3NIGE

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
214
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 40
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigE02
5B21A 5IVOA 1C7SA 2VABB 3BKYH 1FZOB 4FQJL 1B4RA 3OAUH 2ZNXA 3B3IB 3A6CH 4ZD3L 3TEUA 5KSAA 3L7FB 1MIMH 4H25B 4M1CD 3KYNA 3RAJH 3AGVA 4U1KA 4QRPD 3V7AE 1HHGB 4G43A 3O41B 3VA6A 4PJHF 3VMOA 2P47B 4XP1H 2ZUUA 4OCNC 4WHYG 3QZWA 3MCKB 5EUOB 3U6RA 1A2YA 1SJEB 4QRPE 1TJIH 3BDYH 4LRIA 1C16B 4ODWB 1BFVL 3Q3GA 5BVJB 9CGTA 5FDWB 4NPYA 1VFBA 3BZFB 4RQQB 3A6OA 1EUUA 2EE3A 5ESQB 1IILE 1RJLA 2JKXA 3HMWL 3LS5H 5C0GB 3SQOL 4FFYH 2BSRA 2R23A 4PJIB 4NSKB 1QLFA 4ZPTA 3GSNA 2HVJB 3KPPA 3ALWA 2EYSA 1KJ3L 4G5ZL 4HUUB 1JN6A 1RHFA 2ATPA 4KJQD 5FUCC 3VFMA 1I3UA 3KPSB 3WS6A 3HR5A 1TZGL 2P5EA 3TM6A 3ARED 1DBBH 4P5TC 3SCMD 4R4ND 3UBXA 3S97C 1G7JA 1CDCA 5SWSD 1DZBA 4Q74A 1FYTE 4E9LA 2X41A 5EU7C 5BXFA 1P84K 2ZSVA 2J5LC 3MLSH 1KB9K 2ZZUT 2BNRD 3RWGB 3KG5A 1ZT4B 2DWDB 1G9EA 3QIUD 4KXZI 5CJ8A 3VH8B 3DPBA 3CCHB 1O0VA 4ONGH 2H2SC 4GKZB 1YJDH 5IHBA 4ZMAT 3MLVH 4JHAL 5DD3L 2AXFA 3I2CL 1MEXL 5SWSE 4PJFE 1SJXA 1MCWW 3ZKXC 2X4PA 3QIBB 2WLYA 1GVIA 2FX7L 4QRSA 1OP9A 2OJZL 1WFUA 2JCCB 2HRPL 4WEBH 4I4WA 3BGFB 4MDJA 5LXGL 1R3IL 1U8PA 2BSTA 4MSWB 1OARH 4YHIA 3S5LG 3BQUB 3NTCH 4WJ5B 1BP3B 5I1JH 2VLJA 1Q9LB 1UB6B 2O26U 3TWCL 2ICWB 4U1GB 3OKEB 5HHNA 5T1MA 1A8JH 2DICA 3WUWA 5DJ2A 2XXCB 1OB1A 3P30L 5J6HA 5JW4N 3LIZH 1YMHA 2Z31B 2DWEA 1NEUA 2AJXH 5DD0L 4JRWA 5BW7C 3T0EE 2LABA 1LO0H 2P7TA 3D69A 3QG7H 4LSRL 5JHLH 1RK1A 4MJ4A 3UBXI 1G7IB 5EPMB 1GHFL 3NCJH 2Q6WB 1BVLB 4K3GA 2NLJB 3PGFL 3THMH 1JPFA 4Z5RA 4K9EL 4M62H 1QR1A 3EO0A 4U1MA 2PTTB 1AI1L 2A9MH 2A9NH 4D0DA 1CZ8L 2A73B 2F74B 1J0HA 4PJBA 4PJAE 4ZNEE 1UACL 3MNVA 3C5ZC 1BQHG 2DL2A 5FYKU 3H42L 1EA9C 1HINL 1AIFA 1P5VA 3ILQD 5TH2B 2VDRL 3ULVH 1GAFL 5FXCH 4PUBL 1Q72L 3VE0B 1SEQH 2H1PL 5INCA 4PLOB 3IFLH 1I3GL 2VLKD 2YA0A 5EU5A 4C4KT 4YHPA 4MAUL 4IS6A 4DKAA 3DRTA 2NR6D 2Q86B 2DI9A 1BF2A 4Y8DC 1AE6H 4HMCA 4N5ED 4BM7A 3REWB 4DGVL 5IB1B 3P73B 4LMQE 5C71A 2OJEA 4P5TA 5CIPH 1JNHA 1WBYA 1A1OB 4P99A 1UJ3B 5F7HA 3VXNB 3GMQA 1CR9L 1K9TA 4KQ4H 4WDIA 4OZHE 2JELH 4CVXA 1Z2KA 3LHPL 1NBZB 5HGDA 3B8SA 4L4TB 4D9LL 5I19H 5JNYB 1RUML 3O9WA 1YNKL 3GGWB 1ZLUH 1MWAH 4HLZG 1JGVL 4W81A 4EXKA 2IADA 3HE7C 2XQBL 1ACYH 2AI0L 1CLOL 4HS8H 4OLUL 1RD6A 5F7DA 3FB8A 3KPOA 4B5EA 5H35B 5T5FL 3ARVA 1FCGA 2R0LH 4MD5B 2X42A 2VRAA 5A2KH 5IEHB 3FQTA 1DUYA 1ZVSB 4XRCA 5C0ND 3MREB 3MMEA 4DUXA 3AAZB 4MNHB 5DHYB 5EU3B 1RZIA 3OKNA 5CD5C 5DQ9B 4KK6C 4LOUC 1OW0C 2Y5TA 4QRQB 4P4KD 5C3TA 1A9EB 4XNXL 1FL6B 3G5XA 2IGFL 1FNEB 5DURD 2IH1A 4P2OD 4XXCA 1ZGLP 2V7NA 5GGSB 4M1CC 4NQCB 4OD2B 4XGZB 2I5YL 1NFIB 3GSQB 4I0CC 2GTWA 2OTPA 3IDMB 2P8PA 4DKEH 4MNQA 5DD5L 5C8JB 3C5ZA 5I75B 1M6OA 4WUUE 2O5YL 4GW5A 5L0QB 3BKMH 4X5WA 4OZGB 3T08A 4LPTA 3HZVB 3W5NA 4XP9L 5IT2H 4DZBA 4WHTA 3BWAA 2VDPL 5DS8B 5K9KA 2RAMA 1DLFL 2CDGB 5ESAA 5TJWK 2MOVA 4KQ3L 5ACZA 2GI7A 3I75A 2EEDA 2HJFA 3QWOA 2EO1A 4Q6IA 3QO1A 2B4CH 2BMKA 1TTGA 3R8QA 1HH9B 1PKQA 3QNXB 2F5BH 1GIGL 1LEKB 1LP9A 4P3WA 4X6DB 3LQAL 3QCVH 1JVKA 2E7LA 4X5LA 1NGXB 5GGUB 4XXDA 1CFQB 1E4XL 5D7IB 1LDSA 1L7IL 4KJQC 3RWEA 1YNLH 3O11A 4Y89A 4EUPG 1Z0NA 3W0WB 5EO9A 1TZHB 2I9TA 3AREC 4K07A 4YAQB 1HHKA 4R4NC 4U1IA 3SCMC 4BZ2H 1XCTB 2ITDB 2DAVA 2X4NB 4LLVB 5EOQH 1VFAA 4WNQB 2V17L 5IMKA 3HE7A 4J2XA 1NAMA 5IFJA 3QDMD 5SWQA 1T83C 4Z0XA 3QIUC 2X1OA 5MERA 4FP8H 2CO7B 4RBPK 3PP3H 3BAEH 1F90L 5C0BA 4U1LA 5DEFA 1YPZE 4XCNB 4KC3B 3TT3L 3LKPA 2QHRH 4OM0H 1T1XA 1KPVB 2GJZA 3TN0B 2UZIH 3V4UH 3EO9L 4L8CA 4WI8A 5IW1B 4U6HB 3HE6A 5EBMA 4ZS7L 3QDME 5IVXB 4Y4FB 5IEKB 5I1CH 1JMXA 5GJTL 1YMMB 4XBEL 4PJEA 4XP6H 1T21A 3RGVA 1VADB 4RGMB 2EH7L 3DLQR 1AO7B 3TPUB 5IBTH 1HN1A 3TC9A 4TRPL 5LWYL 4E0RB 3EHBD 1CDYA 3SDDB 5IGXH 2CLRB 1H3TA 4NOBA 4WHDA 2NX5B 5EO0A 5GRVK 4OF7A 2A6DA 1SBSH 1BQHA 4EZMA 2ZKHL 1I8LC 3KXFE 3ORJA 4LQ1A 4LIQL 2VQTA 4KHXL 3IETB 3VFGL 1TTUA 3DBXB 1SJHA 5KSBF 5DT1H 3RWCB 4X4YA 3DV4B 4LLUA 3ZE0F 3LS5L 4AMKH 1U92A 3OKMB 5E5UB 3RVVD 1IC7L 1N4XH 3FQRB 5CGYD 4XVTL 1HH6B 3DURA 3PWUA 4LBEA 1FDLH 4NUJB 4M03A 4PV8A 4PJXF 3ILQC 3MUJA 1GZPB 3H3PH 4LPVA 3SKMB 4JZNA 2FB4H 2NY5H 4LPYA 4K7PH 3GI8L 1FNSL 2H6PA 3IDJA 2FIKA 4OJFH 1DQJA 3HCVB 2EDKA 2V2XB 2K7QA 4KGJA 2OLDA 3P4MA 1YZZA 5D5MA 2X9WA 3Q6FB 1XF2B 4FQIH 5FKPB 2NR6C 4PJ7E 2IAMB 2HLAB 1UENA 4N5EC 2HTLD 3MLVL 2YMXH 2F19H 5IFAL 4GT7A 2P8LA 3AREA 1PZUB 3QHZH 3SCMA 5DJ8B 5JXED 1D5ZA 4KRPB 4LVOC 4MD0A 1AKJB 3EW3B 4DOHE 4EOWH 1RJYB 4ZS6D 2BNRA 5DJ0B 3BPOC 5T5NG 3W5MA 2IF7A 1IGFL 2Y72A 1T83A 3D3VA 4NNPL 1K5NB 4BSWB 3N06B 3F58L 3LN5A 1IKFH 3BYTA 2VIRB 3GK8H 3IS1X 3KPQA 3FO0H 1WUNT 2NQCA 3AUVA 2DQDL 3VXRB 5HYQA 1FFNA 3HHRB 3JWOC 2E3VA 2AV7B 2FX9H 3CLEH 1FZJA 4NN6B 3VFSA 4NJ9H 1BQLH 1XH3A 1JNJA 4JO2H 2X4OA 2AK1H 1NCAH 1TQCB 3KWWB 4QRUB 3BW9A 2MQCA 3L7EA 4QRRA 1BIHA 5DQJB 2ZUTA 4Z8FL 2UZXB 4MJIA 4KHTL 5C0NC 2APTA 4ZOBA 3ZT6A 3G6JF 4YDIL 5E00A 4P5MA 3TVMB 2EO9A 5ICYB 5GS1C 4AENB 1DQQB 3I50L 4PY7A 1PDKA 5GGVL 1VGKA 3EBAA 4P4KC 1LD9B 4XP5L 3GMOB 2DD8L 3QUXD 5IESL 5EC1A 1AD9A 5J11C 4MXVE 4P2OC 1EMTH 5AWNH 3D1MC 1QFWI 1HWGB 5E8OB 4OF6A 4JKWA 3WFBH 3BKJL 1T2QL 1RURL 3MZGB 3JV6A 5ITBH 3IFLL 3PV6A 4DFHA 1OGTA 2HP4A 3RVWC 5L2JB 5HDQL 1WFTA 1NJ9B 4K3EH 2Q7YA 4U0QB 5IMMA 2GITA 3LKQB 1UYWH 5JPNB 3ZMRA 4WI4A 4D3CH 5T1DH 1A6UL 1KB5H 4HBQA 2V7HA 1NMCC 4NN7B 4EI5A 3ZO0A 5F72S 2VLKA 2KZWA 4OCRH 3S37L 1AQDA 1B0RB 4EUPA 3CGTA 1BWWA 2H32H 4L9DA 5SX5H 1IKNA 3O2VL 3HNTH 1MELA 5CINL 4POYA 1ACYL 1I1YB 2R4SL 1GOHA 3PABA 3JTSA 4TUJA 5J7CC 3H6JA 1ACZA 4YXHH 1G6RB 2BXZA 3T0WA 5E8NA 3FL7A 4R4BA 3MA7A 1NAKL 1KC5L 5B38G 1U8IB 2GUOB 4OQTA 3WKMH 5CEXB 1OTUD 3PP4L 1VFUA 4GRLB 4Z78B 4FZEL 3MCG1 3L3HB 4HCRH 5ANME 1UCBH 1FNAA 4G6ML 4UB0L 4NO0A 1OT1A 4U6VH 4YR6B 3RY5A 5DWUH 2PR4H 1FSKC 5GXBB 1OY3B 1J0IA 2FSEA 3ZE2E 4GMSH 4NHCL 1U8QB 3UJJH 5TE4H 5HYJD 5ISZB 1D7FA 4JDVA 3U7WH 1E4WH 2ZOKB 1DVFB 2R1YB 2EYRA 2E7CA 5FYJH 4YK4C 1LK3L 3TZVA 5DDHB 4X5XA 4LSVL 4AIZB 3DMMA 5F9JB 5GGSY 4J3XA 1BLNB 4JDZA 3JBG7 4TPRH 4K8RH 1NC4B 3MO1B 3QRGL 1RVFL 4LSTL 2CSPA 5TQ2L 1EV2E 2ED8A 3EHBC 4Y5XA 1FO0A 1FV1A 1F4WL 1PW3A 1PQZA 4P2OA 1KCSL 1FPTH 2ZSWA 3S34H 2JJTA 5D7LD 3VFVB 4JO4H 1ETZB 3MJ8A 1SHMA 4F8QA 2OR9H 4A6YA 4UQ2A 2VXTH 3TO4A 1FG2B 3RTQA 1M05B 3VCLA 3RWHA 1OCWH 2YPKB 4K2UH 3HC0A 4Z7VB 5DSCA 4IOFD 2W38A 5HYIA 3DO7A 1BF8A 1XGTA 2F5BL 3RVVC 1D9KD 1ZTXL 3RVTD 4ZSOB 3QG6A 3VXSD 1A0QL 5CGYC 3PWLB 2WAHA 1QBML 4M7ZC 3IKCB 1UM5L 4NN5B 4LRNH 3CLFL 1P4IH 4YHKH 3MOAL 4TTDD 2G2RA 3G5YA 1MJUH 5DZLA 4PJHE 1NGYA 1IC1A 3ULSB 4HKBB 3SQBA 1S7XB 2VITA 3VXSE 4FTVA 1P2CB 4WY7L 4KU1A 4GBXB 1M7IB 3EDJA 2H9GA 3LEXA 1J0ZA 3LH2H 4KVNL 4QCIA 5I8KL 1T7ZA 1QBLH 3MLRH 2QQKH 1YEHL 3VFPA 5EH1A 3T0XA 1R6VA 3HZMA 3VDAA 1FORL 5D9SA 4X0KA 2HTLC 2GHWB 4N8CH 5E4EC 4Y1AD 2VDNL 3PIQB 4OCXL 1CF8L 1WIOA 3C6LB 1DE4A 3U4EB 4DVBA 4O2CB 3SKUD 5LCVH 5JXEC 5IR1B 3D39D 4ZS6C 5IW6B 2WUCH 4HZLA 4MQSB 3U7YL 4MXWL 1OAXL 3D18B 5AYUH 2FX8L 1PLGL 3T4YA 4UT7L 4JGUA 4XWGL 3ULVD 1L0YA 1BQUA 1I8MB 3GHEH 2W9EH 4JFYA 5EBWB 5I1EH 4HAFA 4LSPH 4N8VG 2HFFA 1OGAE 5IGXL 3WHXB 4S1SL 3ARFB 1M4KA 2XPGA 3EOBA 3BP4B 3H9ZA 2EDTA 3FKUS 4X99A 5CJOL 3F8UB 1YN6A 3MRLA 3QBTB 2Z8WC 3C60D 5D2LA 5C70A 3K8LA 3Q6GH 5I1DA 4XBGB 3P0YL 1C1EH 1RUQH 1N4XL 3HLAA 5KTEH 2AAVA 3HAEG 3KPRB 4A2MA 5D1XB 2UWEA 3QUXC 5I1IH 2NTSP 2AGJH 2AQ2A 4MX7A 4S11A 3ESVF 2PF6A 3QO0B 3IDGA 1HKLL 4QF1A 3DRQA 3BSZH 3WFDH 4PJGB 3R0NA 3AC0A 3ILPA 1BPVA 2D0FA 5JORA 3BN3B 2AK4A 2FJGA 5CJXA 5I1KH 5GZOD 3PGDA 1RJCA 3NN8B 3QDJB 5FF6A 4FQIL 2LTQC 4Z7WA 3K2UL 4JREB 4QHMA 1XEDA 4LSUL 2YRPA 4XX1E 2XOTA 5D8JH 1OHQA 2C4XA 3P77A 3I84A 2BJMH 3ZSTA 4G6JL 5J13C 1MRFL 5I15H 5DK2B 3DUHA 3P9MB 3F7YB 4S10A 4JRYD 3ZE1F 3SKNB 5C3LD 3TF7C 4PBWD 5KSVB 2DDQL 2ZOLA 3BO8A 1V7NL 4NQEB 3HG1B 1WBXB 2GCYB 1KF9B 2FATL 3VFWA 3VFTB 4FQQA 4K71B 3H0TA 2BFVL 4NM4L 4J6RL 4PR5B 2DTML 5D6CB 5GJSH 5IQ7L 5F1SA 2JB6B 4JRYE 4QRTB 3IGAB 3IU4H 2GEEA 5GRZA 2VUOA 1TPXB 1P84J 4G3YL 1Q1JH 2VZ1A 2IALB 5DJDA 1IEBB 1BJ8A 2PUQT 2AJ3A 2XKNB 2Z92A 5MEPB 4ODSL 4FQ2H 1CT8B 4R90L 3OB0K 3SJVD 5I71C 1IM9B 1A1NB 1B4JL 4KVCL 1OTUC 2R9HD 5T3XH 5E8EA 4DAGH 4OD3L 4XNYH 4JN2A 4LKCA 5B3NA 4JY4A 3V4PH 3DV6A 2BSSB 4KKCD 4F9PC 1T04B 3GUTA 2YWZA 4YO0A 3SJVE 5JOEA 4OGAD 1BZ9B 1GGIH 4PGBA 5DUMH 2AJUL 2ZJSL 4OAWB 4I48B 5I1AB 1QBAA 3H7BB 4B53A 5CMAB 2CDFB 3K8KA 4BFEA 1JZ2A 3C5JA 1ZLVK 3T2QA 2V2TB 4HFUH 4HK3N 3TBVA 4HD9A 1CK0H 2R1XB 3OBAA 3PWNB 5HGGS 5E6ZA 1JFQL 3UJIH 3GJFA 1DSFL 4QYOA 1MNUH 5BRZD 1DBJH 4I2XB 4GLRH 4EDWL 2XZZA 3T65B 1LNUB 1X4XA 3NFPB 3QUXA 3MRHB 3GSRB 4NUGL 3SDXF 4P2QB 1I9EA 2IQAB 5ICXA 1CFVH 4S1RL 1IGTB 1RIUH 5DQDL 5AZEL 1BJ1J 5HI4D 1I1AA 4WW1B 5EWIL 1BVZA 1UVQB 3OJMB 1AXSA 4JFHD 4RMUA 5SWZE 4UINL 3U1SH 3BESR 5TFSL 2E27H 3W2DH 2A6KA 2KL6A 1YJDC 4UIMA 4NGHL 1HHHA 4P9HL 3ARDD 1JRHI 4PYHA 2X4UB 5C7XH 5ILTH 2GTZA 4IOFC 5HPMA 1X7QA 4ELKB 1D9KC 2AVGA 3RVTC 3ME0A 2LAAA 4P49A 2ADGA 4JFHE 32C2B 3T77A 4DN4H 5C0CD 3R4DA 5DJXA 4RGOH 1F4YH 3IU3A 2DQFB 3I6GA 2GT9B 4LHUD 3RBSA 4LLYB 4TTDC 4YX2L 2Q8AL 3OAZH 1DN0B 1HSAA 4GMTH 4PRHD 1N7MH 1SQ2N 3VD3A 3DVNA 3PHQA 4NP4L 5FO8A 5C0CE 1P4BL 4RFNB 3D25A 1M71B 1ZVYA 4ZYKA 3WD5L 2F5AL 4Q9BA 3BGAA 3NA9L 4X7TA 4IOIB 4PRHE 2AKRB 1CLYL 1A5FH 4RZCA 2BCKB 5IK3B 3CFBA 3OAYK 4U6VL 4J7RA 1AY1L 5ENWA 2OYPA 1K3IA 3MV9E 3UC0L 1QFWL 4YLQT 3VG0L 2MQ0A 4BQBA 3K80A 3QXDB 5C09B 2C3HA 1E4WL 1T1YA 4IRSB 4N8VA 4ODTL 3P4NA 5CEYB 3Q1SL 1D5MA 1CBVL 3CFJB 2IH3A 4F9PA 4G7VH 1MRCL 4U7MA 1GC1L 3ULVC 1KJMA 2KUTA 4OI8A 2BDNH 2VDQH 4OM1L 5J1AB 5CJQH 5C0IB 3GSWB 3AY4C 1NCNA 4Q58C 1K3ZA 5FECB 1PKOA 3GMMA 5F7YC 1U8HA 2CRZA 4WV1C 3GMPA 1D5BB 1FPTL 5C07A 5HYJA 1T0MA 3O2DH 2NY7H 4ODXA 5B4MD 1WZ1H 2D4FA 5F9WC 4GG6F 3HAEA 4L8SB 1OL0A 3C60C 3HS0B 2X70B 2BNQB 4LAJH 4WO4A 1R5IB 3LN4B 3ZYIA 4P57A 1ZGLA 2SEBB 2DKSA 1HIMH 3STBA 2P8MA 4QXGH 1YN7B 2IPKA 5I1GH 5DMKA 4OSUH 1NGQH 3FRPG 2HKHH 3L3DA 1UZ6F 4BH8B 4XCYA 1KOAA 2FH8A 2WK2A 3QQ4A 2C26A 2X10A 4DQOH 3LV3B 1BX2B 5AEAA 4MDIB 1D9KA 2NY4B 4XMLL 5F7WC 4JDTL 5GZOC 2IQ9H 25C8L 4ZFZA 3HPJA 2LE9A 3A67H 1JPSH 1T7YA 3BIBX 4YHMH 2J8UB 5L9DH 4XP4L 1MHPH 1QBLL 4UDUB 1U91A 1T2JA 2PTUA 4LSQL 1IL1A 3WFHB 5KN5A 4IJ3B 4NQDD 3VGDA 5KSBE 4YNYB 3EGSB 3ZE0E 2V2WA 4CU7A 3SBWA 1TCRA 1TJHL 2EIZA 4KK5D 4WI2A 1N5AB 2WUCL 5L88L 4PJXE 1FZMA 5MEND 3MRNA 4NQDE 1IAOB 3IJHA 4Y1AA 4TULL 1X4ZA 4ETYA 4QT5A 4M7LL 4IDJH 5DJ6B 4HQQL 3MV8B 3DUUB 4HH9A 4H1LG 4LSPL 1P7QD 4OQTL 2R2BA 1DANT 3D39A 1MCSA 1NBVL 3K4DA 2IANB 5MENE 2FJFB 5BJTB 3EFDH 5TDNB 4AEHH 2R9HC 4YBLC 1KCVH 1J8HB 1P4LB 2NY2D 1L7TH 2C5DC 2ADFH 1A9BB 5F7NC 3VWJD 2IBZX 3PWPE 5DRWA 3L5XH 4DZ8A 1FHGA 3OGCB 4BH7A 3AY4A 4KKCC 1UA6L 4Z0BH 1CDJA 5CCKH 4OGAC 4R2GB 4P5KB 4NM8H 4WV1A 4XCEA 5C0JB 3B9KD 4APQD 3RUGE 4QOKA 5F9OH 1BIIA 1ES0B 2B4CC 5C08A 4ZTOH 1UWXH 5TE7H 3DTXA 1A3LH 2DQHH 3KYMA 1LEIA 2GJ6D 4JRXD 2IEPA 2X4SB 1BWMA 3C60A 2A6JB 2C3VB 3MOBL 3V2AR 4JFEE 1J12A 4H26A 3GMRB 1NH6A 5F6IC 1T3FA 1V3LA 4EVNA 4L8DB 2GJ6E 3WFZA 4ORGA 3GRWH 1MREL 5T1KB 3LEYL 4U1NA 4A6YL 1IC5H 5HI4C 5FEBA 1YUHB 3G6JE 1KJ2L 4U3HA 3S7GA 2DJUA 1J1OL 3IDXH 2NY6D 2BERA 2VC2H 5B39G 4WW2A 3IYLW 5EA0H 4ELMB 2W9DH 3ZKXB 4JFPA 5GSRB 3ARDC 4X6EA 5IQ9A 4M9OA 3O8XC 4LVNC 5JO5B 5CJ5A 1LEGB 1R0AL 4H20L 3CDGA 4M3JA 3LD8B 1EIBA 3ELAT 3V5HA 1HILB 4HIHB 2CDEA 3X13A 4NQVA 3DVGB 1EEUA 2X05A 2FR4B 2DYPD 1GGCL 5FYJD 5JDJA 4KH2A 1QYGL 4HWBH 5GRUH 1UKQA 2NY0D 3Q2CA 4YHNA 1JTOA 4G9FE 2FJHB 2BVPB 1S9WB 4G8GB 4PRIB 4K8RD 3KLDA 4HUWB 1OP5K 1OAZL 1UQSA 1E27A 5LVEA 5H2BB 1P7KB 3L5HA 5FYJE 3RX8A 2VXUL 4JFQA 1YEIL 3K0WA 1FFOA 3NFNB 5D4QA 5JMRA 1EEYA 1T0PB 1I9RH 3VMPA 3WXWH 3VXMB 1T1WB 1WZMA 3VD9A 2OQJB 5DJCA 5HYSB 2MCPL 1HCVA 4XNMA 3QUMB 4J12A 1GOGA 4IMKC 4RFOL 5GRVL 4HS3A 5F3HA 1XF3A 1QA9B 2Y6SD 3QFJD 1CXEA 2E9JA 4BQCA 5D1QA 4OCSH 3HUJB 3UZEA 4CMMA 3MCLH 5C9JB 1MNUL 3E6HB 4ZUUA 3H9SD 2NY5C 3T3PF 1I9JL 4NWTH 4XCCL 3ARGB 1KENL 1PSKL 2CGRL 4MMZC 3WN5C 1OD7A 2J7LA 2X4QB 4EEEA 3WLBA 4CDHA 5I76A 1Z5LA 3QFJE 4Q2ZB 3ZYJA 1CE6A 1L4IA 5F93C 4J3OC 3FN0H 4F58H 2VZOA 1DQML 2EZ0D 3MRPA 4XPFH 5B4MC 1A4KB 2JIXB 3H9SE 3M1BA 5BRZA 3RY6A 4E41A 1KV3A 4G8IA 3O4LD 3EKCA 3UTSB 2R1WA 5C7XL 5KOVC 4HUKB 4TNWK 3SO5A 5FO7A 1DR9A 3SDYL 1NLDH 3B9EA 1BZ7A 1C5DB 2PW2A 1PZ5B 4M93B 4UNUA 1MCNA 3SGEH 1IBGH 3L6FA 3OX8B 3QDGD 2F8VA 3OKOA 5BMFH 1F4YL 3V0AC 4X8XA 4YHYC 2VQ1A 2CPCA 2GK0A 4L5FH 4Q0XL 2HMID 4GMTL 4JFDE 2HN7B 3O6KL 1NUGA 3VG9C 3OR7B 4M7KH 3O3EB 1JK8B 3QDGE 5ERWB 2ADJA 3PQYB 4KAQH 4EN3A 3CVHB 5J9PB 3CXHJ 2Y1VA 1GXEA 4R4FL 4HV8B 1DN2A 5D1ZA 4DGYH 3G08A 2FO4B 3MXWL 2P48B 4E5XA 2CKBH 3JZ7A 3A0OA 4JG1H 2X44D 4CW1A 3PGCA 4LLDA 5IKCA 1F02I 4MQ7A 2JJSC 2XWTB 3STLB 3MV7E 3DHMA 3LS4L 2HT4D 3QIWD 3OB0H 4KK5C 4FNLH 3L3KB 3MJ7B 4FQCL 3U36A 3GIZH 1KIQA 5KVGL 4U7SA 2ARJB 3I6KB 3BIKB 3I6LE 1HOCA 3BHBA 4IM8A 1FRGH 4QRPB 1C8PA 3O3DA 4Y2DD 4MMXC 1MFCH 2P45B 3CMOH 3VXOB 2OBGA 2LQRA 1S7UB 3FQUA 3GBMH 4WCYL 1S9YA 1JRHL 5DD1L 1I9IH 2JTDA 5I1LA 1LO4L 4BQ6A 1MPAL 5IJKC 2NY2C 5DRXB 5I16B 1WK0A 5E5MB 1LE9B 1FG9C 4PGEB 2DQIL 3S96A 3VWJC 3ZTNL 5DYOB 1LDPH 3QEUA 3LOWA 4GUPB 1UXSA 3R8BB 1T6WA 3MRQA 2QKIB 1HHJA 4HLJA 2NW3B 4RMQA 1IVLA 1DFBH 1KLUB 3MFFA 4M02A 4NHUA 1RHHB 5IVZB 3B9KC 4APQC 2GAZA 3T4AB 4ZOEA 1IFHH 1G9NH 4R8WH 3IFNL 1FYTB 1IE5A 4LCUB 4GRMA 3CUPB 4OZFG 3D9AH 2E6PA 4K3JH 5HHXH 1F5WA 3U48A 3FB5B 3EJYD 4DQOL 4I77H 2ZG2A 3L5WA 3N0PB 5D70L 5MEQA 1X5LA 3QUZD 4YHZH 3A67L 1BOGA 1H8OA 4YHOH 1D6VH 5LBSL 5T3XD 1FH5L 3ZTJG 1HEZA 1NFKA 1JWSA 5CGTA 3QIUB 5IM7A 3ROLA 1I1CA 4HC1H 1RZJH 1R5WA 2NY6C 4WU5A 3PG2A 5D7JD 1CGYA 2H41A 2XTLA 3BDBA 5TPWL 4JJ5A 1N8ZB 1MFEL 4DJMA 3BKCL 5E99H 2IPTL 4KTEL 4WTWA 2HA1A 5E2TH 3T0EB 2YZ1A 4L3ED 3O6LH 3WNMA 4BA8A 3OAYH 4PJ8A 5EZOH 1A7PH 4G8FB 2NY0C 4G80A 4JM4H 5ALBL 1WC7A 5FK9B 4K8RC 3CDFA 1G6RH 4PJAB 3CFDB 3GEWB 3G6AA 4X6CA 5JUEL 1AGEA 4PP2B 1MVUA 1TJGH 4MD4A 1ZA3B 3W9EA 4AM0A 1YEDA 1A7QL 2R29L 3PDGA 2GY5A 1FL3B 3KPMA 1QACA 1P7QA 2RIKA 1W72H 4K23H 4NZRL 2J8OA 4LLAA 3ZE1E 3V5DA 3ZSSA 3M45A 3JTTA 1QSEE 3WUZA 1SEBB 5F9OL 1F11A 2AJYH 3U7AA 2VZUA 1CGSL 4JFXA 1KB5A 3AMKA 2Y6SC 2GFBA 2LFGA 5KAQG 3TBTA 3KLAA 3SKJL 1U95A 2J1KA 1RUPL 3BUYA 1FNGA 1LK2B 4ZAKB 2BVQB 1I3RB 5F1NA 4PRPE 1QQDB 2H32A 1JHTA 3CSYB 3PWJB 1CDBA 4JRXA 2CLZA 3U0TA 4TTGA 4OZHB 1IAKB 3QULA 1F3JB 4YE4H 4ZFFB 2APBA 1R3HA 2EZ0C 1W2KT 3G04B 4QXUH 2DQTL 5F89A 4N5UA 3I9GH 1U8JB 1F97A 5IROA 5FYLL 1CIUA 2K9UA 3BXNB 3QDHA 1LO5B 4IRZH 1G7PB 1HXMA 1RK0B 2VLLA 4LVOB 4P9ML 3BP7A 5CZKA 2DBLH 4G8EB 1M1SA 1JGLH 3PE9A 4X6CF 2CD0A 3BPOB 4I3RL 2FHBA 1KFAL 1DEEB 1RQ5A 3QNYA 1B6DA 4ZXBD 4AH2B 1AFVH 3QJHA 1ZANL 4YZFE 4M6OH 3EO1A 4OCWH 3QIBD 3VD5A 4GS7C 3PV7A 4OD1L 2Y06L 1Q38A 5DRNB 5E1AB 1QTYT 4X7SL 2HMIC 1JGEA 5MEOB 3DECA 1T4KA 2D7PA 4JLRA 1B88A 3SDCA 1XCQB 3MUHL 2ZUXA 4LLWA 3BQUD 5D2NA 4NO5B 3SDXE 3ZLQC 1NFDA 4ZOAA 4NZUH 3L9RB 4R7NB 3ZL4H 4OBSA 5CILH 5EUKA 5AZ2L 4X4ZA 4KUZL 1GGBL 4FFVD 4PREB 1PGRB 3N85H 3NABL 3MGOB 3LSOA 3HA0A 3D85B 4V1DD 3BEWA 2B2XH 2AJZB 2YKLL 5GS1B 4GKSB 4K3DL 2HT4C 2FWOB 3QIWC 1MJ7L 1UZ8A 4Y19D 2YPLA 4Y0GA 5JLZA 1VPOH 4POUB 1AGCB 4WUUB 1XF5B 3WE6A 5J11B 3FFCE 5DURB 3WFCH 4V1DE 3MODH 2K3TA 4ONFH 2IPUK 4KMQA 4UTBH 4MNGB 4PGDB 3BP5A 4Y2DC 4PG2C 2RCSL 3QB7C 1CXKA 4MB3A 4Y19E 3PHOB 3VU2A 1T5XA 4H5SB 5IB3A 2IFGA 4YXKH 2VMFA 2DTSA 1M7DA 3D48R 4LU5L 1AQKL 1FVEB 3B2UD 3CD4A 5F8QC 5F3BB 3OXRA 3LRSB 1NMCB 4QHKI 5JDSB 3IFOA 1GSMA 1WVZA 4NT6B 5DMJB 4UT6L 1I8KA 1KNOA 1NMBL 3VRIB 4R97C 1MCIA 4OZFA 5E9DE 5T3ZL 2DMKA 5ITFA 1CLZH 5EZJB 4P4RA 4ZFGL 1R3LB 2BNUA 3VGAB 3BZEA 2DB8A 4X98B 3ULUL 5DK0B 3Q48A 1F4XH 3O4LA 3QA3A 5CUSL 1AXTL 4L4TD 4QXTA 2BK8A 3EJYC 1MQKL 1TVBB 1YPZB 2UV3A 5ETUA 1CFSB 4GRWF 3QUZC 5SV4A 1RAMA 4LGRB 1Q0YH 4JM2F 4GAGL 4ODHL 1T20B 1QFUH 2AXGA 5CHNA 4WEMB 3VH8G 2XXMB 1FL5A 3QDMB 4GG6E 3BT2H 4JHZA 3HR6A 5C0RH 5K59F 4ISVB 3OB8A 4WTXA 3B2VL 2KQNA 1W0WB 4TNWF 5D7JC 5L2KE 1FN4A 4QWWD 4HS6A 1FSKB 4F7MA 4OGZA 5ABDE 3UPAA 4YEFA 2BRQA 2DKUA 1OP5H 4BFBD 3ES6B 5J3HD 3MV11 2GSIB 2IPUG 4XPHL 2PTVA 1IGMH 2B0SH 2DM2A 3CX5K 1H5BB 5B22A 1UZ6E 4LSSL 2VH5H 2UYLB 3GKZA 4YK4B 5FUZH 3DX7B 5D6DC 2YRZA 4KY1L 3L3GA 2DRUA 2YD3A 1QPPA 3EJZD 4JQXC 1HSBA 3BPCA 4D9QD 3KXFB 3GJEB 2CQVA 4NQCD 4KFZC 2J8HA 1N3NB 1X3DA 3TYFA 3FO2A 4DUWA 3CFKA 4YUEL 5CP3H 1EO7A 3ZYZA 1X5XA 4YDLB 2P49B 4NRXA 4Y2DA 4LCIH 3AXLB 1J11A 1PG7W 2HVKA 5MHSE 4GRWH 2FBOJ 5E08H 3BIAX 4JPKL 1O7VA 5FA4A 5EDXA 5DHVB 1RJZB 5JIPA 2ATKB 2VZTA 4OTXL 1J1PL 1ZE3C 1SVZA 3DX8A 3GDBA 4R7DA 4P46D 1IGIL 1XT5A 3TBWA 5J06A 3OWEA 3WS3B 3E6FA 1WISA 1XGYH 2G75A 2B1HL 1JMZA 1W8OA 2LU7A 4LKXB 2A1WL 3U9UA 2NTFB 1T7XA 4KPHL 1F6AB 3MRJB 2HTKD 3S37X 3W39B 5LGKA 3W0WD 4DOHB 1ZT7A 5E8PA 4MJ5A 2KPNA 5C0EB 1HQ4A 2YC1A 1NMAH 3QJFA 1RIVL 2IMMA 2WUBL 3G5VA 3HC3L 2G5RA 3ABZA 3T2NH 3QH3A 5D7IE 5JPMB 2YWYA 4ZTPH 1J9CT 1S7SB 1AGDA 5C0DB 3KJ4B 1GL4B 1MUJA 1QOKA 3SEPA 1PVHA 4WGWB 4UT9L 4ZXBC 2DOCA 2VL5B 4FQ1L 1DP0A 5ESVA 1UM4H 4HDIA 2X7LB 4OB5H 3TN0D 1XR9A 3QIBC 2WINB 1ZHBA 2IC2A 4WWKA 4LHQB 4HH8A 1U93B 2OSLB 3GSOA 4M7LT 2IBZY 1SM3L 1DDHA 3BQUC 3RL1B 2XWJB 3RKDD 2AEQH 4L3EA 4U1GC 4Q9RL 2QADD 2K1MA 2VABA 5D6DA 1S8DA 1FZOA 1KPUB 4FFVC 4N9GB 1X5KA 2EKSB 1W72L 3H9YA 3L7FA 3GHBL 3HNSH 3CH1B 2BOBB 3NOIA 2ARWA 5FYKH 1HHGA 1TLKA 3O41A 4PJ9A 1UB5B 3SHSA 4NWUH 4F7TB 5I8EB 3MCKA 1FNFA 2R4RH 1PG7H 3MX0A 5TQ0L 5EUOA 1SJEA 5KSUA 4JFZL 4ODWA 1FLRH 1C16A 1WWAX 1JGDA 4HPYL 1KT2B 4JQVA 4XC1L 5BVJA 1J10A 4M48L 3VWKB 5T3ZE 4M8QB 3UYRL 4PJDF 1C5BL 2GYSA 3BZFA 4RQQA 4EJ1C 5I66B 1BD2D 2EE9A 5ESQA 1G7MB 2GSGB 5F96H 2VN4A 1CL7I 3UTZB 2EDNA 3DYOA 3KNBB 3VXUB 4Z7UF 3B2UC 4PJIA 4OIIH 3C08H 4NSKA 3KVQA 1LO2L 1T89C 2OZ4H 4HUUA 3WJLC 1BD2E 4J8RB 2QSCL 4HWUA 3VGFA 3KPSA 4XVJL 1MIEH 3F7RA 2FLRT 5ICZB 5KVEL 5GGRY 1UJ3C 5F7EL 4RSVA 4KRPD 4HK0B 1AKJD 5EIVA 3OZ9L 3RWGA 5BV7H 1INEL 1ZT4A 3WCYA 2DWDA 4X7CC 5DFTA 5ANMB 3T3PE 5KOMC 3VH8A 3CCHA 4GKZA 4MB5A 1KACB 5I71B 2Y23A 1ADQA 1ND0B 2DS4A 4I1NB 5DXWA 5DTFB 3U9PH 5JR1L 3QIBA 3VXRD 4MQXD 5E6YA 2JCCA 1WZKA 1YNTB 2DLGA 1U41A 1U8LB 1OM3L 3B9DA 1F13A 2B2XL 1S9XB 2Z91B 4MSWA 2OL3A 2VDLL 4QWWC 3MRMB 3RU8L 3WKNA 1JYNA 4WJ5A 1Q9LA 1UB6A 4NRYB 2ICWA 3OKEA 5GIRB 5CEZH 5J3HC 4GAJL 3WFCL 3B6SB 4I8DA 3LMJL 4PPTA 2Z31A 2VLRE 3BE1H 5I30L 4QTIL 1Y0LA 2XY2A 1G7IA 5EPMA 4WU7B 2VAJA 1LE5B 2Q6WA 1BVLA 2EDLA 3EJZC 3JWDL 2NLJA 2HWZL 3T8XB 4I9WD 2YOCA 1ZAGA 1G1CA 4YXKL 4F9LA 4UU9B 2H8PB 2PTTA 2MPAH 2A73A 2F74A 3HZKB 4PS4H 4P59L 4X80H 5GS0H 3EOAB 1BJMA 4Y16B 4YDKL 4B41A 2OK0L 4HEPG 1JGUH 4KWUA 5L0QC 5I74B 2CMRH 1YECH 1HE7A 4QHKJ 4XPBH 1A6AB 4AQ1B 5TH2A 4CKVX 4PJHB 4TSAL 3VE0A 1KIRA 3VXSB 3QXTA 1MFDH 2BP3A 2N7BA 4HBCH 2ICWI 4BKLB 4LLQB 2MQ3A 4UUJB 1IC4L 1Q9WB 3O2WH 4P46C 3BGMB 4UNTA 1T89A 2Q86A 1NCBL 2DM3A 4HIEB 2N7AA 1NBQA 2BY3A 4EQ3A 1X5HA 3IRZA 2Q87A 3REWA 5KZCD 5E6ID 5IB1A 3P73A 3BI9X 1A1OA 1UJ3A 3VXNA 1N5YH 2HTKC 5A3ID 5DJZB 4LEOB 2A6IB 3RZCB 1I7UB 5TDPB 1M7XA 3ARBB 1KGCD 1NBZA 2NW2B 4L4TA 4NBYB 1JHKH 2DQJH 3GGWA 3SOBL 4OLZH 1EHLH 3KYAA 5JOPD 4PD4K 1BFTA 3CK0H 5E4IA 2W0PA 1CU4L 5H35A 4AT6B 5HVHB 3HC4L 1OGAB 1KGCE 1F58L 4MD5A 1YEFL 3TN0C 3RX7A 5IEHA 2YSSB 1ZVSA 5HVGB 4YXLL 3GFUA 1JV5B 3U4BL 5A16B 3RX5A 4AEFA 1KTRL 5JOPE 4LF3B 3AAZA 4MNHA 5ISZD 5DHYA 3BEVB 3F7QA 1DVFD 1FGNL 3RKDC 3OKKB 2MTPA 4RFEB 5DQ9A 4QRQA 3C8DA 3RIFK 2QADC 1A9EA 1H3GA 4K94L 1FL6A 3PXJA 4JG0H 1ORSB 1Q8MA 1FNEA 1MCFA 2HKFL 1RJLB 4UILL 5GGSA 3QEQD 3MLPA 3VXUD 4NQCA 3S3SA 4OD2A 4XGZA 1NFIA 4F7CB 4BZ1L 3GSQA 4R3SA 2R56L 5BCAA 3IDMA 3NZHL 4YWGL 5C8JA 1F3RB 3BVNB 1OAQH 4GW1B 2X5PA 1MWAB 3QUMH 4BZYA 4OZGA 3QRFM 3QEQE 2P5EB 3VXUE 3HZVA 3B43A 5E56A 2OP4H 5DS8A 4JPWH 2CDGA 3TESA 1II4E 2ZSVB 5DJYA 4QEGA 4KJYB 2HFGH 5F97E 2DIAA 3D0LB 3QPXL 2ITCB 4JKLA 1H3PL 4Y8AA 1HH9A 1NGWB 3QNXA 2AABL 4GBXD 1NMAL 1LEKA 3G9VA 4X6DA 5EFIB 2KQMA 5H94A 4HWBA 1NGXA 4JB9H 5HHVL 4PGZA 1CFQA 4X9IA 4JRYB 2X4TB 4NRZB 4GQPH 4I4WB 4XPAL 1IGCL 3W0WA 2H26B 5JXAH 4QKXB 1PAMA 2BVTA 4YHIB 4YAQA 3LPGA 2ADIB 1XCTA 2ITDA 4KRPC 2X4NA 3NCEB 4LLVA 5KS9F 4YQXH 4PLKD 4MLIA 3WNOA 4Y4HD 4WNQA 5J6HB 3DIFB 4XT1C 3WSQL 5JW5B 3V0WH 1PEWA 2QSTA 1JF6A 5I1HH 2OXGA 2P7TB 5I8CB 4XCNA 1D3CA 3MGAA 3TV3L 3TIDB 1KPVA 4YBLB 5I73C 1E4JA 4LDEB 2GY7B 5IW1A 4U6HA 4MQXC 1BAFH 2WWKT 5IVXA 2FD6L 4NN6C 1YYML 4Y4FA 1A7NL 4X4XB 5IEKA 2L7JA 3CVHH 3RKPA 1YMMA 2XQYK 4R0LC 2AXHA 2J4WH 1FIGL 2D7TL 2D2OA 1QNZL 1VADA 3CNKA 1EO5A 2YD4A 1AO7A 4H8WL 1L0QA 3TPUA 3VFUB 4UOJA 3LRHA 5IV2B 1G9ML 5F8RC 1ZHKB 4E0RA 4CAGA 1G9NC 4MA7H 3SDDA 1A64A 2CLRA 3FAWA 2Y9RT 3KJ6L 1WEJL 2P43B 1FLRL 1FE8H 2NX5A 3KPRD 5D1XD 5SWZB 5GGQL 4HT1H 5F6IB 3EYFB 1C5CL 1A6ZB 4HPOH 1JHLH 1A21A 3MNWB 4XNUH 5DUPL 4KUCF 5EU5B 4OZIA 4JO3L 4Y5YC 5D72H 5DK3A 3IETA 4GQ9L 4IS6B 3DBXA 5IHZB 4ZO8A 1E6JL 3RWCA 3DV4A 2X9XA 4LLMB 1J5OL 1N59B 5EU6D 3OKMA 1G84A 4Z76B 3FQRA 1HH6A 3MJ9A 1RULH 4EDXB 1RZJC 4O58H 4NUJA 2OMNA 1CXLA 1A1MB 3TCXA 4HHAB 3ARDB 3MNZB 3O8XB 4LVNB 1GZPA 1GPOH 1CQKA 2XZCH 5EU6E 3MRBB 3OKLB 1MIEL 3SKMA 5HGDB 3KYKL 4RA3A 4NN7C 5FM5O 4KMTL 5DFWH 5C0CB 4GSDH 3HCVA 2V2XA 3I3EA 4XMPL 4U1JB 3QQ9D 3Q6FA 3CIQA 1RPQA 1XF2A 5FKPA 3V8OA 4HWZB 1ED3B 2IAMA 4NQED 3HG1D 3HI6L 3PWVB 4PRHB 4RISL 5DO2D 5IMOA 1C12B 4GXUN 5FGRA 5DVLA 5E6IC 4LAQL 3UTPE 4Z7NF 5FUOL 5DJ8A 1BM3H 1OSPH 1J1XL 3MV9B 4L9LC 2BOCB 3MRRB 1RU9H 2W92A 3MMEB 4H0GA 5A3IC 5GS2H 1LO3H 4AL8H 4U6XB 1RJYA 4NQEE 3HG1E 1WV7T 2QQNL 3DSFL 4FZ8L 1YEJL 4M5YL 1IM9D 1K5NA 4BSWA 5E94B 4BFIB 4OZIF 2VIRA 3V6BR 4LP5A 1KELH 4DW2H 3MLUL 1OLLA 1V3JA 3SE8L 5INDB 2PYFA 3X3GH 1DBMH 3G5XB 5GGTA 4PLNC 3VXRA 3VMNA 3T3MF 2WLZA 1IQWL 3QHFH 4V2BA 3SE9H 2V7NB 2AV7A 4OUUB 1DQDH 1KN4H 2OTUB 1JNNH 4O4YH 4H88H 1EJOH 3KWWA 1RZFH 4QRUA 2CK0H 3T2PA 1KEMH 5DQJA 3L3JB 5EORH 2A74B 1CL7L 4GRWE 5C0FB 2XZQL 3AS3A 3GSXB 3IS0X 5C0AE 3WN5B 3TVMA 2ZPKL 5ALCL 3L1OL 1DVFC 5ICYA 2FO1A 3GM8A 5D93C 3PL6B 2AW2A 4AENA 1DQQA 4DZBB 2APVA 1JF5A 1LD9A 5K59E 3GMOA 2XV6B 5ESAB 4UDTA 3KPLB 5I18H 2Y7QB 1YC8A 3QISA 1VB9A 4F3FB 1Z3GL 1IT9H 5E8OA 2WP3T 3CSPA 3MA9L 1UWGL 1MFBH 5FHAL 1T03H 3MLYH 3S35H 3CDCA 4I3SH 4O2EB 4MA1B 4M7JH 3CVIL 5L2JA 3O45A 4YHYB 1NJ9A 1QO3B 2ICWJ 3LKQA 1NANH 4ODVH 5JPNA 1W0YT 1D6EB 1KXQE 2YD5A 1NL0H 4X4MA 1HHKB 5IG7B 5KSBB 4PRAA 1KN2H 3NACL 3AM8C 1ZKAA 5EO1B 2O61B 5BS0D 5IFJB 4UOW0 1OWRM 5HGHB 1B0RA 4PJXB 2IG2L 3WJJA 3LKPB 5JMOC 4NQDB 1T1XB 2IFFH 3LZFH 3HTLX 3M8OL 4XMKH 5C6TL 5JW3H 3S5LB 1MCWM 3V6OE 1I1YA 3FMGH 3GI9H 1OF2B 3OQ3B 5EBMB 5BS0E 4G7YH 3KR3H 4JAMA 5FYKD 4JY5H 1TETH 1ORQB 4LFHD 1RFDH 3OF6D 4XAWL 5LJYH 1CICD 2FYYA 3NIGF 5MENB 1DTUA 1UWEL 1U8IA 2GUOA 4OGYL 1B2WL 3D2UD 3RGVB 1KBGL 5J8OA 5GGVY 5CEXA 4PLKC 3TBSA 4Y4HC 4OCYL 4MAYB 4FQJH 4GRLA 4Y2OA 4Z78A 2N4IA 4BSVA 4IRSD 3PWPB 1ADQL 4G6FD 4QLRA 3L3HA 4ZD3H 5FYKE 5F1IA 2VKXA 3PF2A 3VGEA 5IJVB 4OUOA 4YR6A 4JPIB 1EHAA 2P5WA 1QHOA 1QRNE 3STZB 1WWBX 4KDTC 1DBAL 2R69L 1PFCA 5E2VH 3ZKSD 2NY2B 5E2WL 2OL3L 1HI6B 3NH7L 5FGCE 1U8QA 5T33L 5ISZA 4S2SB 4TQEL 2ZOKA 4W4NA 4MJ6B 1U92B 5LAXB 2R1YA 4JFEB 3LKNB 3CX5J 3HPLB 5DDHA 4AIZA 1CD1B 1QFOA 2YEZB 5F9JA 5JQ6L 1BLNA 2BNQD 2GJ6B 1NC4A 3MO1A 4IIQB 1AJ7L 3HMWH 3SQOH 4JZNB 3G6JB 1K4DB 3VFVA 4OV5A 5D1XC 2OP4L 2XN9E 3K7UA 1ETZA 4KKBD 4JPWL 2PW1B 2BNQE 1KJ3H 2I26N 4G5ZH 1FG2A 1M05A 3CFEB 3FT3B 1NLBL 2BHZA 2YPKA 1S7RB 3RIFF 1V5JA 1TZGH 3AS2A 4Z7VA 1AD0B 2XKUA 1RZ7L 3JVGC 1JBJA 3QCTL 2NY4D 4ZSOA 5DRZB 2F53E 3PWLA 3EDDA 3QDAA 2EDRA 4NQSA 3IKCA 1OTTD 5DF0A 4P2RD 4JREC 4N0FA 3ULSA 4HKBA 2CO6B 5CEZD 4G9FB 1S7XA 5J6GB 3FQNB 4JHAH 5DD3H 3I2CH 4S1DD 4GBXA 1M7IA 3F62A 1JNLL 2XICA 5FCUL 4CN6A 1NEZB 3MRFB 5ACMA 2FX7H 3QQ9C 4BUHA 1V3KA 4P2RE 2DYPB 2HRPH 5HYQB 1MAML 5DO2C 2NY0B 1R3IH 1XH3B 4PJDE 2A77L 4HUVB 3GO1L 3PIQA 1KCRL 3C6LA 3U4EA 4O2CA 6FABL 3MV8D 3TWCH 4GO6B 4Z7UE 5E2UH 5IR1A 5ADPL 1TPXC 2X1PA 3P30H 2FCBA 1BAFL 1S7WB 3EOTL 5GS0D 2VUYA 4M61B 5E00B 5IW6A 3E3QE 3CPLB 4OI7A 3V9FA 5DD0H 3RRQA 2XI9A 3E8UL 3TJEL 3D18A 5K33A 1T7WA 4QXWA 1J8HD 1GHFH 3MV8E 3TO2B 3PGFH 1I8MA 1PYWB 2FEDD 5EBWA 3QWQB 4K9EH 4X8JB 4D8PB 3PDOB 5BZWB 1AI1H 4R2GD 1NCWH 3DSNA 1CZ8H 3LPFA 3GMLB 2DQUL 1FE8L 3OMZA 3WHXA 3S9DB 3ARFA 1UACH 1S3KH 4DUVA 1JZ4A 3BP4A 1NCCL 4JHBA 3H9SB 1HINH 3V4VL 3QQ3B 2D03L 1JUFB 2VDRH 2EDOA 1GAFH 4XBGA 4PUBH 1Q72H 4XVSL 2H1PH 3KPRA 5D1XA 3LCYA 3RZWA 1I3GH 2R0WL 3OXSB 4ZPVB 3P40A 5T1KD 4BYHA 2WZPD 5F7FA 2W60B 3QO0A 4NO2B 4JFDB 4PJGA 3HNVL 1PY9A 4DGVH 1IQDB 3QDGB 5HGBB 4P23D 4HIJB 4R9HA 3NN8A 3QDJA 5HVFB 3JSSA 4GS7B 3P4OB 4LEXL 5A40E 4NC1E 4NCDA 4FFWC 3MACL 1SBBA 4DKFL 1B0GB 2JB5L 5E8NB 1G7LB 5SV3A 1I1FA 3LHPH 4QHUB 4BJLA 1NCDL 1RUMH 3CFCL 1YNKH 3WNNA 5EZLB 1JGVH 3VD4A 5DK2A 3MV7B 2XQBH 2XFXB 2AI0H 3V6OC 3MTRA 1CLOH 3P9MA 3F7YA 1J88A 3C5SB 4OLUH 1A14H 3BRDA 3SKNA 5T5FH 5KANG 2LV4A 3TA3B 5KSVA 4G8GD 4PRID 3GBLA 4F80A 3S88L 1WBXA 3RI5K 2GCYA 3VFTA 3WUWG 2AJVL 1RZKL 3I3DA 4PR5A 5D6CA 1VGEL 1LGVA 3QIWB 2JB6A 1BECA 4QRTA 3IGAA 5DA0B 2IALA 4JDVB 1IEBA 1WAAA 2XKNA 5MEPA 1CICC 1KXTB 4HJ0D 1CT8A 1ODAA 4N0UE 1MY7A 4Q6YA 1IM9A 2EDBA 3MLWL 3TZVB 1A1NA 4X5XB 3DX6A 1KEML 4KRMB 5GRXG 3FO1B 5EBLB 4XNXH 2IGFH 4IRSC 3BZDA 1KYOJ 4ZUTB 1QHPA 2J12B 2EC9T 4GG8B 4HKJB 1T04A 5DJAB 1CE1L 1BZ9A 2I5YH 3B8YA 1A6WL 4OAWA 4RMTA 2EC9U 4I48A 4X7EC 5I1AA 3SGKA 1IEHA 3H7BA 5DD5H 1U3YA 2O5ZL 5CMAA 2CDFA 2VISB 3ARGD 3CC5B 4AY0A 3DOSA 2O5YH 3MJGX 1KJ2B 4R96B 4WVRA 3BPLB 4OGXL 2R1XA 4HFWB 4DTGL 2FGWL 1HXYB 3TFKD 2OR8A 4R97B 4MA3B 4XP9H 4PB9L 1YDPA 2JIXD 3VXPB 4AEEA 2VDPH 1DLFH 4I2XA 1DQLL 3T65A 1UEMA 1LNUA 4KQ3H 3UTSD 3NFPA 5HJ3B 3FCTB 1OAKL 3MRHA 3GSRA 1Z9MA 4P2QA 1ZSDB 2IQAA 1IGTA 4Q9QL 4RIRB 1JTPA 4WW1A 1GIGH 2N56A 3TJHD 5BV7C 3LQAH 1YEEH 5HBBA 4KKBC 1NGPL 3QUZB 1K8DB 4CADB 1RIHH 3UTSE 1T5WB 1E4XH 3ARXA 4K3HA 4QCIB 4RAHA 4FQXB 1L7IH 2APWA 3F6IA 3BUTA 3MJ9L 3MQIA 4WUKL 2X4UA 4ELKA 1FIEA 2NY4C 1RUKH 2B7DT 3FQWB 3LQZB 32C2A 4N9OB 4HX1B 3PQYD 1EGJL 3LN9A 2XACC 4M6ML 1GGUA 5FA3B 4J3SA 1OTTC 2V17H 2DQFA 2AQ1A 2GT9A 2HG5B 4H0IA 4LLYA 3ZT7A 3RJDA 1DN0A 4HZLB 3WIFB 1F90H 2EEBA 4N0YL 4FABL 1CGWA 5ECJE 5HHQB 3TT3H 6CGTA 2E9BA 4S1DC 1M71A 3LEVL 3EO9H 4ZS7H 5JHDE 5E5RB 3VW3L 4BELD 3E3QC 5GJTH 2BCKA 4KRLB 5IK3A 5DZNA 4XBEH 1QSEB 5E2VL 3F6LA 2EH7H 2B1AL 4PJCF 3MRLB 5GS0C 4O00A 1G7QA 3QXDA 2CRYA 4TRPH 3P11L 2CR6A 4U31A 5C09A 2QSVA 5LWYH 4NKMB 4PD4J 4IRSA 5CEYA 3UPCA 5J89A 4IMLB 5GGTL 3CFJA 5MP6L 1K2DB 1F6FB 4TSCL 2FEDC 5J1AA 2NXZB 2ZKHH 4LIQH 3WDIA 3GSWA 2UUDH 3CU7A 2QQLL 4KHXH 3VFGH 5C0IA 5FECA 3BISA 3K4AA 3T0DA 5KS9E 4PRPB 1YQ2A 4QF1B 4R2GC 1D5BA 4C56D 1XF1A 3T1FB 1IC7H 4YC2B 2OZ4A 4XVTH 2AK4B 1FYTD 4L8SA 2UVFA 4N1HB 2DLHA 3ZDZF 1U3HA 1ZV5A 3HS0A 2X70A 2Y07L 4WI7A 1BGXL 1R5IA 3LN4A 1DUZB 4C56E 1S9VB 1UJTA 5I0DA 2SEBA 5GS2D 3RWDB 3GI8H 3OPZL 1GCFA 1W0VB 3L5IA 1FNSH 5IOPB 3L3OB 1YN7A 4XHQA 1MI5E 5FDYA 3FT2A 3IVKA 1KUMA 4NC1C 3TIEB 4BH8A 1A6VL 3QWRD 3V0VB 4ZXBB 5IFAH 2V5SA 1BX2A 3LV3A 4MDIA 3SDXB 5B38B 2V9RA 4P23C 4PB0L 4ZQKB 4KZDL 1EK3A 5FV2A 2J8UA 4ETQB 4UDUA 4OT1L 4A2LA 1DCLA 1IGFH 4NNPH 3LD8C 3T0ED 3F58H 4LPCA 2N1KA 3WFHA 4X6FB 1X9QA 4C83B 2VDOL 3ARUA 4FXGB 1AH1A 3EGSA 3SDAD 3OG6B 2WQ8A 5E2UL 4P3CL 5KVDL 2DQDH 2AERT 4CVZB 3CH8A 1NDMB 5KG9A 1YYLL 2F54A 1N5AA 3FFCB 4V1DB 1SMOA 1IAOA 1ZS8B 1MQ8A 3V7AG 2ZCLL 4I0PB 4MCYB 4Z8FH 2FIRT 4KHTH 5DJ6A 4Y19B 2A0LD 3DUUA 4YDIH 3U46A 3X3FL 1NCWL 4O5LL 2IANA 1IJ9A 4HJ0C 4O02L 3CU1A 3I50H 2P44B 2R8SL 2FJFA 2OMBA 5TDNA 1S3KL 5GGVH 4QYOB 4XP5H 2DD8H 1J8HA 1U8OB 3BP6B 5F88B 4YEEA 5IESH 1ZXQA 5AAWA 1A9BA 2CLVA 1MLCB 4XNQB 4Z7NE 4IOSD 3OGCA 1CD8A 5E9DB 2B39A 3BKJH 1T2QH 1RURH 1PD6A 4P5KA 1S7QB 4KXZH 5C0JA 1K6QL 4ZAKD 4Z6AT 1ZMYA 3EJJX 4P48A 3ARGC 4UIMB 2CKNA 3GSVB 4R26L 5HDQH 1T80A 2X4SA 1X5IA 3TFKC 3WDHA 2VXSL 1BVKB 5GHWL 4GKNB 2C3VA 1OTSD 1GYAA 4W70A 4X6BB 3T3ME 4LL9A 3DGGB 1A6UH 1A6TB 4NZTL 3GMRA 4ODUB 2PYEE 1ZA6B 3IU3B 4L8DA 3I6GB 5IBUG 4OBRA 2YD8A 4I18C 1N0LA 1X5YA 2X4RB 4LQFL 4JZOB 3MGTB 5T1KA 3S37H 3FOMB 2EDYA 4GG6B 3C8HA 4M93C 3BJ91 1YUHA 3TJHC 5CBAB 5EOTB 2L7UA 2RQ8A 3H3BC 3O2VH 2AXJA 3RNKB 4AK1A 5L2KB 1N0XL 5CINH 2R4SH 5IW3A 4ELMA 1A14L 4PJBF 4NDMA 5GSRA 2MHAB 4OKDA 1QVOB 5JO5A 1KXVC 3FQXB 1KTLB 1LEGA 3PDDA 4AEIL 1NAKH 1KC5H 1QBBA 3RNQB 2NNAB 3N1PC 2DQEL 1T1ZB 1FBIL 1FFQA 1HILA 3PP4H 4PJ5A 4N0RA 3DVGA 3NAAL 4FZEH 2FR4A 4DN3L 2FL5B 3X12B 3D85D 4ENED 1VFOA 4N8VB 1WGOA 4G6MH 4UB0H 5BW7A 2FJHA 2BVPA 1S9WA 2WQRA 4G8GA 4PRIA 3O4OC 4HUWA 3E2HC 2E8ZA 1DL7L 5BOZG 4HF5L 5H2BA 1P7KA 4WUUD 4NHCH 3EYSL 3HRZB 2X40A 3GNML 1P53A 1XIWB 3M17B 3TT1L 3NFNA 5C07B 3VRLF 5BQ7B 3F5WB 1ZLSL 4L4VD 4CJ0A 1LK3H 1YEGL 2AJSL 2HFEA 4YDJA 3VXMA 1T1WA 4LSVH 2OQJA 5HYSA 4HUMB 4N1EA 3HAEB 3RI5F 3RVWD 3VXTB 3QRGH 1RVFH 4GKOA 4LSTH 5TQ2H 1QA9A 5IBLD 3LRGA 1F4WH 1KCSH 4MNGE 4L4VE 3HUJA 5C9JA 3E6HA 5F7UA 3DJ9A 3NIGE 5H37H 4HKZB 4NNXB 2VR5A 2P46B 1EH9A 2R0KL 4CU8A 2X4QA 3NIFF 4P46B 4C57C 5FM4A 2XRAL 4ZUVA 4FFZL 1ZTXH 4Q2ZA 1ZHNB 5J57B 3KPNB 1A0QH 1YEEL 2EE6A 4OLYL 1YY8B 2ZUQC 1A4KA 1QBMH 2JIXA 4HJJL 4J4PD 1RIHL 1UM5H 4LCYB 2A83B 3CLFH 5JTWA 4G42B 5K9OB 3MOAH 4U4BA 3ECBB 5ADOL 1JZ3A 5HHOE 1RUKL 1C5DA 1PZ5A 4WY7H 3OX8A 2D0GA 1E6OL 4MA8H 4Z95L 4KVNH 5KJRL 5I8KH 3KLSA 1YEHH 1HHIB 1F2XK 2YN5A 3HZYB 2WANA 3QXAB 3WO3B 2HN7A 1FORH 2I27N 2VDNH 3VFOB 3HB3D 4HIXL 3MFGB 5GRJL 4OCXH 5CZVL 3OR7A 1CF8H 3O3EA 1JK8A 3KS0J 5EIIB 4JCMA 2HH0L 5ERWA 3PQYA 5J9PA 5CD3B 1I7ZB 4HV8A 1QSFD 1RI8A 2FO4A 3T0EC 3EDFA 3U7YH 4F8TA 1L9MA 1OAXH 4MXWH 4UNVA 2FX8H 1PLGH 3LVEA 3SDAC 2XWTA 4UT7H 3STLA 4XWGH 1OW0A 4ZO9A 4XI5D 3QYCA 3KXFD 3MJ7A 2QADB 3HFML 1K4CB 1LP9F 3L3KA 4KDWA 1QSFE 2EDDA 3NMEA 2ICEB 4KTYA 1J7VR 5IP4A 1AP2B 2ARJA 3I6KA 4S1SH 1VEPA 3BIKA 1KJVB 4QRPA 4Z9KB 3MV01 5EOCJ 3WNPA 4QOKB 3EYQD 5CJOH 2A0LC 5E7FA 2J6EA 1EO8L 3T0VA 1P6FA 1KCLA 1S7UA 4LASL 1RSFA 4ONOA 2EIDA 3O3BB 3P0YH 5BVPL 4S1QL 2E6QA 5DRXA 3UJTL 5I16A 5E5MA 1LE9A 1XR8B 4PGEA 1SY6A 4FQPA 5IMLB 5DYOA 3IAQA 4GUPA 4L29B 1HKLH 5L6YL 4OLVL 2QKIA 2BHYA 1BD2B 2BC4B 2W65B 1KLUA 1F42A 1GH7A 1RHHA 4JHWL 5IVZA 4ZAKC 3GSUB 5FO9A 5GSVB 3T4AA 2WIIB 5FOJA 2CKBB 1FYTA 3GBNL 4PJEF 4LCUA 1N6QL 1H15B 3IJYB 3CUPA 3K2UH 1OTSC 3BOVA 4LSUH 2VAAB 3FB5A 1GRWA 2VR4A 2L0DA 4G6JH 5F44A 1MRFH 4JGMA 4JPVL 4EBQL 4IRJD 5SWSA 3U0PB 4PJFA 3F65A 1WLHA 4HK3J 5HDLA 4KI1A 1MCOL 2DDQH 3QIUA 4YHNB 3OGOE 3D87B 2XG5A 1V7NH 2FATH 4TSBL 3RWIB 3QWRA 2BFVH 4NM4H 4J6RH 2YUXA 1B9ZA 3MUZ1 1FLTX 1ULVA 3TCLB 4Y4KD 2DTMH 5EOCL 1H8NA 5IQ7H 5I73B 2XTJD 1N8ZA 3VI4F 2V6HA 3BMWA 4G3YH 1OAUL 5C86A 3VD7A 1MLBB 1R5VB 3LAFA 1OSZB 4UTAL 3DO3A 4ODSH 2VLRB 4PP1D 2LU3A 4R90H 1NDGB 1NC2D 4R0LB 3T0EA 1B4JH 1F3DJ 1F45A 2VDKL 4KVCH 4OD3H 3WHE0 1EHXA 3K81A 2XTJE 2VO5A 1TFHA 4U6YB 4LPUA 1LMKA 5F3HB 3FT4B 2FGZA 4G8FA 3SPVB 4ENEC 1L6ZA 2F58L 4BK5A 1NBYA 2BRRH 5DMIL 3NPSB 1R3KB 5CSZA 5FK9A 5D5MF 1H3VA 3UTTD 2ESVE 2AJUH 2ZJSH 2YD2A 1IAII 1IARB 4PJAA 4ZNEA 5B8CC 3CFDA 4PP2A 4KKLD 4LHJB 1S5IL 5L8LB 1ZA3A 4P2YA 4M6AA 4OZ4B 4Y5YB 1I8LA 1FL3A 3S36L 4M1GL 3U2SB 1UKSA 1JFQH 4PJFF 3UTTE 4QGYA 1DSFH 2VNCA 3VWKD 1SEBA 1FGVL 4EDWH 2HT3D 3QUYD 4BSJA 3M1BB 1AHWC 4M5ZL 4NUGH 1UM6L 5IBLC 1SMAA 1I4FB 4S1RH 4TNVK 5DQDH 5AZEH 5JZ7D 5EWIH 1WT5C 4L3AA 3GJFK 4UINH 3UO1L 3ZT5A 3CXHK 5TFSH 1G6VK 2WBJB 2FBJL 1LK2A 2BVQA 1I3RA 1KCKA 4NGHH 4P9HH 3TBYB 5DHXB 1QQDA 3CSYA 3PWJA 3GSNL 2PETA 4OZHA 3VGAC 2V9TA 3RPIB 2NCMA 4ZFFA 1F3JA 1MRDL 1JPGB 3NZ8B 4XPTL 3G04A 5KZCB 5E6IB 1N26A 4J4PC 1RZGB 4WI6A 1U8JA 1IGJB 3BXNA 4L9LB 1LO5A 1G7PA 1RK0A 4WFHD 4YX2H 4KKAD 2Q8AH 3DXAD 4G8EA 4JZJC 3K1KC 3QEGL 3PGCB 1DEEA 4NP4H 4AH2A 2VWEE 3LKOB 1P4BH 1W72B 3WD5H 2F5AH 4WFHE 5DRNA 5E1AA 4UIKL 3NA9H 3DXAE 4H1LB 5DUBB 5KVMC 5MEOA 1MJ8L 1CLYH 2W91A 4HLZH 5IB4A 4Y88A 3HB3C 5BOPA 1AY1H 1RZ8B 1XCQA 4K9EC 3P0VL 3H9HA 4NO5A 5CFHA 2YD6A 3O3DB 3UC0H 1QFWH 3MLXL 3L9RA 4R7NA 3VG0H 1MY5A 4HG4K 1BOYA 3BYYA 4PREA 3SGDI 4ODTH 3MGOA 3Q1SH 1H5BC 2ZG3A 2D4DA 3D85A 1MFAL 5D93B 1CBVH 2Z35A 4LIQE 2AJZA 1BJ1H 5FGBC 5GS1A 4JFFE 1MRCH 3IJSA 4S0TD 1GC1H 2D7NA 2VKWA 1MOEA 4XI5C 2FWOA 4NKDB 4P4KA 4OM1H 4JKPL 3RWJB 3S96B 2AP2A 5HTSA 1AGCA 4M1DL 1PG7X 4WUUA 1TTFA 2WM0A 2ERJC 3BDXA 3MROB 5C2BL 3QEQB 3U4AA 1EFQA 1BFOB 2DLFL 2FECI 1U2CA 4Y16D 2EYTB 4YDLC 4LCCB 1QR4A 1CFNB 4PGDA 3RDTB 3EYQC 3WXVL 2OTWB 3G5ZB 4L3CB 3PHOA 4XBPB 5HPOA 1SYSB 5EZIL 2DM7A 1I7RB 2ZUSA 4HMEA 3EYUL 3LQMA 1LWRA 4FQHB 1FVEA 1WT5A 1MHHB 4N90E 5F3BA 2Z8RA 5HHME 5B39B 3LRSA 5JDSA 4NT6A 2ID5A 1SJVA 1BBDL 1QEWB 4PJCE 3VRIA 1S78D 3RGHA 3FONB 5EZJA 2BX5A 1B3JA 5I9QB 4LCWD 1R3LA 3MUGB 1E28B 4QTHB 4XMLH 4J3TA 4JDTH 2R0ZL 25C8H 5A1AA 7CGTA 4MA8L 2EICA 4X98A 2EH8L 2G9HB 2B20A 4XP4H 5FCSH 5IHUL 3MR9B 3QI9B 3RZCD 5DK0A 1FVCA 3LPWA 3ARBD 3N9GL 4XH2B 4B50A 2XA8L 5DA4A 4LSQH 1NCTA 4LCWE 1S7VB 3INUL 4YH6A 2VR9A 1YPZA 2VOTA 3P9LA 1CFSA 1F4HA 5F7LB 4IRJC 4EUPH 1TJHH 1VFMA 3ALPA 4Y4HB 3KJ4C 1OWWA 5KSAD 1T20A 3FB6A 4G9DB 1OGAD 3QDMA 5L88H 3ZDZE 4AZ8A 4QY8B 4GXVL 4ISVA 4NJAL 4TULH 1RUAL 1W0WA 4M7LH 4Y4KC 3BD5A 4TYUA 4X6CB 2XTJC 4HQQH 3C6SA 4MD4B 4AM0B 4OQTH 2F15A 3ES6A 1NBVH 2GSIA 4XPGL 3MLZL 2K7PA 4PP1C 1V3MA 3ZDXF 2AEIT 2HJLB 2YBRB 3NFSL 2UYLA 3C09C 2QJDA 3DX7A 3B5TA 1GJIA 4JQIL 3KXFA 1U8KA 4JFXB 1UA6H 3GJEA 3V52L 4AG4L 1N3NA 2C3GA 5IFHL 1Q0XL 4RMWA 4WI5A 4KKLC 2ZUWA 3HKFA 5T5NF 4KROD 5JA8B 3LQAC 3AXLA 3MBEB 4IEFB 2P5ED 3MOBH 5EU6B 3AU1B 3MRKB 3VWKC 5HY9B 1HZHL 4LVHB 4TOYL 3PUCA 2HT3C 3QUYC 4GW4B 3VFRB 1A6PA 3I02B 5DHVA 5L7XL 5HD8D 5D7SL 1MREH 4Z77B 1Y6MR 5J12C 2D3VA 1B90A 2P5EE 3UPRB 3LEYH 4A6YH 2QR0A 1QUNA 5JZ7C 4PJ7A 1KJ2H 4OLXL 2EXWD 4MZ2A 1J1OH 3WS3A 2XA3A 2G5BB 1V7ML 2BVUA 4ALAL 4LKXA 5IUSA 2NTFA 5T1LB 1F6AA 3MRJA 4ZOCA 3W39A 1AR2A 4ZG1A 3QFDA 4U3CA 3R1GL 1R0AH 1RV6X 4H20H 5C0EA 2VWEC 5D2NB 5D2LF 3ZHDA 4RBPH 1WCBB 2VLJD 2AQ3A 3GIVB 3KDMB 3REVB 5JXEA 5JPMA 3UTQB 5EUKB 1GGCH 3ARTA 4KKAC 1S7SA 5C0DA 1QYGH 2UWEF 1U58B 1J87A 2J88L 2HFTA 1NAML 4LNRB 3HN3A 2VL5A 2VLJE 2X7LA 1OAZH 1U8MB 2Q8BL 5LGHL 2WINA 3WIHA 3FO9B 2YPLB 5CGMA 4HUXB 3BH9B 2QTEA 4GRWB 2VXUH 4ERSL 1U6AL 1YEIH 1U93A 2OSLA 5C0AB 4DCQA 2BRRL 3IXTA 4JM2B 5IB2B 1WITA 1WTLA 2HYMA 3RL1A 2VZVA 2XWJA 3K74B 1XGRB 2R2EB 5ID0B 4Z7WF 2O5XL 1QKZL 1T22B 2MCPH 4M43L 4RFOH 3IXAB 4PJ7F 2NY1D 1XGUB 1EZVX 1WJ3A 1KPUA 2E7HA 4N9GA 2EKSA 1ZWIA 4PJBE 2ENYA 2VXVL 2PO6B 3X11B 3CH1A 2BOBA 4NBZB 5SWZD 1CXHA 2JK5B 2XNAB 4M9PA 5LQBL 1I9JH 4RGNB 4XCCH 1KENH 2CGRH 1PSKH 4JY6B 1D5IL 1CXFA 4F7TA 5I8EA 3OHXB 4M4RA 2AV1B 2D9CA 2AS5M 4Y16C 1DQMH 3HMXA 3TPKA 1ZHLB 3VWKA 5I74C 2RR3A 5SX4I 1EFXB 4M8QA 3O8XD 4UBDD 5I66A 2QQQA 4PV9B 5FUCE 2XZAL 1SY6L 4OKVA 4XX1G 1G7MA 3TLRA 2GSGA 3SDYH 1N64L 3O9WD 1I85C 5EC2B 3UTZA 3KNBA 3O6ML 1N6VA 2VJXA 4F57L 5HYEA 4HXAL 1KCUL 5EU7E 3RA7L 4HW6A 4Q0XH 2AXGB 4P3DB 5BS0B 1S78C 3O6KH 4J8RA 5FOBB 3LDBB 2WIMA 1OQOA 1UXWB 5ICZA 3MV9D 4TNVF 3QQNA 1S7TB 1A7BA 4LDOB 3L3IB 3PP3K 4R4FH 3RZCC 1IAIL 1A7OL 4TUKL 3ARBC 3F7VB 3MXWH 5ANMA 4RAVA 4WGVB 2QSQA 4RAUB 1CICB 3G6DL 5I8OH 3NIFE 3D2UB 1QRNB 3RWFB 1ND0A 3LS4H 1FNHA 5DTFA 2DJSA 1C08B 1R24B 5KSAC 4FQCH 5HVHC 1YNTA 4G6FB 1U8LA 4KDVA 5FGCB 1CG9B 5KVGH 1S9XA 2VL4A 2Z91A 5LGJB 2HRLA 1MVFA 3MRMA 3C8KB 4MNQD 2G60L 4D0BA 5GIRA 3L95A 2Q76B 3PL6D 3B6SA 4WCYH 4TN9A 4LRIC 3CMGA 2MMXA 1JRHH 5DD1H 5K9JL 1LO4H 4MNQE 1MPAH 1AGFB 1I8IB 2XN9B 4WU7A 2IBGA 1LE5A 4ORZC 2DQIH 3ZTNH 3T8XA 2WBKA 1KSRA 2DMCA 1FJ1B 5DR5H 4UU9A 2H8PA 1VSCA 3GKWL 3HZKA 3EOAA 5D7LA 5DI8B 5BV7B 2F53B 4Y16A 1KEGL 1JCKA 4O2FA 3DARA 3IFNH 4KROC 3VI3F 3GJFH 3WS6C 1NGZB 1A6AA 1EHNA 1PKQE 1U9KA 1XZ0B 3BH8B 5HXMA 4JR9L 12E8L 5JOFB 1LP9E 4PJHA 5GISL 3Q5YA 2A38A 3JUYA 5D70H 3G5VB 3P2TA 3VXSA 5TE6L 4CVWA 5FV1L 1MCEA 2H45A 4BKLA 5HD8C 1BZQK 4LLQA 3OJDB 3U82B 4UUJA 4HGMA 4P2RB 5LBSH 1Q9WA 1FH5H 3BGMA 1MUJB 2KZ1B 1I3VA 4N0CD 5E2JA 1MH5B 2EXWC 3W82A 4NQXA 4HIEA 4PJDB 2XKSA 4OFDA 3TYGL 1JP5A 3T1WA 3OKDB 15C8L 1ZHBB 3HE6D 5TPWH 4LHUG 4S0SD 1MFEH 3BKCH 4Z7UB 2ZCKL 2IPTH 2MWCA 4KTEH 1FAKT 3EYOB 3MBXL 5DJZA 2A6IA 2H3NA 5C0BE 4PRBB 3RZCA 1I7UA 5TDPA 3ARBA 4L1HA 3RGVD 2NW2A 1F8TL 2DIJA 2WWMD 4E42A 1ZLWK 4MAYD 2FECL 1S8DB 3PHSA 3PWPD 5BO1L 2PCPB 4AT6A 4HWEL 5ALBH 1OGAA 4PJEE 1MAJA 3SY0B 3IRPX 2HAZA 1J05B 4YBHA 5AG8A 1JF1B 2YSSA 3RBGA 3JWOL 5JUEH 1JV5A 4PJ9B 5A16A 1A7QH 4U0RB 2R29H 4LF3A 1Z9OA 4OLEA 3WL9B 3BEVA 4NZRH 4OI9A 1ZK9A 2Z93A 3O0RL 4JFED 5KSUB 4G6KL 3OKKA 4RFEA 1JGDB 4RCAA 1DBKL 4PGCA 3IFPB 1CGUA 2NY1C 2B5IC 4D0CA 1CGSH 1ORSA 4L4JA 1BEYL 3VI4E 5CIPA 2D9QB 3CDYA 4XZUA 2Q1EA 3SKJH 3S35X 1N2RB 5H8DA 4F7CA 1FO0L 1RUPH 4FQLL 2HT2D 3NA4A 3PNWB 3CXDL 43CAB 3QPQD 5IIEB 3BVNA 3S6CA 4GW1A 43C9B 1NPUA 1MWAA 3HAEH 1Y6NR 3TNNB 1U0QA 1UFUA 1OPGL 2DQTH 5KW9L 3FTGB 3MLTB 5D5ME 5FYLH 3U79A 1JZ5A 4P23B 2ICES 4UBDC 4P9MH 4KJYA 4F33B 1S5HB 2R2HB 1JYWA 3D0LA 1FAIL 5SX5K 2ITCA 3D3VD 3IDNB 1CYGA 1EAPB 4CN1A 4G9FD 4I3RH 1CDGA 3EYVB 3O9WC 3ULVF 4XWOD 1KFAH 1NGWA 3BRGC 1WF5A 1ZANH 2VE6B 4JKMA 5EFIA 1AR1D 5HHPB 4ZO7A 4QHLB 4RX4D 2EDHA 4TUOB 3V95A 4OD1H 2Y06H 2BNRE 2I07B 1WBZB 2X4TA 4JRYA 4NRZA 4X7SH 3D3VE 1H3WM 2H26A 2RFXB 2OL3B 2ZUVA 4QRRD 4N0UB 1K8IB 4MJID 2R2CA 1VACB 2ADIA 3N1GC 5D71L 2FZ3B 5CBEB 3AMLA 5LKNA 5AZ2H 2ORBL 4KUZH 3DIFA 1GGBH 3ULUF 5JW4Q 5JW5A 3NABH 4CNIB 2YKLH 1TXKA 1Y0LB 1JWMB 4QRRE 4K3DH 5I8CA 1F2QA 3SJVA 4MJIE 3TIDA 1MJ7H 2XWBB 4XXCC 3FOLB 2KDGA 7FABL 4X4XA 4WW2F 1RMFL 3WIIH 4DK3A 3P9WB 4ZUWA 4UQ3B 3KAAA 3QNZB 2RCSH 3VFUA 4HKXB 5IV2A 2APFA 3PL6C 1P9MC 4HZAA 2YD7A 1ZHKA 4EIZC 5FKAB 4LU5H 1AQKH 2JJUA 5A43C 1VKXB 1KIRB 4EI5D 5SWZA 2YK1L 3QCUL 3EYFA 1A6ZA 2JF1A 3MNWA 4NNYB 4UT6H 1NMBH 4Q6IC 4I18B 4JFDD 5IHZA 3FFDB 5T3ZH 4PY8J 4LLMA 1N59A 4ZFGH 5I2IB 2E7LC 1I7TB 4Z76A 4UV4L 4MA1C 3OR6B 4EDXA 2VLKE 4OFVA 3ULUH 1A1MA 5TGBB 4JO1L 4HHAA 3ARDA 3MNZA 3O8XA 5CUSH 1AXTH 3X14B 3U0WL 3MRBA 1MQKH 2C1PB 3OKLA 4NKIL 3ZDYF 4ZFOB 2DQGL 3MV7D 5AUMB 5C0CA 35C8L 1ONQB 1MCBA 1MF2L 4GAGH 2WSKA 4ODHH 2J2ZA 4WFED 4U1JA 4LHUA 3TA3D 5JHDB 1YEKL 4HWZA 1ED3A 4M8VA 4N0CC 4PRHA 4NO0D 3PWVA 4AQOA 3JXAA 3I6LD 1C12A 3B2VH 5I8OL 3BN9D 2I60L 3O4OB 3E2HB 1ITBB 1NEZG 3HE6C 3ISWA 3CSBA 3MV9A 3NCYS 2BOCA 4Q9CA 4WFEE 3IF1B 3MRRA 3MZTA 4U6XA 1B0WA 4XPHH 4RA0C 4PRNB 4DVRL 3TZVD 3RGVC 2KBGA 3A6BL 5E94A 2WWMC 2M8XA 2F8OA 4LSSH 4BFIA 3DMMD 4MAYC 2DL9A 4KY1H 5INDA 4IMKA 4HGWB 1JPTL 1HYSD 3WIHL 1ZLVH 5KS9B 5LG1A 4OUUA 4YDVB 1WQVT 4XHJD 3ARRA 2OTUA 1BQSA 5FM5M 4YUEH 3V5KA 2OM5A 4R3SB 3D0VB 2YD9A 3L3JA 3JWNC 3TO4D 2A74A 3RTQD 3MUY1 1PJ9A 4LGSB 5C0FA 1H3XA 3GSXA 4NZDA 4HG4J 2R39A 3WN5A 2C7UB 5DFVD 5DR5L 3PL6A 1P9MA 5KVFL 4P9HC 4C56B 4YHLL 1AXIB 4OIAA 4JPKH 2ZUQB 4FXKB 4YBQD 2P42B 2EDJA 1MCPH 3FN9A 1MI5B 4IIQC 5DJYB 2W0FB 3KPLA 4OTXH 1Z9LA 2VDML 2Y7QA 1J1PH 1PY4A 4KZEL 1IGIH 4F3FA 3CZFB 4FTVD 4U1HB 3UX9B 4DEPC 4FG6D 1IM3B 2B1HH 2HT2C 3ZDXE 1DJSA 2P4AB 2A1WH 5H94B 3W11D 4FQXD 3QPQC 4O9HL 4KPHH 4O2EA 2AEPL 3HMXL 2EDFA 1QO3A 4KRNA 2VXQL 1TVHA 2LU4A 3QUKB 4FTVE 4NKOB 2DQCL 3E0GA 1D6EA 1INQB 4HSQA 1RIVH 3FB7B 2WUBH 3HC3H 5IG7A 5KSBA 2NXYD 3PJSB 3RHWK 5EO1A 2O61A 4XC3L 3LKRB 5EIQA 5HGHA 4WRLA 4HXBL 4XWOC 4UT9H 3S3JA 1HQRA 4PJXA 1KTDB 4FQ1H 2NZ9D 2O93L 3DROB 4NQDA 3VRJB 1AR1C 5E8DH 1G7HB 1MCJA 3OG4B 4HJGA 3SDAB 2JJSA 3S5LA 3BKYL 1MJJB 1OF2A 2VSCA 3VFNB 2RBLA 3OAUL 3W9DB 3A6CL 1GC1C 1TIUA 5EU4B 3ESUF 4HAGA 1DLHB 1MIML 3IAPA 4NZJA 1Z9SA 1ORQA 1SM3H 3RAJL 5MENA 1HDMB 1QSED 2W59A 1TZIB 4Q9RH 5HSFA 4MAYA 3MRGB 4XP1L 3VJ6B 2EEAA 4EI6B 3PWPA 3O3AB 3GHBH 1TJIL 3BDYL 5IJVA 1EXUB 4JPIA 3HI1A 4H1LH 3STZA 1QRKA 3RUGA 2NXZD 5IJKA 5D2LE 4OZIB 1HI6A 2ZNWA 3VWJA 4PRPD 1CFTB 2VQUA 5I17A 3EZ8A 2M2DA 5CAYB 4S2SA 3ETBF 5TQ0H 4FFYL 4JFZH 3I85A 4MJ6A 5LAXA 2AK4D 4HPYH 4JFEA 3LKNA 2UWEE 3HPLA 4XC1H 4M48H 3B9KA 4APQA 5F6HI 2PYEB 1CD1A 5C9KA 2YEZA 2IBBA 3UYRH 1C5BH 2GJ6A 4IIQA 5DVKA 4BQ9A 4M6NH 3V8CA 1CIDA 2AK4E 1DBBL 3G6JA 1K4DA 4EI5C 1XGPB 3WV0A 2UZYB 3OKYA 3MRCB 4RWHA 4MWFB 1X5ZA 2PW1A 3ARWA 5CLWA 1LO2H 3MLSL 5GGRB 1L6XA 3GB7B 4Z7WE 1R3JB 3W81A 4QHNB 3CFEA 3FT3A 1P1ZA 2QSCH 3HRPA 1S7RA 2IMNA 4YPGB 4U7KA 4ONGL 1IKNC 4XVJH 1AD0A 1BHGA 1YJDL 5IB5B 5IMOB 4TVPH 5KVEH 5DRZA 2KKQA 5M95B 4F2MB 5F7EH 4HCRA 3OAZK 4PRDB 3KLHD 3WO4C 3OZ9H 3BWUC 4WEBL 1INEH 1Q9OA 2UY7A 1WFNA 3RUGF 4K7FB 1OARL 4G9FA 5ID1B 5J6GA 3FQNA 3NTCL 4NIKB 3R06B 4UZGA 3SO3C 5I1JL 5FAAA 1WSST 5JR1H 5TDOA 5I6XB 3NCFB 2PYFB 1NEZA 3MRFA 4RX4A 1UGNA 3TA3C 3T0BA 2DYPA 3LIZL 1ZLWH 1OM3H 3FFCD 1HWHB 4GH7B 1CXIA 1HNGA 2AJXL 4KI5F 1EZVY 4NCC1 1IZKA 1LO0L 2VDLH 2GKIA 3BN9C 3QG7L 4I0PD 4JANB 3RU8H 4F7PB 1H0DA 1Q9KB 5JHLL 4HUVA 3NCJL 5HI3D 5B8CB 3THML 3VXQB 1S7WA 4GAJH 4M62L 4M61A 2JJVA 3LMJH 3WIIL 3CPLA 5E24E 2A9ML 2A9NL 3TZVC 5I30H 4QTIH 3QEHB 4L4VB