3NIGA

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 112
structure length 457
sequence length 457
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nigA00
3T3MA 3VI3A 5E6RA 3FCSA 3ZDXA 4Z7NA 3K71A 4WJKA 4Z7OA 3K6SA 1M1XA 5FFOA 3T3PA 3ZE0A 4Z7QA 4MMZA 1JV2A 3V4VA 2VDRA 3VI4A 2VDNA 1U8CA 1TYEA 5E6UA 1L5GA 4WK2A 4WK0A 3K72A 3NIFA 3ZDZA 2VDMA 4O02A 5E6SA 3ZE2A 2VDQA 5FFGA 4IRZA 4MMYA 2VDKA 4MMXA 4UM8A 3ZDYA 4UM9A 3V4PA 4G1MA 2VC2A 3NIDA 5HDBA 2VDOA 2VDLA 4G1EA 3IJEA 2VDPA 4WK4A 3ZE1A 3FCUA 4NENA 3NIGA
chains in the Genus database with same CATH superfamily
4AOWA 1JJUB 1U4CA 4PBZA 2H9LA 3AL8B 4GQ2P 1C9LA 4MMZA 3N0DA 2PM9B 4ERYA 1TYEA 4ES0A 1PI6A 4MK0B 4A08A 4NSXA 2CN2A 2I0RA 5M5SA 1JTDB 3K72A 3SFZA 3UVLA 5CYKA 4A09B 3L4OD 2XU7A 4E5ZB 3C99A 3V9FA 2I3SA 5M5VA 2AGLA 4FA1D 4ERZA 4FA5D 1I2MB 3ZWLB 3NIGA 5I5MA 3FM0A 3MZLA 3VI3A 3EQ7A 4QAMA 3ZDXA 5AFU3 3E0CA 4JXMA 3EMHA 5CXBB 3I7KA 2JKXA 4GZ8A 4UI9R 3EI1B 3C5MA 4A7JA 2XE4A 4A11A 1E5TA 2YNOA 4ESGA 4CI2A 3IJCA 1E8MA 1SHYB 3AFCA 4J84A 4J81A 2QZPA 2OVPB 3HFQA 3MZKA 1A0RB 4X63B 3IJ0A 5IC7A 2IUQA 3BWSA 3OKTA 4Z7NA 3KRWB 5GXIA 4Z7QA 2H3XA 1GOGA 5IJ8E 2IAAA 4BH6A 4X61B 2XYIA 3I7OA 4G56B 4JT5C 2P9LC 5EM2B 3PXTD 3EI3B 3JROA 4L9OA 3DXKC 4Z8LA 1A12A 1GOFA 5I5JA 3JPXA 3EI4B 3V4PA 3RRMC 4CY3A 2B5MA 4E54B 4G1EA 5I5IA 5CXCA 3FCUA 2OK6A 1QFMA 5FA5B 5K1CC 3SBQA 3BG1A 2AGXA 3UVMA 3PVUB 3V4VA 4K3JB 2HJBA 4GQ1A 5C2VB 3V7DB 4FB1D 2QC5A 2VZ3A 3CFVA 3F3GA 2H6KA 1T2XA 2H9MA 3C9CA 3NIFA 4J0XA 5A2Qg 4O02A 4OZUA 3L4MD 1TYQC 3UVKA 4J79A 4J8BA 4X60B 3UVNA 1VZ3A 3EI2A 2HU7A 4JD2C 4GQBB 4DNVA 3EQ9A 3IJEA 2VDPA 2Z2OA 3FRXA 4CZVA 3KCIA 1YR2A 4PBYA 2PM6B 2HU8A 4TZ4A 3ULEC 3AL8A 3FGBA 1U8CA 1U2VC 5E6UA 1L5GA 2AH1A 4L1MA 2J56H 2H47A 4J0WA 3UVOA 3J80g 4LG9A 1QNIA 3DWLC 5M5RA 4BP8A 4QQEA 4D6VA 4MMXA 4A0AB 3IIYA 2MTAH 2VDOA 5H17A 4QL1A 5HE3B 3ZE1A 3I7NA 4CI3A 2Z2NA 2EIEA 2HKRA 1VE7A 1PEVA 4NBMA 4Y7RA 4G55A 1SQ9A 2P9UC 3MMYA 5FKTA 3IURA 2HXCA 2XDWA 2XZGA 4CY1A 3QHYB 4WK0A 1N6EA 4ERQA 5TEEA 4U7AA 4YVDA 2BKLA 5HQGA 4H5IA 3MVDK 4QRJA 2GC7A 4JSVC 4XYIA 5IT9g 3EWEA 1UOQA 3O4IA 3OL2A 4BCCA 4J77A 5K19A 3F3PA 5M61A 1YFQA 1UTCA 3IKOA 1O6GA 2BCJB 3JZNA 3T3MA 2YMUA 3GC3B 3EG6A 4GGDA 5FFOA 3SN6B 4JT6C 1JV2A 1NEXB 1FWXA 2IWKA 4CI8A 3IULA 5HYNB 3ZDZA 2EICA 4DNWA 5E6SA 3ZE2A 5C9ZB 3ORVD 5FFGA 5C2WB 3O4JA 4A0BB 4BCBA 5HDBA 4U1EI 4FAND 4J78A 3I7LA 3GD1I 5AJAA 3AH8B 4GGAA 4RE5A 3EQ8A 1RI6A 3PXSD 4A08B 3VA6A 3MKSB 3NVQA 2TRCB 4CY5A 4Y5RD 3N0EA 5CYKB 2QR5A 4ZOYA 4A2MA 2AQ5A 2VDMA 5H14A 4J8GA 1P22A 2XL3A 1MDAH 3QI0A 2EBSA 2OIZA 1VZ2A 3IUJA 4N14A 2HYEA 4WK4A 3IJ1A 5EAMA 2HJ4A 2IUVA 3VGZA 1GG2B 1PBYB 4BCDA 4ZOZA 1BPOA 2H6QA 5B4WA 4DNUA 4Z7OA 2OVQB 1E8NA 2IURA 2I0TA 3VI4A 4FA9D 4A11B 4GM8A 2H68A 4J86A 4AN1A 4L3GD 1PGUA 2P9PC 4WK2A 4ZOXA 1JMXB 4O3TB 5EMJB 2H13A 1XIPA 4O1QD 2CNXA 4PSXB 2HU5A 4LGNA 4BP9A 1H2ZA 2VDKA 1GP2B 3MKQA 3PXWD 2J55H 3A0FA 3K26A 4GM9A 5M5TA 1ERJA 5HE0B 4JSPC 5E6RA 4O2WA 3RMZD 4O45A 4CY2A 3DSMA 4JHPC 2PM9A 2CE8A 3I89A 4CI1A 5EARA 3I2NA 3KRXB 2P9KC 4PSWB 2CE9A 1K32A 3SLED 5EALA 4A09A 4FHLA 2UZXB 4E5ZA 3OKYB 5CXCB 5EMKB 5KDOB 3SBPA 3OF7A 2O9KA 4GGCA 4LG8A 5IGQA 2B5LA 2W18A 3V5WB 2WQ8A 4AEZA 4J82A 1MG2A 2VDRA 2CO0A 3OKWA 4XEIC 4O9DA 5CXBA 3GREA 3RSEC 2B4EA 5FLXg 3AL9A 3I8EA 3SCYA 3EI1A 3P4FA 2HESX 2UZYB 4XYHA 4GMBA 3DDUA 3EI2B 4JSNC 4CC9A 3MXXA 4NC4A 3RN1D 4IRZA 4O3UB 4ZN4A 2PM7B 3ZDYA 4UM9A 3JZHA 4CZXA 2VZ1A 1JOFA 1O6FA 1C9IA 2YBAA 4FA4D 5HE1B 2QXVA 4L3HD 5IJ7E 4FAVD 1H2WA 4K3ID 3T3PA 3ZE0A 4JHNA 1GOTB 2P9SC 1L0QA 3SXTD 3RFGA 2H9PA 4PNKB 3J81g 5HE2B 5TEFA 5TDHB 3W15A 2G9AA 2AGWA 5EM2A 1UOPA 3UKUC 3EI3A 3SWSD 1NR0A 3UKRC 5AMSA 5M5UA 2VC2A 1TBGA 3EI4A 3PSCB 3BG0A 2G99A 5FKSA 1B9XA 2PBIB 2CN3A 4BUJC 5EMMB 4E54A 3VH0A 2Q7QA 1Q47A 4I79A 2H14A 4J73A 1M1XA 2XL2A 4L1QD 4HDJA 3O4HA 2VDNA 1K8KC 3CFSB 3I7PA 4NAAA 2H9NA 2Z2PA 3O4GA 4GM3A 1K3IA 3PE7A 3IVMA 3DXMC 4ZOVA 4BL0A 1SQJA 5C92A 1OMWB 5EMLB 3OL2B 2EIBA 3I7HA 3I8CA 4AMZA 2IUPA 5C86A 1H2XA 3JAMg 2OVRB 1R5MA 3K27A 5H1MA 2P9IC 4EWRA 3K71A 4WJKA 3IUQA 2YB8B 5JWZA 3IUMA 3JZGA 1XHMA 1H2YA 2AGZA 2I0SA 3MUNA 1UOOA 3ODTA 3U4YA 3IUNA 2IWFA 5FXYA 3CIKB 3SVWD 4PC0A 4PXWA 3SHFA 1GOHA 1JMZB 5IGOA 3RLMD 5FKRA 2P9NC 2OJYA 1QFSA 2BBKH 2VDLA 3OKYA 4X3EA 4AN0A 3OTTA 4A0AA 3C75H 3NVNA 3OW8A 5FKQA 1N6FA 3F3FA 5GSAA 4CZYA 2J57G 4AMYA 2B5NA 3JRPA 5FQDA 4RE6A 1MG3A 4IMMA 2OK4A 3PVWB 3SBRA 1VE6A 4OWRA 2I3TA 2AH0A 2YNPA 3SMRA 3SJLD 4JSXC 4KFMB 3UR4A 4R7AB 3DM0A 4J87A 1N6DA 4UM8A 3IIWA 3RN0D 2GC4A 2H6NA 3PSLA 4D0KA 5GMKn 1OLZA 3MUOA 4QT8A 2GNQA 4H5JA 3JB9L 5GXHA 3FCSA 3B7FA 2YNNA 5TF2A 3RFHA 3K6SA 2AGYA 4D9SA 4A2LA 3EU7A 5EAPA 2EIDA 5SXMA 1S4UX 1XKSA 3GFCA 4IA9A 4FWWA 2VDQA 5THAA 3NVXA 1B9YA 2CO0C 4MMYA 1VYHC 4G1MA 3NIDA 2HKMA 4A0BA 4NENA 1GXRA 4AX4A
chains in the Genus database with same CATH topology
3T3MA 3VI3A 5E6RA 3FCSA 3ZDXA 4Z7NA 3K71A 4WJKA 4Z7OA 3K6SA 1M1XA 5FFOA 3T3PA 3ZE0A 4Z7QA 4MMZA 1JV2A 3V4VA 2VDRA 3VI4A 2VDNA 1U8CA 1TYEA 5E6UA 1L5GA 4WK2A 4WK0A 3K72A 3NIFA 3ZDZA 2VDMA 4O02A 5E6SA 3ZE2A 2VDQA 5FFGA 4IRZA 4MMYA 2VDKA 4MMXA 4UM8A 3ZDYA 4UM9A 3V4PA 4G1MA 2VC2A 3NIDA 5HDBA 2VDOA 2VDLA 4G1EA 3IJEA 2VDPA 4WK4A 3ZE1A 3FCUA 4NENA 3NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3M A;  3VI3 A;  5E6R A;  3FCS A;  3ZDX A;  4Z7N A;  3K71 A;  4WJK A;  4Z7O A;  3K6S A;  1M1X A;  5FFO A;  3T3P A;  3ZE0 A;  4Z7Q A;  4MMZ A;  1JV2 A;  3V4V A;  2VDR A;  3VI4 A;  2VDN A;  1U8C A;  1TYE A;  5E6U A;  1L5G A;  4WK2 A;  4WK0 A;  3K72 A;  3NIF A;  3ZDZ A;  2VDM A;  4O02 A;  5E6S A;  3ZE2 A;  2VDQ A;  5FFG A;  4IRZ A;  4MMY A;  2VDK A;  4MMX A;  4UM8 A;  3ZDY A;  4UM9 A;  3V4P A;  4G1M A;  2VC2 A;  3NID A;  5HDB A;  2VDO A;  2VDL A;  4G1E A;  3IJE A;  2VDP A;  4WK4 A;  3ZE1 A;  3FCU A;  4NEN A;  3NIG A; 
#chains in the Genus database with same CATH topology
 4AOW A;  1JJU B;  1U4C A;  4PBZ A;  2H9L A;  3AL8 B;  4GQ2 P;  1C9L A;  4MMZ A;  3N0D A;  2PM9 B;  4ERY A;  1TYE A;  4ES0 A;  1PI6 A;  4MK0 B;  4A08 A;  4NSX A;  2CN2 A;  2I0R A;  5M5S A;  1JTD B;  3K72 A;  3SFZ A;  3UVL A;  5CYK A;  4A09 B;  3L4O D;  2XU7 A;  4E5Z B;  3C99 A;  3V9F A;  2I3S A;  5M5V A;  2AGL A;  4FA1 D;  4ERZ A;  4FA5 D;  1I2M B;  3ZWL B;  3NIG A;  5I5M A;  3FM0 A;  3MZL A;  3VI3 A;  3EQ7 A;  4QAM A;  3ZDX A;  5AFU 3;  3E0C A;  4JXM A;  3EMH A;  5CXB B;  3I7K A;  2JKX A;  4GZ8 A;  4UI9 R;  3EI1 B;  3C5M A;  4A7J A;  2XE4 A;  4A11 A;  1E5T A;  2YNO A;  4ESG A;  4CI2 A;  3IJC A;  1E8M A;  1SHY B;  3AFC A;  4J84 A;  4J81 A;  2QZP A;  2OVP B;  3HFQ A;  3MZK A;  1A0R B;  4X63 B;  3IJ0 A;  5IC7 A;  2IUQ A;  3BWS A;  3OKT A;  4Z7N A;  3KRW B;  5GXI A;  4Z7Q A;  2H3X A;  1GOG A;  5IJ8 E;  2IAA A;  4BH6 A;  4X61 B;  2XYI A;  3I7O A;  4G56 B;  4JT5 C;  2P9L C;  5EM2 B;  3PXT D;  3EI3 B;  3JRO A;  4L9O A;  3DXK C;  4Z8L A;  1A12 A;  1GOF A;  5I5J A;  3JPX A;  3EI4 B;  3V4P A;  3RRM C;  4CY3 A;  2B5M A;  4E54 B;  4G1E A;  5I5I A;  5CXC A;  3FCU A;  2OK6 A;  1QFM A;  5FA5 B;  5K1C C;  3SBQ A;  3BG1 A;  2AGX A;  3UVM A;  3PVU B;  3V4V A;  4K3J B;  2HJB A;  4GQ1 A;  5C2V B;  3V7D B;  4FB1 D;  2QC5 A;  2VZ3 A;  3CFV A;  3F3G A;  2H6K A;  1T2X A;  2H9M A;  3C9C A;  3NIF A;  4J0X A;  5A2Q g;  4O02 A;  4OZU A;  3L4M D;  1TYQ C;  3UVK A;  4J79 A;  4J8B A;  4X60 B;  3UVN A;  1VZ3 A;  3EI2 A;  2HU7 A;  4JD2 C;  4GQB B;  4DNV A;  3EQ9 A;  3IJE A;  2VDP A;  2Z2O A;  3FRX A;  4CZV A;  3KCI A;  1YR2 A;  4PBY A;  2PM6 B;  2HU8 A;  4TZ4 A;  3ULE C;  3AL8 A;  3FGB A;  1U8C A;  1U2V C;  5E6U A;  1L5G A;  2AH1 A;  4L1M A;  2J56 H;  2H47 A;  4J0W A;  3UVO A;  3J80 g;  4LG9 A;  1QNI A;  3DWL C;  5M5R A;  4BP8 A;  4QQE A;  4D6V A;  4MMX A;  4A0A B;  3IIY A;  2MTA H;  2VDO A;  5H17 A;  4QL1 A;  5HE3 B;  3ZE1 A;  3I7N A;  4CI3 A;  2Z2N A;  2EIE A;  2HKR A;  1VE7 A;  1PEV A;  4NBM A;  4Y7R A;  4G55 A;  1SQ9 A;  2P9U C;  3MMY A;  5FKT A;  3IUR A;  2HXC A;  2XDW A;  2XZG A;  4CY1 A;  3QHY B;  4WK0 A;  1N6E A;  4ERQ A;  5TEE A;  4U7A A;  4YVD A;  2BKL A;  5HQG A;  4H5I A;  3MVD K;  4QRJ A;  2GC7 A;  4JSV C;  4XYI A;  5IT9 g;  3EWE A;  1UOQ A;  3O4I A;  3OL2 A;  4BCC A;  4J77 A;  5K19 A;  3F3P A;  5M61 A;  1YFQ A;  1UTC A;  3IKO A;  1O6G A;  2BCJ B;  3JZN A;  3T3M A;  2YMU A;  3GC3 B;  3EG6 A;  4GGD A;  5FFO A;  3SN6 B;  4JT6 C;  1JV2 A;  1NEX B;  1FWX A;  2IWK A;  4CI8 A;  3IUL A;  5HYN B;  3ZDZ A;  2EIC A;  4DNW A;  5E6S A;  3ZE2 A;  5C9Z B;  3ORV D;  5FFG A;  5C2W B;  3O4J A;  4A0B B;  4BCB A;  5HDB A;  4U1E I;  4FAN D;  4J78 A;  3I7L A;  3GD1 I;  5AJA A;  3AH8 B;  4GGA A;  4RE5 A;  3EQ8 A;  1RI6 A;  3PXS D;  4A08 B;  3VA6 A;  3MKS B;  3NVQ A;  2TRC B;  4CY5 A;  4Y5R D;  3N0E A;  5CYK B;  2QR5 A;  4ZOY A;  4A2M A;  2AQ5 A;  2VDM A;  5H14 A;  4J8G A;  1P22 A;  2XL3 A;  1MDA H;  3QI0 A;  2EBS A;  2OIZ A;  1VZ2 A;  3IUJ A;  4N14 A;  2HYE A;  4WK4 A;  3IJ1 A;  5EAM A;  2HJ4 A;  2IUV A;  3VGZ A;  1GG2 B;  1PBY B;  4BCD A;  4ZOZ A;  1BPO A;  2H6Q A;  5B4W A;  4DNU A;  4Z7O A;  2OVQ B;  1E8N A;  2IUR A;  2I0T A;  3VI4 A;  4FA9 D;  4A11 B;  4GM8 A;  2H68 A;  4J86 A;  4AN1 A;  4L3G D;  1PGU A;  2P9P C;  4WK2 A;  4ZOX A;  1JMX B;  4O3T B;  5EMJ B;  2H13 A;  1XIP A;  4O1Q D;  2CNX A;  4PSX B;  2HU5 A;  4LGN A;  4BP9 A;  1H2Z A;  2VDK A;  1GP2 B;  3MKQ A;  3PXW D;  2J55 H;  3A0F A;  3K26 A;  4GM9 A;  5M5T A;  1ERJ A;  5HE0 B;  4JSP C;  5E6R A;  4O2W A;  3RMZ D;  4O45 A;  4CY2 A;  3DSM A;  4JHP C;  2PM9 A;  2CE8 A;  3I89 A;  4CI1 A;  5EAR A;  3I2N A;  3KRX B;  2P9K C;  4PSW B;  2CE9 A;  1K32 A;  3SLE D;  5EAL A;  4A09 A;  4FHL A;  2UZX B;  4E5Z A;  3OKY B;  5CXC B;  5EMK B;  5KDO B;  3SBP A;  3OF7 A;  2O9K A;  4GGC A;  4LG8 A;  5IGQ A;  2B5L A;  2W18 A;  3V5W B;  2WQ8 A;  4AEZ A;  4J82 A;  1MG2 A;  2VDR A;  2CO0 A;  3OKW A;  4XEI C;  4O9D A;  5CXB A;  3GRE A;  3RSE C;  2B4E A;  5FLX g;  3AL9 A;  3I8E A;  3SCY A;  3EI1 A;  3P4F A;  2HES X;  2UZY B;  4XYH A;  4GMB A;  3DDU A;  3EI2 B;  4JSN C;  4CC9 A;  3MXX A;  4NC4 A;  3RN1 D;  4IRZ A;  4O3U B;  4ZN4 A;  2PM7 B;  3ZDY A;  4UM9 A;  3JZH A;  4CZX A;  2VZ1 A;  1JOF A;  1O6F A;  1C9I A;  2YBA A;  4FA4 D;  5HE1 B;  2QXV A;  4L3H D;  5IJ7 E;  4FAV D;  1H2W A;  4K3I D;  3T3P A;  3ZE0 A;  4JHN A;  1GOT B;  2P9S C;  1L0Q A;  3SXT D;  3RFG A;  2H9P A;  4PNK B;  3J81 g;  5HE2 B;  5TEF A;  5TDH B;  3W15 A;  2G9A A;  2AGW A;  5EM2 A;  1UOP A;  3UKU C;  3EI3 A;  3SWS D;  1NR0 A;  3UKR C;  5AMS A;  5M5U A;  2VC2 A;  1TBG A;  3EI4 A;  3PSC B;  3BG0 A;  2G99 A;  5FKS A;  1B9X A;  2PBI B;  2CN3 A;  4BUJ C;  5EMM B;  4E54 A;  3VH0 A;  2Q7Q A;  1Q47 A;  4I79 A;  2H14 A;  4J73 A;  1M1X A;  2XL2 A;  4L1Q D;  4HDJ A;  3O4H A;  2VDN A;  1K8K C;  3CFS B;  3I7P A;  4NAA A;  2H9N A;  2Z2P A;  3O4G A;  4GM3 A;  1K3I A;  3PE7 A;  3IVM A;  3DXM C;  4ZOV A;  4BL0 A;  1SQJ A;  5C92 A;  1OMW B;  5EML B;  3OL2 B;  2EIB A;  3I7H A;  3I8C A;  4AMZ A;  2IUP A;  5C86 A;  1H2X A;  3JAM g;  2OVR B;  1R5M A;  3K27 A;  5H1M A;  2P9I C;  4EWR A;  3K71 A;  4WJK A;  3IUQ A;  2YB8 B;  5JWZ A;  3IUM A;  3JZG A;  1XHM A;  1H2Y A;  2AGZ A;  2I0S A;  3MUN A;  1UOO A;  3ODT A;  3U4Y A;  3IUN A;  2IWF A;  5FXY A;  3CIK B;  3SVW D;  4PC0 A;  4PXW A;  3SHF A;  1GOH A;  1JMZ B;  5IGO A;  3RLM D;  5FKR A;  2P9N C;  2OJY A;  1QFS A;  2BBK H;  2VDL A;  3OKY A;  4X3E A;  4AN0 A;  3OTT A;  4A0A A;  3C75 H;  3NVN A;  3OW8 A;  5FKQ A;  1N6F A;  3F3F A;  5GSA A;  4CZY A;  2J57 G;  4AMY A;  2B5N A;  3JRP A;  5FQD A;  4RE6 A;  1MG3 A;  4IMM A;  2OK4 A;  3PVW B;  3SBR A;  1VE6 A;  4OWR A;  2I3T A;  2AH0 A;  2YNP A;  3SMR A;  3SJL D;  4JSX C;  4KFM B;  3UR4 A;  4R7A B;  3DM0 A;  4J87 A;  1N6D A;  4UM8 A;  3IIW A;  3RN0 D;  2GC4 A;  2H6N A;  3PSL A;  4D0K A;  5GMK n;  1OLZ A;  3MUO A;  4QT8 A;  2GNQ A;  4H5J A;  3JB9 L;  5GXH A;  3FCS A;  3B7F A;  2YNN A;  5TF2 A;  3RFH A;  3K6S A;  2AGY A;  4D9S A;  4A2L A;  3EU7 A;  5EAP A;  2EID A;  5SXM A;  1S4U X;  1XKS A;  3GFC A;  4IA9 A;  4FWW A;  2VDQ A;  5THA A;  3NVX A;  1B9Y A;  2CO0 C;  4MMY A;  1VYH C;  4G1M A;  3NID A;  2HKM A;  4A0B A;  4NEN A;  1GXR A;  4AX4 A; 
#chains in the Genus database with same CATH homology
 3T3M A;  3VI3 A;  5E6R A;  3FCS A;  3ZDX A;  4Z7N A;  3K71 A;  4WJK A;  4Z7O A;  3K6S A;  1M1X A;  5FFO A;  3T3P A;  3ZE0 A;  4Z7Q A;  4MMZ A;  1JV2 A;  3V4V A;  2VDR A;  3VI4 A;  2VDN A;  1U8C A;  1TYE A;  5E6U A;  1L5G A;  4WK2 A;  4WK0 A;  3K72 A;  3NIF A;  3ZDZ A;  2VDM A;  4O02 A;  5E6S A;  3ZE2 A;  2VDQ A;  5FFG A;  4IRZ A;  4MMY A;  2VDK A;  4MMX A;  4UM8 A;  3ZDY A;  4UM9 A;  3V4P A;  4G1M A;  2VC2 A;  3NID A;  5HDB A;  2VDO A;  2VDL A;  4G1E A;  3IJE A;  2VDP A;  4WK4 A;  3ZE1 A;  3FCU A;  4NEN A;  3NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...