3NIFA

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 113
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nifA00
2VDRA 3NIFA 2VDKA 3NIGA 3T3MA 3VI4A 4MMXA 3V4PA 3ZDYA 4Z7QA 2VDLA 4O02A 1L5GA 5FFGA 4MMZA 4IRZA 3T3PA 4MMYA 3ZE1A 3ZE0A 5FFOA 4Z7OA 4UM8A 1TYEA 5E6RA 3VI3A 3ZDXA 3NIDA 1JV2A 3K71A 3K72A 3IJEA 4WJKA 5HDBA 4G1MA 3V4VA 4NENA 4WK0A 3FCUA 3ZE2A 5E6SA 2VDNA 1M1XA 4UM9A 2VDQA 4WK2A 2VDOA 1U8CA 2VC2A 2VDPA 3FCSA 3ZDZA 2VDMA 4WK4A 4Z7NA 4G1EA 3K6SA 5E6UA
chains in the Genus database with same CATH superfamily
3NIGA 4GM9A 4PXWA 5EAMA 1L5GA 4GM3A 5FFGA 4FAVD 1E5TA 4E5ZB 2Z2PA 3IURA 2OIZA 2AH0A 4NBMA 3ZDXA 4GMBA 4BCDA 2P9LC 2PM9B 3FCUA 1O6GA 1UOQA 2I3TA 5E6SA 3L4MD 5M5UA 3RMZD 5EMJB 4JD2C 3I7NA 5B4WA 3GD1I 4IMMA 3ZDZA 1NEXB 2VDMA 5M5VA 1R5MA 5CYKA 3EI1A 5FKSA 5IC7A 4J73A 5AFU3 1SQJA 4PC0A 1VYHC 4J0XA 4J0WA 2VDLA 4XYHA 3MKQA 2UZYB 5M5SA 4IA9A 5EMKB 4D9SA 5EMMB 3JB9L 4GQBB 5M5RA 2VZ3A 3EQ9A 3JZHA 4L1MA 4AMZA 4NSXA 4A0BA 3RSEC 2XE4A 3AFCA 5FXYA 3KRWB 4U1EI 2HU8A 3NIFA 2VDKA 4GQ1A 3PXTD 1C9LA 4MMXA 2H14A 4ESGA 3DSMA 2OJYA 4CI3A 2EICA 1SHYB 4A11A 3U4YA 4X61B 4DNVA 2H68A 3KCIA 3VH0A 4RE6A 3EI4A 1N6FA 2YB8B 4GQ2P 4CY5A 1GOHA 4WJKA 1VE6A 3I8CA 1QFSA 3JPXA 4DNUA 3DM0A 4AEZA 4CY2A 4HDJA 4LGNA 5CXCB 5EAPA 2UZXB 3O4IA 4Y5RD 4A0AB 1H2XA 5EM2B 3C75H 2CE9A 3SLED 3VI4A 3PXWD 2H9LA 4D0KA 3SVWD 5H17A 3SBRA 4O02A 4X63B 5GMKn 1SQ9A 5GSAA 1OLZA 2H47A 3EG6A 3OKYA 5GXHA 2AGXA 2OK4A 2I3SA 3AL8A 3DXMC 3FM0A 2AGLA 2H9PA 3NIDA 1JTDB 1JMXB 3K71A 3EI2B 1MG3A 1UOOA 2MTAH 4G1MA 2CNXA 4CI2A 3MMYA 3MXXA 2P9SC 2J55H 4ERZA 3IUQA 3IJ0A 4H5IA 1XHMA 1U4CA 3DXKC 4A2MA 3ZWLB 1JMZB 1VZ2A 3PVWB 4AOWA 4BCBA 3ZDYA 3EQ7A 4Z7QA 4A08A 3EI3B 2G99A 1NR0A 5SXMA 4FA9D 2GNQA 2XL2A 1JJUB 2GC4A 4AN0A 4KFMB 3J81g 4XYIA 1K32A 3IUJA 4J81A 3IUMA 3K27A 3RLMD 5C9ZB 3I7LA 2EBSA 2PM6B 3AH8B 4J8GA 4WK2A 4E54B 3IUNA 1PBYB 2AH1A 3F3PA 4Z7NA 3V7DB 3UVOA 3I7KA 3NVQA 3UVLA 4MK0B 4OWRA 2IUPA 5IGOA 5TEEA 5JWZA 2I0RA 2WQ8A 1FWXA 1GOGA 3T3PA 4AN1A 4BH6A 3O4JA 2BCJB 3RN1D 2QXVA 2Z2NA 5THAA 3SBQA 3UVMA 2VZ1A 4N14A 5FLXg 2YNPA 3FGBA 1BPOA 3I2NA 4D6VA 5HE3B 5C2WB 2PM7B 4CZXA 3SWSD 1K8KC 1S4UX 3BG0A 2H13A 4WK4A 1GP2B 2HU5A 3MVDK 4JXMA 2OVPB 4J86A 2IAAA 5CYKB 3NVXA 3EI1B 3OF7A 5KDOB 3IJ1A 3EWEA 4Z8LA 3ZE0A 3CFVA 3SCYA 2H6QA 4ES0A 5I5JA 2HYEA 1QNIA 2XU7A 3PSLA 2XYIA 4NC4A 5EARA 1N6DA 3GFCA 4J77A 2VDNA 4CC9A 1PGUA 2B5NA 4PSWB 2OVRB 4A09A 2P9KC 4CI1A 4BL0A 4QL1A 4RE5A 4A0BB 4GGAA 3IJCA 1C9IA 4L9OA 1Q47A 4L3HD 1YFQA 4LG8A 5EMLB 1MG2A 4QQEA 4IRZA 4MMYA 4JHNA 3AL9A 3JZNA 5FFOA 4Z7OA 5I5IA 2CN2A 4QRJA 2BBKH 4A11B 3IJEA 3P4FA 4AMYA 3EI4B 2P9PC 3C5MA 3IIYA 2H6KA 3UVNA 4YVDA 2B4EA 2I0SA 2HXCA 5FQDA 3JZGA 3KRXB 2H9MA 4J84A 4NAAA 4BUJC 2CO0A 4FWWA 5C92A 2W18A 4DNWA 1QFMA 3DDUA 5A2Qg 4J8BA 3SN6B 2XL3A 3I7OA 2AGWA 4U7AA 1U2VC 5M5TA 2YNNA 4ERYA 3OKYB 3BWSA 2QC5A 3V4VA 3AL8B 4O1QD 4GZ8A 4JSNC 2EIBA 3DWLC 3C99A 3FCSA 3SJLD 3IIWA 3QI0A 2IURA 3ORVD 2OK6A 2YNOA 3FRXA 3MUOA 1K3IA 1OMWB 3K26A 3V4PA 5CXBA 5TDHB 3V5WB 2G9AA 4FAND 1GOTB 5M61A 4CI8A 4G56B 4G55A 1VZ3A 5EALA 4UM8A 3JRPA 4CZVA 3OW8A 5K1CC 4A08B 4LG9A 2YMUA 3K72A 3ULEC 2H9NA 2CO0C 2HKRA 4I79A 4JSXC 1PEVA 4JT5C 3PVUB 5IGQA 1A12A 3OKWA 2HJ4A 1A0RB 2O9KA 4L3GD 3MZLA 4K3JB 1P22A 2GC7A 4GGDA 1GXRA 3W15A 3MKSB 4PNKB 4MMZA 1L0QA 3VA6A 2P9IC 3IVMA 2AGYA 3O4HA 1XIPA 1E8NA 4BP8A 5C86A 1O6FA 1TYQC 3OL2A 4JHPC 3N0EA 4NENA 3JAMg 3ZE2A 3HFQA 4PBYA 3PE7A 4ZOVA 3RFHA 4J79A 4JSVC 4UI9R 3J80g 4E5ZA 2H3XA 1GOFA 4JSPC 5IJ7E 4ERQA 4AX4A 5GXIA 3F3FA 4H5JA 2PM9A 3MUNA 1I2MB 2JKXA 2BKLA 3I8EA 4O3TB 5C2VB 2I0TA 4A09B 2HU7A 3GC3B 5FKQA 3I7HA 2B5MA 1RI6A 5HE1B 1GG2B 1XKSA 1B9YA 2HJBA 3CFSB 1B9XA 5TEFA 1TBGA 5TF2A 1UOPA 4ZOZA 2YBAA 5H1MA 1TYEA 5H14A 4O9DA 5E6RA 2CE8A 3EQ8A 2IUVA 3N0DA 1VE7A 2QR5A 4XEIC 4J78A 2VDQA 4CY1A 3UR4A 4FA4D 2VDPA 2VC2A 2OVQB 1H2YA 1E8MA 4FHLA 5K19A 2VDRA 3V9FA 4L1QD 1H2WA 4OZUA 3O4GA 3RN0D 3L4OD 3UKRC 5AMSA 2IWKA 4CZYA 4GM8A 3RFGA 2QZPA 4O3UB 2J57G 3ODTA 3JROA 5AJAA 4X60B 2B5LA 3EU7A 4R7AB 2CN3A 4A2LA 5CXCA 4WK0A 2IWFA 5IT9g 4O45A 4A0AA 4ZOYA 3PXSD 3PSCB 2IUQA 5EM2A 2VDOA 2HESX 4G1EA 4QAMA 1YR2A 3GREA 4O2WA 5E6UA 3I7PA 4A7JA 5FKTA 4EWRA 1PI6A 3CIKB 1H2ZA 4Y7RA 5HYNB 5HE2B 2PBIB 3A0FA 4CY3A 5CXBB 3IKOA 2EIDA 4X3EA 5HQGA 3SXTD 1UTCA 3EI2A 3EMHA 2H6NA 3MZKA 4J87A 3UVKA 3VI3A 1JV2A 3NVNA 2XDWA 5HDBA 2AGZA 4TZ4A 3OKTA 4UM9A 1M1XA 3SFZA 4QT8A 2TRCB 2EIEA 3F3GA 4ZN4A 3B7FA 1U8CA 1JOFA 4PSXB 3SHFA 3E0CA 3I89A 5FKRA 4PBZA 3K6SA 3IULA 2P9NC 3BG1A 3T3MA 3EI3A 2P9UC 5FA5B 3VGZA 5I5MA 5IJ8E 3ZE1A 1T2XA 4FA5D 1ERJA 2Z2OA 1N6EA 2AQ5A 4ZOXA 2HKMA 3RRMC 5HE0B 4BCCA 4E54A 2Q7QA 3QHYB 4J82A 4FB1D 4K3ID 3OL2B 3C9CA 3SBPA 3UKUC 4GGCA 4FA1D 4BP9A 3SMRA 2XZGA 2J56H 1MDAH 4JT6C 3OTTA
chains in the Genus database with same CATH topology
2VDRA 3NIFA 2VDKA 3NIGA 3T3MA 3VI4A 4MMXA 3V4PA 3ZDYA 4Z7QA 2VDLA 4O02A 1L5GA 5FFGA 4MMZA 4IRZA 3T3PA 4MMYA 3ZE1A 3ZE0A 5FFOA 4Z7OA 4UM8A 1TYEA 5E6RA 3VI3A 3ZDXA 3NIDA 1JV2A 3K71A 3K72A 3IJEA 4WJKA 5HDBA 4G1MA 3V4VA 4NENA 4WK0A 3FCUA 3ZE2A 5E6SA 2VDNA 1M1XA 4UM9A 2VDQA 4WK2A 2VDOA 1U8CA 2VC2A 2VDPA 3FCSA 3ZDZA 2VDMA 4WK4A 4Z7NA 4G1EA 3K6SA 5E6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDR A;  3NIF A;  2VDK A;  3NIG A;  3T3M A;  3VI4 A;  4MMX A;  3V4P A;  3ZDY A;  4Z7Q A;  2VDL A;  4O02 A;  1L5G A;  5FFG A;  4MMZ A;  4IRZ A;  3T3P A;  4MMY A;  3ZE1 A;  3ZE0 A;  5FFO A;  4Z7O A;  4UM8 A;  1TYE A;  5E6R A;  3VI3 A;  3ZDX A;  3NID A;  1JV2 A;  3K71 A;  3K72 A;  3IJE A;  4WJK A;  5HDB A;  4G1M A;  3V4V A;  4NEN A;  4WK0 A;  3FCU A;  3ZE2 A;  5E6S A;  2VDN A;  1M1X A;  4UM9 A;  2VDQ A;  4WK2 A;  2VDO A;  1U8C A;  2VC2 A;  2VDP A;  3FCS A;  3ZDZ A;  2VDM A;  4WK4 A;  4Z7N A;  4G1E A;  3K6S A;  5E6U A; 
#chains in the Genus database with same CATH topology
 3NIG A;  4GM9 A;  4PXW A;  5EAM A;  1L5G A;  4GM3 A;  5FFG A;  4FAV D;  1E5T A;  4E5Z B;  2Z2P A;  3IUR A;  2OIZ A;  2AH0 A;  4NBM A;  3ZDX A;  4GMB A;  4BCD A;  2P9L C;  2PM9 B;  3FCU A;  1O6G A;  1UOQ A;  2I3T A;  5E6S A;  3L4M D;  5M5U A;  3RMZ D;  5EMJ B;  4JD2 C;  3I7N A;  5B4W A;  3GD1 I;  4IMM A;  3ZDZ A;  1NEX B;  2VDM A;  5M5V A;  1R5M A;  5CYK A;  3EI1 A;  5FKS A;  5IC7 A;  4J73 A;  5AFU 3;  1SQJ A;  4PC0 A;  1VYH C;  4J0X A;  4J0W A;  2VDL A;  4XYH A;  3MKQ A;  2UZY B;  5M5S A;  4IA9 A;  5EMK B;  4D9S A;  5EMM B;  3JB9 L;  4GQB B;  5M5R A;  2VZ3 A;  3EQ9 A;  3JZH A;  4L1M A;  4AMZ A;  4NSX A;  4A0B A;  3RSE C;  2XE4 A;  3AFC A;  5FXY A;  3KRW B;  4U1E I;  2HU8 A;  3NIF A;  2VDK A;  4GQ1 A;  3PXT D;  1C9L A;  4MMX A;  2H14 A;  4ESG A;  3DSM A;  2OJY A;  4CI3 A;  2EIC A;  1SHY B;  4A11 A;  3U4Y A;  4X61 B;  4DNV A;  2H68 A;  3KCI A;  3VH0 A;  4RE6 A;  3EI4 A;  1N6F A;  2YB8 B;  4GQ2 P;  4CY5 A;  1GOH A;  4WJK A;  1VE6 A;  3I8C A;  1QFS A;  3JPX A;  4DNU A;  3DM0 A;  4AEZ A;  4CY2 A;  4HDJ A;  4LGN A;  5CXC B;  5EAP A;  2UZX B;  3O4I A;  4Y5R D;  4A0A B;  1H2X A;  5EM2 B;  3C75 H;  2CE9 A;  3SLE D;  3VI4 A;  3PXW D;  2H9L A;  4D0K A;  3SVW D;  5H17 A;  3SBR A;  4O02 A;  4X63 B;  5GMK n;  1SQ9 A;  5GSA A;  1OLZ A;  2H47 A;  3EG6 A;  3OKY A;  5GXH A;  2AGX A;  2OK4 A;  2I3S A;  3AL8 A;  3DXM C;  3FM0 A;  2AGL A;  2H9P A;  3NID A;  1JTD B;  1JMX B;  3K71 A;  3EI2 B;  1MG3 A;  1UOO A;  2MTA H;  4G1M A;  2CNX A;  4CI2 A;  3MMY A;  3MXX A;  2P9S C;  2J55 H;  4ERZ A;  3IUQ A;  3IJ0 A;  4H5I A;  1XHM A;  1U4C A;  3DXK C;  4A2M A;  3ZWL B;  1JMZ B;  1VZ2 A;  3PVW B;  4AOW A;  4BCB A;  3ZDY A;  3EQ7 A;  4Z7Q A;  4A08 A;  3EI3 B;  2G99 A;  1NR0 A;  5SXM A;  4FA9 D;  2GNQ A;  2XL2 A;  1JJU B;  2GC4 A;  4AN0 A;  4KFM B;  3J81 g;  4XYI A;  1K32 A;  3IUJ A;  4J81 A;  3IUM A;  3K27 A;  3RLM D;  5C9Z B;  3I7L A;  2EBS A;  2PM6 B;  3AH8 B;  4J8G A;  4WK2 A;  4E54 B;  3IUN A;  1PBY B;  2AH1 A;  3F3P A;  4Z7N A;  3V7D B;  3UVO A;  3I7K A;  3NVQ A;  3UVL A;  4MK0 B;  4OWR A;  2IUP A;  5IGO A;  5TEE A;  5JWZ A;  2I0R A;  2WQ8 A;  1FWX A;  1GOG A;  3T3P A;  4AN1 A;  4BH6 A;  3O4J A;  2BCJ B;  3RN1 D;  2QXV A;  2Z2N A;  5THA A;  3SBQ A;  3UVM A;  2VZ1 A;  4N14 A;  5FLX g;  2YNP A;  3FGB A;  1BPO A;  3I2N A;  4D6V A;  5HE3 B;  5C2W B;  2PM7 B;  4CZX A;  3SWS D;  1K8K C;  1S4U X;  3BG0 A;  2H13 A;  4WK4 A;  1GP2 B;  2HU5 A;  3MVD K;  4JXM A;  2OVP B;  4J86 A;  2IAA A;  5CYK B;  3NVX A;  3EI1 B;  3OF7 A;  5KDO B;  3IJ1 A;  3EWE A;  4Z8L A;  3ZE0 A;  3CFV A;  3SCY A;  2H6Q A;  4ES0 A;  5I5J A;  2HYE A;  1QNI A;  2XU7 A;  3PSL A;  2XYI A;  4NC4 A;  5EAR A;  1N6D A;  3GFC A;  4J77 A;  2VDN A;  4CC9 A;  1PGU A;  2B5N A;  4PSW B;  2OVR B;  4A09 A;  2P9K C;  4CI1 A;  4BL0 A;  4QL1 A;  4RE5 A;  4A0B B;  4GGA A;  3IJC A;  1C9I A;  4L9O A;  1Q47 A;  4L3H D;  1YFQ A;  4LG8 A;  5EML B;  1MG2 A;  4QQE A;  4IRZ A;  4MMY A;  4JHN A;  3AL9 A;  3JZN A;  5FFO A;  4Z7O A;  5I5I A;  2CN2 A;  4QRJ A;  2BBK H;  4A11 B;  3IJE A;  3P4F A;  4AMY A;  3EI4 B;  2P9P C;  3C5M A;  3IIY A;  2H6K A;  3UVN A;  4YVD A;  2B4E A;  2I0S A;  2HXC A;  5FQD A;  3JZG A;  3KRX B;  2H9M A;  4J84 A;  4NAA A;  4BUJ C;  2CO0 A;  4FWW A;  5C92 A;  2W18 A;  4DNW A;  1QFM A;  3DDU A;  5A2Q g;  4J8B A;  3SN6 B;  2XL3 A;  3I7O A;  2AGW A;  4U7A A;  1U2V C;  5M5T A;  2YNN A;  4ERY A;  3OKY B;  3BWS A;  2QC5 A;  3V4V A;  3AL8 B;  4O1Q D;  4GZ8 A;  4JSN C;  2EIB A;  3DWL C;  3C99 A;  3FCS A;  3SJL D;  3IIW A;  3QI0 A;  2IUR A;  3ORV D;  2OK6 A;  2YNO A;  3FRX A;  3MUO A;  1K3I A;  1OMW B;  3K26 A;  3V4P A;  5CXB A;  5TDH B;  3V5W B;  2G9A A;  4FAN D;  1GOT B;  5M61 A;  4CI8 A;  4G56 B;  4G55 A;  1VZ3 A;  5EAL A;  4UM8 A;  3JRP A;  4CZV A;  3OW8 A;  5K1C C;  4A08 B;  4LG9 A;  2YMU A;  3K72 A;  3ULE C;  2H9N A;  2CO0 C;  2HKR A;  4I79 A;  4JSX C;  1PEV A;  4JT5 C;  3PVU B;  5IGQ A;  1A12 A;  3OKW A;  2HJ4 A;  1A0R B;  2O9K A;  4L3G D;  3MZL A;  4K3J B;  1P22 A;  2GC7 A;  4GGD A;  1GXR A;  3W15 A;  3MKS B;  4PNK B;  4MMZ A;  1L0Q A;  3VA6 A;  2P9I C;  3IVM A;  2AGY A;  3O4H A;  1XIP A;  1E8N A;  4BP8 A;  5C86 A;  1O6F A;  1TYQ C;  3OL2 A;  4JHP C;  3N0E A;  4NEN A;  3JAM g;  3ZE2 A;  3HFQ A;  4PBY A;  3PE7 A;  4ZOV A;  3RFH A;  4J79 A;  4JSV C;  4UI9 R;  3J80 g;  4E5Z A;  2H3X A;  1GOF A;  4JSP C;  5IJ7 E;  4ERQ A;  4AX4 A;  5GXI A;  3F3F A;  4H5J A;  2PM9 A;  3MUN A;  1I2M B;  2JKX A;  2BKL A;  3I8E A;  4O3T B;  5C2V B;  2I0T A;  4A09 B;  2HU7 A;  3GC3 B;  5FKQ A;  3I7H A;  2B5M A;  1RI6 A;  5HE1 B;  1GG2 B;  1XKS A;  1B9Y A;  2HJB A;  3CFS B;  1B9X A;  5TEF A;  1TBG A;  5TF2 A;  1UOP A;  4ZOZ A;  2YBA A;  5H1M A;  1TYE A;  5H14 A;  4O9D A;  5E6R A;  2CE8 A;  3EQ8 A;  2IUV A;  3N0D A;  1VE7 A;  2QR5 A;  4XEI C;  4J78 A;  2VDQ A;  4CY1 A;  3UR4 A;  4FA4 D;  2VDP A;  2VC2 A;  2OVQ B;  1H2Y A;  1E8M A;  4FHL A;  5K19 A;  2VDR A;  3V9F A;  4L1Q D;  1H2W A;  4OZU A;  3O4G A;  3RN0 D;  3L4O D;  3UKR C;  5AMS A;  2IWK A;  4CZY A;  4GM8 A;  3RFG A;  2QZP A;  4O3U B;  2J57 G;  3ODT A;  3JRO A;  5AJA A;  4X60 B;  2B5L A;  3EU7 A;  4R7A B;  2CN3 A;  4A2L A;  5CXC A;  4WK0 A;  2IWF A;  5IT9 g;  4O45 A;  4A0A A;  4ZOY A;  3PXS D;  3PSC B;  2IUQ A;  5EM2 A;  2VDO A;  2HES X;  4G1E A;  4QAM A;  1YR2 A;  3GRE A;  4O2W A;  5E6U A;  3I7P A;  4A7J A;  5FKT A;  4EWR A;  1PI6 A;  3CIK B;  1H2Z A;  4Y7R A;  5HYN B;  5HE2 B;  2PBI B;  3A0F A;  4CY3 A;  5CXB B;  3IKO A;  2EID A;  4X3E A;  5HQG A;  3SXT D;  1UTC A;  3EI2 A;  3EMH A;  2H6N A;  3MZK A;  4J87 A;  3UVK A;  3VI3 A;  1JV2 A;  3NVN A;  2XDW A;  5HDB A;  2AGZ A;  4TZ4 A;  3OKT A;  4UM9 A;  1M1X A;  3SFZ A;  4QT8 A;  2TRC B;  2EIE A;  3F3G A;  4ZN4 A;  3B7F A;  1U8C A;  1JOF A;  4PSX B;  3SHF A;  3E0C A;  3I89 A;  5FKR A;  4PBZ A;  3K6S A;  3IUL A;  2P9N C;  3BG1 A;  3T3M A;  3EI3 A;  2P9U C;  5FA5 B;  3VGZ A;  5I5M A;  5IJ8 E;  3ZE1 A;  1T2X A;  4FA5 D;  1ERJ A;  2Z2O A;  1N6E A;  2AQ5 A;  4ZOX A;  2HKM A;  3RRM C;  5HE0 B;  4BCC A;  4E54 A;  2Q7Q A;  3QHY B;  4J82 A;  4FB1 D;  4K3I D;  3OL2 B;  3C9C A;  3SBP A;  3UKU C;  4GGC A;  4FA1 D;  4BP9 A;  3SMR A;  2XZG A;  2J56 H;  1MDA H;  4JT6 C;  3OTT A; 
#chains in the Genus database with same CATH homology
 2VDR A;  3NIF A;  2VDK A;  3NIG A;  3T3M A;  3VI4 A;  4MMX A;  3V4P A;  3ZDY A;  4Z7Q A;  2VDL A;  4O02 A;  1L5G A;  5FFG A;  4MMZ A;  4IRZ A;  3T3P A;  4MMY A;  3ZE1 A;  3ZE0 A;  5FFO A;  4Z7O A;  4UM8 A;  1TYE A;  5E6R A;  3VI3 A;  3ZDX A;  3NID A;  1JV2 A;  3K71 A;  3K72 A;  3IJE A;  4WJK A;  5HDB A;  4G1M A;  3V4V A;  4NEN A;  4WK0 A;  3FCU A;  3ZE2 A;  5E6S A;  2VDN A;  1M1X A;  4UM9 A;  2VDQ A;  4WK2 A;  2VDO A;  1U8C A;  2VC2 A;  2VDP A;  3FCS A;  3ZDZ A;  2VDM A;  4WK4 A;  4Z7N A;  4G1E A;  3K6S A;  5E6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...