3NIGA

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
457
structure length
457
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 112
structure length 457
sequence length 457
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nigA00
3NIGA 2VDRA 4G1EA 3V4PA 3ZDYA 1JV2A 2VDMA 3IJEA 3K71A 3ZE0A 3NIDA 4Z7QA 4O02A 1M1XA 4IRZA 3T3PA 4UM9A 3FCSA 3VI4A 2VDNA 1U8CA 3ZDXA 4Z7NA 3ZDZA 3NIFA 4WJKA 5FFGA 4UM8A 5E6UA 4MMZA 2VC2A 3T3MA 4WK2A 4MMXA 4WK4A 4WK0A 2VDLA 3K6SA 5E6SA 3VI3A 3FCUA 4G1MA 3ZE2A 1TYEA 4Z7OA 3K72A 2VDQA 4MMYA 5E6RA 5HDBA 4NENA 1L5GA 5FFOA 3V4VA 2VDPA 3ZE1A 2VDOA 2VDKA
chains in the Genus database with same CATH superfamily
3RRMC 1TYQC 4A11B 4CI1A 5GSAA 2AGZA 4ERYA 2IUVA 2H13A 5E6UA 5SXMA 1ERJA 5EMKB 1H2XA 1T2XA 2VZ1A 4QL1A 4WK4A 2VDLA 4O45A 1TBGA 4RE5A 2OVPB 2B5MA 2YNNA 4KFMB 4ERQA 2H6NA 5TF2A 3IIYA 2TRCB 2YMUA 1XIPA 2CO0C 3JROA 2HJBA 3EMHA 3V4PA 2GC7A 2XL2A 1VE7A 4D6VA 3K27A 4A09A 4JXMA 1E5TA 3ORVD 5EMMB 4BCDA 3OL2B 2OVQB 1U8CA 2AGXA 1XKSA 2H6QA 3I89A 2H6KA 4GGAA 3EI3A 3NVXA 3ODTA 4U7AA 2MTAH 3MKQA 4MMXA 3K6SA 4GGCA 3I7LA 2HJ4A 3U4YA 3MKSB 5E6RA 5HDBA 4FA1D 3EWEA 4LG9A 5TEFA 3UKUC 5FKSA 3BG0A 3SBQA 1H2WA 3RN0D 4IA9A 3JZGA 4JSNC 3EQ8A 3MZKA 2P9PC 2VDNA 3MUNA 3VI4A 2IAAA 2AGYA 2H68A 2VC2A 5KDOB 1QFSA 1C9LA 4A09B 4QT8A 5H14A 4I79A 2VDQA 2YNOA 1SQJA 4RE6A 3IIWA 5JWZA 4BP9A 3EI3B 4A0BA 5H1MA 4UI9R 2EBSA 4OWRA 5A2Qg 3IJ1A 5I5MA 2I0TA 4CI8A 3DM0A 3CIKB 4LGNA 4ES0A 1JMXB 2J56H 4J81A 4O3UB 4Z7NA 3B7FA 2HKMA 2HU5A 3C9CA 2G99A 2VZ3A 4H5JA 1NR0A 4YVDA 3AFCA 3DSMA 2I3SA 2PM7B 4JSXC 4L1MA 4ERZA 3KRXB 3JZHA 3GREA 2HYEA 5HE3B 2IWFA 1L0QA 2OK6A 4CC9A 1VE6A 3QI0A 4J77A 3J81g 3W15A 2P9NC 5AFU3 4DNVA 4CZXA 2UZYB 3EQ9A 3N0DA 2CE8A 5HE2B 3SLED 3UKRC 4A0BB 3PVWB 4CZVA 1SHYB 3SWSD 1A0RB 1UTCA 2XU7A 1YR2A 5EAMA 3JZNA 1E8MA 4ZOVA 4QRJA 5EMJB 4O9DA 2AGLA 5K1CC 4FWWA 3L4MD 5EM2B 5HE1B 5M5UA 2Q7QA 3OW8A 4IRZA 3I8EA 1R5MA 4O2WA 3SVWD 3AL9A 2B5LA 4MK0B 1SQ9A 2EICA 3JRPA 3T3MA 5AMSA 3CFSB 3DXKC 3IUNA 3EI2B 2JKXA 1N6DA 3VI3A 3ZE2A 5C86A 1MG3A 2GC4A 4PBZA 1S4UX 1L5GA 3C99A 3V4VA 1U2VC 3GFCA 5FKRA 5TDHB 4G55A 1Q47A 2H14A 4GQ1A 2P9UC 4GQ2P 1U4CA 4X3EA 3IUJA 5TEEA 4Z7QA 3RMZD 4FB1D 2OK4A 4GZ8A 3T3PA 3EI4B 3RSEC 4UM8A 1GP2B 3VA6A 3IUMA 3EG6A 4WK0A 3NVQA 5E6SA 5M5VA 2OJYA 2EIDA 5I5IA 5FQDA 1P22A 2IUPA 3RFGA 4DNUA 2PM6B 1C9IA 4K3ID 1NEXB 2YB8B 5FA5B 2VDPA 4H5IA 4NAAA 3SMRA 4PNKB 3SBPA 3UVMA 4Z7OA 2YBAA 2IUQA 3L4OD 3C75H 3IUQA 3SCYA 3SHFA 3IJEA 3PXWD 5CYKA 1RI6A 3GC3B 5FKTA 2P9KC 4PSWB 3JPXA 1UOQA 3FCSA 4GGDA 2AH1A 4R7AB 4ZOYA 4L3HD 2I3TA 3BWSA 4CI3A 1GOTB 4JHPC 4CY1A 3O4IA 5IJ8E 5GMKn 2Z2OA 4IMMA 3I7HA 4A2MA 4AX4A 2H3XA 2PM9A 5FFOA 4FAND 3MVDK 2VDKA 4G1EA 5EMLB 4ZOZA 2H47A 2BBKH 4CI2A 4O02A 4AMYA 4D0KA 3O4HA 4A0AA 3AL8A 3IURA 3SXTD 4FHLA 3UVLA 5FFGA 3PVUB 3I7PA 4J8BA 2YNPA 2OIZA 4J86A 3JB9L 2AH0A 4J73A 5B4WA 5H17A 4FA9D 3DWLC 5CYKB 3O4GA 1MDAH 2HU8A 2B5NA 4FAVD 4XEIC 4NENA 1H2ZA 1A12A 4NC4A 3SJLD 3ZWLB 1K3IA 4BCCA 2P9LC 3QHYB 4XYHA 2VDRA 4ZOXA 3P4FA 4G56B 4BH6A 4GQBB 3CFVA 5CXBA 5HYNB 1UOOA 2PM9B 2H9LA 2XE4A 4AN1A 2OVRB 3FM0A 3MMYA 1JMZB 1OMWB 2J57G 5THAA 4J84A 1QNIA 4MMYA 3SBRA 4A0AB 3AL8B 4PC0A 4XYIA 1B9XA 5HQGA 3DXMC 2IURA 2CNXA 4J0WA 4K3JB 4PSXB 3V5WB 2XYIA 3F3GA 3NIDA 4X60B 5AJAA 3FGBA 1JJUB 3RFHA 3OKTA 3ZDXA 4LG8A 1N6EA 3ZDZA 2O9KA 2Z2PA 5GXHA 5IJ7E 1GOHA 3RLMD 4G1MA 4JSPC 5CXBB 3K72A 1XHMA 3K26A 3N0EA 2AGWA 3O4JA 1K8KC 1H2YA 4L9OA 4PXWA 3ZE1A 5FXYA 3F3PA 3PE7A 2HKRA 3I2NA 2XL3A 2HESX 3ZDYA 2EIEA 3FRXA 5HE0B 5C2WB 1MG2A 3UVNA 3BG1A 4AEZA 3OTTA 5IGOA 4WJKA 5C2VB 1YFQA 3PSLA 2P9SC 4NSXA 1O6GA 3OKYA 2HXCA 1VZ2A 3MUOA 3PSCB 4FA5D 2GNQA 2H9MA 3F3FA 2BKLA 3DDUA 3PXTD 3UVOA 2I0RA 4J0XA 5K19A 1QFMA 4GMBA 1GXRA 3V9FA 4PBYA 3I7KA 5C9ZB 4J79A 2QC5A 3V7DB 1N6FA 5M61A 4X61B 3ZE0A 4GM9A 5CXCA 3MZLA 4A08A 3OKWA 3I7NA 3SFZA 5M5TA 3KCIA 3VH0A 4JT5C 4CY3A 3EI1A 5FLXg 3MXXA 4AN0A 2H9NA 3GD1I 4GM3A 4L3GD 2P9IC 3FCUA 3E0CA 1TYEA 5EALA 1VZ3A 1VYHC 4E5ZA 3VGZA 4CY5A 3PXSD 3KRWB 5IGQA 1PGUA 3IVMA 5M5SA 2IWKA 3NIGA 3C5MA 1OLZA 4O3TB 4ESGA 4A7JA 2VDMA 3K71A 3OF7A 1JOFA 3OKYB 3I8CA 2J55H 3HFQA 4X63B 4UM9A 3IJ0A 4JHNA 5C92A 4Z8LA 3IJCA 4AOWA 2QXVA 4J78A 4ZN4A 4WK2A 2H9PA 3IULA 1JTDB 3UR4A 1K32A 4CZYA 4U1EI 3A0FA 4QAMA 3RN1D 5EAPA 3EU7A 2PBIB 5CXCB 4GM8A 4A08B 3SN6B 1I2MB 2AQ5A 1PI6A 2CE9A 4Y7RA 2I0SA 4BL0A 3EI1B 4JD2C 4OZUA 1BPOA 1PBYB 5FKQA 1PEVA 1E8NA 3EQ7A 3JAMg 4E54A 2G9AA 5GXIA 4J87A 1M1XA 4O1QD 5IT9g 4BCBA 2CO0A 4J82A 5IC7A 4E5ZB 2UZXB 1B9YA 3I7OA 3ULEC 5M5RA 4CY2A 4TZ4A 5EM2A 4A11A 4FA4D 1GG2B 2BCJB 2XZGA 4JSVC 1GOFA 3EI2A 4DNWA 2VDOA 1UOPA 2QZPA 2QR5A 5EARA 1FWXA 1JV2A 2W18A 2Z2NA 3NVNA 4AMZA 1GOGA 2CN3A 4BUJC 4J8GA 3IKOA 4Y5RD 2XDWA 3NIFA 4MMZA 2EIBA 2HU7A 4L1QD 4N14A 4BP8A 4QQEA 4E54B 4EWRA 3AH8B 1O6FA 2B4EA 3EI4A 2CN2A 3OL2A 3J80g 5I5JA 4A2LA 2WQ8A 4JT6C 4D9SA 3UVKA 4NBMA 4HDJA
chains in the Genus database with same CATH topology
3NIGA 2VDRA 4G1EA 3V4PA 3ZDYA 1JV2A 2VDMA 3IJEA 3K71A 3ZE0A 3NIDA 4Z7QA 4O02A 1M1XA 4IRZA 3T3PA 4UM9A 3FCSA 3VI4A 2VDNA 1U8CA 3ZDXA 4Z7NA 3ZDZA 3NIFA 4WJKA 5FFGA 4UM8A 5E6UA 4MMZA 2VC2A 3T3MA 4WK2A 4MMXA 4WK4A 4WK0A 2VDLA 3K6SA 5E6SA 3VI3A 3FCUA 4G1MA 3ZE2A 1TYEA 4Z7OA 3K72A 2VDQA 4MMYA 5E6RA 5HDBA 4NENA 1L5GA 5FFOA 3V4VA 2VDPA 3ZE1A 2VDOA 2VDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIG A;  2VDR A;  4G1E A;  3V4P A;  3ZDY A;  1JV2 A;  2VDM A;  3IJE A;  3K71 A;  3ZE0 A;  3NID A;  4Z7Q A;  4O02 A;  1M1X A;  4IRZ A;  3T3P A;  4UM9 A;  3FCS A;  3VI4 A;  2VDN A;  1U8C A;  3ZDX A;  4Z7N A;  3ZDZ A;  3NIF A;  4WJK A;  5FFG A;  4UM8 A;  5E6U A;  4MMZ A;  2VC2 A;  3T3M A;  4WK2 A;  4MMX A;  4WK4 A;  4WK0 A;  2VDL A;  3K6S A;  5E6S A;  3VI3 A;  3FCU A;  4G1M A;  3ZE2 A;  1TYE A;  4Z7O A;  3K72 A;  2VDQ A;  4MMY A;  5E6R A;  5HDB A;  4NEN A;  1L5G A;  5FFO A;  3V4V A;  2VDP A;  3ZE1 A;  2VDO A;  2VDK A; 
#chains in the Genus database with same CATH topology
 3RRM C;  1TYQ C;  4A11 B;  4CI1 A;  5GSA A;  2AGZ A;  4ERY A;  2IUV A;  2H13 A;  5E6U A;  5SXM A;  1ERJ A;  5EMK B;  1H2X A;  1T2X A;  2VZ1 A;  4QL1 A;  4WK4 A;  2VDL A;  4O45 A;  1TBG A;  4RE5 A;  2OVP B;  2B5M A;  2YNN A;  4KFM B;  4ERQ A;  2H6N A;  5TF2 A;  3IIY A;  2TRC B;  2YMU A;  1XIP A;  2CO0 C;  3JRO A;  2HJB A;  3EMH A;  3V4P A;  2GC7 A;  2XL2 A;  1VE7 A;  4D6V A;  3K27 A;  4A09 A;  4JXM A;  1E5T A;  3ORV D;  5EMM B;  4BCD A;  3OL2 B;  2OVQ B;  1U8C A;  2AGX A;  1XKS A;  2H6Q A;  3I89 A;  2H6K A;  4GGA A;  3EI3 A;  3NVX A;  3ODT A;  4U7A A;  2MTA H;  3MKQ A;  4MMX A;  3K6S A;  4GGC A;  3I7L A;  2HJ4 A;  3U4Y A;  3MKS B;  5E6R A;  5HDB A;  4FA1 D;  3EWE A;  4LG9 A;  5TEF A;  3UKU C;  5FKS A;  3BG0 A;  3SBQ A;  1H2W A;  3RN0 D;  4IA9 A;  3JZG A;  4JSN C;  3EQ8 A;  3MZK A;  2P9P C;  2VDN A;  3MUN A;  3VI4 A;  2IAA A;  2AGY A;  2H68 A;  2VC2 A;  5KDO B;  1QFS A;  1C9L A;  4A09 B;  4QT8 A;  5H14 A;  4I79 A;  2VDQ A;  2YNO A;  1SQJ A;  4RE6 A;  3IIW A;  5JWZ A;  4BP9 A;  3EI3 B;  4A0B A;  5H1M A;  4UI9 R;  2EBS A;  4OWR A;  5A2Q g;  3IJ1 A;  5I5M A;  2I0T A;  4CI8 A;  3DM0 A;  3CIK B;  4LGN A;  4ES0 A;  1JMX B;  2J56 H;  4J81 A;  4O3U B;  4Z7N A;  3B7F A;  2HKM A;  2HU5 A;  3C9C A;  2G99 A;  2VZ3 A;  4H5J A;  1NR0 A;  4YVD A;  3AFC A;  3DSM A;  2I3S A;  2PM7 B;  4JSX C;  4L1M A;  4ERZ A;  3KRX B;  3JZH A;  3GRE A;  2HYE A;  5HE3 B;  2IWF A;  1L0Q A;  2OK6 A;  4CC9 A;  1VE6 A;  3QI0 A;  4J77 A;  3J81 g;  3W15 A;  2P9N C;  5AFU 3;  4DNV A;  4CZX A;  2UZY B;  3EQ9 A;  3N0D A;  2CE8 A;  5HE2 B;  3SLE D;  3UKR C;  4A0B B;  3PVW B;  4CZV A;  1SHY B;  3SWS D;  1A0R B;  1UTC A;  2XU7 A;  1YR2 A;  5EAM A;  3JZN A;  1E8M A;  4ZOV A;  4QRJ A;  5EMJ B;  4O9D A;  2AGL A;  5K1C C;  4FWW A;  3L4M D;  5EM2 B;  5HE1 B;  5M5U A;  2Q7Q A;  3OW8 A;  4IRZ A;  3I8E A;  1R5M A;  4O2W A;  3SVW D;  3AL9 A;  2B5L A;  4MK0 B;  1SQ9 A;  2EIC A;  3JRP A;  3T3M A;  5AMS A;  3CFS B;  3DXK C;  3IUN A;  3EI2 B;  2JKX A;  1N6D A;  3VI3 A;  3ZE2 A;  5C86 A;  1MG3 A;  2GC4 A;  4PBZ A;  1S4U X;  1L5G A;  3C99 A;  3V4V A;  1U2V C;  3GFC A;  5FKR A;  5TDH B;  4G55 A;  1Q47 A;  2H14 A;  4GQ1 A;  2P9U C;  4GQ2 P;  1U4C A;  4X3E A;  3IUJ A;  5TEE A;  4Z7Q A;  3RMZ D;  4FB1 D;  2OK4 A;  4GZ8 A;  3T3P A;  3EI4 B;  3RSE C;  4UM8 A;  1GP2 B;  3VA6 A;  3IUM A;  3EG6 A;  4WK0 A;  3NVQ A;  5E6S A;  5M5V A;  2OJY A;  2EID A;  5I5I A;  5FQD A;  1P22 A;  2IUP A;  3RFG A;  4DNU A;  2PM6 B;  1C9I A;  4K3I D;  1NEX B;  2YB8 B;  5FA5 B;  2VDP A;  4H5I A;  4NAA A;  3SMR A;  4PNK B;  3SBP A;  3UVM A;  4Z7O A;  2YBA A;  2IUQ A;  3L4O D;  3C75 H;  3IUQ A;  3SCY A;  3SHF A;  3IJE A;  3PXW D;  5CYK A;  1RI6 A;  3GC3 B;  5FKT A;  2P9K C;  4PSW B;  3JPX A;  1UOQ A;  3FCS A;  4GGD A;  2AH1 A;  4R7A B;  4ZOY A;  4L3H D;  2I3T A;  3BWS A;  4CI3 A;  1GOT B;  4JHP C;  4CY1 A;  3O4I A;  5IJ8 E;  5GMK n;  2Z2O A;  4IMM A;  3I7H A;  4A2M A;  4AX4 A;  2H3X A;  2PM9 A;  5FFO A;  4FAN D;  3MVD K;  2VDK A;  4G1E A;  5EML B;  4ZOZ A;  2H47 A;  2BBK H;  4CI2 A;  4O02 A;  4AMY A;  4D0K A;  3O4H A;  4A0A A;  3AL8 A;  3IUR A;  3SXT D;  4FHL A;  3UVL A;  5FFG A;  3PVU B;  3I7P A;  4J8B A;  2YNP A;  2OIZ A;  4J86 A;  3JB9 L;  2AH0 A;  4J73 A;  5B4W A;  5H17 A;  4FA9 D;  3DWL C;  5CYK B;  3O4G A;  1MDA H;  2HU8 A;  2B5N A;  4FAV D;  4XEI C;  4NEN A;  1H2Z A;  1A12 A;  4NC4 A;  3SJL D;  3ZWL B;  1K3I A;  4BCC A;  2P9L C;  3QHY B;  4XYH A;  2VDR A;  4ZOX A;  3P4F A;  4G56 B;  4BH6 A;  4GQB B;  3CFV A;  5CXB A;  5HYN B;  1UOO A;  2PM9 B;  2H9L A;  2XE4 A;  4AN1 A;  2OVR B;  3FM0 A;  3MMY A;  1JMZ B;  1OMW B;  2J57 G;  5THA A;  4J84 A;  1QNI A;  4MMY A;  3SBR A;  4A0A B;  3AL8 B;  4PC0 A;  4XYI A;  1B9X A;  5HQG A;  3DXM C;  2IUR A;  2CNX A;  4J0W A;  4K3J B;  4PSX B;  3V5W B;  2XYI A;  3F3G A;  3NID A;  4X60 B;  5AJA A;  3FGB A;  1JJU B;  3RFH A;  3OKT A;  3ZDX A;  4LG8 A;  1N6E A;  3ZDZ A;  2O9K A;  2Z2P A;  5GXH A;  5IJ7 E;  1GOH A;  3RLM D;  4G1M A;  4JSP C;  5CXB B;  3K72 A;  1XHM A;  3K26 A;  3N0E A;  2AGW A;  3O4J A;  1K8K C;  1H2Y A;  4L9O A;  4PXW A;  3ZE1 A;  5FXY A;  3F3P A;  3PE7 A;  2HKR A;  3I2N A;  2XL3 A;  2HES X;  3ZDY A;  2EIE A;  3FRX A;  5HE0 B;  5C2W B;  1MG2 A;  3UVN A;  3BG1 A;  4AEZ A;  3OTT A;  5IGO A;  4WJK A;  5C2V B;  1YFQ A;  3PSL A;  2P9S C;  4NSX A;  1O6G A;  3OKY A;  2HXC A;  1VZ2 A;  3MUO A;  3PSC B;  4FA5 D;  2GNQ A;  2H9M A;  3F3F A;  2BKL A;  3DDU A;  3PXT D;  3UVO A;  2I0R A;  4J0X A;  5K19 A;  1QFM A;  4GMB A;  1GXR A;  3V9F A;  4PBY A;  3I7K A;  5C9Z B;  4J79 A;  2QC5 A;  3V7D B;  1N6F A;  5M61 A;  4X61 B;  3ZE0 A;  4GM9 A;  5CXC A;  3MZL A;  4A08 A;  3OKW A;  3I7N A;  3SFZ A;  5M5T A;  3KCI A;  3VH0 A;  4JT5 C;  4CY3 A;  3EI1 A;  5FLX g;  3MXX A;  4AN0 A;  2H9N A;  3GD1 I;  4GM3 A;  4L3G D;  2P9I C;  3FCU A;  3E0C A;  1TYE A;  5EAL A;  1VZ3 A;  1VYH C;  4E5Z A;  3VGZ A;  4CY5 A;  3PXS D;  3KRW B;  5IGQ A;  1PGU A;  3IVM A;  5M5S A;  2IWK A;  3NIG A;  3C5M A;  1OLZ A;  4O3T B;  4ESG A;  4A7J A;  2VDM A;  3K71 A;  3OF7 A;  1JOF A;  3OKY B;  3I8C A;  2J55 H;  3HFQ A;  4X63 B;  4UM9 A;  3IJ0 A;  4JHN A;  5C92 A;  4Z8L A;  3IJC A;  4AOW A;  2QXV A;  4J78 A;  4ZN4 A;  4WK2 A;  2H9P A;  3IUL A;  1JTD B;  3UR4 A;  1K32 A;  4CZY A;  4U1E I;  3A0F A;  4QAM A;  3RN1 D;  5EAP A;  3EU7 A;  2PBI B;  5CXC B;  4GM8 A;  4A08 B;  3SN6 B;  1I2M B;  2AQ5 A;  1PI6 A;  2CE9 A;  4Y7R A;  2I0S A;  4BL0 A;  3EI1 B;  4JD2 C;  4OZU A;  1BPO A;  1PBY B;  5FKQ A;  1PEV A;  1E8N A;  3EQ7 A;  3JAM g;  4E54 A;  2G9A A;  5GXI A;  4J87 A;  1M1X A;  4O1Q D;  5IT9 g;  4BCB A;  2CO0 A;  4J82 A;  5IC7 A;  4E5Z B;  2UZX B;  1B9Y A;  3I7O A;  3ULE C;  5M5R A;  4CY2 A;  4TZ4 A;  5EM2 A;  4A11 A;  4FA4 D;  1GG2 B;  2BCJ B;  2XZG A;  4JSV C;  1GOF A;  3EI2 A;  4DNW A;  2VDO A;  1UOP A;  2QZP A;  2QR5 A;  5EAR A;  1FWX A;  1JV2 A;  2W18 A;  2Z2N A;  3NVN A;  4AMZ A;  1GOG A;  2CN3 A;  4BUJ C;  4J8G A;  3IKO A;  4Y5R D;  2XDW A;  3NIF A;  4MMZ A;  2EIB A;  2HU7 A;  4L1Q D;  4N14 A;  4BP8 A;  4QQE A;  4E54 B;  4EWR A;  3AH8 B;  1O6F A;  2B4E A;  3EI4 A;  2CN2 A;  3OL2 A;  3J80 g;  5I5J A;  4A2L A;  2WQ8 A;  4JT6 C;  4D9S A;  3UVK A;  4NBM A;  4HDJ A; 
#chains in the Genus database with same CATH homology
 3NIG A;  2VDR A;  4G1E A;  3V4P A;  3ZDY A;  1JV2 A;  2VDM A;  3IJE A;  3K71 A;  3ZE0 A;  3NID A;  4Z7Q A;  4O02 A;  1M1X A;  4IRZ A;  3T3P A;  4UM9 A;  3FCS A;  3VI4 A;  2VDN A;  1U8C A;  3ZDX A;  4Z7N A;  3ZDZ A;  3NIF A;  4WJK A;  5FFG A;  4UM8 A;  5E6U A;  4MMZ A;  2VC2 A;  3T3M A;  4WK2 A;  4MMX A;  4WK4 A;  4WK0 A;  2VDL A;  3K6S A;  5E6S A;  3VI3 A;  3FCU A;  4G1M A;  3ZE2 A;  1TYE A;  4Z7O A;  3K72 A;  2VDQ A;  4MMY A;  5E6R A;  5HDB A;  4NEN A;  1L5G A;  5FFO A;  3V4V A;  2VDP A;  3ZE1 A;  2VDO A;  2VDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...