3NIGA

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 112
structure length 457
sequence length 457
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nigA00
4MMZA 3ZDXA 4MMYA 5HDBA 4O02A 4WK4A 2VDOA 3IJEA 3ZE2A 4WK0A 1L5GA 3K6SA 2VDQA 4Z7OA 4WK2A 2VDPA 3T3MA 5E6RA 3ZDZA 4Z7QA 3T3PA 3NIFA 1JV2A 4IRZA 1TYEA 3FCSA 3VI3A 4UM9A 3K71A 2VDLA 3FCUA 3K72A 4NENA 2VDMA 3ZDYA 1M1XA 3NIGA 5E6SA 5FFOA 3VI4A 3V4VA 4MMXA 2VDRA 5FFGA 4G1EA 2VC2A 2VDKA 2VDNA 4WJKA 3ZE0A 3ZE1A 4Z7NA 1U8CA 3NIDA 4G1MA 5E6UA 4UM8A 3V4PA
chains in the Genus database with same CATH superfamily
3VGZA 3F3GA 3KRWB 3SFZA 3ZE2A 3I7LA 5C92A 4ERZA 2IUPA 2QXVA 2QC5A 3C75H 4H5JA 3RMZD 4A08A 4CZXA 3CFSB 5EMMB 2BKLA 4CI8A 1A12A 4UI9R 3K72A 4IMMA 3MZKA 1SQ9A 3VI4A 1PEVA 4JT5C 2PM9B 4WJKA 5GMKn 3DXMC 2HJBA 3SBQA 4Z7NA 3DSMA 3NIDA 2PM6B 4A2MA 4E54A 3IUNA 4J0WA 4CZVA 5GXHA 4QL1A 3OKYA 3RN0D 2B5MA 3ZWLB 5M5SA 1E8NA 5EALA 5FKRA 2B5NA 3JAMg 4GMBA 4JSNC 1SHYB 4O2WA 2HU7A 5CXBB 3KRXB 5HE1B 4GGCA 2OK6A 3O4GA 2EIEA 3V4VA 3OF7A 2HU8A 2IAAA 3UR4A 3EI3A 3N0EA 1GOHA 3JROA 4GGAA 5FXYA 5FLXg 4DNUA 2H9PA 5SXMA 4LG9A 2H9MA 4O9DA 5HE0B 4CI2A 3IULA 5I5IA 3IKOA 4J8GA 4L1MA 5H1MA 3GD1I 2H6QA 1NEXB 4FA5D 2H47A 5HYNB 1VYHC 5M5UA 4OZUA 4QQEA 2AGZA 3MUNA 5M5TA 1YR2A 2HJ4A 4JT6C 2VDMA 4HDJA 4RE5A 3SBPA 2HU5A 2IUVA 3OL2A 5CXCB 2PM7B 5EARA 2H3XA 3IJ1A 3UVMA 2OK4A 2P9NC 3PXWD 4WK0A 3K6SA 4GQ1A 3I7KA 3A0FA 3ORVD 4CZYA 1H2XA 4J78A 3PSLA 4JSVC 2P9PC 3UVNA 3FCSA 4N14A 4J81A 4L3HD 5IC7A 3JPXA 4BH6A 5AJAA 3EI4B 3GFCA 4BL0A 5FFGA 5FQDA 1N6FA 5E6UA 1YFQA 4UM8A 4AEZA 5FKSA 4FAND 3I8EA 4WK4A 3RLMD 3JZGA 4PNKB 4J84A 4L3GD 4PBYA 3EQ9A 4FWWA 4Z7QA 2CN2A 3MKSB 4A0AB 4NAAA 2IURA 2AH0A 3I2NA 3MUOA 4A0BB 2H13A 2CE8A 3EWEA 4J77A 5TEEA 4IA9A 3GREA 3I7OA 4CY5A 3SCYA 1P22A 2GC4A 4MMXA 3FM0A 3V7DB 3JRPA 5IJ8E 2XL3A 4J86A 3O4IA 4JXMA 5IGOA 5B4WA 1RI6A 2HKRA 2OVQB 2YBAA 4AN0A 2P9UC 5HDBA 2UZXB 1FWXA 4O3TB 5HE2B 4XYHA 4BCCA 4GZ8A 2EBSA 2AQ5A 5C9ZB 3N0DA 3EQ8A 2AH1A 3EI1B 4H5IA 2UZYB 3FCUA 3O4JA 1XIPA 4O3UB 4GGDA 3SHFA 2HXCA 3IJCA 5THAA 3K27A 4FA1D 2CN3A 3MMYA 4O02A 5H17A 3IJEA 4ZOZA 4NC4A 3AL8B 4ERYA 4WK2A 3F3PA 5EMLB 3I7NA 5C86A 5C2WB 5H14A 3SMRA 4UM9A 3IUQA 4PBZA 1MG2A 4CY1A 5GXIA 1M1XA 3C99A 1U4CA 4GQBB 3OKWA 4CY2A 2BBKH 3IUJA 1N6EA 4D9SA 4G1MA 2I0TA 2CO0A 3QI0A 1VZ2A 3BG1A 4ZOVA 4GM9A 5TEFA 2Z2PA 3C9CA 2YNOA 3NVXA 2VDOA 4A08B 3IURA 1GOTB 2B5LA 3OTTA 1E5TA 5HQGA 2I3TA 4DNWA 2GC7A 1JTDB 4QRJA 1A0RB 3DM0A 1OMWB 1GP2B 4JSPC 2H68A 1OLZA 3SLED 1H2YA 3V9FA 3SN6B 3NVNA 4E54B 1U2VC 4QAMA 2AGYA 3PVWB 3P4FA 4J87A 4G1EA 3OKYB 1L0QA 3DWLC 4A11A 2H6KA 5GSAA 2P9IC 1T2XA 4GM3A 4A09A 4CI3A 5CYKA 4ZOYA 3AL9A 3IJ0A 2J56H 3PXTD 2GNQA 4DNVA 2VZ3A 4E5ZA 2P9LC 3EI2A 2XYIA 3RN1D 3O4HA 3MVDK 1MDAH 5I5MA 3J80g 4R7AB 1K32A 3SBRA 2G99A 5AMSA 1VE6A 3VI3A 3J81g 3W15A 3EI3B 4CI1A 4K3JB 2O9KA 1K8KC 1N6DA 2YNNA 1C9LA 3NIGA 4JHNA 4Y5RD 5EM2B 4TZ4A 1GG2B 3UKRC 1B9YA 4G55A 4J79A 4A7JA 5FKQA 2OVRB 3HFQA 1O6FA 4LG8A 5TDHB 1R5MA 1MG3A 1PGUA 3OL2B 4ZN4A 3SWSD 2CE9A 5EMKB 3K71A 2VDLA 2J57G 3NVQA 3I89A 3QHYB 3ODTA 1TBGA 4BCDA 3SVWD 1BPOA 4JHPC 3L4MD 3IIYA 5C2VB 2MTAH 2TRCB 3JZNA 2Z2OA 5JWZA 5K19A 4GM8A 4MMYA 2PM9A 4AX4A 4ESGA 1GXRA 3MKQA 2PBIB 3U4YA 2YNPA 4Y7RA 3I7PA 3DDUA 3VA6A 2VDQA 1SQJA 4J8BA 2WQ8A 5IGQA 1E8MA 3OKTA 1PBYB 2J55H 3DXKC 5AFU3 2OVPB 3ULEC 4D6VA 4O1QD 4CC9A 4U1EI 4KFMB 5I5JA 5FFOA 1XHMA 2EIDA 5CXBA 3RFHA 4BUJC 1ERJA 3IIWA 2VDNA 3I8CA 4JD2C 5M5VA 5M61A 2H9NA 5EAMA 1U8CA 5HE3B 2Q7QA 2AGLA 1UOOA 3CFVA 1JMXB 4Z7OA 1JOFA 2IUQA 3ZDZA 3T3MA 3NIFA 2P9KC 5A2Qg 1B9XA 1JJUB 1QFSA 1QNIA 5IT9g 5EMJB 3FGBA 3K26A 4XYIA 3RRMC 1GOFA 2XL2A 1O6GA 4EWRA 1UOPA 4QT8A 3ZE0A 4X60B 4Z8LA 4L1QD 2H14A 4I79A 2OJYA 3FRXA 1H2WA 3MXXA 5CXCA 2QZPA 3EU7A 4AMYA 4L9OA 4J73A 4AMZA 4FA4D 4RE6A 1S4UX 4XEIC 2YB8B 3SJLD 4K3ID 3AH8B 2BCJB 2AGXA 2B4EA 2IWKA 4AOWA 1XKSA 3JB9L 1NR0A 5EAPA 2AGWA 1Q47A 1QFMA 1UTCA 2VZ1A 3AFCA 3IVMA 5IJ7E 2VC2A 2G9AA 3ZE1A 4OWRA 4YVDA 3BG0A 3EI4A 4FB1D 1GOGA 5FKTA 3RSEC 2XZGA 2I3SA 2XU7A 4MMZA 3ZDXA 3EG6A 3PSCB 4BCBA 5EM2A 1L5GA 5K1CC 3UKUC 1K3IA 1C9IA 4X61B 5E6RA 3PE7A 3V5WB 2YMUA 4U7AA 3EMHA 2QR5A 1I2MB 3BWSA 2HKMA 2JKXA 3PXSD 4NSXA 4BP9A 3GC3B 3C5MA 4G56B 4A0AA 4FA9D 3JZHA 2EICA 3OW8A 2VDRA 4A0BA 3CIKB 4X3EA 4A2LA 2VDKA 4PSXB 4CY3A 4ZOXA 2EIBA 2P9SC 2HYEA 4LGNA 3V4PA 2HESX 3RFGA 4X63B 2IWFA 3UVKA 1JMZB 2OIZA 1PI6A 1H2ZA 2VDPA 4JSXC 3T3PA 1TYQC 5M5RA 4FHLA 2I0SA 4J0XA 4NBMA 3F3FA 3SXTD 1TYEA 3EQ7A 4ES0A 2XE4A 2Z2NA 3B7FA 3UVLA 5FA5B 4A11B 1VZ3A 1VE7A 2CO0C 3ZDYA 3VH0A 5E6SA 4A09B 3EI1A 5CYKB 2H9LA 4E5ZB 3EI2B 3I7HA 2H6NA 3E0CA 2W18A 2CNXA 5TF2A 4AN1A 3KCIA 4J82A 4BP8A 4PC0A 3IUMA 4GQ2P 1JV2A 3L4OD 4PSWB 4IRZA 3AL8A 4FAVD 5KDOB 4NENA 4MK0B 3UVOA 2XDWA 4ERQA 2I0RA 4PXWA 3PVUB 4O45A 3MZLA 1UOQA 4D0KA
chains in the Genus database with same CATH topology
4MMZA 3ZDXA 4MMYA 5HDBA 4O02A 4WK4A 2VDOA 3IJEA 3ZE2A 4WK0A 1L5GA 3K6SA 2VDQA 4Z7OA 4WK2A 2VDPA 3T3MA 5E6RA 3ZDZA 4Z7QA 3T3PA 3NIFA 1JV2A 4IRZA 1TYEA 3FCSA 3VI3A 4UM9A 3K71A 2VDLA 3FCUA 3K72A 4NENA 2VDMA 3ZDYA 1M1XA 3NIGA 5E6SA 5FFOA 3VI4A 3V4VA 4MMXA 2VDRA 5FFGA 4G1EA 2VC2A 2VDKA 2VDNA 4WJKA 3ZE0A 3ZE1A 4Z7NA 1U8CA 3NIDA 4G1MA 5E6UA 4UM8A 3V4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMZ A;  3ZDX A;  4MMY A;  5HDB A;  4O02 A;  4WK4 A;  2VDO A;  3IJE A;  3ZE2 A;  4WK0 A;  1L5G A;  3K6S A;  2VDQ A;  4Z7O A;  4WK2 A;  2VDP A;  3T3M A;  5E6R A;  3ZDZ A;  4Z7Q A;  3T3P A;  3NIF A;  1JV2 A;  4IRZ A;  1TYE A;  3FCS A;  3VI3 A;  4UM9 A;  3K71 A;  2VDL A;  3FCU A;  3K72 A;  4NEN A;  2VDM A;  3ZDY A;  1M1X A;  3NIG A;  5E6S A;  5FFO A;  3VI4 A;  3V4V A;  4MMX A;  2VDR A;  5FFG A;  4G1E A;  2VC2 A;  2VDK A;  2VDN A;  4WJK A;  3ZE0 A;  3ZE1 A;  4Z7N A;  1U8C A;  3NID A;  4G1M A;  5E6U A;  4UM8 A;  3V4P A; 
#chains in the Genus database with same CATH topology
 3VGZ A;  3F3G A;  3KRW B;  3SFZ A;  3ZE2 A;  3I7L A;  5C92 A;  4ERZ A;  2IUP A;  2QXV A;  2QC5 A;  3C75 H;  4H5J A;  3RMZ D;  4A08 A;  4CZX A;  3CFS B;  5EMM B;  2BKL A;  4CI8 A;  1A12 A;  4UI9 R;  3K72 A;  4IMM A;  3MZK A;  1SQ9 A;  3VI4 A;  1PEV A;  4JT5 C;  2PM9 B;  4WJK A;  5GMK n;  3DXM C;  2HJB A;  3SBQ A;  4Z7N A;  3DSM A;  3NID A;  2PM6 B;  4A2M A;  4E54 A;  3IUN A;  4J0W A;  4CZV A;  5GXH A;  4QL1 A;  3OKY A;  3RN0 D;  2B5M A;  3ZWL B;  5M5S A;  1E8N A;  5EAL A;  5FKR A;  2B5N A;  3JAM g;  4GMB A;  4JSN C;  1SHY B;  4O2W A;  2HU7 A;  5CXB B;  3KRX B;  5HE1 B;  4GGC A;  2OK6 A;  3O4G A;  2EIE A;  3V4V A;  3OF7 A;  2HU8 A;  2IAA A;  3UR4 A;  3EI3 A;  3N0E A;  1GOH A;  3JRO A;  4GGA A;  5FXY A;  5FLX g;  4DNU A;  2H9P A;  5SXM A;  4LG9 A;  2H9M A;  4O9D A;  5HE0 B;  4CI2 A;  3IUL A;  5I5I A;  3IKO A;  4J8G A;  4L1M A;  5H1M A;  3GD1 I;  2H6Q A;  1NEX B;  4FA5 D;  2H47 A;  5HYN B;  1VYH C;  5M5U A;  4OZU A;  4QQE A;  2AGZ A;  3MUN A;  5M5T A;  1YR2 A;  2HJ4 A;  4JT6 C;  2VDM A;  4HDJ A;  4RE5 A;  3SBP A;  2HU5 A;  2IUV A;  3OL2 A;  5CXC B;  2PM7 B;  5EAR A;  2H3X A;  3IJ1 A;  3UVM A;  2OK4 A;  2P9N C;  3PXW D;  4WK0 A;  3K6S A;  4GQ1 A;  3I7K A;  3A0F A;  3ORV D;  4CZY A;  1H2X A;  4J78 A;  3PSL A;  4JSV C;  2P9P C;  3UVN A;  3FCS A;  4N14 A;  4J81 A;  4L3H D;  5IC7 A;  3JPX A;  4BH6 A;  5AJA A;  3EI4 B;  3GFC A;  4BL0 A;  5FFG A;  5FQD A;  1N6F A;  5E6U A;  1YFQ A;  4UM8 A;  4AEZ A;  5FKS A;  4FAN D;  3I8E A;  4WK4 A;  3RLM D;  3JZG A;  4PNK B;  4J84 A;  4L3G D;  4PBY A;  3EQ9 A;  4FWW A;  4Z7Q A;  2CN2 A;  3MKS B;  4A0A B;  4NAA A;  2IUR A;  2AH0 A;  3I2N A;  3MUO A;  4A0B B;  2H13 A;  2CE8 A;  3EWE A;  4J77 A;  5TEE A;  4IA9 A;  3GRE A;  3I7O A;  4CY5 A;  3SCY A;  1P22 A;  2GC4 A;  4MMX A;  3FM0 A;  3V7D B;  3JRP A;  5IJ8 E;  2XL3 A;  4J86 A;  3O4I A;  4JXM A;  5IGO A;  5B4W A;  1RI6 A;  2HKR A;  2OVQ B;  2YBA A;  4AN0 A;  2P9U C;  5HDB A;  2UZX B;  1FWX A;  4O3T B;  5HE2 B;  4XYH A;  4BCC A;  4GZ8 A;  2EBS A;  2AQ5 A;  5C9Z B;  3N0D A;  3EQ8 A;  2AH1 A;  3EI1 B;  4H5I A;  2UZY B;  3FCU A;  3O4J A;  1XIP A;  4O3U B;  4GGD A;  3SHF A;  2HXC A;  3IJC A;  5THA A;  3K27 A;  4FA1 D;  2CN3 A;  3MMY A;  4O02 A;  5H17 A;  3IJE A;  4ZOZ A;  4NC4 A;  3AL8 B;  4ERY A;  4WK2 A;  3F3P A;  5EML B;  3I7N A;  5C86 A;  5C2W B;  5H14 A;  3SMR A;  4UM9 A;  3IUQ A;  4PBZ A;  1MG2 A;  4CY1 A;  5GXI A;  1M1X A;  3C99 A;  1U4C A;  4GQB B;  3OKW A;  4CY2 A;  2BBK H;  3IUJ A;  1N6E A;  4D9S A;  4G1M A;  2I0T A;  2CO0 A;  3QI0 A;  1VZ2 A;  3BG1 A;  4ZOV A;  4GM9 A;  5TEF A;  2Z2P A;  3C9C A;  2YNO A;  3NVX A;  2VDO A;  4A08 B;  3IUR A;  1GOT B;  2B5L A;  3OTT A;  1E5T A;  5HQG A;  2I3T A;  4DNW A;  2GC7 A;  1JTD B;  4QRJ A;  1A0R B;  3DM0 A;  1OMW B;  1GP2 B;  4JSP C;  2H68 A;  1OLZ A;  3SLE D;  1H2Y A;  3V9F A;  3SN6 B;  3NVN A;  4E54 B;  1U2V C;  4QAM A;  2AGY A;  3PVW B;  3P4F A;  4J87 A;  4G1E A;  3OKY B;  1L0Q A;  3DWL C;  4A11 A;  2H6K A;  5GSA A;  2P9I C;  1T2X A;  4GM3 A;  4A09 A;  4CI3 A;  5CYK A;  4ZOY A;  3AL9 A;  3IJ0 A;  2J56 H;  3PXT D;  2GNQ A;  4DNV A;  2VZ3 A;  4E5Z A;  2P9L C;  3EI2 A;  2XYI A;  3RN1 D;  3O4H A;  3MVD K;  1MDA H;  5I5M A;  3J80 g;  4R7A B;  1K32 A;  3SBR A;  2G99 A;  5AMS A;  1VE6 A;  3VI3 A;  3J81 g;  3W15 A;  3EI3 B;  4CI1 A;  4K3J B;  2O9K A;  1K8K C;  1N6D A;  2YNN A;  1C9L A;  3NIG A;  4JHN A;  4Y5R D;  5EM2 B;  4TZ4 A;  1GG2 B;  3UKR C;  1B9Y A;  4G55 A;  4J79 A;  4A7J A;  5FKQ A;  2OVR B;  3HFQ A;  1O6F A;  4LG8 A;  5TDH B;  1R5M A;  1MG3 A;  1PGU A;  3OL2 B;  4ZN4 A;  3SWS D;  2CE9 A;  5EMK B;  3K71 A;  2VDL A;  2J57 G;  3NVQ A;  3I89 A;  3QHY B;  3ODT A;  1TBG A;  4BCD A;  3SVW D;  1BPO A;  4JHP C;  3L4M D;  3IIY A;  5C2V B;  2MTA H;  2TRC B;  3JZN A;  2Z2O A;  5JWZ A;  5K19 A;  4GM8 A;  4MMY A;  2PM9 A;  4AX4 A;  4ESG A;  1GXR A;  3MKQ A;  2PBI B;  3U4Y A;  2YNP A;  4Y7R A;  3I7P A;  3DDU A;  3VA6 A;  2VDQ A;  1SQJ A;  4J8B A;  2WQ8 A;  5IGQ A;  1E8M A;  3OKT A;  1PBY B;  2J55 H;  3DXK C;  5AFU 3;  2OVP B;  3ULE C;  4D6V A;  4O1Q D;  4CC9 A;  4U1E I;  4KFM B;  5I5J A;  5FFO A;  1XHM A;  2EID A;  5CXB A;  3RFH A;  4BUJ C;  1ERJ A;  3IIW A;  2VDN A;  3I8C A;  4JD2 C;  5M5V A;  5M61 A;  2H9N A;  5EAM A;  1U8C A;  5HE3 B;  2Q7Q A;  2AGL A;  1UOO A;  3CFV A;  1JMX B;  4Z7O A;  1JOF A;  2IUQ A;  3ZDZ A;  3T3M A;  3NIF A;  2P9K C;  5A2Q g;  1B9X A;  1JJU B;  1QFS A;  1QNI A;  5IT9 g;  5EMJ B;  3FGB A;  3K26 A;  4XYI A;  3RRM C;  1GOF A;  2XL2 A;  1O6G A;  4EWR A;  1UOP A;  4QT8 A;  3ZE0 A;  4X60 B;  4Z8L A;  4L1Q D;  2H14 A;  4I79 A;  2OJY A;  3FRX A;  1H2W A;  3MXX A;  5CXC A;  2QZP A;  3EU7 A;  4AMY A;  4L9O A;  4J73 A;  4AMZ A;  4FA4 D;  4RE6 A;  1S4U X;  4XEI C;  2YB8 B;  3SJL D;  4K3I D;  3AH8 B;  2BCJ B;  2AGX A;  2B4E A;  2IWK A;  4AOW A;  1XKS A;  3JB9 L;  1NR0 A;  5EAP A;  2AGW A;  1Q47 A;  1QFM A;  1UTC A;  2VZ1 A;  3AFC A;  3IVM A;  5IJ7 E;  2VC2 A;  2G9A A;  3ZE1 A;  4OWR A;  4YVD A;  3BG0 A;  3EI4 A;  4FB1 D;  1GOG A;  5FKT A;  3RSE C;  2XZG A;  2I3S A;  2XU7 A;  4MMZ A;  3ZDX A;  3EG6 A;  3PSC B;  4BCB A;  5EM2 A;  1L5G A;  5K1C C;  3UKU C;  1K3I A;  1C9I A;  4X61 B;  5E6R A;  3PE7 A;  3V5W B;  2YMU A;  4U7A A;  3EMH A;  2QR5 A;  1I2M B;  3BWS A;  2HKM A;  2JKX A;  3PXS D;  4NSX A;  4BP9 A;  3GC3 B;  3C5M A;  4G56 B;  4A0A A;  4FA9 D;  3JZH A;  2EIC A;  3OW8 A;  2VDR A;  4A0B A;  3CIK B;  4X3E A;  4A2L A;  2VDK A;  4PSX B;  4CY3 A;  4ZOX A;  2EIB A;  2P9S C;  2HYE A;  4LGN A;  3V4P A;  2HES X;  3RFG A;  4X63 B;  2IWF A;  3UVK A;  1JMZ B;  2OIZ A;  1PI6 A;  1H2Z A;  2VDP A;  4JSX C;  3T3P A;  1TYQ C;  5M5R A;  4FHL A;  2I0S A;  4J0X A;  4NBM A;  3F3F A;  3SXT D;  1TYE A;  3EQ7 A;  4ES0 A;  2XE4 A;  2Z2N A;  3B7F A;  3UVL A;  5FA5 B;  4A11 B;  1VZ3 A;  1VE7 A;  2CO0 C;  3ZDY A;  3VH0 A;  5E6S A;  4A09 B;  3EI1 A;  5CYK B;  2H9L A;  4E5Z B;  3EI2 B;  3I7H A;  2H6N A;  3E0C A;  2W18 A;  2CNX A;  5TF2 A;  4AN1 A;  3KCI A;  4J82 A;  4BP8 A;  4PC0 A;  3IUM A;  4GQ2 P;  1JV2 A;  3L4O D;  4PSW B;  4IRZ A;  3AL8 A;  4FAV D;  5KDO B;  4NEN A;  4MK0 B;  3UVO A;  2XDW A;  4ERQ A;  2I0R A;  4PXW A;  3PVU B;  4O45 A;  3MZL A;  1UOQ A;  4D0K A; 
#chains in the Genus database with same CATH homology
 4MMZ A;  3ZDX A;  4MMY A;  5HDB A;  4O02 A;  4WK4 A;  2VDO A;  3IJE A;  3ZE2 A;  4WK0 A;  1L5G A;  3K6S A;  2VDQ A;  4Z7O A;  4WK2 A;  2VDP A;  3T3M A;  5E6R A;  3ZDZ A;  4Z7Q A;  3T3P A;  3NIF A;  1JV2 A;  4IRZ A;  1TYE A;  3FCS A;  3VI3 A;  4UM9 A;  3K71 A;  2VDL A;  3FCU A;  3K72 A;  4NEN A;  2VDM A;  3ZDY A;  1M1X A;  3NIG A;  5E6S A;  5FFO A;  3VI4 A;  3V4V A;  4MMX A;  2VDR A;  5FFG A;  4G1E A;  2VC2 A;  2VDK A;  2VDN A;  4WJK A;  3ZE0 A;  3ZE1 A;  4Z7N A;  1U8C A;  3NID A;  4G1M A;  5E6U A;  4UM8 A;  3V4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...