UOQA 2YD4A 2YPVL 3RVQA 3S99A 2DDQL 4K7FA 1RHKA 2PIAA 2D0PB 2RI6A 2XZDA 3RODA 2QUJA 5JIHA 1JGEA 5IHZA 2G2RA 5C0CA 3WR5A 4NM8L 3GN2A 4B32A 5DJ8A 3T7KA 1R1CA 5MEOB 2NVBA 1CDZA 1DQQB 1OK8A 4CBPA 5G1OA 5JCXA 3K4DA 1P9NA 1U3GA 1AO3A 1TW3A 1LO0H 1GOTA 3ELBA 1MLCA 3DX7A 4YDHB 1IWBB 3RLFA 1M73E 1O7SA 4YVUA 3IMSA 2BIQA 1PT7A 3FMPB 1Y1QA 4F71A 4UDUB 1QSVA 4D3XA 4DREA 5TDNA 4PRIE 1GTL1 4R2KA 2HREA 4OU3A 1D7OA 1IB0A 4NQEE 5D6CB 3L4BA 3MLZL 5IG7B 3VISA 5IFKA 3ET9F 3FTYA 3TO4D 2VUUA 5AVTB 1GAXA 3ZQUA 1C7FA 5DWVA 1XFDA 3FCSB 4Z7VF 4PJDA 1T9ZA 5AICA 5T6MA 2DWUA 1FFYA 3SGJC 3TZ6A 3TIEA 2OLDA 1NBYB 4N2CA 3O8QB 2OTWA 5T41A 3LD8C 1MJ5A 1B6RA 2ACWA 3ZTNH 1E2WA 3H9SD 1EB9A 3KVRA 4LDOB 1WS6A 2RAFA 1H2AS 3HCFA 2YGVA 4QGYA 3RS8A 2ST1A 2GFBB 3MJ6A 2VQFB 1ZT4B 2R0LH 4H8VA 5LOVA 1ZWIB 1RKBA 4EHIA 4GW5A 3QK7A 1SN7A 4HRYA 1XRPA 1P5UB 5CK5A 4EYOA 4J43A 4V03A 4OHKA 3FT9A 1GRCA 2WU4A 3IDQA 4WAFA 2P24A 4OZIF 2B1GA 3KNBB 1U3DA 4R2GD 3PGCA 5E8NA 4FBMA 1A9TA 3ANSA 3OQHA 2DLIA 2MH4A 1F38A 4FS3A 5B1DA 3NS7A 1U8CA 3AESA 3K92A 4UQDA 3DWIA 2PCYA 2XUWA 4AF6A 1MCZA 1ZEMA 2IANB 4I1IA 2Y1EA 4TULH 1I3CA 4B76A 4E41D 1ZIDA 3WK4A 1SNRA 2G1UA 1S5HA 2Q4OA 2XUHA 5ENVA 1N57A 2LOEA 4OBBA 4PYIA 5CLXA 4MB5A 3ZKNC 2B5OA 3LO8A 2JH3A 2DQUH 3A22A 1KGWA 4FE4A 2UZ0A 3L5WB 1P2TA 25C8H 5AK6A 3CLTD 1J8RA 2QKIC 1TM7E 2I2FA 2VO5A 5TF1H 2QAGC 2UYLB 1NFDA 3QVWA 1JPVA 4YRZA 3P3UA 4YJ3B 3FRHA 4X8XA 3AVPA 2JLSA 3NABH 1B4RA 4GUCA 2CK0H 4U0RC 3VU1A 2KQUA 2XWSA 1A1MA 3S3JA 2NZVG 1TQ2A 1R0RE 2PMEA 1YY8A 4PRZA 4CTOA 4KAXA 3V6FB 1M3JA 3OHXB 3T65A 3LTVA 1RSFA 4B97A 3KOOA 4GP5B 2BKLA 4NIKB 1DEEB 4U4BA 4QLRA 2OOKA 1AQDA 2O26U 3FT2A 5KPDA 2EE6A 3ZUPA 1L9MA 1QKJA 3TIEB 4BGEA 3F73A 2VRAA 1NBYA 3IQGX 3N05A 5J23A 4YDJA 3A9VA 5E03A 4MLDA 1K8IA 5EIWA 1NGPL 1IHPA 3CIQA 1VADB 4Z1MD 1M0EA 3DLQR 3GBMH 4AV0A 4RNDB 2CL7X 4YZFF 3RJ9A 2P5WA 3FB4A 1NSYA 3MLSL 4V11A 4P7GA 4C1BA 2CV2A 1GQQA 5C8JA 4RRPM 5CXXA 1LXMA 1JI2A 2G4VA 1QSEB 1YNSA 3DO7A 4YHBA 5E8PB 3B7RL 2K4AA 3QW9A 2J87A 1J56A 1UAYA 2V6BA 3Q3GA 3QOFA 4PRNA 4MUEA 2NO9A 1JHTB 2A33A 3WGVB 1M1ZA 3T8YA 3VO9A 2YA2A 1PX4A 3AJRA 1CZLA 1SOVA 1A9QA 1JG6A 1KY5A 1NZDA 5FNVA 3AITA 3ME5A 4ADGA 4Q74A 1MOEA 4D8OA 3EG5A 4AGLA 3I6LE 1R9GA 4M21A 2RR3A 2FRGP 1ZT4A 3W34A 2MCMA 5C6TH 2V2WA 1TO6A 3QJQB 4KDTC 3LRHA 2AN9A 4UT9A 4S1PA 3WD5L 1HAUA 3A6KA 5JJ5A 4FG2A 4JQIA 1U0JA 3AR3A 2AGJL 1XUOA 4TTIA 3MRQB 3FNQA 3K94A 1XH1A 4FW8A 5ENDA 1XGPB 4LQDA 1KSFX 4AI6A 2DHRA 5H16A 5K9OB 2QDWA 1HCZA 4ZQCB 5DD0H 2HHCA 4B0OA 2G6BA 2VLLA 1Z0DA 2DD8H 5A9TA 2ZAHA 2RBLA 5F96H 2IPUK 1UQUA 3VUEA 3QX7A 2XB6A 5DP2A 4EQZA 4TRPH 1L1QA 2PRJA 1GFSA 3E7JA 1TJ5A 3I4FA 3UKDA 3O41A 1E60A 2HPHA 3QBTA 1HOEA 2V2XB 1LL1A 4K15A 2NO0A 3WJMA 3G0DA 4CMKA 2WJ5A 5IVXA 2HKIA 1KIQA 5JXEA 3PQ4A 4LK3A 2FBJL 4MR7B 4BQOA 3UXYA 4U3JB 1R17A 4DEPB 2UYOA 4PJ5E 2JLWA 3ETBF 3N91A 2DWDA 4KPHL 3TLRA 3LS2A 2JLVA 1WUZA 4JM2D 2OULB 5F7MC 2A78A 3NXSA 5AVVA 4TWBA 3ES6A 5FPQA 4O02A 1U31A 4RO0A 2DTXA 2Q4EA 3Q7SA 3NBQA 3GXFA 4FZVA 2G60H 3OO0A 4Z2YA 4QDGA 3SN6N 3ASZA 1Y18B 3H9YA 1XF4B 7ABPA 9MHTA 1MAWA 1DKUA 4PX3A 4LSMA 3IOEA 4NKDA 4JFFE 4H7IA 1NKGA 1GEEA 4QCIA 4WLVA 4RCAA 1AA6A 3ANYB 2YHGA 5D5QA 4PTUB 2JJ8A 4QARA 5CA0A 5I1KL 2CMRL 5B3NA 5HS4A 1USIA 4U3XA 4TMWA 4PO9A 5F9MA 5REQA 3PGDA 1OV6A 4LDRA 4NN7B 2DWCA 2W0SA 5D7IF 2O8EB 1Q2UA 2P6UA 2HW8A 4HNHA 3KVVA 6ADHA 3W9EB 3BFXA 2BD0A 1O2DA 4G8GE 4I5FA 4LDLB 2XKAA 1W85B 4DP5X 5HPOA 2BVQB 4JRYB 3TZQA 3V4PH 3JVDA 3T7JA 4MJ5B 3MRFA 2DWSA 3DCNA 2MHAA 4Q1CA 2PLWA 2HF2A 3A1NA 1B4TA 4LJAA 2GASA 3NKVA 1U3UA 4LIQL 1XYGA 4A8JC 1OWOA 5TFSL 4A38A 4GIAA 1DAPA 2J3MA 3IS1X 4YVNA 1CQJB 5I5JA 1YIDA 3HYCA 2FR4B 3H0EA 2DKSA 3B5EA 5IBCA 2D0IA 3JSXA 3PGCB 1QGDA 4V0QA 3BMVA 1H2YA 1SH7A 3DV6A 4EM6A 4MVJD 4RAVA 1WITA 1S78D 2PD3A 1YY9D 4UJ3A 1NRJB 2QQ0A 4AM0B 1WFOA 3IRPX 4L3EA 4JDEA 3COOA 1C4OA 4PCAA 3VTZA 1T2DA 2OC9A 4L0YA 2DIAA 3AVVA 5BOSA 1BEYH 3UG3A 1JRHL 2DOCA 1N2IA 2Z6QA 2C4WA 2VSOA 2W7TA 4ND7A 3DXAD 3TRHA 3D8HA 3M2PA 3WHLA 2NV0A 3GRUA 3RX9A 4IIEA 1I8KA 2DHQA 2WBJB 4PCSA 3RVXC 2GRAA 4Y7DA 3TRKA 1MX5A 2NO5A 4UQCA 4WUVA 3VU9B 3O4LB 4A6PA 4ZXBD 3L17A 2XZLA 3ZDYB 4RHYA 3FU6A 3JYQA 2Y0CA 1XHHA 2XXFA 1P1HA 2FL5A 2Q3LA 2GUYA 4XLZA 3BPLB 2DQHL 3PDJA 2BMVA 1QTRA 3H5AA 2DUWA 5BV7A 5FBWB 3CO0S 3D3VE 1RCTE 5CYGA 3DMTA 1UOPA 4OZ4A 2D7OA 1L7DA 1POXA 1SBBA 2R8OA 1T8PA 3QUXD 3QI9B 5EE1A 1HYGA 4GWGA 4R4ND 1SVZA 1D5CA 5C0AD 4HETA 4BE5A 3O8XB 3S55A 5D71H 4AICA 2VF2A 5GIRA 4YCJA 1I9CA 3J7HA 2BEJA 5J2TA 1U3HA 2Z30A 4K9NA 1LPOA 2IU3A 2CXKA 2J25A 5IQMA 3LRXA 4X6BB 1C14A 3RH0A 2EJTA 5L2KD 3OM1A 2BVUA 4KQJA 5DRNA 5ALQA 1NMCC 4C29A 1VADA 1SVIA 3F9CA 2DH6A 2D7NA 4GI8A 3PC2A 1A8QA 1I30A 4XCYA 1BVNT 3LEYH 2DH5A 4TVPL 1NNI1 5THXA 1K63A 1AMOA 4MGIR 3VYSB 4HWZB 3CDYA 4EFKA 2R9HD 1H2HA 3VSEA 1KCUL 4YGVA 4EMSA 4P7BA 3U3ZA 3UXHA 3EEYA 4AKHA 4KO3S 1QSFD 2R8ZA 1J33A 3H2YA 2YEZA 4DMGA 2ALWA 1SGKA 1HETA 1A66A 4FNUA 2NO6A 3WTYA 2QUKA 2C95A 1XIWA 2BVNA 4AUEA 1DARA 3BDAA 4PTZA 1DBAL 3BQMB 1HTWA 4I9UA 3STYA 3RWHA 3QO1B 3MINB 1EAOA 4B5EA 4WF7A 4WY2A 2ZSDA 3SN6A 1MI5A 3JZ7A 2YD9A 2BFCB 1IT9H 1MF2L 4AJ1A 3WNJA 3EPPA 1TJIL 3LWNA 1BHJA 4LKXB 1WJGA 5IU6A 4JG5A 4MMXA 3W39A 3TDNA 6NULA 1YYMH 2H0RA 3NX4A 1RPAA 2GN4A 1OXBB 5H8WA 4TXVB 4M00A 4QXAA 5IJBC 3VXMB 5SYAA 2GSWA 1R3IL 4ZICA 3WUWG 1AXRA 3L7LA 5JAHA 1ETA1 2BFFB 1XHLA 4ZK6A 4OV6B 2D7TL 3GIVA 3ODGA 4FCAA 4TMZA 5A2JH 5CMLA 2TSBA 3CXHK 5IB1A 3D8BA 4UAVA 1KEGL 5HJBA 2C5BA 4AQYB 4EKGA 1F11B 2REOA 4FNLL 2F64A 3T1OA 1M6UA 1MWAH 5EU4A 1EBUA 1OYVA 1V54B 1DAKA 1M67A 5BSKA 1AY0A 1WCXA 2Z1MA 3D30A 1ANUA 2XUIA 3ONDA 5BSRA 2JI2A 1P4LB 4Z0BH 5AAMC 4K0OA 3A26A 1Y6NR 2J9XB 4CTJA 3UTQA 1J8DA 3FQNB 4NERA 2BCJQ 2FPPA 3FTCA 2WZBA 3RK4A 2BKAA 8ATCA 4OD2B 4JY5H 3WL7A 3QEMA 1MFCL 4AJHA 2DXIA 1IUNA 3V5KB 1UEIA 3U4BL 2DTML 1BXXA 2C9BA 2UU9B 3MRNA 1Z4QA 4IG9A 3WFIA 3UROR 3QFGA 1FTWA 1JP5A 2NXYD 4JM2A 4L3ED 2GVDC 3PYXA 2OBBA 2ZJSH 4NQSB 4I1YA 1AGFB 3N6VA 1A8UA 1Y0LA 2PRYA 2R69L 2B9AA 2LWIA 1RQXA 3OJ0A 4XB6B 2JVJA 5B1YA 3NJRA 4RESB 1X1QA 1RZPA 5C9JA 3IDNA 4TM9A 3CFJA 1G7HB 4LXHA 5ALZA 5KYXB 1ORQB 2XZQH 4G6KH 2I24N 1JEYA 4APXB 1PK7A 3AUSA 4UF7C 3GNMH 1M71B 3TBBA 4IOFD 4FHJA 2EHJA 1Z5VA 5DBGA 1QCZA 1R0CA 1U8EA 4GXUM 3I2JA 1BOGA 4JUDX 3VI3F 1R6UA 3B6ZA 1MLBA 2HF7A 5C3TA 1MHPL 4FQXB 4MRPA 4D9RD 2ORVA 5FR2A 3QULB 4TUYB 1Z68A 3PFWO 4QUJA 5GGVY 5J3HD 3OQPA 2NUTB 2B99A 2EJ1A 2WFAA 1DEDA 3VQLA 3K0AB 5JI2E 5E6SA 4B85A 5CVDA 4WWKA 3H6GA 2XG4B 2C9SA 2DPLA 3KHSA 4AJVA 3SC2A 4MRNA 3VGPA 3DWFA 5B7EA 3RWMB 3S97C 4E13A 1UINA 3HMQA 3V6OC 3QO1A 4GG8A 5CD1A 1O1YA 4KK8D 1S2DA 4R2WA 4PC1A 2CFOA 5F9FA 1EIZA 5A3QA 4XOUA 4Z2AA 1JAYA 5E7MA 3JQ9A 1RPTA 1TO1E 3T9AA 1LLCA 3KBEA 1L6IA 2G5RA 3UYPB 5EO9A 3HU5A 1LQ2A 3FSWA 1T66C 2AQ1A 5EPMB 1Q7EA 2A92A 1HA3A 1GVNB 2HTKC 2C3PA 3ZL4L 2K87A 3ARDC 3B8YA 4MNQE 2JD2A 3QXJA 5JPNB 1ID2A 2WWOA 2AIRA 3LEXB 1I5OA 1UJNA 4M9PA 3WAKA 2WN2A 1G21A 3NJXA 3ZPXA 2E7BA 3LDGA 3TLKA 1E8YA 4WHTA 3VG9C 1FJ2A 1FNNA 4EUFA 2X5KO 3BUTA 2EXSA 1UC8A 3TQSA 1BX0A 4GF5A 3KT6A 4REMA 1G5IA 4D9QE 3WY9A 3N75A 5SV2A 1K4DB 3PYCA 5JI3E 2QFPA 4DXAA 2NXYC 5KVFH 4BIIA 1OAOA 1N3BA 3IJ5A 4OGZA 2LW7A 2OCGA 4QYOB 4G1MA 4JO2L 2QW8A 4B7IA 1ZYUA 2PKRA 3TXAA 1TUGA 2HA5A 4B2YA 2MDTA 3MRGB 5AD1A 5LZ5A 4QBTA 4WHYG 4B4VA 3WRXA 1NJ1A 4UV7H 4B43A 4I88A 4WRRA 2YPLB 2D7TH 3BQ9A 3OT1A 3ZWNA 4TKMA 1QNIA 1Z9BA 3TNMA 2QR0B 1NJFA 4WNJA 1YR1A 4BMXA 1ZRSA 1T03L 5DK0B 4X6CF 4OAPA 1YB7A 3LFTA 1VBFA 4KDFA 4MQMA 4DN4L 5DUPH 1X7DA 3EYSL 1A6AA 2J9YB 3STVA 2YGQA 1LDMA 1SOSA 5CVJA 5IYZF 3GJ6A 2N75A 2OZKA 3KE8A 3VU3A 3E3NA 4ED9A 5K09A 2QR3A 5I8KL 1HT2E 5IBUB 3CNHA 5ILTH 3KQSA 5F88A 3ESNA 5AM5A 3SZGA 3FW6A 2ZXUA 2C7VA 3CG8A 5MENA 5E6UA 3UYOD 3VXPB 1QP8A 3IA7A 2JW5A 5ANMB 1J5IA 3G5MA 3QUML 3LC0A 3OKEB 4JO3H 1A1MB 5CNKA 5LQNA 3K8OE 4B1FA 5AW0B 2J3IA 3GHBH 1FFNA 4K8RD 1QYGH 4JI2B 1UFKA 3MAGA 3CZCA 2QY6A 1QHNA 3S8MA 2PPVA 1AF4A 3A21A 4HNQA 2E47A 4EZLA 2PQMA 1B0GB 1E5LA 4G65A 4LEBA 3FSAA 1ZFNA 2H48A 1H6TA 2JWHA 2ATEA 4U3HA 3E22B 4Y2QA 2IVFA 5EXTA 4EL0A 3HS0B 3OLEA 2QQNH 2ORYA 3VTFA 3NGLA 1A6UL 3IAHA 1BG6A 4KE8A 4GSQA 4KHXH 2XICA 4JJEA 1HYHA 2YXBA 2VDPH 4KV7A 2QSTA 2W9LA 2VKQA 1GNSA 1U0LA 2O0JA 3CZFB 4UQ9A 2IPKA 5CBPB 3VDNB 4F15B 2W8BB 3NIFE 3P4MB 4P82A 4CA4A 1VP9A 1LLFA 1QRAA 3OAAD 4B2LA 2NU8B 2PH3A 2DEUA 4X5OA 3UIEA 2BGTA 3MZ0A 3NM6B 1YDWA 1NMCB 2H0EA 1V4VA 1YTLA 2V03A 3W4JA 1FO0A 1WEHA 2EO1A 1XVUA 2VP5A 4UVIA 4KOBA 3CA8A 1IM5A 1Z45A 1NGWA 3N3BC 3FWKA 4FFDA 3SZ6A 2J3DA 2ZDQA 2J9FA 2YY7A 1YJDC 1YVUA 2IOHA 4RUKA 3B2NA 4UV4H 3N0TA 4P8QA 3HNOA 3T0EA 4EKJA 2P7TA 5JSFA 3MTDA 3NTCH 3JTTA 1HZHH 3JXAA 3T2LA 4G4IA 2QRUA 3V52H 1GAQA 1NKTA 2Q7AA 4YRPA 1APBA 3QDJA 1RUAH 3IKVA 1XN4A 4HF5L 4RK4A 5FD8A 2LUOA 2LTQB 5JXJA 2Q99A 3PJFA 3O6ML 2VLRD 1S6YA 3MYZA 4G09A 2V0CA 3PC4A 3MBKA 4XXDB 2QUBA 4P4KC 2O8DB 4D9QD 4EHFA 3MBWB 1OM3H 1LQTA 2Z9CA 1DC3A 3O3AB 1S9HA 4DR5B 2YLKA 2CEKA 5JQ6L 4D2IA 3SDCC 1K27A 4M7OA 2J09A 2EYQA 1J49A 2G4EA 3I6KA 1T9DA 1RZ7L 2QR2A 3OIWA 4Q01A 2Y0DA 3D3QA 4HK4A 4ZDKA 1P4RA 4MXVF 1J1PL 3UBFA 2L04A 5EJ2A 4EX6A 2CE2X 3L3BA 2ITDB 4WNYA 1QG2A 1H2ZA 1LMKA 1YLBB 2HRRA 3KL0A 3R2JA 2CBZA 1NP6A 1R6BX 1G4MA 4HWBA 4OUUA 1LUAA 3A2MA 2K9UA 1LJUA 2I60L 4FADA 1NCTA 5C07A 3IOBA 4NCXA 3TEMA 3WYRA 1P29A 1WX1A 4HTFB 4MR9A 1CQZA 2QYTA 1I8AA 1QUPA 5CP7B 2HFTA 3T0VA 1CDGA 4DTGH 3WLLA 2YA0A 1MRSA 1WUHS 3BD3A 2P8JA 5LN1A 3NCTA 5HDRA 2UUDH 1JDPA 3LNDA 5BPFA 1I8LA 3ARBC 1INQB 4BUCA 1ND5A 4BJ5A 4ITVA 3M1LA 1EZZA 1JZJA 3ZWAA 1VDMA 4LE2A 3WISA 2HCBA 2MKWA 2WBJC 2Q9CA 1PKQA 5GRJH 2ZD0A 3IXQA 2XDQA 4IVRA 4NF2A 2P8LB 3GPLA 1NUAA 3NJNA 1W5AA 1PSZA 4YWGH 1KPVB 4E7OA 3CX5J 2V9RA 4OQZA 1QI5A 2HMID 5CSBA 3WP1B 2DICA 2IO5A 4H17A 1GGJA 1IM3B 3QJUB 3BM5A 3GHEH 2XT9A 1PZ3A 4JUSA 4QHTA 1DJHA 3E4CA 2YN4A 2HO5A 3UGEA 5A5FA 5FOWA 1WD8A 4TXHA 4PU0A 1EH5A 3ABOB 4EKDA 4RVSA 3ZI7A 2JK0A 1VYHA 1DAMA 3WFBL 4WY5A 3ARDD 1Z63A 3EGXB 1ORHA 2TYSB 2BSED 3D4CA 1HYRC 1QLFB 4WXYB 3WADA 2VZ3A 3AETA 2YGNA 4ISVA 5KS9F 3LUFA 4FQQA 4RH1A 2DERA 4HEA1 5IASA 3SNKA 3D3VA 4BEIA 2BTOA 3OZAA 2UX7A 5DJAA 2ZWMA 4QTIL 1OKEA 4ZUWA 4DGIH 4JDTL 1SRQA 3WKEA 2GAZB 4X9YA 4F4JA 2ZUUA 3AETB 3Q5TA 2Z98A 1OBVA 5IHPA 3O2DA 4X95A 1DO0A 1OH7A 3LIZL 4ZAXA 2E82A 5JWOA 3STZA 4XNQA 4LGVA 4Y2HA 4BK8A 2WVSA 3IJ7A 5AJWA 2XCLA 4NUGL 5B5SA 2XW6A 5I7WA 1J8KA 3JTSA 1AHWC 3FDZB 5C7ZA 2H1FA 2YK1L 5LM3A 2DPGA 4G63A 3WHXB 5LLDA 1DUYB 3UEOA 1SRRA 1I1YA 1OE0A 3PXBA 4D96A 5FKPB 2H1OA 4R9UC 2XDQB 4LKRA 5A2AA 2XA2A 2GG1A 3JWDC 3SS9X 1V1RB 4OKVB 2H11A 1R0KA 1KK0A 4RACA 3R6TA 4KWEA 5JU6A 1T4MA 2PUWA 5AKKA 5E0QA 4KO5A 3BVXA 3RYCA 1JRHH 1D2PA 5K8VA 3QFTA 3R41A 3GLFE 3SDAC 1YNLH 3CFNA 4DIUA 3QPVA 3WEMA 1C8VB 5BWBA 4CV2A 4Q6YA 2J3HA 4B44A 3DKRA 1FU7A 3S81A 3CVCA 4MHTA 3PGKA 5THKA 4KVPA 2B36A 1A1NA 4N1HB 2I65A 1FVEA 1D09A 3MSXA 4WUUD 3E5RA 4G4SO 4AMUA 3WEXA 4RWEA 4LSRL 3GJEB 3HI6L 4DF9A 4DT1A 2BFEA 1GT91 5PAZA 4GIPD 5FUVA 5JOEA 3FK3A 1P5FA 4RGND 1WXIA 2NX5E 3GMLA 1L9PA 1VMEA 1MR3F 4US1R 4Q66C 3KR9A 2JVIA 4EJSC 1ACLA 2K8QA 4O3TB 4PSAA 2FEDD 4DFHA 2A6JB 1YB1A 4A6EA 5F7HA 4BE9A 3IFLL 2VP4A 2IS2A 3WLPA 3V6ZB 4AF7A 2I1VB 4RMGA 4ZFNA 1MWOA 2O6CA 1EM6A 3N5AA 2YVKA 3T8XB 3GI1A 4O25A 2J6BA 1H22A 2CHUA 3PVCA 4XXDA 2O1EA 1PLGH 3L7CA 5G02A 2JIOA 4G0QA 4NCNA 2NR6C 3KDSE 5JHDB 4ITRC 4F72A 4CSPA 5ER9A 3WSQL 2PUEA 3FT0A 3VD2A 2QKIB 4P7KA 3UBTA 5EU6A 4GRWE 3G6AA 4UMGA 4LI0A 4ZS6C 1RK0B 4M6NL 4GMDA 2J33A 2NU6B 5T67A 3F6BX 4OU4A 5K6RA 4QC2A 2WXHA 4PYGA 1JNLH 1C1XB 2HLPA 1IM9A 1H0DB 3ON5A 4G6FD 5J3HC 4HN2A 5GRYA 4HBGA 3DETC 4KK9D 1NQBA 4G6KL 2P45B 3ZYOA 1GGTA 2ZXAA 4JO1H 4ZX5A 1JVSA 1HOCA 1QLRA 2P80A 1ENZA 4AXBA 3ESOA 3OM9A 2X4NB 3C6LD 2H3KA 4PB9L 2YV2A 4Y98A 2YY5A 2OLEA 1WUTA 1H8SA 1CXKA 2ZLBA 4ZPTB 1EX1A 5SYNA 4M7WA 3GRWH 3U62A 3G68A 5FW8A 1BU8A 3OHXA 1ST2A 2NNCA 3ROZA 1YO6A 4OD1H 2D03H 1SSLA 2REXB 5F51A 2YAOA 2H47C 2Q3AA 4LCBA 4RFEB 2BGLA 4Q9NA 4MCZB 1L6ZA 1R8SA 4EI6A 4X98B 5DT1H 4C4BA 3TKYA 1XF3A 4KJYA 3FHEA 3HCRA 2VERA 2DTEA 4ML3A 4Y2UA 1ZS2A 2LU7A 4MVBD 4ZMQA 5KX5A 1ZHNB 4ND3A 2P5EB 4L0QA 1XZNA 3UG6A 2GT9B 5G3YA 4HH3C 4FFYH 2YCBA 1BA9A 3FJTA 4GRWF 1V3TA 3HFGA 2H29A 3N7TA 3DUSB 1SIUA 2ENUA 4AUUA 3T3MF 1W15A 2JNZA 3KPOB 4HWBH 4UDXX 3K0SA 2A5UA 2FN9A 1F6FB 1NFDE 2OCDA 4Q3OA 3S96B 4BWGA 3AF1A 5DD0L 1VESA 3CEPB 2ZI5A 3WB0A 4E5XA 2YC1B 1IY1A 3NBMA 4Y3UA 4WJKB 3WCYA 3VXRB 3HE7C 3WL9B 3DTNA 4WXEA 3RTAA 1XE3A 3FDXA 3BCFA 4PR0A 3UBHA 2JB6A 2WZPD 4J0CA 3QP3A 3R8QA 1YKSA 4TLCA 1GCIA 3TRDA 4R7NB 4CKZA 1SKMA 1YBVA 3BLPX 3PWVB 1TQUA 3AWEA 3HCWA 1K86A 1KCRH 2QVKA 2V17L 3TD9A 4E4YA 5C6TL 4K71B 3LMKA 1AKJD 1N5IA 3OFKA 1XNQB 2D03L 5GXBB 1L5YA 1A4CA 1DJZA 1QFWH 5CK4A 5J9PB 5HHPA 5E6ID 2Z2XA 3CGWA 1W2GA 1RZIB 3ZWQA 3ZDYE 1Q0LA 1DBRA 1N6HA 5D7JC 2IX9A 1KP3A 1JFQH 4TSCH 4B34A 1KIPA 1ZV2A 4YR6A 2EX0A 2X0UA 5DD6A 5BN4B 3CF4A 1T0BA 4JO5A 1Z7BA 5DHVH 2IV2X 2ESVA 4XUCA 1BREA 4R5TA 3KPQB 4P7FA 1UZ8B 1I5RA 3HBAA 3GUFA 2CE7A 3LUKA 2BP0A 3QXAB 5JHGB 4DEYA 2HPAA 1VXOA 4DH2A 2GITA 2CLSA 4CN8A 2QRVB 1MQAA 1JHPA 1LPNA 4PCVA 5AYVA 1IQ0A 2WXFA 7YASA 2DQGH 1JVLA 2XMSA 3FFBA 4JVMA 5J11B 4P3PA 5ESAB 3UUEA 3FVWA 1JQDA 2IDMA 4RM2A 1RV6X 3PNVA 1KE1A 2X88A 4PRPE 2ZQZA 2BFFA 4YH1A 1X5XA 1ODSA 3NIDE 2MIIA 3AKCA 1KYVA 3IDGA 4PWFA 5ICCA 1BJ8A 1JR6A 3NSXA 5PNTA 4F3TA 5AFSA 2H0QA 4G8FB 4JEUA 1B0WA 1TQ8A 4ZUUA 5FI3A 4D41A 4EKEA 3VMPA 1I7TA 4R8LA 3HN2A 1KN4H 5G2NA 2VABB 2E0IA 4DDVA 3LF2A 2IP4A 4WJ5A 4B9GA 3OHMB 1MBZA 2D2EA 2VLKE 2GO7A 3H85A 2GSIB 3VFSA 3E35A 3FPLA 1HE4A 2C42A 5DJXB 3TZCA 4BEJA 1W73A 2LVEA 4I85A 4OUDA 2V5MA 4HB0A 2OP0A 4HEJA 1QSZA 4Y30A 3ODPA 4LRQA 5E8RA 3EJTA 1CY2A 1NBOA 5ILQA 1D5RA 3K20A 2PKQO 4LRUA 2XY1A 2JI1A 4M83A 5EJ4A 4FS8A 2WUGA 3GMPB 1KIMA 4HAWA 2OJZL 4XDZA 2HFFA 4TT8A 1M1YA 1UKVY 3FCAA 5H4YA 1V3LA 3VG0L 4POOA 2V9UA 4P99A 4FZ8L 2QV2A 2WXKA 1VKJA 3RFZB 5TH2A 4MBRA 4K9PA 1ZDMA 4HUQB 5K0BA 1J1OH 5HFJA 1SG9A 3NC1C 2QBYB 4X5XB 3V8BA 1F3DH 3ZE8A 2Q10A 4JFDD 4JB9L 2Y1KA 2ZX7A 3H8NA 1WHTB 2X4TB 1JPGB 3QR0A 1Y98A 3ZV6A 4LJ8A 3MTXA 1ZNYA 2WJPA 5EKUA 4UEWA 2EIEA 4HHGA 1XT5A 2RKOA 1OTYA 1ZA3A 5I19L 3QZOA 1T5SA 4MDFA 1WWBX 3LX8A 1Q1QA 1MCJA 3EGDA 3VFVB 1T20A 3HZVB 3MYJB 1H3EA 2YAFA 1ONSA 5CEZH 3AF6A 1IJKA 2DQFB 1Z36A 3OKMA 2C2HA 1Z37A 3RYFA 2G77B 4AU1A 4YNBA 4ZMAT 4M1SA 5HHME 1G7CA 1ENPA 3FUMA 5AALA 4EW2A 1NLDL 3GUTB 4X4ZA 4A1RA 1GS6X 3A9WA 4PYOA 3BW9A 3U7IA 1ZISA 5L4NA 2FU5C 3DXAA 3ZCPA 4C7OA 4RZCA 4HH9A 1P72A 4RFEA 1G6KA 1ORWA 1WPCA 3D81A 4TVSa 3AW5A 2OL3B 4JM2C 1DJQA 3QPUA 2WLZA 1L4UA 4A15A 2DZDA 5IF0A 2G0AA 2X4UB 4KFRA 4S1TA 1VAHA 1OCOB 4YS4A 3LVQE 1MCPH 3QLVC 4GKBA 4KDVA 2POCA 2PT6A 1U0HC 2MINA 2IIJA 4TV9F 4AQDA 2HV9A 1ORQA 1P4HA 2C5SA 1XTTA 1I0LA 5HTOA 4YBQD 1GA1A 1ZJ5A 1B0RB 3O9WA 3SQRA 2HF8A 3EGXA 3IURA 1QC5B 1CYWA 4YV7A 1OSPL 4BFJA 3HMWH 1JEQB 1Z5OA 5KJFA 2WTMA 1JNLL 5GQBA 1RPQA 2BNQE 3NV9A 1IJFA 4HIIA 2DBRA 5D5MA 3NHUA 3SZMA 4M2LA 2IDKA 2V6MA 1NOIA 3L0DA 3UJTL 3PWVA 4K6GA 4PICA 2FOIA 5LB2A 1P5ZB 2VH5R 4X7CC 1QSED 3FFXA 4XYLA 4I8IA 8ABPA 1U9ZA 4MQFB 1ZLDA 1G2PA 3R7WB 2FZKA 3ME0B 3GK3A 2G09A 4Y2TA 1SVUA 2QOEA 4PTTA 2OXCA 4TSBL 2Z6FA 4OQTA 2VZ0A 1G66A 4NRZB 2J2ZA 4RZQA 3F4BA 3DW1X 2PO7A 1EVYA 1VI2A 3K2UH 5ESQB 3L5XH 2E89A 3OC0A 5ISMA 1BLIA 2XVAA 2GJ6A 4HYYA 3GJ4A 3A3NA 1VLLA 1NL0H 5L2JA 3ONWA 1ABFA 3JT0A 2G2PA 4UNVA 4HVCA 4AMZA 5IVXB 2NOYA 3U44A 2QRQA 2B4RO 4W9GC 1MENA 3FRPA 4X65B 3HB4X 5FXMA 5M2QA 4TUUA 1HEYA 4GMGA 2XC8A 1J07A 2WWIA 1Q9WB 5F0MB 4JHUA 5J5VA 1S7WB 3SVZA 3L9BA 5D9SB 5DFVC 2WSMA 5F21A 4J1TA 3OAZK 4YDLC 3IDGB 3RTQC 1LNZA 3F7NA 1H66A 4KQ9A 2WINB 4Y1RA 1BEYL 3U44B 1X4YA 2J4FA 3WDKA 1OX5A 4AKOA 1TVMA 5BP7A 2CD0A 1TK2A 4BB5A 3N55A 4MD5A 3CR3C 3IE0A 3NBZC 1Z16A 3UHOA 4KAQH 4QRSA 4ALMA 2UZIL 1VA5A 4Y5XA 2Z0MA 2FIRT 1ETZB 1A8JH 4BDTA 5FUMA 3BZFA 3L84A 4E68A 2AI0H 1D6VL 2YPVA 3VO0A 2E46A 1AANA 1T9AA 3FO9A 4UU7A 3JQBA 1RPJA 2HJVA 4BMCA 2GD2A 3LU1A 1FBTA 5A2QA 5LCVL 1TTTA 2ORBH 3QEHA 2CUKA 1JA9A 3P0EA 5HHTA 4JOBA 2C94A 1T0MB 4V0RA 3JUYA 4NJMA 1SKYE 4GAJH 4AP5A 5FDFA 4F2MB 2X53A 2ZIFA 4P2CG 1ZEJA 1J0CA 1KIUA 4U6HA 5JTTA 4DFIA 2VDNH 5CSZB 3TO2A 4XQ9A 3G13A 1OGTA 4PJXB 4TUYA 2C34A 4J7CA 3FBQA 4OF3A 4YQEA 2WLHA 2DHEA 4O4YL 4L8SC 4IQ8A 4KK5C 1HKLH 2XZPA 5JA8B 2W9DL 3CXRA 1GRWA 4FGMA 1NXOA 2CWWA 4YAJA 1NBCA 4F6LA 1F5NA 4JQVA 2BP8B 1LE5B 4U7TB 4GQPH 2O72A 4LPYA 2LW3A 2YWFA 3HRZC 5KOVC 3WP0A 5L6LB 3HV0A 2XVKA 4L8VA 5KG9A 4MQBA 1TEYA 1E64A 1NUNB 1FNSL 5EPOA 4RD6A 2B0CA 3B9KC 2V7QD 4EEZA 2A88A 3HJCA 3U0TA 3G7TA 5A71A 1DCTA 1F7UA 1S7VA 4U9IS 1WLHA 1FTQA 3QEGL 2PCFB 1VKXA 1VZGA 2O2DA 5JS7A 3JD4A 3HHPA 1WVMA 4WY7L 1ZO8A 4QCIB 4TYYA 2FXIA 2OFQA 4FR5A 5D85A 1RLWA 1TDJA 1RWPA 3MO1A 4QPCA 3IUQA 1FNEA 3TLZA 2O5NA 3OIGA 2PJDA 4RSYA 1QIHA 1AURA 3RO7A 4DEXA 2GKSA 3I5UA 1E1RA 2GTQA 4DYHA 3E38A 4W5QA 5I66A 3VFTB 2CO7B 4NUJA 1SQ6A 2X6UA 5IEKB 2CNWA 3RVUD 1VMAA 4NIMA 5F2OA 3CFCL 1E9DA 3V8OA 4JB9H 3UTSB 3ADOA 3IEIA 2DQKA 1ZU4A 2XRYA 3S9DB 5TE6L 4X9HA 1G5PA 2ZM6B 1RP7A 3RC7A 4PRHA 5DTIA 1P5UA 5FYJD 1CZNA 4NFLA 1OT2A 4OXXA 3SXPA 1N6QL 4PC2A 4IH1A 1QK5A 4KK8C 5KSAA 2G4GA 5DMXA 2GSDA 3PLNA 4Y9BA 4N3TA 3LFHA 1B3JA 3ULUH 3MN1A 4XN4A 1KAOA 4OUKX 1OX4A 1HZHL 4JO3L 3CZGA 4Y19D 2YICA 2IH8A 3S34H 4OP3A 4XNYL 1BYOA 2WNGA 2O1XA 1ZA6A 2XVMA 2E6JA 4Q4IA 1DO6A 2NUPA 4HH1A 5JZVA 1EFUA 1H2XA 2WQSA 4JFUA 4NMXB 3RREA 4DP1X 5ICXA 4PBRA 1EGQA 2NU7B 3AF0A 2HNAA 4XFDA 2AOUB 2AK4E 5HOQA 3PQYB 5J2UF 4TTVA 4U8GA 3E1ZA 4Y2NA 3X14A 2YUXA 3QPAA 2QTTA 3LBNA 3BPCA 1I36A 3RYTC 4JFHD 5JDIA 3DVLA 5J12B 1K5GA 1U2ZA 3GEDA 1HE8B 4KQMA 4HC1A 1OCZB 3QXAA 4NE2A 4LO9A 1SVLA 3MRSA 5FEMA 1QTNA 2YUZA 1OHZA 3R3HA 5JALA 2RC5A 2O2EA 4AYXA 4ZFFA 1CFMA 4HNAA 1QVAA 1UPCA 4KKAD 2WZCA 1U02A 1K7XB 3RGGA 4ECNA 3R4VA 3FFCB 1WA5A 2YRWA 5D1QE 3DE4X 1U33A 4C56E 3GCGA 4OQMA 5A6MA 4R4NC 3UH0A 1UBEA 4Q6BA 3E15A 4ZD6A 1GU0A 1XMPA 1T2QH 2JZCA 3OTWA 5DK6A 3OMWA 5K8JB 2XVYA 1GXSB 1FTGA 2FJ0A 2PG3A 4MQ6A 3AUJB 4EF3A 4TYUA 4P5TC 4XWOA 4DPAX 5B1AB 4CG2A 2G75B 2YYZA 1PX8A 3G5XB 4CKEB 3K6SB 5TQ0L 4YWGL 5CT8A 3DJZA 4PLCA 1DC7A 4BK5A 2B39A 1E92A 2C0PA 3GIDA 5L3QB 2BTQB 5ALRA 3RDJA 3IP5A 3QIWA 1IU9A 3MI6A 1Q6YA 4JSRA 5T33L 3H4VA 4LY9A 4PUBL 4PYNA 4IHJA 1RAAA 3JYBA 1Z34A 4NYLB 3PCRB 5K0ZA 3Q2LA 1FS6A 4CKEA 2JFZA 4DO4A 3FHAA 3TNJA 5FKAA 4YTEA 4B9CA 2JJWA 4P2RA 2Y7LA 2NW6A 3ZHYA 4LZZA 1E8DA 3DH0A 3GFPA 1LO4L 3GW8A 5TGDA 2MQ0A 3ZTEA 1FRFS 1DQSA 3RRMA 2XYGA 1WXGA 4HDQB 2FHBA 3OHXC 4JQYA 1GG9A 5I17B 3LLVA 4TSAH 5HYQA 1P2FA 4GSDH 5LQRA 2BSSA 4UHBA 3E2PA 3FDZA 3SODB 1TEXA 5JASA 2CYBA 3ND8A 2QGFA 1L5SA 3PPVA 1Z2PX 1YE8A 4P1ZA 4B95C 3ZKXC 3QOWA 3BKJL 4ESHA 1YEJH 4F2MA 1AD9B 1YQXA 1QPXA 3S5LG 4F9PC 4R01A 1T1JA 4QRPB 2PSSA 4RFVA 4P5TB 1A3LL 2YWYA 2AK3A 1IN4A 2PXYD 4PJ8B 2OXGB 3HKEA 5EC1B 1U0NA 2REBA 1ZGLB 3B9KA 2V9TA 4ZXBA 4FFWD 5J4MA 1QUNA 2PPEA 4KAQL 5DN6D 4A0FA 4AQ1A 2BP5M 1NGPH 5GONB 1TETL 4DW2L 3FROA 2VL5B 4RDQG 5DX1A 5KNCH 1JGDA 4QDZA 3DBLA 3P4MA 4L27A 2OYCA 2FBRA 2VLRA 5LKAA 2O2SA 4F37K 3SDCB 3IMUA 1VPVA 4N47A 3QVGA 2D3TA 4YMVA 3B7PA 2OM2A 4QHMA 1UWFA 2I9LA 2ZBEA 3OZTA 2ZYSA 3UA4A 3SBXA 1SXJE 3SY0B 1DX4A 5FFMA 1SMKA 2HWZH 2WM3A 1M2HA 2Z35B 3UUGA 2X4RB 1WE2A 1JDBB 2RJNA 4V02A 2EDNA 1L9SA 3OOWA 2EQ5A 1Y0BA 1Z6JT 2DM4A 5LBIA 4YRQA 4L29A 3CM0A 3HFSA 3ZDZB 1Z29A 5AIAA 3DP9A 4MJJA 1MQKH 4Y2DC 4GDMA 5DJXA 2JLCA 2ECOA 1R27A 2WMYA 5IAOA 3O3NB 4GXUN 3AWFA 4HF5H 4NQDD 1BHGA 1DCFA 4NZPA 1XD9A 5DGDA 5AVWA 4FG6D 2NY1D 2WI8A 3WB9A 4PJDB 3D0VB 1AUVA 1FUKA 2G4LA 5A5EA 3CDZA 3QNWA 4CKYA 5IWLA 1Q14A 2CO7A 4NUJB 3J07A 2WB4A 5P8WA 4RGNB 3ZHDA 1KENH 4G5OA 2X4DA 1M2OA 1Q9LB 3OKCA 3VWKA 2PUJA 1U8HA 1BHQ1 3LVRE 1RK0A 4IWXA 5EQTA 3E9RA 1U93A 4S0ZA 2W38A 3TK1A 3QPKA 3WIAA 2HK6A 1ONNA 3LP8A 4TLAA 5FK9B 4CMIB 1J23A 4Z4IA 5I45A 4FFVD 1KEEB 3J7AC 1XZQA 3MTAA 1E3ZA 3CV5A 4IDJL 4PRNB 4AKQA 1TJHH 1A2QA 4QU5A 1JHOA 2X4SA 3U4MA 1RJCA 2PYEA 1WW3A 5F9JA 3ZTTA 2FDBP 2KLHA 2FW0A 2X9LA 5FWXB 4FQJH 5CH5A 3BERA 2GEJA 4U9UA 1ES0B 2YBEA 2XMBA 1WXXA 1I4FB 3V7WA 4ZO6A 2QRLA 1DNPA 4N5UA 2GC7C 3KVOA 2R84A 4FYHA 4WSOA 3ZY7A 3FH0A 5M3BA 4PYKA 1LX7A 1IX2A 2Y4NA 4B81A 4QXGL 1J9GA 1PEKE 4J16C 4OX9Y 2Q8AH 2Q2LA 1GUYA 4PFSA 5FA6A 4TTRA 3SLRA 4EGQA 1KOAA 1KXTA 4EBBA 1VG9B 1YULA 1KYTA 4ZZKA 2XXCB 1SOMA 3LBYA 2ZCKL 5EO1A 1Y81A 4IFIA 2BNQA 1NG9A 4ZO8A 4IR7A 5DNEA 1XKLA 4NBNA 4Y5YC 2IWHA 1KY6A 5D7LE 4HQ6A 2CLEB 2CUNA 3P7MA 4UUQA 1SF5A 1XHEA 2W94A 3MJ8A 4JDPA 1YVEI 1SZPA 1NKOA 1R9FA 4JVWA 3K7EA 3C45A 2DUUA 2H52A 5BURA 1JD9A 3LUHA 3SZLA 1L7PA 3IBCA 5C0ND 3FAWA 3VGEA 4RPLA 2XB8A 3U4QB 8OHMA 1XV8A 3MOBH 4GS7B 1I80A 2GKIA 4ONHA 4KLZA 3OFSA 4B9KC 1LS6A 2Q1UA 1XZ8A 2BJVA 4F7CA 1MRDH 4KGLA 2O5XL 2Q29A 2LFEA 1TJ4A 3KYBA 1OP4A 1L5NA 5K5YA 3GMPA 4PJAB 2ZBDA 4XH9B 3ZQKA 1NPYA 5A2KH 3MWGA 1KSJA 4DVBB 4UTZA 5EZQA 3NOIA 5T33H 5BV7C 3SQXA 4ALJA 2R751 2OENG 5CFPA 3NC4A 1K6XA 3ZCRA 2DM3A 1G5HA 4HJGA 4MJ5A 3VRHA 4MA7L 5KKNB 3ZIDA 4BC1A 2VBFA 3T35A 3W06A 4GKSB 4GH5A 4H88H 1YR8A 4ENED 4HQLA 2F19H 3C7DB 4FA8A 2GVZC 4N2AA 1N10A 1G59A 2F58L 3BSZH 2JEZA 5FFNA 3WGNA 4PJBA 3UJCA 2DQDH 2W92A 3S5UA 3ARGB 2XWQA 2WTPA 2XV6B 1Q7CA 4OD1L 4PZZA 4PC3A 1IC6A 4ESVA 5CWSB 3H1EA 5BWLA 5JAOA 1CBJA 3C09B 1GYPA 4PAWA 2EDWA 5C07D 2BMEA 1Z0KA 3B8HA 1LE5A 4PJBF 1EZLA 5A6SA 1AYRA 1T6WA 2D9CA 4ZOCA 2YS7A 3R7AA 3E0XA 3TR5A 4DJJA 1ES0A 1HFEL 5AW9A 5JHMA 4KAFA 2HPZA 5CAEA 3AJ9A 1JZEA 2NXNA 4N01A 4L3WA 3LQKA 3AVUA 3OJXA 1SQ2N 5ALYA 1HZLA 1AK1A 2DAPA 1HQCA 5MFZA 4NQDA 1DUSA 2OFOA 2O5ZH 2HEGA 3O45B 2QL1A 1Z9SA 2ZRMA 4KJQD 4H8WL 3X11B 2Q45A 3DF9A 4NYIR 5JADA 3C6SB 1V25A 2VDNL 4TF4A 2DT5A 2ICWJ 1I7TB 1EERB 3U0PA 4HMCA 1E7RA 4G4GA 3IYLW 4Q89A 3W5CA 4P81A 1A7KA 1RUKL 3T6ZA 1JLSA 1HT3A 1SWWA 3QU7A 5EBLA 4XOAA 3BVUA 2JLUA 1OQOA 1L5HA 3IVGA 1XMJA 1M33A 4PE5B 3PUHA 1A9YA 3ZT5A 1E9PB 2FRDA 3AUYA 1XU9A 2YOHA 4QRRA 3KLOA 1U8QB 3SPIA 4I8DA 1CBUA 3UFXA 3COZA 4FQ8A 2IH3B 4PR5B 2RB8A 4XC1L 4M93B 2YFHA 1XMOB 1CGYA 3AHIA 1V9CA 3LCJA 3ICCA 3MCAA 3AR5A 2EO7A 4IQ0A 2NLJB 4NO5A 4OLHA 3L0YA 5IW6A 1E90A 4APQC 4ASUA 5IF0B 4H7KA 4BQPA 1QFUL 3CXHJ 1MKFA 3NEJA 3WQRA 1ZL0A 2PGOA 3BMWA 5KNBA 3UZQB 5KTPA 3NAQA 1A7PH 3FKUS 3BP5A 3RTGA 1SYSA 1YMME 1EPUA 3LPFA 4NDMB 1QTPA 4WEUD 1REQA 3WOHA 4CM4B 5TFSH 1F4YH 4UFNA 3F65A 3G0OA 1R15A 4A92A 1HILB 2JJ2A 4AZVA 1KMNA 4OLVL 1LNSA 1R4ZA 3CIOA 1XZFA 3RU2A 1KPRA 1WU8A 3JAWB 2P77A 3QF7A 5FV4A 5FHQA 2BGNA 1SUEA 4BCZA 1BAGA 5DUJA 4DRZA 5EYPB 3TR0A 4DV3B 4IKLA 2VSFA 3STZB 1PE0A 4UM8B 2D2OA 1ZKDA 3H87A 2VJMA 3HCOA 2X3UA 2G9KA 4GUPA 1HRKA 3PXUA 2V58A 3V00A 3T0AA 2ED6A 3TQIA 5DHYA 4ELMF 3C6ZA 3VRJA 3EOBB 1JEEA 1AFVH 4DP8X 1ZT1B 2FDRA 5C2BH 2DQZA 2FUTA 3FCEA 4NEGA 1YS7A 2D9QB 2WHRA 5IROC 4JY4A 5ES3A 2PV7A 4LX8A 5FR3A 1JWUB 3G2MA 2ZE6A 4O2AF 2UWEE 4XPBL 1J1UA 2HMIC 1K6JA 5EZJA 4HK0B 3TBVB 1ZANH 1XGRA 4E41A 1A95A 3TZLA 4OM1H 3CXFA 3K09C 2R3SA 4LAJH 1MNUL 5I9IA 2FZGA 4Y6QA 1A50B 4OXNA 4LDNA 1AQHA 3IULA 2C9XA 5GRWA 1DBBH 1B16A 1I2ZA 4OBSA 2JLRA 3LEVH 1JWBB 2WUFA 4IHBA 3W5UA 1F11A 3AADB 3WJ7A 1KXJA 5IEKA 5AWFC 3FOZA 5L3QA 1TOXA 4F60A 1GKUB 3O9WB 3PXLA 1Y7LA 5IAAA 4LYFA 4JM2F 1U7PA 3II3A 4W5HA 4F20A 1WISA 5AHRA 3T95A 4MWOA 5CLLA 2ZP9A 2QMYA 5DUBB