3NIGA

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 112
structure length 457
sequence length 457
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nigA00
4MMXA 3VI4A 5HDBA 2VDKA 4NENA 3ZDXA 4WK2A 2VDNA 4IRZA 3K72A 5FFGA 3ZE1A 4O02A 3T3MA 4Z7OA 5E6RA 5E6UA 3FCSA 4UM9A 4WK0A 1TYEA 3T3PA 3NIDA 3FCUA 1L5GA 2VDLA 3NIFA 1U8CA 5E6SA 3V4PA 3ZE0A 3ZE2A 2VDRA 4Z7NA 2VDMA 4WJKA 4WK4A 2VC2A 3NIGA 2VDPA 3V4VA 3VI3A 3ZDYA 4MMZA 4Z7QA 4G1MA 1JV2A 3ZDZA 1M1XA 2VDOA 3K6SA 4MMYA 3IJEA 3K71A 4G1EA 2VDQA 4UM8A 5FFOA
chains in the Genus database with same CATH superfamily
2PM9B 4NENA 2XYIA 4A0BB 3QHYB 4AN0A 3CFSB 4NAAA 5EMLB 3SCYA 5E6UA 3DDUA 2OK6A 3C5MA 1PGUA 2PM6B 1O6FA 4J0XA 4ZOXA 5KDOB 2YMUA 4CY2A 2MTAH 3U4YA 3F3PA 2IWKA 4XYHA 4X60B 4BUJC 2OJYA 3RMZD 3IURA 3BG1A 3MUNA 4JSNC 3SHFA 3N0EA 2AGYA 1QFMA 2PM9A 1JTDB 5K1CC 4GM3A 1TBGA 4E5ZA 3KRXB 5C86A 4ZN4A 4E54A 4WJKA 2AGLA 3UKUC 3PVUB 4BL0A 3K27A 4NSXA 5M61A 1JV2A 3I7OA 2HYEA 3K26A 2G99A 4GQ2P 4XYIA 3RFHA 4ESGA 4GM9A 2B5NA 2J57G 4A7JA 4XEIC 2B4EA 2QC5A 2H13A 4O9DA 2AH1A 2H9LA 4O45A 1H2WA 3SMRA 3OF7A 5M5RA 5M5SA 3PVWB 4ZOVA 5FQDA 1VE6A 1NR0A 4A11A 4LG9A 3JZHA 5TEFA 4WK4A 4JT6C 2XU7A 4AMZA 4RE5A 1YR2A 5HE2B 3L4OD 2AGXA 4AN1A 2B5LA 4J8BA 3SWSD 3SLED 3SBQA 4G1EA 4I79A 2VDQA 2EIBA 4Y7RA 3IJ0A 3ZDXA 3QI0A 2OK4A 3IULA 4FA9D 3I8EA 2OVQB 2YBAA 4J0WA 1N6DA 4BCCA 1TYEA 1MG3A 2G9AA 3NIDA 4G55A 3ZE2A 5EM2B 4CC9A 4DNVA 4CY3A 2H14A 5EMJB 1SQJA 3JRPA 3NIGA 5H1MA 4CZXA 4CY5A 1I2MB 4Z8LA 5H14A 4Z7QA 2CO0A 3GD1I 2EIEA 4A0BA 4L1MA 3C99A 4CY1A 3IJEA 3A0FA 2H6QA 3EG6A 5GXHA 2HKRA 2P9LC 5I5MA 4PSXB 3NVQA 3PXTD 5HYNB 2HESX 2VDNA 4JXMA 1H2ZA 3MMYA 3T3MA 4MK0B 1E8MA 1XKSA 1R5MA 2AH0A 2Z2OA 3FGBA 4GM8A 4X3EA 2VZ3A 3BWSA 3EI4B 3MKQA 3IUQA 3NIFA 3V5WB 5TEEA 4GZ8A 2IUQA 1U4CA 2IUPA 5IGOA 3SVWD 5CXCA 2XL3A 4PBYA 3RLMD 1UOQA 2PBIB 5GXIA 3OL2A 3DM0A 2B5MA 4FWWA 4UM8A 3J81g 3MXXA 1GG2B 1QFSA 5M5UA 2OIZA 4J78A 1GP2B 2TRCB 3C75H 1P22A 3ORVD 2HJ4A 4CI1A 2HXCA 2BCJB 3DSMA 4TZ4A 3GC3B 4JT5C 3SN6B 2CE8A 4CZVA 4FAVD 3MZLA 5AFU3 3V4VA 4E54B 3EI2A 2QR5A 3EI1B 2QZPA 5FKQA 2H47A 4A0AB 2GNQA 5IC7A 5IT9g 1B9XA 3KRWB 4UI9R 3RN0D 3V7DB 5IGQA 2XE4A 5HQGA 4RE6A 4J82A 3K72A 3OKWA 3JZGA 3UVNA 2HJBA 2H6KA 2OVPB 3IUNA 5IJ8E 1ERJA 5TDHB 4AOWA 2O9KA 1S4UX 2CO0C 3FM0A 5EARA 3AL9A 1PBYB 1O6GA 3V9FA 4PC0A 3W15A 3RSEC 4A08B 4DNWA 2EICA 1SHYB 3OTTA 3UVOA 4YVDA 3P4FA 2I3TA 4U1EI 2VDKA 4D0KA 1UTCA 1N6EA 2BBKH 2I0SA 3C9CA 4BCDA 3EI3A 5B4WA 1U2VC 4PNKB 4LG8A 3O4JA 3SFZA 3AFCA 4K3JB 4D6VA 3SJLD 4JSXC 3T3PA 5CXBB 2YNNA 2P9NC 3SXTD 3HFQA 4JHPC 2W18A 4GGAA 3B7FA 5FXYA 5CYKB 5EAPA 1JMXB 1K8KC 3DXKC 3UKRC 4L3GD 4QRJA 2YNPA 4EWRA 4AX4A 2Z2PA 4R7AB 4IRZA 2IWFA 4J77A 5EALA 5M5TA 5FA5B 3VH0A 1VZ2A 4A09A 4CI3A 1B9YA 3AL8A 4ZOZA 5HE3B 1L5GA 1PI6A 3CIKB 3L4MD 1K32A 3CFVA 4QAMA 4NC4A 5TF2A 4U7AA 2EBSA 3K6SA 3OKTA 4J87A 1UOPA 4J81A 3K71A 3EQ7A 2WQ8A 3IJ1A 3PXWD 4L1QD 5HDBA 3MVDK 3JB9L 2H3XA 2P9KC 3AL8B 4ZOYA 3O4IA 4O02A 4J84A 5FKRA 1YFQA 2EIDA 1UOOA 5AMSA 5FLXg 4QQEA 5C2WB 3RRMC 5SXMA 2H9PA 3RN1D 1OMWB 3MKSB 3FCUA 1XIPA 4H5JA 3MZKA 2VDMA 2VC2A 3JAMg 4QT8A 2P9UC 3AH8B 3OKYA 4CZYA 4MMYA 3GFCA 3SBRA 3SBPA 1GOFA 4FA4D 4GQ1A 5CXBA 3PSCB 5C2VB 4O3TB 1VYHC 1GOTB 3OKYB 2AGWA 3FRXA 3IIYA 4L3HD 5K19A 3I2NA 1NEXB 4UM9A 4WK0A 3KCIA 1RI6A 4AEZA 5E6SA 1U8CA 3O4HA 2GC4A 4IMMA 1A0RB 3VI3A 4GMBA 4A08A 4MMZA 2Z2NA 4NBMA 1M1XA 3IUJA 5EMMB 5FKSA 4BP9A 5THAA 3IIWA 4JSPC 1FWXA 3PSLA 2J56H 3ZWLB 4GQBB 3ZE1A 1MG2A 4J73A 1A12A 1QNIA 1H2YA 4A2LA 1TYQC 1VE7A 1OLZA 1JJUB 1N6FA 2CN3A 2QXVA 4J79A 4J86A 4JHNA 5EAMA 3IUMA 3JROA 3JZNA 4A0AA 4A09B 4L9OA 3EI1A 3EI2B 5IJ7E 4FAND 4PSWB 2I0RA 1XHMA 1GOHA 3PXSD 2Q7QA 5JWZA 5C9ZB 4MMXA 4X61B 4K3ID 4OWRA 5CYKA 3ULEC 1MDAH 1BPOA 4Z7OA 3EMHA 1C9IA 4JSVC 4O3UB 2OVRB 5EMKB 5I5IA 2H6NA 3ZE0A 2VDLA 4D9SA 3DWLC 3UVLA 2H68A 2P9SC 3J80g 3OL2B 3I7NA 1E8NA 4A2MA 3F3GA 2IURA 5FKTA 5I5JA 1GOGA 2XDWA 3EI3B 4G56B 3ZDZA 5CXCB 2JKXA 4H5IA 2XZGA 4CI2A 2CE9A 3RFGA 4FA5D 1VZ3A 4LGNA 3EI4A 4BCBA 2H9NA 4OZUA 4WK2A 4J8GA 4N14A 2VZ1A 4FHLA 5E6RA 1GXRA 3F3FA 3EQ9A 3EWEA 3JPXA 2J55H 3IKOA 1K3IA 4IA9A 3V4PA 2I3SA 3I8CA 2XL2A 4G1MA 4BP8A 5A2Qg 2AQ5A 5H17A 2YNOA 3IJCA 1SQ9A 1JMZB 5EM2A 5FFOA 3E0CA 3VI4A 4CI8A 1JOFA 5C92A 3VGZA 3GREA 2BKLA 4JD2C 4QL1A 4FB1D 2CN2A 1L0QA 3DXMC 4ES0A 3NVXA 2CNXA 4KFMB 2GC7A 3FCSA 4O2WA 1E5TA 3ODTA 4O1QD 5HE1B 4GGCA 2P9IC 4GGDA 4X63B 2I0TA 2PM7B 1T2XA 2P9PC 3EQ8A 3ZDYA 4FA1D 4BH6A 3NVNA 5M5VA 2HKMA 4A11B 2H9MA 3EU7A 5FFGA 3I89A 3UVMA 4AMYA 4DNUA 1PEVA 3BG0A 5HE0B 3I7HA 5AJAA 1H2XA 3UR4A 4ERQA 4HDJA 1Q47A 2HU5A 3IVMA 3I7KA 3VA6A 2UZXB 2HU8A 4PBZA 2VDRA 4ERYA 2UZYB 4Z7NA 2VDPA 2YB8B 2AGZA 2HU7A 3UVKA 4ERZA 3MUOA 1C9LA 2VDOA 3I7LA 3PE7A 2IAAA 5GSAA 3I7PA 3N0DA 3O4GA 4PXWA 5GMKn 4E5ZB 3OW8A 2IUVA 4Y5RD
chains in the Genus database with same CATH topology
4MMXA 3VI4A 5HDBA 2VDKA 4NENA 3ZDXA 4WK2A 2VDNA 4IRZA 3K72A 5FFGA 3ZE1A 4O02A 3T3MA 4Z7OA 5E6RA 5E6UA 3FCSA 4UM9A 4WK0A 1TYEA 3T3PA 3NIDA 3FCUA 1L5GA 2VDLA 3NIFA 1U8CA 5E6SA 3V4PA 3ZE0A 3ZE2A 2VDRA 4Z7NA 2VDMA 4WJKA 4WK4A 2VC2A 3NIGA 2VDPA 3V4VA 3VI3A 3ZDYA 4MMZA 4Z7QA 4G1MA 1JV2A 3ZDZA 1M1XA 2VDOA 3K6SA 4MMYA 3IJEA 3K71A 4G1EA 2VDQA 4UM8A 5FFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMX A;  3VI4 A;  5HDB A;  2VDK A;  4NEN A;  3ZDX A;  4WK2 A;  2VDN A;  4IRZ A;  3K72 A;  5FFG A;  3ZE1 A;  4O02 A;  3T3M A;  4Z7O A;  5E6R A;  5E6U A;  3FCS A;  4UM9 A;  4WK0 A;  1TYE A;  3T3P A;  3NID A;  3FCU A;  1L5G A;  2VDL A;  3NIF A;  1U8C A;  5E6S A;  3V4P A;  3ZE0 A;  3ZE2 A;  2VDR A;  4Z7N A;  2VDM A;  4WJK A;  4WK4 A;  2VC2 A;  3NIG A;  2VDP A;  3V4V A;  3VI3 A;  3ZDY A;  4MMZ A;  4Z7Q A;  4G1M A;  1JV2 A;  3ZDZ A;  1M1X A;  2VDO A;  3K6S A;  4MMY A;  3IJE A;  3K71 A;  4G1E A;  2VDQ A;  4UM8 A;  5FFO A; 
#chains in the Genus database with same CATH topology
 2PM9 B;  4NEN A;  2XYI A;  4A0B B;  3QHY B;  4AN0 A;  3CFS B;  4NAA A;  5EML B;  3SCY A;  5E6U A;  3DDU A;  2OK6 A;  3C5M A;  1PGU A;  2PM6 B;  1O6F A;  4J0X A;  4ZOX A;  5KDO B;  2YMU A;  4CY2 A;  2MTA H;  3U4Y A;  3F3P A;  2IWK A;  4XYH A;  4X60 B;  4BUJ C;  2OJY A;  3RMZ D;  3IUR A;  3BG1 A;  3MUN A;  4JSN C;  3SHF A;  3N0E A;  2AGY A;  1QFM A;  2PM9 A;  1JTD B;  5K1C C;  4GM3 A;  1TBG A;  4E5Z A;  3KRX B;  5C86 A;  4ZN4 A;  4E54 A;  4WJK A;  2AGL A;  3UKU C;  3PVU B;  4BL0 A;  3K27 A;  4NSX A;  5M61 A;  1JV2 A;  3I7O A;  2HYE A;  3K26 A;  2G99 A;  4GQ2 P;  4XYI A;  3RFH A;  4ESG A;  4GM9 A;  2B5N A;  2J57 G;  4A7J A;  4XEI C;  2B4E A;  2QC5 A;  2H13 A;  4O9D A;  2AH1 A;  2H9L A;  4O45 A;  1H2W A;  3SMR A;  3OF7 A;  5M5R A;  5M5S A;  3PVW B;  4ZOV A;  5FQD A;  1VE6 A;  1NR0 A;  4A11 A;  4LG9 A;  3JZH A;  5TEF A;  4WK4 A;  4JT6 C;  2XU7 A;  4AMZ A;  4RE5 A;  1YR2 A;  5HE2 B;  3L4O D;  2AGX A;  4AN1 A;  2B5L A;  4J8B A;  3SWS D;  3SLE D;  3SBQ A;  4G1E A;  4I79 A;  2VDQ A;  2EIB A;  4Y7R A;  3IJ0 A;  3ZDX A;  3QI0 A;  2OK4 A;  3IUL A;  4FA9 D;  3I8E A;  2OVQ B;  2YBA A;  4J0W A;  1N6D A;  4BCC A;  1TYE A;  1MG3 A;  2G9A A;  3NID A;  4G55 A;  3ZE2 A;  5EM2 B;  4CC9 A;  4DNV A;  4CY3 A;  2H14 A;  5EMJ B;  1SQJ A;  3JRP A;  3NIG A;  5H1M A;  4CZX A;  4CY5 A;  1I2M B;  4Z8L A;  5H14 A;  4Z7Q A;  2CO0 A;  3GD1 I;  2EIE A;  4A0B A;  4L1M A;  3C99 A;  4CY1 A;  3IJE A;  3A0F A;  2H6Q A;  3EG6 A;  5GXH A;  2HKR A;  2P9L C;  5I5M A;  4PSX B;  3NVQ A;  3PXT D;  5HYN B;  2HES X;  2VDN A;  4JXM A;  1H2Z A;  3MMY A;  3T3M A;  4MK0 B;  1E8M A;  1XKS A;  1R5M A;  2AH0 A;  2Z2O A;  3FGB A;  4GM8 A;  4X3E A;  2VZ3 A;  3BWS A;  3EI4 B;  3MKQ A;  3IUQ A;  3NIF A;  3V5W B;  5TEE A;  4GZ8 A;  2IUQ A;  1U4C A;  2IUP A;  5IGO A;  3SVW D;  5CXC A;  2XL3 A;  4PBY A;  3RLM D;  1UOQ A;  2PBI B;  5GXI A;  3OL2 A;  3DM0 A;  2B5M A;  4FWW A;  4UM8 A;  3J81 g;  3MXX A;  1GG2 B;  1QFS A;  5M5U A;  2OIZ A;  4J78 A;  1GP2 B;  2TRC B;  3C75 H;  1P22 A;  3ORV D;  2HJ4 A;  4CI1 A;  2HXC A;  2BCJ B;  3DSM A;  4TZ4 A;  3GC3 B;  4JT5 C;  3SN6 B;  2CE8 A;  4CZV A;  4FAV D;  3MZL A;  5AFU 3;  3V4V A;  4E54 B;  3EI2 A;  2QR5 A;  3EI1 B;  2QZP A;  5FKQ A;  2H47 A;  4A0A B;  2GNQ A;  5IC7 A;  5IT9 g;  1B9X A;  3KRW B;  4UI9 R;  3RN0 D;  3V7D B;  5IGQ A;  2XE4 A;  5HQG A;  4RE6 A;  4J82 A;  3K72 A;  3OKW A;  3JZG A;  3UVN A;  2HJB A;  2H6K A;  2OVP B;  3IUN A;  5IJ8 E;  1ERJ A;  5TDH B;  4AOW A;  2O9K A;  1S4U X;  2CO0 C;  3FM0 A;  5EAR A;  3AL9 A;  1PBY B;  1O6G A;  3V9F A;  4PC0 A;  3W15 A;  3RSE C;  4A08 B;  4DNW A;  2EIC A;  1SHY B;  3OTT A;  3UVO A;  4YVD A;  3P4F A;  2I3T A;  4U1E I;  2VDK A;  4D0K A;  1UTC A;  1N6E A;  2BBK H;  2I0S A;  3C9C A;  4BCD A;  3EI3 A;  5B4W A;  1U2V C;  4PNK B;  4LG8 A;  3O4J A;  3SFZ A;  3AFC A;  4K3J B;  4D6V A;  3SJL D;  4JSX C;  3T3P A;  5CXB B;  2YNN A;  2P9N C;  3SXT D;  3HFQ A;  4JHP C;  2W18 A;  4GGA A;  3B7F A;  5FXY A;  5CYK B;  5EAP A;  1JMX B;  1K8K C;  3DXK C;  3UKR C;  4L3G D;  4QRJ A;  2YNP A;  4EWR A;  4AX4 A;  2Z2P A;  4R7A B;  4IRZ A;  2IWF A;  4J77 A;  5EAL A;  5M5T A;  5FA5 B;  3VH0 A;  1VZ2 A;  4A09 A;  4CI3 A;  1B9Y A;  3AL8 A;  4ZOZ A;  5HE3 B;  1L5G A;  1PI6 A;  3CIK B;  3L4M D;  1K32 A;  3CFV A;  4QAM A;  4NC4 A;  5TF2 A;  4U7A A;  2EBS A;  3K6S A;  3OKT A;  4J87 A;  1UOP A;  4J81 A;  3K71 A;  3EQ7 A;  2WQ8 A;  3IJ1 A;  3PXW D;  4L1Q D;  5HDB A;  3MVD K;  3JB9 L;  2H3X A;  2P9K C;  3AL8 B;  4ZOY A;  3O4I A;  4O02 A;  4J84 A;  5FKR A;  1YFQ A;  2EID A;  1UOO A;  5AMS A;  5FLX g;  4QQE A;  5C2W B;  3RRM C;  5SXM A;  2H9P A;  3RN1 D;  1OMW B;  3MKS B;  3FCU A;  1XIP A;  4H5J A;  3MZK A;  2VDM A;  2VC2 A;  3JAM g;  4QT8 A;  2P9U C;  3AH8 B;  3OKY A;  4CZY A;  4MMY A;  3GFC A;  3SBR A;  3SBP A;  1GOF A;  4FA4 D;  4GQ1 A;  5CXB A;  3PSC B;  5C2V B;  4O3T B;  1VYH C;  1GOT B;  3OKY B;  2AGW A;  3FRX A;  3IIY A;  4L3H D;  5K19 A;  3I2N A;  1NEX B;  4UM9 A;  4WK0 A;  3KCI A;  1RI6 A;  4AEZ A;  5E6S A;  1U8C A;  3O4H A;  2GC4 A;  4IMM A;  1A0R B;  3VI3 A;  4GMB A;  4A08 A;  4MMZ A;  2Z2N A;  4NBM A;  1M1X A;  3IUJ A;  5EMM B;  5FKS A;  4BP9 A;  5THA A;  3IIW A;  4JSP C;  1FWX A;  3PSL A;  2J56 H;  3ZWL B;  4GQB B;  3ZE1 A;  1MG2 A;  4J73 A;  1A12 A;  1QNI A;  1H2Y A;  4A2L A;  1TYQ C;  1VE7 A;  1OLZ A;  1JJU B;  1N6F A;  2CN3 A;  2QXV A;  4J79 A;  4J86 A;  4JHN A;  5EAM A;  3IUM A;  3JRO A;  3JZN A;  4A0A A;  4A09 B;  4L9O A;  3EI1 A;  3EI2 B;  5IJ7 E;  4FAN D;  4PSW B;  2I0R A;  1XHM A;  1GOH A;  3PXS D;  2Q7Q A;  5JWZ A;  5C9Z B;  4MMX A;  4X61 B;  4K3I D;  4OWR A;  5CYK A;  3ULE C;  1MDA H;  1BPO A;  4Z7O A;  3EMH A;  1C9I A;  4JSV C;  4O3U B;  2OVR B;  5EMK B;  5I5I A;  2H6N A;  3ZE0 A;  2VDL A;  4D9S A;  3DWL C;  3UVL A;  2H68 A;  2P9S C;  3J80 g;  3OL2 B;  3I7N A;  1E8N A;  4A2M A;  3F3G A;  2IUR A;  5FKT A;  5I5J A;  1GOG A;  2XDW A;  3EI3 B;  4G56 B;  3ZDZ A;  5CXC B;  2JKX A;  4H5I A;  2XZG A;  4CI2 A;  2CE9 A;  3RFG A;  4FA5 D;  1VZ3 A;  4LGN A;  3EI4 A;  4BCB A;  2H9N A;  4OZU A;  4WK2 A;  4J8G A;  4N14 A;  2VZ1 A;  4FHL A;  5E6R A;  1GXR A;  3F3F A;  3EQ9 A;  3EWE A;  3JPX A;  2J55 H;  3IKO A;  1K3I A;  4IA9 A;  3V4P A;  2I3S A;  3I8C A;  2XL2 A;  4G1M A;  4BP8 A;  5A2Q g;  2AQ5 A;  5H17 A;  2YNO A;  3IJC A;  1SQ9 A;  1JMZ B;  5EM2 A;  5FFO A;  3E0C A;  3VI4 A;  4CI8 A;  1JOF A;  5C92 A;  3VGZ A;  3GRE A;  2BKL A;  4JD2 C;  4QL1 A;  4FB1 D;  2CN2 A;  1L0Q A;  3DXM C;  4ES0 A;  3NVX A;  2CNX A;  4KFM B;  2GC7 A;  3FCS A;  4O2W A;  1E5T A;  3ODT A;  4O1Q D;  5HE1 B;  4GGC A;  2P9I C;  4GGD A;  4X63 B;  2I0T A;  2PM7 B;  1T2X A;  2P9P C;  3EQ8 A;  3ZDY A;  4FA1 D;  4BH6 A;  3NVN A;  5M5V A;  2HKM A;  4A11 B;  2H9M A;  3EU7 A;  5FFG A;  3I89 A;  3UVM A;  4AMY A;  4DNU A;  1PEV A;  3BG0 A;  5HE0 B;  3I7H A;  5AJA A;  1H2X A;  3UR4 A;  4ERQ A;  4HDJ A;  1Q47 A;  2HU5 A;  3IVM A;  3I7K A;  3VA6 A;  2UZX B;  2HU8 A;  4PBZ A;  2VDR A;  4ERY A;  2UZY B;  4Z7N A;  2VDP A;  2YB8 B;  2AGZ A;  2HU7 A;  3UVK A;  4ERZ A;  3MUO A;  1C9L A;  2VDO A;  3I7L A;  3PE7 A;  2IAA A;  5GSA A;  3I7P A;  3N0D A;  3O4G A;  4PXW A;  5GMK n;  4E5Z B;  3OW8 A;  2IUV A;  4Y5R D; 
#chains in the Genus database with same CATH homology
 4MMX A;  3VI4 A;  5HDB A;  2VDK A;  4NEN A;  3ZDX A;  4WK2 A;  2VDN A;  4IRZ A;  3K72 A;  5FFG A;  3ZE1 A;  4O02 A;  3T3M A;  4Z7O A;  5E6R A;  5E6U A;  3FCS A;  4UM9 A;  4WK0 A;  1TYE A;  3T3P A;  3NID A;  3FCU A;  1L5G A;  2VDL A;  3NIF A;  1U8C A;  5E6S A;  3V4P A;  3ZE0 A;  3ZE2 A;  2VDR A;  4Z7N A;  2VDM A;  4WJK A;  4WK4 A;  2VC2 A;  3NIG A;  2VDP A;  3V4V A;  3VI3 A;  3ZDY A;  4MMZ A;  4Z7Q A;  4G1M A;  1JV2 A;  3ZDZ A;  1M1X A;  2VDO A;  3K6S A;  4MMY A;  3IJE A;  3K71 A;  4G1E A;  2VDQ A;  4UM8 A;  5FFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...