3NIDB

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 123
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3nidB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3nidB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3nidB03
3AL8A 3EGDA 4C2AA 2VDOB 3IJEA 3T3MB 1SHUX 4PN7A 4JDUA 1M1XA 1PT6A 2NVOA 3EGDB 1U8CA 5KYUB 4Z7NB 4HQOA 1IDN1 3N2NA 4HQFA 3EFOB 4JX0A 4MMYB 4MMZA 1MJNA 1PD1A 3Q3GE 4O02A 1SSLA 1BHQ1 4CN9A 1SQ0A 2NUTB 5HDBB 2VDKB 3EG9B 4M76B 4O02B 1IDOA 1RTKA 3AL8B 1M1UA 1IJKA 1MQAA 1SHYB 3IJEB 4O3UB 1NA5A 1PCXA 3EG9A 3TVYA 4F1JA 2NUPA 1FE8A 1U8CB 4XW2A 3AFCA 2VDRB 3ZQKA 5HGJA 4CN8A 2UZYB 1LFAA 4F1KA 2M32A 2NUPB 1DZIA 1L5GA 3QA3E 5KYWB 5E6SA 4HQNA 3AL9A 3FCUB 1MF7A 1RRKA 2IUEA 3PPWA 4MMXA 2ICAA 1M2VA 4CNBA 3TW0A 2VDNB 3EH1A 4HQLA 2P26A 3GXBA 4Z7QB 2VC2B 4UM8B 4UM9D 1N9ZA 5KYXA 1JV2B 3K72A 1U0OC 3FCSB 1OLZA 1AO3A 1BHO1 1AOXA 3HI6A 4O3TB 5E6RA 5KYYA 2VDQB 4NENB 3TXAA 3FCSA 4WK2B 4FWWA 4HQKA 1MHPA 3EFOA 1V7PC 4MMXB 3F78A 1JEYB 3NIDB 1IJBA 3T3PB 3ZE2B 2WINI 5E6UA 3OKYB 4WJKB 2O7NA 1JEQA 1AUQA 5E6UB 4Z7OB 4BJ3A 3E2MA 3OL2B 1ZOPA 5KYUA 4K3JB 3EGXB 5ES4B 2I6QA 1YVPA 4IHKA 3K6SA 5KYYB 3EOBI 2B2XA 2P28A 3K71B 3EGXA 1N3YA 4C29A 3HXOA 1OAKA 4A0QA 1XDGA 3ZDZB 1JEYA 2I91A 3BN3A 4G1MB 1FNSA 4MMYA 1YVRA 4NEHB 4G1EA 3NVQA 2ADFA 1M2VB 5LN1A 2NUTA 2VDMB 3OL2A 1QC5A 2XWBF 1CK4A 4G1EB 4GZ8A 3M6FA 2VDLB 1RD4A 4FX5A 3BQMB 3EH2A 3VI3B 3K6SB 1L5GB 5KYWA 3K71A 2XWJI 1CQPA 3V4VB 1MQ8B 3ZDXB 4MMZB 1M10A 5KYNA 4NENA 3RAGA 3EOAI 3VI4B 1T0PA 3BQNB 1DGQA 3NIGB 4WK0B 1JLMA 2VDPB 4UM9B 2ODQA 3PPXA 4IXDA 1QCYA 1QC5B 2WW8A 1T6BY 1JV2A 3K72B 3OKWA 4DMUB 5KYXB 5HJ2A 3HXQA 5BV8A 4WK4B 1Q0PA 5E6RB 4WFQA 1U0NA 3NIFB 1TYEB 1MQ9A 3PPVA 1SHTX 1UEXC 5E6SB 3TCXB 1PD0A 4C2BA 3PPYA 1M2OA 3IBSA 2ODPA 1XDDA 1YUKA 1JEQB 1ZONA 2X5NA 1XUOA 1ZOOA 2I6SA 3F74A 4G1MA 3V4PB 1ATZA 3ZDYB 1RS0A 3ZE1B 2XGGA 4IGIA 1M1XB 2QTVA 3ZE0B
chains in the Genus database with same CATH superfamily
3PJRA 4OFVA 2QUAA 4QBTA 3FTSA 1NCWL 4X6EA 4BCCA 4CADB 2VOJA 2FW6A 1T0HB 2EZ8A 2GYSA 1CXIA 3ANYB 1KJJA 2PUHA 5MGBA 4M86A 5CD3B 1CKEA 4PNZA 2Z83A 1RYFA 3ZIDA 2V97A 4ZZ3A 3GT0A 3DR3A 1A21A 1LPAB 1BVRA 3NGLA 3MJTA 5KJEA 1P61B 1DANT 4LRIC 1V27A 4HPHA 2VLJA 3BMNB 3TCKA 3KWJA 1ITBB 1DCLA 4KQ3L 1U8PB 3MV7B 1WAAA 4YYZA 5B53A 5BPFA 3UMNA 3O9WB 4FDTA 3RIFK 5JCPA 1X44A 1IFRA 1ZGAA 1ZIPA 1S01A 3DKRA 3EC2A 1CF4A 5JALA 4OFXA 3QG7L 3I3BA 5CW1A 4PVLA 3MCKB 5AMXA 3GINA 1BS1A 1PZ2A 1UP7A 2ZPTX 3BGVA 5DTRA 3EH5B 3KQVA 5HYSG 2PT5A 2UXCB 2C59A 3UTZB 1DBAL 3ZCPA 4O1IA 3QXWA 4OBWA 3IQZA 1QC5B 1JI2A 2HT3C 2P5UA 4QYIB 2R2EA 4WNYA 4A04A 3OTGA 4AYTA 3GXDA 1FL3B 4S1QH 3EFHA 1JZ4A 4A82A 3WRWA 1SCUA 1U92B 1U1EA 4UV7L 5MGNA 2I54A 3LV8A 1WZ1H 2AQKA 4FGLA 4E22A 2BV3A 3F62A 2GFQA 4YX2L 1QWUA 2BNQD 5B36A 3X1KA 4AGLA 2X4UA 4ZVUA 1WO2A 4EA6A 2IW1A 5I0DA 5LN4A 3WYFA 3TBSB 1VLJA 1NFDE 3U0PA 2BMJA 2OOSA 5E8OA 5EIAA 3TBYA 2W6JD 2YJZA 5IP4A 3PWVB 2FB4L 1PG7H 2NZIA 3SIRA 3PPSA 1RRGA 4R3SB 4Y9CA 3S29A 1FC2D 5DJYA 4QL3A 3MJHA 4ZX5A 4DQXA 4UUOA 3I9AA 3SYNA 3UWMA 3SB3A 4P23B 2CJUH 4XNMA 1PGJA 1ZM7A 2QIPA 5KBLA 5DMHA 5CM2Z 4CF6A 1J18A 1KFCB 2D31A 2J87A 4PRID 2XE8A 2XKNB 4Z7OB 1CGTA 1D9KC 1EGQA 1GFIA 2YYZA 3KLMX 5J6GA 1C5BL 4YI5A 1S2MA 4EEXA 10MHA 2F58H 4UM5A 1NL3A 1RZIA 3GSVA 3AR8A 4L3EB 1YEDB 4Z51A 4XVQA 5EA2A 1FLRH 3P2OA 1U8EA 1YA8A 4XCYA 3N1PC 5JROA 3UYKA 1BFUA 3FTNA 5BT9A 5BUSA 2PTTB 2RAUA 5K9ZA 5JD5A 6LDHA 3N2LA 3H42H 2FCBA 3K70B 1CZUA 4NP4H 4RGBA 1GGCH 4HUXB 5DGHA 3EEYA 2F48A 1NDGA 1S3KH 3E15A 1N7GA 2FLVA 2PLAA 4JFDE 1V25A 2WJJA 1XR8B 4LNUB 2ITDA 3WJMB 2WINA 5IVNA 2KLSA 2PW1A 4PG2C 4Q1EA 3V1LA 1DAGA 3WFEL 4ZEMA 3VNVA 5JQWA 2PKDA 2YRLA 2BIPA 2COVD 3V1KA 3K9QO 2M32A 3K5WA 1ODKA 4I0WB 2D3NA 3EY4A 3G6DL 4DNXA 5K2MA 3X3FL 2YUXA 1F06A 1ZLDA 2J85A 6ADHA 2VSYA 4KR2A 4FSHA 1NPJA 2IPOA 5K5YA 2JIQA 2BP7A 3DJTA 1OW0A 4NMMA 4K2UH 4ACAA 3MTGA 4PCSA 1BNCA 5KW9H 1TZOA 4DWHA 2ZRKA 3ZWNA 3QNXA 4B9YA 3DPBB 5F0JB 2DUUA 2JIXA 1R5OA 4P7FA 4GUAA 3QHQA 1N59A 2ZRHA 5L7XL 3QYPA 2VT7A 4Q18A 4MMYA 1C8BA 4ILDA 1GTG1 3O3MB 3EOTL 3JQAB 4FEGA 3JYOA 2P48B 2KC0A 4HOXA 4K6MA 1RZ7H 1ISPA 4DCUA 3IP9A 1FK8A 1KC1A 3ABGA 5EE5B 1UD8A 2PHZA 2PQ6A 3VHQA 4Y8AA 1B4RA 3S4SB 4RAOA 1JFTA 5EUBA 3F58H 3EC1A 3MMNA 5L4MA 1JDPA 3E9CA 5H9WA 3DE2X 1HHGA 5FKAA 4UQCA 4N0UE 4QOJA 3RIFF 3IEKA 3T08A 4XUGB 2WWKO 1VBKA 4L3VA 3AKCA 4MMZA 4BQOA 2YRPA 2B4TO 2HPZA 4FVTA 3M6LA 2HA0A 4WXEA 3HCEA 5DVNA 2NY6B 5K05A 1QR1A 1P1ZB 4NHCL 3HR6A 4O08A 4YAKA 3O9VA 3D34A 4R2XA 4HEA6 2IMMA 1UBCA 1UIRA 1MTZA 1J8FA 1ACYH 3WGLA 1JQKA 2QLBA 4Z4GA 1DAOA 5BZWB 4ENTA 4IILA 4CN1A 4KPYA 1JPST 3PD1A 4EG6A 1SQ2N 2X44D 1QO7A 3O45B 3HNSH 2I4IA 1ZVYA 1QBML 3MD9A 3V95A 3V0WH 4EE2A 3A4MA 5ANME 2FX7H 4IVRA 1ECBA 4QD3A 1HQDA 1GGEA 1UENA 3UYPA 4KY2A 4A8JC 4RH0A 1I14A 4H18A 1KGUA 4TPRL 2IIVA 3BXGA 3IHKA 3PICA 5JR1H 2GXUA 2G1KA 5KNDH 3RRQA 4D0DB 4LE0A 12E8L 1FS6A 1Q4NX 2O5CA 2C8JA 5DVLA 1UJTA 3QAZC 4MIOA 1E96A 1BG1A 3GI8H 4GUPA 4V1DE 5AXCA 2OYRA 1BEZA 1UT1A 2Y06L 3UAWA 1UH4A 1DJHA 3LPWA 5B3JF 3EWNA 3HUJF 4C76A 5F9FA 3BMWA 4J9UE 4MJ7A 2BCEA 5A2CA 1REQB 3T9DA 4GP6A 2F1BA 3D33A 3OJOA 1OB5A 3T61A 4D8WA 1F8XA 3ARDD 2QVTA 1N6QL 2QSZA 3BKMH 1RM5A 4H4CA 4KBFA 3JCZA 1T7XA 4FLQA 2XKAA 3E84A 3VVCA 5CJBA 3MRXA 1V7ML 5BS0D 3ZWPA 1J8MF 2HCFA 1GZUA 3L4KA 5GPBA 4ZEOA 2XOKA 1B6TA 1CE8B 4MWGA 1ZDSA 3MWLA 5IV2B 1RU9L 4MNQA 2YJQA 4TUKL 5F9WB 1DDHB 4ZICA 1TO5A 3U9UB 4CVUA 4ESEA 4E5DA 5FWYA 2CBZA 1QLFB 2HBZA 3RC1A 1XVAA 1NQUA 3DX8B 4EBQL 1TZMA 1IM3A 2CZNA 3KLBA 1CNEA 5DVOA 4BXSV 5G0TA 3UXFA 1CFMA 1GMIA 4F2MB 3A6LA 3W5BA 3A3YA 1K9SA 1KPVA 4XQ0A 4EDFA 4GW3A 1OK0A 3MRMA 3ANSA 3A58B 4Y2DD 3QX9A 5GJWC 4RH4A 1XJCA 3T9WA 1U9KA 3DBHA 1RD4A 3QHTC 2WJ6A 3KZVA 4JT9A 5TDHA 2QN6A 2VLKD 1L5GB 2ZR9A 1IZ9A 4JREB 2NN3C 2HT2C 1HNWB 1NSYA 3GFGA 5FQNA 5KNCH 4ZMOA 1ZDQA 3TB4A 1S7XA 4KFCA 4IM7A 5AQEA 4UM8A 2VNJA 2YK1H 1DDHA 3QITA 4EZJA 2XG4B 4V3CA 1Z0IA 3FYIB 5EKUA 5SWSB 3GJQA 3FWNA 3K96A 2VRQA 3K2BA 4Y0NA 8LDHA 1HDCA 3UDWC 5A0TA 4KXMA 3SDDD 3P0FA 5KVFE 3PNSA 1P44A 2AYZA 32C2A 4OCSL 2Z4TA 4LPTA 4TQHA 4P31A 3ZBPA 4BMOB 2PL5A 1XPUA 5B6PA 3DCJA 1O1YA 3RL2A 2BVPA 2XYBA 5KJFA 1DQKA 1XB2A 1A6TB 4KH1A 5L3SA 2X4RA 1KIRB 1LMIA 3DV6B 4H13C 5F7BA 3QJSB 3EEQA 4F5WA 4G1CA 2FETA 4KQMA 2G7MC 3MBWA 4ESOA 1Z82A 2VXUH 3R0JA 2XEDA 2FPRA 4M6WB 5AW4A 3OVMA 1XN4A 1MEXH 1TIPA 1T5OA 4QRUA 3D6JA 4JRXB 3V6MA 3DM5A 1TNMA 1ZH4A 3NJGA 1NOIA 1OH8A 1Q6ZA 2AEQL 4WUUE 1O0CA 3QWRA 4X8MA 4EG1A 4WFED 4OI1A 4JUTA 3UAXA 1HSAA 4HIEA 5KVFL 4AP9A 2WG1A 2Y23A 4EZMA 1KF9B 4G8GB 4JFRA 3DGGB 1N5AB 1U8LB 4QKQA 1NXVA 3II3A 3A1NA 5DF0A 4IHQA 4XI5D 3NH6A 4PJCA 1ZIBA 2HVKA 5LAPA 3EXHA 5ALNA 4B3MB 4IDJL 1NBME 4FOTA 4NPCA 5T1KB 1TO1E 5GIPE 4B9CA 4IJ3C 2A0KA 1M3IA 1NC1A 4KK6D 4LQLA 2I07A 2GT1A 3D3VB 3OO0A 3V8PA 1Q7RA 3EF4A 2PGAA 4XIFA 1UFRA 1RHRA 3DL0A 2H2PD 2K1MA 1S3SA 1X80B 4CV0A 1YFKA 3LX9A 3P9YA 4YLEA 4I3RH 1RTKA 1KP2A 4BB9A 4BE7B 4B9KC 3JQQA 3NIBA 4K3DH 2DKFA 3BFXA 1U1FA 4HDRB 1CDZA 3ZXXA 5DD6A 2VLKB 2BM8A 2OJZH 2VC2L 4LSRL 4C30A 3UT0A 4E88A 4QXWA 3QFJD 3FLAA 1LP9A 2WE7A 1QB7A 1PNQA 1E79D 3CZRA 4G5QA 4OI9A 5AYQA 1BXRB 1OX4B 5HDBF 1UWEH 3IDJB 1FFXA 4W5OA 2ZRJA 2OL3A 3ER9A 3QTLA 4I08A 2X41A 1OAKA 2CB9A 2W0FA 4I50F 2WU3A 4YXFA 1WXHA 4WNAB 4HZLB 3QVSA 1EDDA 3UZEA 3Q2NA 1WHPA 3ER8A 3MUZ1 1JQBA 1L7AA 3STZB 5EI5A 5FEMA 3RAGA 1SEBA 2VWEE 3ZZUA 2P9QA 1QOQB 3QUYA 2ZQ5A 4ZVPA 1V11A 3OAUL 1PEAA 5I4KA 3L6OO 1EEXB 1QSZA 3QEQD 3JY6A 3BORA 2FEPA 2PX6A 4PAMA 5CJXC 5C0CE 1K66A 3PP4L 3BH4A 1Q9KA 1NR5A 1KO5A 4MV3A 4INZA 2Z91B 1FAKT 3D39D 3RSSA 2H8PA 3QPDA 5I9QB 3I9MA 3VR4D 4EN3C 5FLVA 3IDJA 2FEDC 3DIDA 1KYYA 5JQGF 3U49A 1A82A 4JROA 1NC4A 2HHAA 2W2NA 4M8UA 4M93C 5YASA 3SE7A 4XFJA 3UPTA 1W36B 1XF3A 4Z7WB 2VRWA 2IEGA 4MW4A 1Q9OA 2BSCA 1XK6A 4ZCRA 2V5VA 4LXXA 5B1EA 3TPCA 1I3GH 1G6RH 5IGXL 5HMMA 4UMGA 1L8AA 3O82A 1VFBA 5ADPH 3UJTL 1MCEA 5HK8A 4EJFA 3IQDB 2DF3A 4DT1B 4HADA 4NP6A 1Y42X 1XE3A 2NYKA 4B3CA 4MZDA 5D2CA 1BW8A 3NXKA 3NTCL 2ITEA 5A5GA 1YBVA 3ELYA 4IRSC 4JS7A 5EU3B 2DYSB 2F19H 5CRIA 2C3WA 4G9DA 4ZVLA 3HEIB 1DAEA 2W70A 2DQJH 2WKWA 1SRRA 5AJUA 2CPCA 1ULAA 2CCGA 5JJKA 2X8JB 1ULUA 4BGIA 2ARJQ 1G6KA 1UWCA 2YV5A 1U0RA 4JPQA 2R56L 2BFGA 4YSEA 1WXGA 4LSTH 4OKVA 5J0BA 5JW3H 5A7HA 1FI8C 1AXTL 5C46F 2J33A 5B3JC 4M8RA 3ZBMA 4HAWA 4OKDA 5JXEA 3GT6A 3F9CA 1A6TA 4QU9A 4H26A 3EF7A 1AS3A 5TMEA 1N5LA 2H5EA 3OIGA 2HA2A 4AULA 4ES8A 1C1HA 3R3VA 2OMZA 3WQBA 3MOQA 4G7VH 3U3JA 1XZ0A 1HTYA 1SUHA 3FRPB 3UO8B 4OUUB 2H00A 3O0TA 2YZ2A 4IFEA 4QY8B 1N33B 2X5KO 4CN4A 3R0ZA 2FDXA 1UM9A 3K6KA 5T4FA 4D43A 1A6UL 2Q6WB 2V7GA 1DN2A 3T4UA 2QW0X 4XPHL 1X7XA 1HTTA 2FO1A 4HGKC 4EABA 5EUKA 5DQDH 4YVFA 4XR9A 1VRVA 3BP4A 4OHWA 2Z35A 3H9SB 1LK3L 3COWA 5F89B 5IUSA 3PV0A 3K0WA 2JIMA 3A1DA 2DX7A 3NBYC 1W5BA 2CVFA 5EXXA 3R5XA 4L4XA 4PINA 1M10A 3EUFA 4WKNA 1QH9A 4OLFA 2UYCA 5BVHB 2WBJD 3QJFB 4E30A 3MODL 5TPZA 1OCCB 2YRZA 4ZALA 4PJHA 3MT0A 4MIKA 2W0KA 4PC1A 4JGMA 2XW6A 1RJZB 1XD2A 2IOYA 2C9AA 1J9ZA 3C15C 4BLTA 4A2PA 1JTPA 2AEWA 5JBQA 2E6JA 4XFKA 3KKOA 3ZHOA 2V3EA 2NY6D 3FWZA 3L9EA 4TVPL 1GQQA 4UU0A 2ZWMA 3VPXA 1N0LB 5E2BA 1DO6A 5B39A 1IM3D 4I6JA 4QR7A 4PRIB 4KAQL 3D87B 1XEWY 3NCXA 2FFQA 3OKKA 2HI0A 2C4FU 3L8ZA 3S37H 421PA 3S4SA 5LNEA 2DM4A 5DJXB 1P0QA 2TMDA 3JASB 4MQMA 1FA4A 1G20A 4KBGA 1C4XA 1NCBH 1GIGH 4CKQA 1XGUA 3DW1X 1P31A 1OLUA 4UM8B 2I2XB 1E3LA 3VFUA 4A67A 4O4YH 2BSXA 2FEEL 2N4IA 4FWWA 3EFOA 4HUTA 3BZFB 4XCVA 1RIVL 4OCLC 2NW3A 3ZR5A 1NW8A 4KDEA 1KJYA 4HLNA 4OZGB 3MG9A 1FN4B 3D3WB 5EOCH 2Y1AA 1JPVA 1OWNA 5F4BA 5EIIA 1K7CA 5AQ1A 4JQIH 3BK1A 2WIDA 3H4HA 4WKXA 5HVHC 4TMKA 3MLTA 1P7HL 3VWKC 3ZT7A 5MEQA 4MZ2A 3ZU6A 2C07A 2IDZA 1G1MA 3ANNA 3TW4A 3GMIA 4BKLB 3V10A 2YTZA 3LLVA 4NO5B 1TQCB 1PKEA 2YXFA 2P9FA 3UPUA 4N0QA 3IAXA 4RVFA 3IPRA 1YEJL 4QQKA 4WACA 5B1KA 4C6SA 4D56A 1FQJA 4ZO6A 1SK9A 2RQEA 3VUFA 2IH4A 2FWIA 4Y4KC 1O94A 3GSQA 4FYVA 2Q3ZA 1PNDA 3HMXH 2RALA 5BV7L 2X9NA 2R8SL 1PU2A 3DA8A 4IDLA 3N2EA 2H08A 3LDBC 1KJ2B 1AC6A 5DJ6B 2EL9A 4ESVA 1PLKA 3EOAB 3E7PA 1YC8A 5ILTH 3N2NA 2WHVA 2DTMH 1GS6X 3A2NA 3GN2A 2EG9A 1RJDA 4XGZA 1GTVA 3DKIA 3GPBA 5JIDA 2OJEB 3V1MA 4R9SA 3V6OE 4XYGA 4G9FD 4MCZA 3M5PA 3ISRA 3H83A 3OV6A 2NG1A 5GZOD 3VXSD 2PBZA 1NVEA 3DS8A 5JAHA 1NGWB 2CM6A 4D1YA 4XH2B 1HE4A 1FFOA 2JE8A 5FUCE 1PNCA 4M5YH 3WFCL 1OA1A 2WVGA 3JQ7B 5BMVA 1L9MA 3G5XB 3PHBE 1CDJA 2B9EA 1SXIA 3GPDG 3ZLVA 1R4AA 2WQ8A 5T5NG 4A27A 1KTDA 1HT0A 5C31A 2BMWA 2Q8AH 1T5IA 1A4KB 3FDWA 4Z8FH 4PBTA 4L0ZA 4I50B 4TLTA 2DS4A 2P35A 2BY4A 2F62A 1DLHB 1SVBA 2XD9A 3B37A 2Z9CA 1NCTA 3CNLA 3E1ZA 1GZ7A 2HV8A 2PWGA 1SZCA 1X8XA 3LPNA 2F3TA 4MD5B 1DRKA 1CRZA 1H15B 2AJSL 2GNOA 4YQFA 3LKSA 5I66B 2M8XA 2R7EB 4E36A 2O5XH 1TTGA 3KZ8A 4JHAL 1ATZA 4MNGE 2EUVA 5IHXA 4TQAA 4L9LC 2JFXA 5G4NA 4MYCA 3A6FA 5CEYA 3L2OB 4OIAA 5HEKA 4NQCE 5B57C 1EV2E 3WRYC 5H37G 2UWEF 4M1KA 5IT4A 3MLSL 1TQUA 5L2JB 1K68A 2C57A 4WESB 4BEJA 2RK4A 5E70A 1GLGA 1NC4B 4PYKA 2AS0A 2C3YA 5DC0A 4Q7JB 3DLCA 2BCMA 4NM8L 3RAJH 5CGYD 2VI5A 5J9FA 1E2HA 1H8LA 1IGYA 2GVZC 4N0CC 1E4JA 1Q1EA 3H3FA 32C2B 4LAJH 3FRJA 3FKSD 3A1CA 5H82A 1U0TA 3KUCA 2JJWA 2GJ4A 1WG3A 4AL8H 3BIBX 3EMBA 2Q1XA 2X5XA 1G9TA 5E6IC 4QRTB 3G13A 3DO6A 3FPHA 2B5OA 2QVYX 3WNVA 2COQA 4P46D 1FV1B 1GFWA 4MUIA 2DY2A 2VJDA 3K8ZA 1NLUA 1QNFA 2XWZA 1NMSA 1PG7W 2DHCA 4QGAA 3QEKA 2X1QA 5C3MA 2OR9H 3QIUD 1AHNA 3OD1A 2WNGA 1A88A 3L8DA 2BLFA 4M0LA 1PDOA 1RVFL 1X5KA 1NF9A 3ZW9A 1MRFL 5I66A 1VZIA 1QWHA 1TX4B 5AOVA 3GS4A 5H2BA 3OM3B 3T95A 1DMRA 1H23A 1AO7E 4HKZA 5JNSA 3GK8L 4A73A 4P49A 3SKJH 5CT8A 2BVQB 1VL0A 4A6DA 4F8QA 3WNDA 3OB0K 1C41A 4NJOA 4O2CA 3K1KC 4OVKA 2QA5A 4K26A 4QEKA 2ZAHA 3Q3IA 5ILGA 3ORJA 1EG7A 3SX4A 2GK0B 4KJWD 4TXMA 2GUGA 4X6XA 1SCJA 4EPTA 1IE3A 4FZ8L 1O0VA 2Y7QA 1TJNA 3IOYA 3FE2A 3RQIA 4B95C 4YX2H 5KREA 2QZJA 1YB5A 3CC5A 5DUBB 5CGZA 4R5XA 1WOYA 1UXJA 4F86A 5IT5A 5JZSA 4KGDA 4ZQHA 5EMHA 3KV1A 2BSTA 1E6OH 1WB5A 1B0WA 1KI2A 4YVUA 1DC5A 2X1XR 1N8TA 1TF4A 2RMKA 1EJ2A 3FPGA 3OPNA 1EVTC 2VKXA 3W82A 2O3JA 1NJSA 4AJOA 3RD5A 1XJ5A 4N5EC 1CK0H 4NBUA 4JWTA 3CUVA 1LQBC 5D1XE 2DQCL 2XZDA 3WBJA 2IDQA 3UGTA 4AKQA 3OCUA 4PZ9A 5GGTL 5AVUA 1U9IC 1DNPA 5E94A 2WUBH 1WD7A 3HFRA 3EXG1 5T5QA 5F7DB 3L7KA 5CB4A 3H9SA 5JXAL 1V11B 1TUBA 3E05A 4QRRD 5IAJA 4PVBA 2WQ7A 5IB5B 4I7EA 1J0EA 4N49A 3HADA 4IK6A 5GZOA 2YW2A 2BKAA 5FCUH 4II3A 4V2UA 5L9DL 1J0ZA 2NYRA 1XDDA 4OCRH 3REQA 5E95B 4GO1A 3UUFA 3RTBA 2Y2UA 3KOWA 5DGQA 1ST3A 1TC2A 1TYCA 2R00C 4LPYA 4JPVL 1IFHL 2M2DA 5EHIA 3U4KA 1EZ1A 2VF4X 3HXTA 3U60B 2FP4B 5DK3A 4ZREA 3ROPA 1HTBA 2O8VA 1S3KL 4HU8A 2OUKA 4CN8A 4R7XA 4KUCD 1BA3A 3VG0H 3GMSA 3KSBC 2NX5B 1E4OA 3WP1B 3SJVE 2HC9A 5FD8A 2V7TA 4JC0A 4JMXA 3OOSA 5E3HA 2GBPA 1IAIL 4PR0A 1ZE3C 3NT4A 5C8XA 3F3SA 4PYOA 2AC4A 3VX0A 3O7WA 1XGUB 3DR5A 4IF4A 2I27N 3CN7A 3MLRH 4HJ1A 3JZFA 4Q82A 3E9NA 3U7AA 1TM2A 4HLCA 3D3VA 4ACPA 5KKAA 2J6WA 2G4VA 1PJ3A 4AMGA 1EM8B 5T8IA 3LOPA 1L7TL 3GQBB 4G36A 1M1NB 4E9SA 5CSGA 4Z5RB 4G8BA 4WKZB 1Y3FE 4IXNA 2I8AA 2R5FA 4XJSA 4MI3A 2AEMA 3COSA 4OZFB 2R0LH 4QTUB 3W5CA 4RHYA 3DT8A 1VFMA 2BVOB 4KKQA 5D3KA 3CIFA 1I3KA 3VFOB 1NIEA 4RIRB 2F67A 4H0FA 1RZ7L 1OF0A 5T4BA 2Z7ZA 1IOLA 4AFNA 3RIHA 3EGIA 1V5GA 5GS3A 1A3ZA 1UHVA 2W9LA 3VMFA 1JAZA 2CGYA 3Q85A 3QDAA 4IH9A 5C37A 1I4LD 1Z6QA 3IT0A 3KLHC 3T04D 2ZE5A 4D5EA 2PWAA 3N1GC 1MNNA 4HWPA 1U0GA 3MRKB 1XTSA 3L7DA 4C0LA 4FI8A 4F2ME 3IEMA 1ABFA 1XEFA 3BH9A 4J3FA 1WCBB 1E5XA 1XVLA 5HGJA 1SK8A 3IESA 4N6RA 2BDNL 3ULUC 4TN5A 3FCBA 4C7OA 1NDHA 2EKDA 3DMHA 1BPVA 4LBVA 5G0VA 3IEVA 1N3LA 4DQOL 3ONEA 6YASA 3HXMA 3H0EA 4DLWA 3RVSA 2DLDA 3B1YA 4C59B 2EW2A 3MT8A 3VC7A 1XZCA 4NT6A 2BGNA 3ZUGA 3SDXF 4ZT7A 4PR5B 4M1DL 3TSZA 3NBAA 2H5LA 1FF5A 2OQ2A 2CCJA 3PJNA 2XQYG 3UB3A 3RP1A 2NO1A 5IW3A 3L3HA 5J11B 4Q6IC 3MWJA 1K27A 1V3MA 3A1SA 4KQ2A 2YVUA 2WQZA 4NBSA 3VSEA 4OZ4A 1DG1G 4QWWA 3D30A 1QHYA 3JQDA 3SPXA 3ES6A 4IEFA 4R5TA 1X5YA 1OXMA 4E1BA 2EJWA 2GSIB 3A4TA 5EIHA 5AENA 1NRWA 1WFMA 2YUZA 4A39A 4DLPA 3KQOA 4FYTA 3KPNB 1S7WB 1TOAA 3AWIA 4FHBD 5B3KA 5GJTH 3NOQA 3NJ8A 1NDMB 4UEQA 3IE4A 5IJ9B 5IUNC 1O6SB 3ABZA 3F5DA 3QJYA 1MB9A 1BIIB 5J63A 4RDBA 2DETA 4TV8B 4UMFA 1C5KA 4G1BA 4DS3A 2ATXA 3T9FA 1H6UA 3VFTB 2ZVDA 4Z76B 1XNGA 4DP8X 4MKXA 4M1OA 5FLUA 1F4XH 3TEJA 1W6LA 1GNRA 3WJ2A 3O41B 3ZV7A 5D2NB 2K5UA 3WLEA 1RK1B 3V6FA 1IUNA 5KG9B 4FQJL 1UFQA 3R3UA 3USZA 4U7JA 2MMCA 3PNLA 4QBHA 3JYBA 2ASEA 1QEWA 4LCJA 3DTXB 4XRCA 2W6ZA 1JXGA 3AMVA 3QVVA 4CWAA 5F1KA 2RG7A 4Y89A 3VU1A 2ZAMA 4FQIH 1UPXA 3WYGA 3SIKA 1XCJA 1EDQA 5HE9A 1W72L 4TYMA 4DV6B 2O7NA 3TECE 1NJ5A 1XZLA 4F5EA 3OEHD 4YR6A 1X8LA 1YZNA 4CQLA 3PJSB 3FMOB 3KEDA 3S1SA 5LJLA 4KR9A 4HAGA 1CFSB 4NHEA 3WLHA 4QPCA 3H65A 5L3VA 1B0PA 3ZTWA 4X3CA 2Y1YA 2B2CA 1N7HA 2XZAH 4TUJA 5K8LA 3AVYA 2Y1DA 2J7LA 1MXFA 1WVZA 2JWHA 3A5VA 2O5NA 3OKDA 2DMGA 3KB2A 4N41A 1MQ9A 1YZTA 4KK6C 3KEGA 4OLYH 1O8BA 1PJZA 1A5SB 4ZS7L 3IBSA 3DVQX 3ZQ4A 3OOWA 1DQZA 3MJ8A 1A6WH 3V4PB 2XJ9A 4YDKL 2H0AA 3ILEA 4UNNA 1IZKA 5DX1A 5G2OA 2EOAA 5K6RA 1KGDA 3P2YA 2EEDA 3MLTB 4KXFB 1IVSA 1MCFA 4F60A 4ELMA 3OKFA 2V6HA 4AXBA 4IS2A 1DQTA 3SS8A 2LU5A 1SEVA 2VLRB 4Q47A 5I6PA 3THYA 4L1KA 1KY3A 1NUHA 5F3BA 1YQQA 4WJ5A 1BE1A 1JF6A 5KYWB 3LKVA 5JNRA 4MRPA 5D2LA 2GCPA 3U4BL 4AYDC 3H7BA 4Q48A 3BZFA 1FDVA 2WY3B 5TT0A 4EVRA 1QTQA 4K6OA 2IHZA 1X38A 2ABWA 4KP7A 2RTTA 2A9FA 3H4IA 1RIFA 4IS3A 4UTVA 2XTJE 5HYSB 1KKMA 2P42B 3MLVL 3MCYA 4A6YH 3HJ0A 4BNWA 2GTQA 3U79A 2B9VA 3ZHXA 1XYVA 1I1OA 3O73A 2IBZX 3IE1A 4FFLA 4I2XE 4I3SH 3WEAA 3MNVB 2NNAA 3BC9A 3HVRA 4RFSA 1M5UA 1F7UA 3SDXA 3C6LD 3UPRB 3WYAA 3PU6A 1NDTA 3TTYA 1O5OA 1MJGA 2C0CA 4LNRB 3APCA 1MZYA 2V5UA 4FFDA 3LGXA 3D9AH 4YLYA 2XXAB 4WFHD 3ROQA 4KNWA 4C6TB 1WDWB 2P0AA 4WK0B 2ICEB 1K4YA 3Q8EA 2DOCA 3DYPA 4F6RB 3KAAA 3T0EC 3KQUA 4HR7A 2ZX7A 5CCBA 1Y07A 4YHIA 3EOBA 4IO1A 4XWKA 4K9KA 3HKBB 3DP9A 2G60H 2O9JA 4DKFL 3TLMA 4XN9A 3IRPX 5LXGL 4Q3EA 1W6WA 4MUNA 4LF4B 1DVFB 4NPHA 3GLHB 4CHTA 5JPMA 4G4GA 4Q03A 2BEVA 4TLMB 5JSYA 1EO7A 3SGJA 5FL7A 4LKCB 4JFSA 3R4RA 1H4TA 4AIIA 3RBGA 4M99A 1KA9H 3LW7A 4TSBL 5D8JH 2EGUA 2IOFA 4YSPA 4J03A 3NZUA 3CEMA 4B3BA 5A1JA 4WI0A 2ZJ8A 2L82A 4EM6A 5I48A 4GG8A 1LS6A 4NOBA 1XRSB 3QLVA 4OOEA 5SYNA 2BNRE 2DPHA 3K4QA 3AWDA 2CN1A 2QTRA 1XTKA 3IS3A 3FB8A 5CJ8A 4KXAA 4CUZA 4GSRA 3PNYA 2WJPA 5ESQA 4XXWA 4P3KA 3DO7A 4L0QA 2FV8A 2BVPB 3EDQA 5K9OA 4POYA 4LCYB 2OSWA 5CG1A 1MCWM 5TF1H 5EJ4A 1NI3A 4IMJB 4Z7WF 1Y1PA 4JLRB 3BULA 4OIMA 5ADVA 1QYIA 1RP8A 4RMRA 2GXAA 2WFAA 2VIIA 2E7DA 4ZEVA 1DQLH 1AD9A 6CGTA 4NDMB 2CO7B 2FPLA 1K72A 3S1AB 2ZW9A 2AOTA 5DLEA 4J4HA 1CUBA 3OTQA 3GLVA 2J4WL 1HL7A 4MV7A 3VO2A 1LSUA 3PQYE 4B9FA 1N3NA 3QORC 4Y2QA 4TKVB 1OAYL 2O1EA 2IC5A 2PWYA 4JCMA 3OPVA 1MRCH 3QUMH 4JG9A 2XG5B 5PCYA 4U05A 3PFBA 4YRQA 4B8YA 2HCTA 4M21A 1I3OA 2AJUH 5KNBA 3GMQB 4GEGA 4ITVA 4UMVA 5DFVC 5IB2B 3EEOA 1I1FB 2JGRA 1G0YR 4ZAKC 5I76B 1TJHL 1GL4B 5KSBA 3PKIA 4LAFA 4PTTA 1ML4A 2Y0EA 2DQIL 2WZAA 3G68A 3IFOB 1E3DA 3VDXA 4DRYA 2QTLA 1T1JA 3DGDA 4L6CA 1T22B 1AUVA 1T9AA 5A16A 4BE6A 3UDWA 4A8HA 5FYJD 5ENWB 2WP3O 3WMWA 4CSSA 1N2GA 5GY7A 5I0ZA 3TH3T 4YP9A 1JXQA 2MCAA 2ZSVB 3TPUB 3DT6A 4QEGA 2OKMA 4WRLA 3ZCXA 4QXUL 5HOEA 4YDJA 3FHLA 2ZKYA 3HBQA 1SKUA 2PMWB 2WAQA 2V4LA 3DLIA 4KXYA 1CLVA 1SHJA 1A2YB 2Y24A 4NJAH 3I9PA 4NQEE 4PV9B 2OXHA 3UTZA 2M2IA 3JV4B 2DBQA 2N42A 4YEEA 1UXLA 3WLWD 2XKKA 4L3ED 1AC5A 1U31A 4M43L 3H2GA 4KNSA 2IEIA 1UM5H 4FQXB 4UHDA 2ODBA 3V5NA 4G8EB 5B1JC 4RAQA 4GXVL 1RULL 3A11A 4A5OA 1RAHA 1KTKE 2X5JO 2NQCA 1YEHH 4NRXB 1VZ3A 1KEMH 3OF6A 2AEIT 3DDHA 4PPTA 4CMAA 4GXRA 3AL8B 1N8ZA 1V9LA 4LMQE 4N65A 1DANU 5LVAA 3QW2A 1WRBA 5JHGB 4O8CA 4WDRA 1XRQA 1E1DA 4ZKDA 2HO5A 5JCJA 4B50A 4JRWA 5B8CB 4MVJH 3PUHA 1JDJA 3KG5A 3QEBZ 1JV5B 1X5FA 2I4RA 1A0OA 1N34B 5KYXA 1CUWA 4DAGL 4CPDA 2AEJA 3RWDB 5TC4A 4NQXB 2WOOA 4WCFC 3SHVA 5EEZA 3ZE1E 1V1MA 4B33A 3RVLA 3LRKA 3U0TB 3D3JA 2AKAB 1SZNA 5FV1L 1PJ4A 2RCNA 3E48A 5IAAA 1SU7A 3KYMB 3W2FA 2ARWA 3DDNA 1IZJA 5AW3A 3CPSA 4NO3B 4MS1B 3PTAA 3MO1B 5EIIG 5COQA 2QPAA 1PDWA 4JJAA 1QWSA 3VRIB 3SE8L 1A5BB 1X1CA 1L5NA 3I0MA 4X5RA 1I4OA 4PZPA 4X3OA 3HKFA 2Y07H 2B7BA 2PMFA 5AI8A 1NJ1A 2RIPA 1HQRA 4JP5A 1ZU4A 3HR7A 3SE3C 1SU6A 4ZT4A 2IS6A 1P1CA 3RWGA 2ZXEB 4UTXA 3R0XA 3IAEA 3R7SA 3KLDA 5A5DA 1RDFA 3THRA 2COKA 5JNLA 2RJOA 3R3ZA 5C4GB 3T3MB 1LVUA 3ORRA 3C16C 2QLNA 3R75A 3OUUA 1VSCA 3KPYA 1MFNA 4K94C 3QNXB 3TBVA 2JFBA 3RHZA 2BHLA 3NH7H 3KD2A 2XIDA 4A8JA 3P3YA 3UB2A 4XHJC 1Z38A 3QVTA 3IAS6 1P5VA 4HH1A 3R7WB 2QL9A 3TJHD 3UGUA 1FJXA 2HMWA 1R5WB 3QIVA 4UT9L 4UTAL 3QJHA 4ZS6D 4LCIL 4M7LL 4DESA 3IN2A 2UXTA 4YUZA 1VP3A 5DYIA 3VGGA 3RT7A 4LVHB 1JUFB 2XCMC 3OC6A 4E5MA 4Y5YA 3FCGA 3KBBA 3KKQA 2Q5BA 3VHXB 1R16A 5BV2P 4HGQA 1VADB 4FFTA 2H18A 1ZXBA 3L0ZA 3LK7A 2I6XA 2QR5A 4BP9A 1MSPA 4JFEE 2NY0C 5D7SL 4DF3A 1PSZA 5C6WH 5HZKA 5HM6A 2V0NA 4PGEB 1R0SA 3R3JA 3ENWA 3HM2A 5BXQC 4CMEC 4PICA 4L28A 3ZWQA 1M3SA 4BP8A 4ND5A 3LTVA 2FZKA 4BVBA 5DS1A 1SIWA 5FUYA 2EKPA 5LCVH 2JKLA 4ODWA 1ADYA 2CMRL 4BP1A 2IAMD 4NI3A 2BELA 4U6XA 3RFCA 4K7FA 4RJKA 1W80A 1NLZA 4R2IA 2PETA 4FULA 4LYDA 5LQJA 5I8WA 3ZCUA 5CB8A 3ZBTA 1FXSA 4K86A 3UJNA 2V6JA 1YIOA 2A3NA 5HBBA 4GGPA 3EOBB 3IDNB 4D96A 3NYKA 3CEHA 3ZE1F 2DWCA 4AW9A 4EHNA 3TRHA 1BZYA 2NY0D 1RKQA 4GRMA 5JIBA 1SO8A 4RQBA 2VXUL 2GC4C 4CADA 3LQKA 2HFGL 5AVZB 2EW8A 2XXAA 2WAOA 2QR2A 4UVDA 4QTYA 5DOVA 3MT7A 4S10A 2XVMA 5ALHA 5LBUA 1EVYA 5M04A 3P9QA 3IV6A 2AG6A 4DJFC 4JFXB 3VSTA 1HCVA 1X92A 3LYUA 2EUZA 2CXNA 4M0EA 1BAGA 3JWOC 4U6XB 4ZVMA 2ZBDA 5ALVA 1LFDB 5EZLA 3MC0A 5KZMB 1KNOA 5KG9A 1RE1A 3PQ6A 1ZHNB 2RHRA 4M1YA 4Y98A 2WV3A 4XE5B 5JISA 1GPYA 5JFOA 2R1VA 5T3ZL 3BVVA 1B0UA 2JWGA 5BJTA 3IT3A 3BWEA 5EWMA 1G4AE 4JC8A 2VTEA 5HJ2A 1TK9A 4RV4A 2MCFA 4QSMA 1ZT1A 1PR0A 2VP2A 2C4NA 2DIAA 1YSCA 3Q7RA 4X41A 2J6CA 1CG9A 4OKNA 1KJ3H 4BEVA 4IINA 2H7XA 1T21B 4ZCPA 3MX0B 1XWFA 3K9LA 5KVAA 1B9KA 4EOGA 3D1JA 4QPNA 4JANB 3U0WL 2QHRH 2PXXA 3QBTB 1YB1A 5CNIA 4KUZL 4UNIA 5CEJA 1B0IA 3AS0A 1NCIA 1YB7A 5JNTA 4RLQA 4CEIB 5A43C 1L8LA 4FC6A 2II6A 3GXMA 3MRIB 2MSWA 3ETNA 3GDOA 3VNUA 5ESVB 5E03A 1E2FA 4FKBA 2XX1A 5HPOA 4G5FA 1LNUA 2QD5A 3ORQA 2YR0A 3PHQB 3KL3A 4U6YA 4OW6A 3L5KA 2F1EA 1BZ7A 1UDRA 3FPKA 4Y2YA 4N8CL 2NU9A 3LPAA 3TN0D 2GBUA 3SJZA 3L48A 2QHLA 3TEFA 3Q72A 1HC7A 5EUOE 1XZDA 3T77A 2OV2A 2WUVA 2YAEA 1QFOA 4MB2A 1QSFD 1UA3A 3LRGA 3D8TA 2OSYA 4LVHC 3M7IA 1RHJA 5J4VA 3WSQL 2NOYA 1WWCA 4H3KB 4PC7A 1S7TA 5CCEA 4FQ8A 1K88A 1TTAA 3QDJE 2BBTA 3SQOH 3WLSA 4DJ5X 5JOFB 3HHMA 1ISMA 1ZD6A 3VXRE 4QYOA 5E4YA 2V5YA 2W9XA 4Y9BA 4DP9X 1RZUA 1IQWL 1H8SA 1BSVA 1KSJA 4GXQA 3PXXA 4N54A 2G0TA 3BRGC 4XUCA 3HFGA 2PSJA 3EK2A 4MSWB 4BLQA 5BN4B 2XQFA 1WFJA 3KZKA 3QTTA 5D4JA 2VJ8A 4QXGL 3FZUD 5CXSA 1GG2A 3REOA 2MINB 3IMVA 3AC0A 2CDAA 4PY2A 4M7KL 2HH9A 2AI3A 4CCAA 1NM5A 5I7UA 4LXHA 4M87A 4JFOA 1NYTA 2VH2A 3UHJA 3DEIA 3E9DA 1UG9A 3RTQB 4B73A 4PFJA 3SPHA 3WJ1A 2X22A 4Y2SA 1MV8A 4AJJA 2NAPA 5EXDA 2IHBA 3O91A 2OXFA 1JTEA 2YJ5A 3GFBA 1THGA 1X94A 3F7NA 5D87A 4Q9RL 5J4HA 3Q8AA 3NASA 1JXMA 3BICA 4JFTA 1I8IA 3DUUB 3EWAA 5E6RA 3G7TA 3HWX1 4F5ZA 5AW4B 3N43F 2G1UA 4CR8A 2ZNXA 1GZQB 4P5KB 4EQ3A 2H7CA 1ZVJA 4MVXA 4PC2A 1I9EA 3ZL1A 4OQ1A 3M8OL 2QTVB 3U30B 1DQJB 4HX1A 1KRXA 2FPXA 3IAM6 2CT8A 2K2QB 3N41B 2XA1A 3WMEA 5KTKA 5IJZA 4AKSA 3T5BA 1NCGA 5IXJA 1NJ2A 1T0PB 2X0WA 4I4LA 4JU9A 2I5YL 2CBQA 3MN1A 2ADFA 4FGMA 2XT9A 3N53A 4BP3A 4H0LC 1CFQB 3ULVC 4U1GB 1NYRA 2R6AA 2C42A 4X84A 4OIFA 1VMKA 5DHDA 3DD5A 3B5TA 1RJGA 1MBZA 1CF1A 1OPXA 3WL3A 1Q0EA 3KPSB 3N0PB 2QLYA 3MCLL 1UXWA 2H51A 2IPXA 1SQ5A 1J0YA 3ZPXA 2X1MA 1ZOOA 3ENKA 1NC2B 4JGUA 3VRJB 1N1GA 3IAUA 5ECGC 2RBLA 1A72A 1U30A 3SZ6A 2PO6C 5E0FA 3SXUB 3HABA 4M9RA 1PZBA 4C78A 3IFLL 5AWNH 4R7LA 5I1GL 2DECA 3UUWA 4P9MH 3RRXA 3EFDH 1P9WA 1B88A 5KJ6A 1KQ3A 2W0FB 3AJEA 5K6TA 4I50A 4DB4A 5B38G 4QECA 2CXSA 1JZ5A 3ZCQA 7MHTA 2VHQA 2AQIA 4PM1A 1OTSD 1YFJA 5HHNB 2ODTX 4S35A 5EA0H 4PW3A 4G8JA 4KQ6A 1E42A 1HH9B 2FYYB 1H3PH 4L9LA 4F7MA 1CDDA 2YWBA 3OXRB 8CGTA 4MLSA 3FOWA 5JYBA 1X8KA 2OEPA 2PABA 3C2SA 5TRTA 2BRRH 5E8DL 3TU6A 1FY2A 3I39X 4CU5A 1TMOA 5CVJA 3S68A 3K2EA 1IGCH 1DEEA 2AXJA 2Q2NA 1GRVA 1U2PA 4J4BA 3IDYB 4BLWA 1XDZA 2JK5B 1MRDH 4R1UA 2HLFC 2PQMA 1E2KA 3VFPA 3NBNA 3O6FC 4RWZA 4Z3KA 1E4XL 4NBLA 1O96A 2YH2A 1FFEA 2O2XA 2Q76A 3L3BA 2PWFA 2J08A 1HH6B 3TLAA 5F64A 5KOYA 1ZLXA 4PMFA 4QRHA 3LGSA 5MERB 3LD8B 1NN3A 4TVPH 2ZTUA 4P3CL 3LRLA 1AS0A 5BMOA 2JHGA 2H8PB 3DOIA 2JIDA 4C4UA 4HQOA 3AU8A 3DHEA 2NP6A 2E5LB 4CM3A 1IAOA 3A1WA 2R1TA 3B9KA 3QIAA 1G98A 2Q4TA 4OGYH 3C7TA 2ONKA 3T0AA 2OMXA 1TUBB 5AOCA 2FKNA 1D5ZA 3ILYA 4PY8J 2EQAA 3L07A 3B1UA 2J2ZA 3ME0B 5ALFA 1KYOJ 3IU3B 4PJGF 3VH8A 2XITA 4AKEA 2KSQA 4QRRE 3P73A 1OPRA 2BDEA 2OTUB 4XHJD 5DBGA 5IDVA 1S6NA 4L9WA 5I6MA 2UUDK 1V6SA 4C4ZA 1DUZA 3LDHA 2C2MA 5EU3A 3PG5A 4XCCH 1H85A 5A40E 3KT0A 1KVQA 3E8SA 3CC5B 5DUBA 4AGPA 3QHPA 5MHTA 2O54A 3EVEA 4FFVD 3CMCO 4EMZA 2AUNA 4FHGA 4IZIA 3O4HA 4WSGA 3RW9A 1MH9A 3ZWCA 1I7UA 3LBNA 3U62A 2X88A 2AK2A 4XN1A 4WKGA 1IMHC 1OPGH 4KK4A 3W5IA 1OAXH 2HKHH 2PANA 3R0QA 2PVCA 3CX2A 3HG0A 3G3EA 1XCQB 5HW0A 4RY0A 1I1YA 1KBGH 5AW0B 1VM6A 2BVTA 2PT9A 4IKJA 1TLFA 1ECZA 5BYAA 1QK4A 1CRWG 4RPGA 1F90L 3ZOAA 4EMBA 5JJBA 1CD1B 2J5RA 1M9WA 1YH3A 4ZO9A 3CVHL 3FFDA 1VYVA 2VQ6A 2UVQA 5BSFA 5F6IC 1KJMA 4JXZA 2L7JA 4QJ3B 3ETGA 4QXTA 4EN3D 1CBJA 1W46A 3QNZB 3P9WB 1EFHA 3D1MC 1BRMA 4X6LA 3SE9H 1H69A 4YHLH 5KTRA 2AP2A 1Y1UA 3HP4A 4R68A 3RPIB 3PQYD 2HGSA 4QATA 5FOUA 1TM3E 3VTTA 4PIMA 3LX4A 1T7VA 4XC1H 3ZGLA 4LCWE 2YUTA 2X3CA 1PX3A 1T0MB 3UZVA 5EO0B 1ZPDA 1AIZA 3R23A 4R5MA 2PZFA 3ZX5A 3TJZA 1V3JA 4NN7B 1B8UA 1ML3A 4Q6BA 4ZGBA 4BBWA 4QFDA 1OXYA 4HZLA 3IDMA 1KYZA 4HIHA 2SEBA 4Z7NE 1LB1B 3PBKA 2R00A 4FQIL 1RI2A 4JLAA 3PAZA 5A6SB 5EZYB 3TOZA 3I2FA 4LCWA 1YT5A 3FTWA 1FS4A 3VXUA 4NH4A 3AFNA 3BJIC 4IUDS 3Q2WA 3DF7A 2PUAA 2XVLA 1U65A 2I76A 1ZT7B 3OF5A 1AGNA 3U4DA 5F7AA 1GZVA 4D7BA 1H2XA 2Z91A 4B3XA 3N9IA 3GF4A 4JHAH 2LLGA 1SMDA 2HLFD 4O2FA 2J8UB 2WIFA 2LU7A 3PXDA 1DKUA 1FLTX 3IVAA 3WJJA 4DV5B 3E9MA 4LCVA 4FYWA 1RNLA 3KQHA 4OCXL 2NX5D 5CCHE 4LL4A 2JCGA 3D2AA 2JD1A 4HJTA 2JLZA 5CFRA 1WWWX 1P2SA 3S3BB 5D7JB 1JD9A 1LEKB 5DRZA 1DLFH 1FDLH 4B9EA 3I6ZA 5FNVA 3C60C 2X0NA 1KDRA 3JWJA 4GKJB 2XNKA 4EPSA 3ZGNA 1OCEA 1YUBA 1GZSA 3AFCA 2N3JA 3BPLC 2X8JA 5HNKA 1Z4QA 4PJDE 4KV9A 4ODSH 1ZCFA 4LHWA 1UUNA 4EI5B 2B6NA 4FQ7A 2G0NA 4L5YA 2ACEA 4N6GA 1K6QL 3GP3A 4IYRA 3SY8A 4KKAC 5FV7A 4DDTA 3FBWA 4NZZA 3TCXA 4MKZA 5J7CC 3WTUA 2CXRA 3IAHA 5F52A 3ALPA 3AM8A 4ND3A 4U7HA 4YJ3F 2WEKA 1ZGZA 3LNIA 1WIPA 3PAYA 1U1CA 5T5FL 1T5LA 1TVBB 3ROKA 4HVLA 5LP6B 4P3OA 2PSHA 2ORED 5AW1B 2GCYA 2QOEA 4B40A 2HK9A 1T5HX 3U9TA 1NPDA 1T89C 4XMXA 5F8QC 1ZI8A 3KTFA 1U2DC 3ZRFC 1ZV2A 2P8PB 3CMGA 3FGZA 3NIWA 2V8LA 4WHMA 4GQZA 2JGEA 3DX6B 2PTHA 5AUQA 4QGHA 5MI0C 3PWLB 3OCCA 4GXUM 2PUJA 1TOXA 3ARBB 2JAQA 4AZ3A 4PV7A 1UKQA 1B73A 2CZGA 4TL6A 2FATL 4MD4B 1HQYE 3GTVA 4KO7A 2RHLA 3S2YA 1CF2O 4PJBA 1ETUA 1QO3A 4C56E 3QORD 5F1IB 1JA1A 2PBFA 5EKTA 2EP7A 2E7MA 4Q3CA 3ZKND 3MCVA 2ZTBA 5E2UH 5ICFA 4NUJA 1RYNA 3R7BA 4L76A 3EXG2 1FB5A 4AXXA 4X54A 1T5WB 1N4AA 3NO4A 5F1OB 3ESVF 4PYQA 1CC1S 5EU6A 3R9XA 2GPYA 2QRGA 1MUJB 2CWDA 5EUCA 1A9EA 3C9NB 2JLSA 4GRDA 2HBQA 3B8EA 1P9MA 4DIEA 1M2NA 4Z0PA 2H2GA 5IJXA 4O4HB 1XALA 3IL2A 4Z7NF 1LVEA 3Q7JA 3F6PA 4L5FH 2CFOA 1A9EB 3C9NA 3B9BA 3HB1A 2HA5A 2FRXA 3JVIA 5TDOA 4RD4A 3Q13A 1TQCC 4UNUA 1SBSH 2QMKA 1K4DB 1UUFA 3VGEA 2CLSA 4I85A 3WFDL 2B16A 2JAHA 4MRAA 4ENQA 3K0FA 3T0DA 2GN1A 5DW0A 4GOND 3O3CA 5ESWA 3WLFA 1Y7HA 2OL3L 4XBEH 3CBRA 5I1IH 1CUUA 4WFJA 1SDYA 4HS3A 2G5PA 5FKJA 4FFYL 3NI2A 4IRZL 1MQKL 4GT0A 4FYIA 2LE0A 3QUZC 1XDWA 1IOVA 1U8TA 4C87A 4B45A 4KRNA 4EI6A 3SDAD 1DTWA 5EQJB 3GYBA 2CF5A 4L07A 2Q50A 3ZYCA 3F49S 4OCRL 4P2CG 4CMHC 1VMAA 2ZUXA 4HAZA 5JLAA 5EFOA 1J9QA 2VRBA 4WV1B 3C1OA 2EYTA 2ZB2A 4FFBA 4CDNA 4OKVB 3LSTA 5E9AA 2MYTA 3BT0A 4ZAKB 2NYYD 2WTEA 1EFVA 1X5GA 3T6KA 1DJOA 3C1TA 2E48A 3MGCA 2WWOA 3GBSA 5KS9A 2V6FA 2VJBA 1IKOP 2N47A 1RPKA 2F3PA 2P44B 1GPMA 2RHHA 4H7FA 4EN2A 4G3YH 1ORDA 3PRKE 2PH5A 3VR0A 3MS2A 4HQQH 5E38A 3HNSL 1XZIA 1G1CA 2EIMB 1CDGA 2VHYA 3B2VL 2WWFA 3MBKA 3I2CH 2GWRA 2JJMA 3QYJA 4ENZA 1N5RA 2FMKA 2V17H 2DQZA 2WQRA 2PPAA 5KVDL 4AM8A 3GOHA 1NRIA 3TXAA 1LLCA 4R4ND 2WABA 1X77A 3NIDB 3V8QA 1W34A 1PV2A 1IWOA 4FFYA 1P5UB 2B14A 2PV7A 1WTAA 1TAGA 1JG9A 2KERA 1THCA 1YQWA 2H6PA 5BQDA 2QTWB 4DEPC 4ZT1A 5DNAA 5JT1A 3IO5A 1FS5A 5DGRA 2HBRA 3F47A 4PTYA 4JENA 3UPAA 2APJA 4QREA 1FSKB 3L3GA 3RWHA 5CAEB 3IVCA 3BZWA 1MVUA 1NAMH 4X7SH 4WWNA 2HT4D 3RUGB 4YRTA 3GIWA 5E8NB 5T8KC 2B3IA 4FYHA 2ZKLA 4Z4EA 3K16A 4UILL 2CHQA 2L17A 4HPYH 2OCIA 5F3RA 3A6ZA 2HN7B 1EWRA 4G3XA 5CH8A 1WSDA 4Y2OB 2A67A 2I8CA 4L4JA 3RR2A 5HQTA 3CUPA 4XP1L 2XDAA 2OMWA 2NPLX 1U3NA 3O7MA 4QYWA 5KMGB 1K4CB 3TFQA 1ZHKB 1UBEA 3DURB 4G5XA 4WW2F 4D4GA 1SC9A 3IELA 3WI7A 3HA2A 3C3WA 1KPRA 3OC5A 1QLWA 4HAFA 2W2LA 4BDVB 1H3XA 3D3VE 3IMRA 1JZ3A 3V5HA 4LGVA 5JC8A 3VI3A 5ER9A 5D93C 4OZHB 3DAOA 2W9EL 3CVBA 4ERSL 5LLIC 1V5FA 5KTEL 3DFFA 4KX7A 4L2IB 5ALCH 4MS3B 2EATA 4X61A 1A4JB 3T94A 2DP4E 3NYRA 3T0GA 1SKQA 1A2BA 2C5BA 2HYIC 1RWXA 4DXHA 3JWOL 4IV5A 4EYKA 3GSWB 3IILA 4FG6D 3ECVA 4DFDA 1YB6A 3CFMA 5FUOL 2YK1L 3HLAB 3WL9B 3QOXA 2VLME 4AMZA 1AQHA 3UOWA 1L8OA 4FEAA 1RUPL 2NW3B 2GVDC 4K6GA 1WAAF 2OFQA 3E3OA 1ASQA 4GUQA 2RKBA 4YO8A 4LLUB 5TGTA 2D3VA 3QEGL 2H5JA 2IYWA 3GRYA 1SYSA 2Y0SA 4KKPA 4CQJA 5C2UB 1ENZA 1MW2A 4ASUA 2GAZA 1WXFA 3CLUD 2RFLA 4LPCA 1XGRA 1E18A 5A9TA 5COBA 2R2EB 1KWGA 1IAII 2RIKA 2NOAA 4NIYE 4XXCC 1EVLA 1UFKA 1ZD5A 1Y9EA 3R6TA 5IAEA 3VOSA 2XWJA 3H6JA 2PXCA 3NMUF 3TEWA 3ED5A 5TF4A 3GSQB 3JTMA 4FOLA 4XVUA 4BNXA 1UWYA 3UN1A 1FJ2A 2PUDA 1CD5A 3H53A 4AX4A 1G2QA 2IALA 2I7CA 3IJ5A 3BP7A 1L9XA 2UZIH 2Q6LA 2JBAB 4DWOA 4BX8A 3CEJA 5DT9A 1JTOA 4JX9A 1U8MA 1YL5A 3E18A 4GOOD 3RVMA 2YWYA 4ONFL 3WLOA 1KENH 4GIPD 4GX5A 1FPTL 3TF7C 1P9RA 5ENZA 1OI7A 3C7AA 2GH1A 4I4CA 1Y1TA 1FVCB 4PJHF 4X92A 1XL0A 2R6JA 3NWOA 3PEVA 4QXOA 4P57A 3RIMA 3MTXA 4X6DE 3ZQ9A 4H8WL 2PAFA 3FO0L 3VBCA 4JLUA 5BURA 2JKWA 4PI2A 3IVGA 3HKCA 4MWDA 4HYQA 5ILOA 3EXHC 5G5DB 1SLUA 1JIBA 3KSMA 1MIMH 3U13A 2NADA 1B4JL 1EB8A 1IZ0A 1CE6A 3CH1A 4YQYA 5AVRB 4B4WA 2ET6A 4LHSA 1VHTA 2DB3A 4HKXB 3MS4A 4A7VA 4ZXBB 4Q3KA 2CJ3A 4HBCL 2HLDD 3U7QA 1UEYA 3QWOA 2O8FA 5C07A 4NQSA 4IHJF 2F58L 1B3BA 4LARH 4GRWH 4W6YB 2VJKA 1IN1A 2FQDA 4CT5A 2D4AA 2ODAA 1YOVA 4X65B 3H42B 2ZE8A 3I53A 4KSCA 3UJ6A 5I1KH 4EMSA 2NU8A 4E33A 3ZXSA 2FGKA 1KEGL 1KXVC 2H3EA 3MHTA 3EADA 3WADA 2OFFA 2C4XA 2EH7L 3PQYB 1OGTB 3IJEB 4ZNCD 2J1WA 4ZANA 5MEOB 3EQ2A 4JB0A 3I12A 4KW7A 3HBJA 3H42L 1ZMYA 3FB5B 1OP5K 4CLRA 4WO0A 4HOWA 4M0PA 3JQ6A 3GUUA 4TXJA 1HOCA 3U25A 2F53D 4ZVSA 4XRGA 3LRPA 1VLHA 2UUOA 3OR6B 3WWEA 3G08A 1I3RA 3BB1A 3WK4A 1KR5A 1LDNA 4AJ1A 4HQKA 4LHYA 3VUAA 3VWKA 2H1LA 5BSMA 1QBBA 3IMKA 1R50A 3Q06A 3VXUD 2EXWC 5KWEA 4QO1A 4XB3A 3NX4A 4WT7A 3SCMC 4AG5A 3TI7A 1E43A 2CKBB 1D6MA 1ICTA 4P2RA 2G5TA 3LWNA 1KK3A 2H2AA 5AJZA 3DLAA 1BGWA 2PUGA 4Y4KA 1O94C 2AYYA 4UNQA 4C0XA 1WAMA 3S96A 4ZD3H 5DLDA 4MZRA 1GKLA 2XYVA 1D5CA 3MV7D 3I84A 3GI1A 2FG5A 4CVNA 3OHMA 2C9UA 1XMJA 1RURH 4H4EA 2AHOA 5E7FA 4YPFA 2L04A 4TVSa 2F7PA 3C3MA 3EQ7A 2PSSA 3UT5A 1VENA 4ZPXA 4Z6AT 1MI5E 4CBVA 1MCIA 3IN0A 4PSVA 5H81A 3QVJA 3H4FA 2ZSJA 4AWXA 3GUHA 2B9AA 4A91A 4AX8A 4HT3B 5LPNA 2WIJA 1NQOA 1GIAA 1Y8QA 2J4CA 4RX1A 4HWEH 4K5NA 1NW4A 3OM9A 3AKZA 3IEUA 5K0FA 3MB5A 2JLBA 1A9ZA 2GNPA 1VP9A 2VP6A 5DBHX 1IN4A 1DQYA 1OX4A 3BUDA 2K8MA 3E1KA 3O3DA 2FI1A 5KTNA 4PHFA 4QDTA 4QXPA 2B08A 5AD0B 3X11A 1PJSA 2CA4A 1XZAA 4YHKH 3WNOA 4UHJA 1LEGA 3S81A 3V1YA 5I6LA 5DWQA 1J87A 2BVNA 1YJDC 2C4UA 4LBEB 2YPVL 1QZXA 3M89A 4TWAA 3RPEA 4IIJA 3UAEA 4HB3A 1NSNH 4IHJB 1ESMA 3IUPA 3MWKA 2YHIB 3VOAA 4H7DA 1E3TA 1K98A 5BNZA 1HPLA 4INAA 1BQSA 1H8NA 2N0KA 1JDDA 1BE8A 5T64A 4KQCA 2A78A 4EHDA 1U3GA 3NBUA 2IAMB 3QZBA 4F91B 3R8XA 2TMYA 4BFRA 1SCIA 3OT1A 4KJYB 2QYTA 4UARA 1T9BA 1BQKA 2HKFH 4P5TB 3WRYA 4LS3A 1F1JA 1A8ZA 1JVOA 3RGVB 3QEOA 3TLBA 1UKYA 3RJ5A 2XWSA 1GGHA 5DHTA 3RJ9A 3UROR 2A5JA 2F74B 4M0CA 2WWYA 4DLAA 1GEEA 2RH4A 2PK3A 4YE0A 2AJUL 1TM7E 4F5CA 5JHLH 5CJPA 4Y4FC 2CHXA 3W9DB 1NUFA 1IQWH 4NAQA 4XZUB 1AQDA 3OURA 2H2SD 5K99A 3H97A 3UC0H 5IKOA 3S5LG 4NN6B 4KWCA 1UJMA 4YDQA 1GKOA 1D6NA 6PAZA 2NR6D 2A5UA 3LQMA 4L3EE 5EIBC 3VZBA 1ZD3A 3ZR4B 4L8GA 4TTTS 4PSKA 1PNVA 1R34A 1KH1A 1EQAA 4Y4HB 2YKGA 3WEXA 3WG7B 3T5WA 1G20E 1M74A 3QF4A 5G1NA 4KMTH 4QXUH 1P17A 1NFDF 1CUVA 4BX0A 2Z1KA 1AQYA 4MV9A 4XMLH 3AR9A 5AXBA 1P1VA 1R7RA 3KLPX 3QDMB 4OMDA 3KFLA 1T1XB 3VUEA 5IB2A 2Z30A 1RXIA 2HX9A 5KSBE 4D9HA 2BGIA 1COWA 2WJVA 2GXQA 2I4TA 5GGUB 1QTNA 1WFUA 4OVUA 3GZQA 1RRPA 4NQTA 5GINE 1LNQA 4K28A 3QS3A 2ZGVA 3MUY1 3WKQA 3QG6A 5KVEE 5F9MA 3ABMB 1HEZA 2A7QA 2W4IA 2I6SA 2JFGA 5LFAA 1KOLA 1EPFA 3EGDA 3BWXA 3PQYA 1WY7A 4NFLA 4ALMA 4P7KA 1FFAA 1NM9A 2Q41A 4Y2DA 4C57C 2XFGB 3LN9A 4JKKA 4LIPD 3L8GA 4AENB 1AK2A 4HMPA 4XCYB 5TGZA 3TSOA 4DA0A 1N0WA 3FDJA 3ESXA 1Z13A 4UVEA 1ID2A 1BV8A 1QEWB 1GQFA 4MINA 3NRJA 2JATA 5BO5A 2PT7A 1S7TB 1DWUA 1C0IA 1QATA 4G83A 4DV2B 3UBXA 3S34L 3AJ8A 2PWEA 5ALQA 2UZXB 4HS8L 3MRHA 3Q2OA 3JVGC 4OCMC 3SX0A 3BQUC 4FNUA 2NZ2A 1JZ6A 1V3TA 3MWEB 4MA0A 3DX4A 1J8YF 1OY3B 3BE6A 3X2FA 5BRZA 5I7SA 4OQPA 3RJQB 4YXHH 3ZE2B 2C84A 2NTFB 1E61A 4LXQA 4KC0A 1Q0YH 2H41A 5CKAA 4NSNA 4FJ2A 1CFVH 3RU8L 1YIDA 4QE3A 2JIRA 5IMBA 2K6GA 1FH5L 3TAUA 3PX3A 3FBQA 1AGBA 1PYWA 2ZI6A 1BWRA 3HE7A 2GHZA 3GFRA 4J0EA 4JUCA 4MEJA 4G6KL 1P1IA 2PGJA 3GIZH 1PZCA 5DURB 4DH2A 3PJEA 5AVTA 2DDQL 4M0FA 3F1KA 5F7NC 1SHZA 1A4UA 3NHJA 3MRLA 1F8GA 3T52A 2A33A 5EZIL 3I72A 1GZQA 4P5KA 1DFGA 1RHFA 3WIVA 4QJIA 3R6WA 3VNAA 3IQWA 2MSPA 2GN0A 4OXQA 4N2OA 1Y5LA 5KUKA 3RTLA 1EP2B 3Q0IA 2QDKA 1RCUA 3O8XA 1ND0B 4YHML 2VWPA 1MFAH 1YS9A 5BV7B 3IF1A 2NTYC 4UT9H 4OG2A 5KWYC 2APXA 1HKUA 4X98B 4W5TA 1UD3A 2WLSA 2B3TA 4JMNA 4RQTA 3NRQA 2F4NA 1EEQA 4XR4A 2AN1A 4JK3A 3PCRB 2B8TA 2IOIA 2AMFA 3SZGA 2FZ3B 4KOBA 4IMLB 2A77L 3UMVA 4P2BA 4X63A 2QM3A 3D6AA 3BDVA 5I6DA 2FJGB 3V32A 4QQNA 4MUEA 2VDKL 3WNNA 4LF9B 2VZVA 1VGEL 3U48A 5ES4B 2Q9BA 1CDUA 3C5ZD 4LMBA 1DAFA 3HS0C 5C6TH 1MHPH 1NM5C 2W2KA 4FZ3A 4BMVA 1JGVH 3KVRA 2AX4A 3IR7A 2V5TA 3O6MH 2C7FA 3IGUA 1KFGA 1G8PA 4WKZA 1KMMA 2GBVA 2OMTA 2ZIEA 3DMMC 1CJTC 4PJXB 2PXYC 3EZJB 1I1AA 3E8UH 5D5QA 3IJSB 5T1MB 1PBNA 4K0RA 3W1EA 4R4JA 1UOWA 4BQSA 2B83A 2ZUVA 2ATEA 2JVIA 221PA 5FBQB 3QSKB 3P9KA 2BGJA 4G9FE 1FAIH 3EBLA 4G8IA 2DULA 3CSGA 3V0AC 4XBGB 2DQFA 4PRYA 2B8EA 4PRPD 3BWYA 3OEHA 2X9WA 1ARZA 3P9NA 4LOVA 4LRXA 1W15A 3QNFA 1N5OX 4YECA 1AS6A 3I83A 3SD7A 3GFFA 3T7SA 1H6CA 3VGFA 4EAQA 3LCRA 4PCKA 2IG2L 4RNDB 1HDIA 3OZGA 4MIYA 3LP8A 2VDNB 2JLPA 1UOVA 1W25A 3JVDA 3SDDB 1KIPB 4KZKA 4L37A 4I88A 2VPIA 3NC1C 1A9SA 1Q9LA 4PJ9B 3EFFB 5E99L 5G1OA 2DBYA 4X4ZA 3KJ4C 1RWQA 3KDAA 2YOCA 4OHBA 4NYMR 1R3KA 2FX8L 2JSFA 4E14A 3Q2VA 5C0BA 5IC4A 4EKNB 4FP8H 4LXFA 3B7PA 3BFWA 4L16A 2KLRA 5EJEA 1ZCAA 3REWA 3NRBA 1HILB 2YAQA 4L18A 4QLBA 2VF8A 4NEQA 1NNUA 3JWGA 1I82A 4GF5A 1DCFA 4S1RH 4RS4A 3AIOA 3WG9A 2PV0A 5EUMA 4L50A 4ON9A 2OK0H 4IHJA 5E9QA 2KYRA 2ID7A 1UT5A 1KACB 4PJIA 3L8CA 2KKQA 4EW1A 3V9CA 1LQ2A 5DDHB 3F5SA 5CZKA 2FVXA 1NXSA 1U3HB 1NDMA 2DY1A 1QFWH 2EP5A 1RQ7A 4UTAA 3NSCA 5K3AA 1QUEA 1RLJA 5I7HA 3LC2O 2D0HA 1N0XL 2GUYA 1HY3A 3GKWL 3AF2A 3A1VA 4HJEA 4U1KB 2P45B 3F12B 1SKBA 4B4DA 3A6BL 2NSHA 4ZC1A 4J3TA 3KVQA 1FFYA 1EIWA 2GSDA 3P9ZA 3L7FA 2AJ3A 1XPOA 4ONHB 2IXEA 3JPWA 1Y0BA 5D2NA 1JMKC 1XKXA 2JJ2D 4FGZA 4YA6A 2V7BA 5DEOA 4N85A 3ETTA 3GRWH 4J90A 2I65A 4DP1X 3CM0A 1CK0L 3DX1A 4YGAB 1HF3A 3TI9A 1DO5A 1WTLA 1UQSA 5HKKA 4OXYA 3KWVA 5ECJE 3UH0A 3HUUA 2JWYA 4AIOA 4M61A 4M3JA 1YS4A 2FWOA 1QX4A 4LGYA 3R74A 4RF4A 3P9PA 4H9GA 2G9QA 4MAYB 1UDCA 2V7EA 4FHKA 1OAUH 2I2FA 2FJSA 3TZLA 1SBCA 3IGAB 3L1JA 4BSVB 4MARA 3K0AA 3DDCA 3TBSA 3PNOA 1BCSB 3OG4B 8OHMA 3MACL 1NGPH 1QIHA 1AP2A 1DO0A 2GSIA 1FTNA 3U9SA 4JJIA 5I6XC 2DM3A 1XTMA 4K2HA 1J1PL 2F18A 4J7UA 3RARA 1O77A 3CTPA 4RE6A 3K0HA 4QRUB 1BEEA 4OZ4B 4AG4L 1BXGA 4LCYA 5D5ME 5TQ0A 4PAOA 4JSRA 3FT2B 4KKBC 4DE5A 3LKRB 3HG1E 1JZFA 2QVKA 3UTTD 2XMZA 3I9OA 2OX5B 1OAJA 4U1LB 4C4BA 1Z0JA 2EEZA 1SHUX 1NYQA 4DM3A 5DFAA 3AP2A 3IGAA 2V59A 4N26A 4FMCF 3Q5YA 4P5EA 4US2R 1DSFL 2KMLA 3NSJA 1WDLA 2Y99A 3AQZA 5E2UL 2W92A 4LC9A 3ZI7A 1OV4A 2EXWD 2IZZA 1FF9A 1FDWA 5CW2A 1ZHNA 3K73O 2B99A 4QI3A 4PJIF 4L3EA 3OLZA 1E5YA 2CHWA 3AVWA 3FB1A 1DLJA 5KNCD 3KLNA 3AXHA 2YA1A 1Y0LB 2G3NA 3WKAA 2QX4A 1JSLA 4M9QA 4FDUA 3OQJA 3X1MA 4W5RA 2YJLA 1L9RA 2Y1ZA 2X09A 4U7GA 5IR1A 1MGPA 2WIGA 4Y2UA 1UMDB 3DLHA 1E3IA 4I89A 1SBSL 3EYQD 5LQMA 4JP2A 4HIIB 3J8F7 4Y5VA 1HCYA 4UQ3A 1GG9A 4Y7CA 1PZNA 2WD7B 4GW4A 1VJGA 1O9ZA 4V3BA 2ZP8A 4FSXA 4DC1A 1PZMA 1NIFA 4UXJA 4WTOA 3HSKA 1C3XA 3RYHA 4IMPA 1OXBB 4I1PA 1DP4A 4UZEA 4ZSOB 1J07A 1T0NB 4OQNA 4RS3A 3ZHSA 3IP7A 5C1BA 4IGBB 4RO0A 1EHLH 4RV9A 1SCBA 2Y67A 2FIKB 1I9JH 4GAEA 1Y3HA 3B6SB 1KMQA 1N6LA 3DPUA 3GNLA 4N9GA 4M3HA 3FXAA 1PFQA 2XACC 3T0VA 4X8JA 2H1WA 3A4DA 1PFUA 1KI6A 2WO3B 2VLBA 5KJ1A 3GI9H 1IGJA 4P4SB 2WPDA 1I4DD 2V7HB 2FTAA 1X42A 3LI2A 1R6XA 3EAFA 4N6NA 1D07A 5FOVA 1I9IL 4LX0A 4L37B 3W5SA 1D5IH 4YC2C 2HKAA 1H93A 4FFPA 2Q5HA 3INUH 1NXOA 1IZYA 4Y9RA 3TZHA 2VLRA 1KVTA 5AVTB 1KI3A 2SKDA 1VJ0A 4RF2A 2O61B 2OW6A 5HP4A 3SDSA 3FKUS 1GOHA 5DEGB 4B5ZA 5HG0A 2WJ3A 4R7TA 4QQFA 5E6UA 2CSPA 2OHFA 3CE6A 5D5MF 1JP5A 3MLWH 1N6VA 3ZX1A 2AQNA 4GKNB 4TMPA 4OLVH 4CDRA 3SYOA 2QSJA 5IT2L 3CHOA 2IZ0A 1Z5LB 3ENQA 3C60A 3SX2A 4JJ7A 3ON5A 4DQUA 1EAPB 5JATA 1TZAA 4JM2C 4U0RB 3G6WA 4JXJA 3GB7B 1G6Q1 2WHRA 1JIUA 3X1FA 3M17A 3ZUCA 4ZU3A 2DKSA 1JTVA 1I2AA 3QXSA 4KSBA 1RSYA 3SMVA 1EFUA 1H15A 4P4KC 4JI3B 3MW8A 1WCWA 3QDJB 4LEEA 1UKBA 2IGFL 3T3PF 1EXGA 2EX0A 2OXIA 5GGTA 1WYJA 1QYWA 3MSXA 2BSTB 1V41E 1QPXA 3LVFO 1JQ3A 1EP1B 4EUFA 3CZGA 5M94B 3JYNA 3FTYA 1K4MA 5LIPA 3H0CA 1FGNL 3N40F 2DBZA 3FNKA 1C30A 2FWSA 3PT9A 1RPNA 4GKBA 4YJ2F 4RA6A 4K88A 4Q21A 4UFPA 1MIOB 5IJVA 2QRPA 3QG6B 3C8HA 4EF5A 1NMCC 2ZFUA 3QI9B 2GJPA 4IVPA 3S2CA 4EX7A 2BBOA 1JVNA 4H40A 3FYEB 1NY6A 3JD0A 3U7YH 1LK2A 4H7HA 4LKCA 4Q37A 3WMSA 1ULTA 3UH1A 3V0VA 4DO4A 4PP2B 1FZKB 1UWXH 1OXKB 3ECCA 3EEBA 7PCYA 1RUKL 1T1XA 1G9MC 3HN3A 4D5GA 3V7YA 2NO9A 2BFEA 1AKMA 4KRYA 2G25A 2Z1PA 1WB9A 1DJMA 1GL7A 1ZC4A 3UENA 4XPGH 1NBOA 4Y5YB 1VPTA 3E2PA 1ZKDA 4NZTL 2NX2A 4JKYA 2VATA 4ZS7H 4ZVQA 5GV8A 3GAFA 4F4CA 4N1CA 1AZLA 2J45A 5LGHH 3P97A 5CNHA 5CIWA 5TQJA 2C3OA 4L8FA 3DWTA 1N78A 5H5JA 4XIGS 3V5DA 1RZFH 4RDIA 2BEWA 2P9GA 4W7HA 3RIGA 4MS4B 3IU3A 3L1OH 5CVCA 1QIGA 3U83A 5JH7B 1H6DA 4TSFD 1PF3A 4B3HA 1UMCA 2A4EA 3BDYL 4D25A 5ED4A 2NT4A 4XJXA 3KAKA 2VBIA 1N0VC 4IQHA 2AFIB 1KN2L 3DP7A 4FF9A 2DWEA 5IX8A 3C39A 2I9LA 1XF4A 1D7CA 3DVIA 3C8UA 4NRDA 3KNZA 1RK0A 1UFUA 1N10A 3QUHA 2P6NA 4PB0L 4E9WA 4H7EA 4RA9B 5AUPB 3V4PL 3GL9A 3SAJA 4XZ4A 1ONQA 4G43B 4ZMBA 4D9RE 3I34X 5BRZD 4JBGA 2NT3A 4BHTA 3ZZQA 5I1CH 4ZV9A 2I3ZA 1GXSA 2EH8H 4OBXA 5KN5B 3LVTA 5SWQA 4WWKD 3D39E 4EEEA 4UAUA 3F7QA 4JDEB 2BNUB 2GBIA 1JHZA 1V95A 5ER6A 5FBVB 5CLLA 3N0RA 3PDOB 2XLLA 4HK3J 1T7ZA 2A4CA 1YI1A 4L08A 2WI8A 3QQ9D 2PXHA 3T0EA 4HFMA 2P5EB 4ZX4A 3RYHB 2BVYA 2YEQA 5E1QA 2AOWA 2PZKA 1R2QA 5LOVF 5ALJA 1C9EA 3RPIA 4H1LB 4NM4H 1A4CA 2Q20A 5F9OL 1MO6A 5CZXC 3U36B 1QRAA 2OMBA 4Z9FA 3D39B 5DBIA 5KCZA 4BH8A 1DBRA 4ZRGA 3MRHB 1ZZEA 2AXQA 4IHAA 4NG4A 1E2BA 3PRYA 4Y19A 1DJLA 1N2BA 2C97A 2ECPA 4I8DA 3BS4A 1XYGA 5JYMA 5A4FS 4FUTA 4DETA 4NQRA 1XCQA 4ALKA 3ZNNA 3TZKA 1XKQA 3LAWA 4MVJA 1JJBA 1Q0LA 4R1OA 4B9GA 1A8QA 3HE6B 5DI3A 3PEWA 1JRHL 2WM9B 3UL4A 1VFPA 1NUAA 2OWDA 1Y3IA 3ZMEA 4UAOC 2DOKA 5GRJH 1OWRM 3V8BA 4ZDWA 2PKEA 3ES6B 2UZ3A 3CF2A 3PGDA 1ZOSA 2FPIB 3O0RH 2IYTA 1N2IA 1D8TA 2E27L 3EJRA 1FPMA 1WQ1R 3NXSA 1MKFA 5AKJA 5F97E 1YDWA 3CN0A 3BJZA 1TU4A 2ZT8A 3VD7A 1YFLA 5HVGB 4DLNA 5DMIH 3T41A 1IBHA 4PJBF 1Z9MA 3MINA 4AGQA 5FYLL 1PT5A 2X1OA 1JEQA 2ZT7A 3A2MA 4G0UA 4JM4H 2HMUA 2J56A 1UZUA 2O3RA 1G21B 5ENWA 2B9BA 4OQMA 5KNBH 3TURA 5CLJA 4HJSA 2ATPA 5FECA 1GPLA 4A15A 1U1IA 4UOEA 2YEZB 4DZZA 2A2ZA 1HL4A 1A8IA 4Z76A 1G1YA 1KEWA 4NCDA 3WMQA 2VJOA 4ND2A 4QTIH 3HM9A 3GBVA 2A83A 3J7AC 2XMDA 4MRCA 5BYBA 4FMBB 2AJVH 2CKMA 3IAM1 4JFEA 1GGYA 1B2LA 2Y3IA 1MFDL 3FH7A 1KZQA 2O6HA 4PRPB 2FSEB 2HPHA 3FTGA 1IUPA 4MP8A 1ZM4A 2J32A 2FH8A 2F0CA 2X6VA 3WS7A 5JXJA 1QNIA 3AWFA 1YR7A 4UINL 2OSBA 4GKVA 2C0PA 1GZ4A 4R3UC 2V96A 4PLZA 1U2ZA 4LEIA 3TBFA 2YD6A 5IK2A 3NSDA 2CDGA 3ZE0B 4YJDA 3EJTA 3HG2A 4DPMA 5C9ZA 1W0CA 4GKKB 3EQZA 1HQRB 2ZIDA 1JI3A 5IVXE 2HJWA 1G19A 2OMYA 1UWLA 2ATVA 3UHAA 1FP4B 3RX5A 4AT6A 5FPQA 4BCXA 1K92A 2X1PA 3C4QA 1WMEA 1G42A 1P3JA 1QTIA 4N86A 3T3ME 5IWLC 3VYTB 1U7ZA 4Q7KA 1PIFA 5IHPA 1F6BA 1S8DB 2HRCA 2ESRA 3DL4A 4IJ5A 4C06A 2NY4D 1H2WA 1X2EA 2QELA 3OPYB 3ARGA 3RTQD 1DJZA 1Q7EA 2X9YA 1CL7L 4B6RA 3KOYA 4JEUA 4LE8A 1R0BA 3PD7A 3MRKA 4JGBA 2O52A 1YPZA 4KMLB 4YAIA 4JQYA 3FQ1A 1E9OA 3U0TA 3FJTA 2PYDA 4ZK6A 1R3HB 3OFVA 2Z34A 1H0DA 4UQDA 3WWPA 2B59B 3DWIA 5LNGA 3BJMA 3J81k 1K8IB 3UAAA 4ERXA 1PQZB 4EPRA 4DN6A 5IHZB 4O4JA 1L6PA 1WAPA 1MQ8B 3K9GA 5FBKA 2WO4A 4QPEA 3OCJA 2JW5A 1BXGB 1RAIA 4N0RA 5GGRA 1DBVO 5BUZA 5E7JA 1OWMA 2QLTA 4UFNA 3SN6A 3FMGA 1ZLEA 3G5YB 4WO4A 121PA 4AO8A 1S78D 3P11H 2EVGA 3TTTA 1AP2B 2WXMA 1IAOB 1VLLA 4W8OA 3O9MA 5JPDA 1UXWB 4CNIB 1AZZC 4KX8A 1HN1A 2AZAA 4GKNA 5E8EA 3T4AB 3DFZA 4U2ZA 1TLTA 1ZRHA 4UXIA 1XIWD 4UNPA 4XVJH 3TEXA 3DZKA 3P19A 5AOAA 2BS71 4ONOA 1GA4A 4K2AA 3DWGA 1J0AA 4C6TA 2ISQA 4H59A 1Z5OA 4RDQG 4YHPB 2QMUA 5FL3A 3UWDA 2CHDA 2QKIC 4KKNA 4FEIA 1ZU5A 3RFXA 1I1YB 4P5TC 4KQGA 4M9ZA 2BMAA 3RF6A 1RBYA 1L1EA 5DP2A 3MGKA 1RKXA 3QPQD 3ROEA 1J8KA 1XEWX 2O30A 3KL5A 4JQVA 3P32A 3Q6NA 4IIJF 5KSAD 4B53A 3Q9LA 1XBTA 4RGND 4HZIA 1WICA 3AL0C 4DY6A 4NBKA 4F46A 1EDZA 4QBFA 2FYYA 1RL1A 2NNLD 2VBFA 1NVXQ 5KTYA 5F7EL 4ILKA 2GKOA 2J9ZB 3FO9B 2W8CA 1EFPA 2ZJ4A 1BJMA 4UILH 2EF0A 4DPCX 1RLUA 4HH9B 3CZKA 4FWTA 3ENZA 4C4OA 4GXTA 4QF1A 5GZNA 1D6VH 5DLQC 2ZYHA 5AUNB 2A1UB 1C9KA 2ZR7A 4P0DA 2ICEC 1LEGB 4YBZA 4MI9A 3S8EA 5J3JA 3GSOB 4QIRA 2DKNA 1TCUA 3GW8A 4W81A 1UBSB 1OCRB 1EEZA 3V55A 2DWXA 4DLSA 4U1IA 2Q27A 4GM1A 1AV6A 4LF5B 1I7TB 4BL5A 2JJUA 5HP5A 2OBYA 2PFGA 1J0DA 4JR1A 1NVVR 5FOQA 4BH7A 2E5FA 3WC4A 3L7LA 3X1JA 3HYLA 4KL8S 1LX6A 2ZVQX 2ZVPX 3SJBA 4P2QE 4UZGA 1SG6A 3H5WA 1JNNL 2ZXCA 5D71L 4EYOA 1XVTA 5K3SA 3C98A 4FEMA 5ALGA 1JHRA 1KIQB 3I6BA 4DDUA 1MW3A 3HCVA 2F3UA 2Q4BA 3ITEA 1U11A 2RGNC 3K5PA 4YZFF 4KWTA 2ZCHH 1MAUA 4A4DA 5JANA 5F72S 4P84A 2XF2A 2VTFA 1DP0A 1ZS2A 4B96A 2XVAA 4UTPA 4KIUA 2F5AL 3I30X 4KDWA 1WC7B 4XPFL 4BOYA 4AEIH 4BNFA 2C3MA 3LW8A 3NSYA 2C3PA 4XOBA 4FKHA 4KK8C 2YCLA 2VSMB 4XXDA 2B0JA 5A71A 2K4AA 1JCVA 5ESAA 4I1UA 2P5EE 1XO1A 4WTQA 5IFJB 3R3XA 3K2UL 1SBZA 4KFUA 5C9JA