3NIGE

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 40
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nigE02
5GHWL 2DWDB 3SGDI 2E7MA 4GLRI 4GRWE 5D1XA 3TGXA 1JPGA 1E6OL 4JFOA 3VA6A 4X80L 3TYGL 1NDMA 4GKNA 2XT1B 1LILA 4NKMA 4Z0BH 1GZPB 5GGVL 1RHHB 5T1LA 4WGVB 2FCBA 3S34H 4ZODA 3N1PC 1N4XH 3EJZD 2ZKHH 3QNZB 4H88L 4ODVL 4TUJB 1MLCA 1SMAA 1NFKA 4M48H 2Y5EA 3TWCH 5BRZB 1F5WA 1XMWA 2FBOJ 5FGSA 4X0KB 4JRXE 5C0AB 5HYSB 4Z76A 1T1WA 4PG2C 3VH8B 1TZHB 2VYRE 4L3EE 4Z18A 2ADJB 2XTJE 3I02A 5DJ6B 1W0VB 4X6DA 4JKPH 3FQTA 4LL9A 3WKMH 2E7LC 4PJ9A 3TPUB 4Q0XH 5HJ3B 4Y5XB 3X14A 4GXUN 2E7LA 3E2HC 1B0GA 4WIQA 3RIFK 1FNEB 4FFZL 3M17B 1KJ2L 1X7QA 4M9PA 1MUJB 4MJIA 4ZG1A 3RUGE 1NJ9A 1V7MH 4LVHB 3CDGB 4LRIA 4LSPL 4ZNEE 1KTRL 1IBGH 4WFEE 3HMXL 5I75B 5D5MF 2VXVH 2Y6SD 5JDJA 3C09B 4G6FD 3U9PL 1YMME 3VD9A 3VWKC 7FABL 5JW4R 4XCEB 5KSVA 1NFDB 5GGQL 5GRUL 3GHEH 5IFHH 4MA7H 5I8EA 4WEBL 1U36A 1AO7A 3MO1A 1HYSD 5IROC 2AJYL 1T4KA 4OD2B 4XPGH 3WL9A 2AGJL 2ADIA 4JAMA 2ZWLT 4PRPB 6FABH 5JLZA 3F12A 5MEOA 1HHKB 3VE0B 4U1NB 1TMCB 4X4YA 2DTML 3L1OH 5FYJU 2J2ZA 2B5IB 1A9BA 5GRWA 2ENSA 4JRYB 3HZVB 2YUWA 5E95B 4KH2A 4RWYH 1JE6A 4LSSL 2DKMA 2IBBA 3O2WL 5JPNB 2F54B 3QDGD 5JQ6H 2QQLL 4J3TA 3RZCD 5I15H 3BKYH 3EDEA 1NKRA 2H26A 3D3VA 5BS0A 4LVOC 4EN3D 4P46B 5L2KD 3TJHD 3SGEI 1MY5A 5EC1A 3D69A 5IM7A 1NCCL 3PP4H 1MFCL 4MA8H 1Q1JL 3MLVL 2QQNH 4ZFGL 1MAJA 1HKLL 1BFOA 3FTGA 3PWLB 5DO2C 4RISH 1MFAL 1ZV5A 3FFCB 4PP2A 4WU5A 4BH7B 4K7PY 1R3JA 4GAYA 3MXWL 1HHIA 4ORZC 5DD1L 4YUEL 5DK3A 2XACC 4LLVA 5DD5H 1MI5A 4UMGA 1BVLA 3CSYB 3MODL 3VFOA 2DYPB 4APQB 3WFHA 1MAKA 1FV1B 2XOTA 3MRMA 1JHTB 1FGNH 3NFPA 3OKKB 1YY9C 4UV7H 3HG1E 4IRZH 2EDEA 2DM3A 5JXEC 5T5NG 5DJ8B 4KY1H 5CJQL 2BRQA 4OLZL 3KPMA 4XMPH 3BKJL 3RVXC 2QHRH 1UWXK 4XXDA 4J4PC 2AJ3B 4XMLH 3RKDD 3CDCA 3SDXA 1SEQH 4Z78B 1INQB 4NRYB 4W6WB 3MLZH 4OLXH 2UZIL 4YE4L 2WQRA 3IGAB 4R8WH 4JR9H 4OGXL 1A1OA 1OLLA 4JZNB 1HCVA 4Y4KA 2P43B 2R0WH 3HZYA 4FQXC 3BQUD 3SHSA 5E99H 4XVSH 1CDHA 2EYRB 3NZHH 2XICA 2Z35B 3ZE2E 3MYJA 5SWQB 1KTKE 4JCMA 3TNMB 1RUMH 1V5JA 2VNCA 1MVUA 5FHBH 5H35B 5HI3D 1LO0H 1IGCL 4TUOB 5JMOC 3KYOA 4FFVC 4OI9A 1BVKA 4RMQA 4XH2B 4U0RB 4NJ9L 3GI8L 1FHGA 4JFFA 3VI4F 2VLKA 4PGDB 1CGUA 1UH4A 5F93C 4HLZG 4S1QH 2PXYC 1HNGA 4PUBL 2XZQH 3K2UH 3KLAA 4IOFC 4UTBH 1IQDA 4OBRA 4MQ7A 5E9DE 2IG2H 3CUPA 4HG4K 1MPAL 5BZDA 3LIZL 4XCFH 5IESH 4PJXA 3F6LA 5SWSD 1UEMA 5DJYA 3WIIL 2SEBB 4CMMB 4NZUH 2EDQA 4M5ZH 3G5VA 3GSOB 1CZ8H 5FUCE 3WN5B 1FL3A 3PF2A 2VZ1A 5I8CA 1OP3H 3TN0D 4B7IA 5IGXL 4Z95L 2I26N 3U0TB 3TZVD 3W9EB 2FIKB 4L4TA 3L7FA 5C0DB 2OX5A 3REWA 4Z9KB 3MX0A 4ZPTB 1JGUL 4G7YH 3C5SA 4PRAB 4G5ZH 4YHLL 5IJVB 4L3CA 3GKWL 4ONHA 3MV8B 2P5ED 3MXVH 4ZYKA 4LCYA 2AXJA 2DKUA 2R1WA 3BT2L 1NFIB 1NCWH 1T6WA 3EDKA 3JV4A 1FFNB 1NC4B 1JBJA 3HC3H 4Y16B 1GAFL 4L4VB 5C0IA 1HQRA 2HFTA 4I18B 5KSUB 5E8EA 3CFBA 3RVWC 2AJVL 2GT9B 2Y6SC 3G04B 5A2JH 5F96L 5GGQH 1R6VA 1I1CA 4QRUB 4OLVH 3RX5A 5L8LB 4G6ML 2ZOKA 4GXUM 2HP4A 3FN0H 4JRXB 4OF0A 1A0QH 2JJTA 1YYML 1Q0XH 4XNMB 5E6ZA 3ZTJG 4PLKD 5D70H 5F1IB 5B39A 4QRSB 1XGRB 1R3KA 3T4AA 3F58L 4A2MA 1QEWB 4S2SB 1XGTA 3QUKA 3X13A 4P2RE 5FM8A 4PG9A 1YEJH 4GW4A 4IJ3C 3BGFB 3AY4A 5DRNA 4EI5C 4F37K 1L4IA 1F58H 5AUMB 4MXQD 1EMTL 3CFEB 2AXGB 4OT1L 5DD6A 3RDTA 4OCLC 3QO0B 5EWIL 3FAXA 4M6AA 5KANI 4DTGH 1WWCA 4DZBB 3MRCB 1OOAA 3ZL4L 4OJFL 4ERSH 2AV1A 4MJ4A 3GUTB 3FQXB 1HQ4B 1ZTXH 2X4RB 1PD6A 3SDAB 2VDOL 1UWEL 3L7EB 1KGCD 1XF5A 1LEGA 5BJTB 5IF0A 1QNZH 5F3HA 1JUFA 5ACZA 4WO4A 3HZVA 1SYVA 43C9B 1MI5E 3MSPA 4Y19A 3M8OL 4EEEA 1RURH 4WI9A 3HR5A 5H2BB 4JAMB 2HLAA 4ZQKB 2I9LA 3BEWB 5C0EB 2PYEB 1AKJD 4MHHG 1BBJB 3UBXG 1I7RA 4X83A 1MH5A 4ZS6C 4DGIH 2OSLA 4UT7L 1Z0NA 3EYUH 5IB2B 1GXEA 3PWPE 1HI6B 3HPLA 3V0WL 2GCYB 4D94A 4P3DA 4ZNCD 2PF6A 5IFAL 3S4SB 4H0HB 4CJ1A 1CXIA 2GK0A 1UZ6E 4ACPA 4YE4H 1FE8L 4E0RA 1NCAH 1REIA 3HUJF 1OAXH 3EYQD 1ZWIB 3M17A 3RHWF 5CJOH 2N7AA 3W5NA 1DQQB 1INEH 2YD4A 5E2UH 2DQCH 4JRWA 3HG1A 1G6RB 4PJ9B 3TPUA 5HHVH 3UPCA 2BERA 1ZVSA 4CVZB 5FK9B 4G9FE 3Q6FB 5CEZD 1IGIL 3DTXA 5EPMA 1CWVA 5DUPL 3ULVF 5DQDL 4MXVF 1LE5A 3ULUF 1NMCC 4DN4L 2RB8A 4R0LA 1C5BL 4Z7UE 3FQRB 3QNZA 3NCYP 4RCAA 2Q3AA 1JN6A 3AB0B 3IJYA 2YD5A 1JPTH 4N0FA 1G7PB 4QOKB 3OKDA 5IVZA 3Q1SH 2AJSL 4NO2B 3LDBC 1OL0A 2LVEA 3NTCH 4LASH 4S1SL 3K2UL 4ENEC 1MFEL 5EZJB 3RWFA 2F53B 2O5ZH 1VENA 4NQEA 5CEZH 1JL8A 4X8JB 3CU7A 4HS6A 3VFMA 1BZ7B 4UU9A 4Q58C 4LEOB 1YQVL 3HS0A 3QUXD 4O5LH 1JP5A 2P8LB 1SM3L 2N1KA 4Q74A 5C07B 3U0WL 4U6YB 2NR6C 1KPVA 3ESVF 2WINB 1IZKA 1SJEA 2KPNA 3BSZH 1DBJH 4QRQB 1KYOK 4XNUH 4JHZA 1QFUL 5J6GB 4P2OC 3R8QA 3SCMB 1NCTA 3T0EA 4M48L 5L2KB 3DUHA 2X9XA 2GFBA 4NO3A 3T4YB 2JIXA 5I15L 4I77L 4NQCA 1U91A 3VMPA 2JELL 4ODBD 1I8IA 1B6DA 1F3DH 4KGJA 1X3DA 4JM2D 4JQXA 5B21A 4NQDA 1ZK9A 4TQEH 4G42A 4WUKL 4LPUA 3EOAA 3IJSB 3RFZC 4P3CL 5ALBH 4KKLC 4P23A 4BSWB 2NY2B 4Y8AA 3IXTA 1P7QA 4LHUD 1KC5L 1MCOH 4R4BB 1TCRB 1IFHL 1AC0A 5D1QB 1GPOH 5FGCE 3ALXA 1YJDC 1QZ1A 1I8LA 4HT1H 2H32H 3U2SA 2WWKO 4ZMAT 3PUCA 1OQXA 1FGNL 1HXYB 5BO1H 5EC2A 5TFSH 5TGBB 2MNUA 3QXAA 3LKOA 1QSZA 4PJHB 3MRLB 3F6IA 4UI2A 2CDEB 5DGRA 2BNRD 4N8VA 3H42H 5IW6A 3FT3A 1IRAY 4HK3N 3V6FA 3TBTB 3LEVH 4YDJB 2DQHH 4TVPE 1BFSA 4Y5YA 1G7JA 3QCVL 5D9SA 5D7LB 1CLYH 3FKUS 1N0XH 1AXTH 1NBQA 5F9WB 4HJGA 4FABL 2G5RA 4WTZA 3GSWB 1NBZB 2X1QA 4NGHL 2Y1VA 2OZ4L 3H3PH 5D7JB 3RL2B 4BQ9A 3C9NA 4CDGC 3PWVB 3E8UH 3T2NH 1DEEB 3GSNH 3EYOA 4OCWL 5LVEA 1I1RA 2CJUH 1GOFA 1C5CH 3FO2B 3VCLA 4D3CL 5CEXA 3QI9C 1WWBX 4IBLT 2FSEB 3HZMA 1KIUA 3SKNB 1AD9B 2BK8A 1R3HA 4Z7QE 4BH8A 5IHZA 1CE6B 5IQ7H 4Y8DC 3STLA 1KB5A 4EDXB 3D85A 2NY0C 5T1KA 1NEUA 3B9DA 2AVGA 4KC3B 5IQ9B 1CD8A 4X6CF 5ESAB 5DK2B 4K8RH 2PXYB 2V9RA 4XMKH 3RA7H 5FYLD 3QCUL 3EJZC 4IHOB 4X5XB 4QHMA 4E41D 1YNTA 4YPJA 4PR5B 4HMCA 3LS5L 5A3ID 5SWSB 1T7XA 2OI9C 3LH2L 1O0VA 4NNPH 3LMJH 5HGAA 3JWDC 3WNPA 1L9NA 5B4MC 3DROB 5LCVL 4NRXA 4U1KA 5C6TL 5HHQA 1T5WA 3ARPA 1FYTD 1TPXC 3PJSB 1U95A 1W72B 4I1NB 3VXSB 3QWOA 1IEHA 2EH7H 5I76B 4WNQB 2VJXA 4HAFA 1TVBA 5DQDH 3H9HA 4EOWH 1NBYA 3HFML 3DHMA 5TE7H 3VGHA 4WV1B 5KSBF 1PZ5A 3CK0L 4KUCF 1ONQA 2OMNA 4FQIH 4OCXL 5F3BB 2R8SH 3WS3B 5D6DC 4KFZC 1NDGB 1JNNH 3QIUD 4RSVA 4Q6IC 1VFAA 5I74C 2HFFB 1MNUL 1IJ9A 1S7UA 5I1HH 4JN1L 2HTKD 3KJ4C 1CR9L 3HFMH 3VH8G 1RK1A 3WCYA 4P5KB 3EFFB 4ISVA 4V2BA 1BF2A 5H37H 2PN5A 4TVPH 4LU5L 4LPWA 4YO0A 2VLRD 5C71A 5CBEA 2Q20A 2BHZA 3THMH 1XCQA 3BZ4B 2EC9T 4GG6F 4MA1B 3MOBH 3MJ9A 4OCSH 3QIWA 1RULL 1S9YB 4TNWF 4JY6A 5DF0A 1F4WH 1MCBA 2V9QA 4LSUH 5CZXC 4DGVH 3VU2A 3FRPG 1VFBA 5SX5K 1PLGL 1ODAA 4M5YL 4X4XA 1I7ZA 3MRBB 2J8OA 5EOQH 1MQ8A 3O41B 1GHFH 3O3AA 3UTZA 4PJ8A 3BPCB 2EDNA 1G9MC 4X6DE 5JA8B 2E27H 1TVDA 3GBLA 2UWEE 5A2KH 3HCVB 5DTFB 4NNPL 5D1QC 5JORA 4YHZL 5ECJE 3LN5A 4Z7VE 3UYPA 4KJPD 2HT2C 3KNBB 4CN1A 3QDJA 2LTQB 3HHRB 3KLSA 1MLBB 3S37X 2PYEE 2E9BA 5F7EH 3S3JA 3FB7A 4PJBF 1TITA 2BFVH 2EDJA 2DYPD 4ODHL 4LPYA 1I1AD 4HJ0D 1FH5L 3VJ6A 3ZDXF 3ZDYF 3QDAA 4HUVA 2JCCF 2PYED 4TULH 2VXTH 1I9IH 3DNKA 3RNQB 2N7BA 5FFLA 5I2IB 3AU1A 4MAYA 2WSKA 1E6JH 3HRPA 4F9LA 3LKSB 4PJDF 3P0YH 4G8EA 1ETZB 4HS3B 3P4OB 4XBEH 4ZXBA 4DQOH 4OFIA 5C0GA 1BJMA 3V5DB 4K3DH 4KTYA 3S3PA 3TV3L 5ESQB 3S5LA 3MUHL 5T3XD 1A6VL 4OGAC 3UTSD 1FVDB 3O6KL 3P0VH 3JXAA 4HX1A 3WLBA 3AXLB 3ROOB 1Q38A 3G6JA 4NKIL 4JPWL 1X9QA 4G9DB 3MLXL 1N64L 3QIBD 4XNQB 5B39G 4C4KT 3OG6B 3WE6B 1U8QA 2ZP0T 4FTVD 1DP0A 3BWAB 1P2CB 5JZ7C 4PY8I 5TDNA 2OR7A 2Q76B 3UJTL 5HHOE 1I1AC 1DQDH 4QKXB 3RY5A 4LFHG 2OXGA 3GMLA 3WBDA 4F7PA 2XI9A 1D6EB 4FMKA 5C08D 2OP4L 1AC6A 3BRFA 3L5XL 3QNYB 1E0OB 3NFSH 3FQNA 2D9QB 5GJSH 4KRMB 3IFOB 5CJBA 5TQ2L 5KVGH 3VXSE 2QSCL 2R0KH 3O2DH 4JHAL 2YWZA 4YGVA 2FB4L 4ALAH 1JV5A 4LVNC 3FO1B 5GS1A 4WU7B 3BKML 1YUHA 5DJ2B 5TDOA 4Y88A 2F9BT 2JJUA 4RX4D 3HE6C 5F7EL 4XPBH 3SE3A 3S6CA 1MCNA 3ARDD 3PL6A 1WAAE 2X05A 1BF8A 2ZUUA 1AHWB 3NACH 3G9VA 2ARJA 3T0BA 1CDBA 5GQBA 2ARJQ 1J12A 2DKSA 2D7TL 3MNZB 3GMMB 5FV1L 4ZO7A 1E27A 1QBLH 4P5TC 1ZGLM 2IGFH 2WV3A 4LF3A 4H0GA 3MV8D 1YMHA 1H5BB 5IW1A 4NNXA 3L5JA 5DVMA 1OQOA 4GS7C 3IKCB 4MNQA 1WC7A 5EDXA 5CZVL 3Q6GL 2FL5A 4ZUUB 4FQJH 1V3MA 4J4PD 4GRWF 4L4VD 3RNKB 4ODUB 2XTJC 4I0KA 2XKNA 4JM2A 3OMZA 3TO4D 3U9PH 2PYFA 1D5BB 1WTLA 3B6SA 4JPIA 4MB3A 3HE6D 2CQVA 5E99L 1KIQB 4DZ8B 2HAZA 3NCJL 1EEUA 4Q6YA 3B9KA 3OKOA 3T0WA 1OTUD 2G60H 1DVFD 1WCBB 3JTTA 1L6ZA 2Q7YB 3OKEA 2P8PB 5FM4A 3T8XB 4WWKB 1P4BL 3MRRA 4XBGB 3F7VA 3R0MA 4S0SD 5DMKA 1AQDA 3VD5A 4M7LH 5GS0C 2K9UA 2FGWL 4XWGL 4G8GE 2P1YA 4WHTA 1NSNL 2IMMA 2V2TB 5DRZB 3L95B 4OCSL 2QKIA 2EDOA 1X5KA 1DLFH 1MFBL 4U6TA 5F71A 4KRNA 4NM4L 1N5AA 3KPRD 4U1MA 2LABA 5DDHB 1QFWM 2R2EB 2BJMH 5EOQL 4NQDD 3MJ8A 1QSFE 3TA3B 3BP6B 1UVQB 3IS0X 1KPUB 2BSSA 2E27L 4J6RL 5L88H 3OR6B 2YPLA 5T3ZH 3STBA 1UACH 5EU7C 5EFIA 2YXMA 1MFAH 4FFZH 4KPHH 3KYMA 4IRJC 4PJIF 5HVGB 5IR1B 4JPVL 4UIKH 1ZLWH 5GRJH 1WZLA 1ADQH 2F5AL 4O2EA 5CCKL 1FO0B 1YUHB 5TDOB 5AZ2L 3HR6A 3X11B 3TIEA 3D9AH 5K33A 3BDXA 4GFTB 3VGBA 1JZ6A 4YDKH 5DHVA 5DR5L 4PJDE 1J87A 3DPBA 3VXUA 4DOHB 2W9LA 5L2KE 4ONFL 4N0YH 5KG9A 4P3CH 5ALBL 4BZ1L 1G0DA 4F7EB 5D1ZB 2FR4A 3QHTC 1A3LL 1A2YB 1IAIL 3KYNA 1CYGA 1S7TA 1GC1H 4P4KD 5KAQF 1KG0A 4TNWK 3GM0A 4V1DA 3RGVA 4JFDA 2A6JA 3P11L 3EYSL 1IM3A 5I17A 1QA9B 2JK5B 2ITCA 3O3BB 3ZZ1A 4HKJB 5INDB 5CGTA 1T1ZB 4G3YL 3WE6A 5GSRB 3H42L 1TPXB 1WBYA 4OFPA 2IAMA 1BP3B 4L3AA 1XT5A 4HUWA 1ACZA 1FYTB 5MEQB 2D4FA 3C5ZD 1ITCA 3QCVH 4HX1B 1RZIB 2Z91A 3GMQA 3IFNL 4Z6AT 4O2CB 1DLHB 2NNAA 3VXPA 2AK1H 1DSFL 2HA1A 1RFDH 2WLZA 5GGRB 2NY5L 2KBGA 3GSNL 4B41A 1YEJL 4U3CA 1ORQB 2NZ9D 5FO7B 1GJIA 1OSZB 3JWOC 1SQ2N 5FDYA 4AEFA 1U8LA 3HZKB 4XP9L 4YXLL 4I0PA 4PD4K 4AT6B 2R56L 5GRYA 5IB4A 1DQMH 3OHXB 4XP4L 3S4SG 2BJML 4R4FL 1BQLH 1DN0B 1T66D 3TJEH 3T3ME 3ZKXB 1FAIL 4H26A 4OF5A 1IAOA 1AI1H 1R5VB 1HH9A 4LEXH 35C8H 4NC0B 3ROLA 1KN4L 2X4TB 5FCUH 3E3QE 4M7ZC 1EERB 1LO3L 3L9RB 1BQUA 3BKMH 3PWUA 3H9SA 5HYFA 3GSXA 5D7IB 3WHXB 1IGFL 2AP2A 4ELKB 3BPOB 1QSFA 1RZKL 2YEZB 3U7WL 2UY7A 2C3GA 1XR8B 5LGKA 3PHQB 4KJWD 5ITFB 4NZTH 3BGFC 3HLAA 1EX0A 4WW1A 1CICB 4YJZL 4APQD 3O11B 3PHOA 4MWFB 4X9FA 2MFNA 4K7PH 2HJKB 1I85C 2H41A 5DVOA 3VXMA 2VAAA 3FFDA 4GAGH 3U6RB 4HGKC 3DYMA 2BY0A 3SE8L 2AABL 1S9YA 1EBAA 3QIWB 4NP4L 3CFJA 4ZS6D 1KLUB 2VERN 4QHNB 4HSQA 4KZEH 1WUNT 1PY4A 3BWUC 3GI8H 1ZLVK 4N0UE 5GS0L 3W82A 1HNFA 2OTUB 3MRIB 2BNQA 4CRPA 4YX2L 5DYOA 4OM0H 1PAMA 3CX2A 1PW3A 2XQYK 1FL5B 5GJTH 3IDNA 1EXUB 3AB0C 5D71L 1LEKA 1DBML 2OCFD 4PJAE 2VWEC 4G6KH 3MLPA 3NVQA 2VXTL 4LNVA 3BGMB 4WV1A 2VDPH 4IMKC 4HLJA 1NH6A 2R4SH 4DN4H 4N5ED 1EGJL 4S1DC 5IMMA 3OF6A 1NANI 2ORBH 5ICXA 3IU3A 3QHFH 4R8WL 4XAKE 4YXHH 3U82B 4KK5C 5C0JB 2IMNA 3CFDA 4YHKL 3L1OL 4OD3H 5J6HA 1MQKL 2V7HA 3LCYA 1I9EA 3CVIH 4GW5A 3GIVA 4L1DA 4LSSH 2VLKD 4RZCB 1AGEB 3H9SD 3GHBH 2APFA 5KJRL 1CFTA 4FQHB 4FQLH 2R4RL 1WGOA 4R7NA 3RKPA 2W91A 2GJ6B 5I19H 2R2BB 1KLGB 4PRIA 3EJJX 1EXUA 5IFJB 2B1HL 1WZKA 2IQAB 1NCCH 2F8XC 3ZKXC 3NCCB 1PBYA 2HVJB 5BCAA 3O3DA 4HWBL 1A4JB 3MUZ1 1BEYH 4NQVB 4R97C 1T7ZA 4PGBA 1YN6A 5C0CD 1RD6A 1MEXH 3FCTB 2WP3T 5JR1H 4LBEA 1A14L 1JWSB 3ZKMD 4WW1B 3VG0L 3NIGE 5B3NA 4M7KL 5BV7C 3QEGL 4PJBE 4NWUL 4N9GB 1XR8A 2MMXA 1CCZA 4XC1H 3S96A 4NN5B 4WUUB 3TFKC 3MRKA 5EORL 1EEYA 5GRVL 4DKDC 4PJ7A 1OAXL 2UYLB 5AG9A 4A6YA 3KVQA 1INEL 4LCUA 1T3FB 1DEEA 1XZ0B 5DMIL 4MXVE 3MROA 3PGFL 1H5BC 5J11C 5IVXA 1NC2A 1DN0A 4CU7A 3N85L 1LMKA 2AEWA 4YHYB 1YEKL 3JVGA 1S7VB 1H3XA 4NKIH 2H45A 4DJMA 3PHQA 3HZKA 5CUSH 4HUKB 2XZCH 2X4OB 2HLFC 1CL7I 3V0VA 3DSNA 3MV8E 5ID1B 2FJHB 1XGUA 2XZAH 2YUXA 2IH3B 4PTUA 4NRZB 4MD5A 5CKAA 3QIUA 2WIMA 4U1JA 4Z7VF 1EPFA 1P84J 3VRLF 4KVCL 4OZFA 4XWOD 5JHDE 2Y07L 1UCTA 3QDGA 3NIFF 1OAZL 1KSRA 1AD0B 5INDA 1BD2D 4H20L 3D85D 1HXMA 4NPYA 4HJJL 5HGHA 2Q6WB 5I66B 1Z6JT 3SGDH 1MWAL 3EAKA 4H8WC 2X6MA 1L7TH 2VLRB 1HYRC 1X5IA 4YHPB 4GAJH 3HPJA 4OUUB 1FRGL 2CR6A 2A6DB 3MYZA 4XB8A 4TUKH 2B1AH 1KJVA 2B20A 2XN9E 2IAMB 4F7EA 2NY4D 5GIRB 1FNSL 2D7QA 5BOZG 3IDUA 1HHJB 2YPLE 4WWID 3ILPA 3SDXE 5AYQA 4OZIB 3OJDA 2LU3A 2BMKB 4IEFB 3P4LA 3R0NA 4HKJA 4G8FA 1G1CA 2D3VA 2CSPA 3RTQA 1HHHB 2IALA 1BQHB 1YNKL 1KPVB 3DO3A 4KQ4L 4XPAH 4HFUH 1KULA 3QXDA 1OGAB 3W9DA 5D2LB 5GGVH 3QCTL 2VLMD 2HJFB 4FFWD 3TO2B 5J13B 3KPPB 1K3IA 4XPFL 3TVMC 3ISWA 4V1DB 4J6RH 5L88L 5DA4A 4GQ9H 4F33B 1MIEL 5IVXE 1RZFH 4OM1H 3HI5H 4PYHA 4Z7WE 1D9KA 1RMFH 4LKXB 4CU6A 3K74B 4M3KB 2Y36H 2BSSB 3R1GL 3BP7B 3VXUB 1UVQA 1BFVL 5A2LH 2YZ1A 3QA3B 3QUXC 1NGPH 4PJ9D 4F58H 3KPNB 4QRRA 1EFXB 1URLA 4WHYG 3HAEA 1MHPH 4I9WE 1CD0A 4QXWA 1HZHL 1L6XA 2QKIB 3VXQA 1MSPA 5DRZA 3LEYL 4RIRB 3TBWA 3T09A 2GIYA 1B4JL 3EJYC 5I1DA 4X5LA 2H9GB 3MV7D 4MAUH 4YAQB 4F7MA 3VFRA 1CD1B 2R15A 1KPUA 3C8KB 4LLMB 1MJUL 4MA3B 3JTTB 4CVZA 3ECBB 1E28A 4O58H 3B9KB 2GSIB 3OR7A 3LRSA 3O6FC 1DUZA 4WDIA 2EXWC 1UB5A 5D2LF 3D39A 4JPIB 4CGTA 2PYFB 2V2TA 5KVDL 4PTTA 5D2NC 1CZ8L 1OGTA 2D0HA 5GS2H 3BIBX 4LRNL 5LAXB 1C5DB 3F7VB 5DMKB 3O4LD 4JG1H 1YEFH 3MRRB 4K94L 2P4AB 3QUXB 5KBNC 1II4E 2VTFA 1PGRB 4JGJA 2P8PA 3D2UD 1N59B 1CLOH 5DFTA 3LQMA 4LDEB 4BFIB 4OQTH 1FNSH 1OGTB 3X12B 5GS2D 4S1RH 1G7QA 3BE1H 3CZFB 3U30C 1YMHB 3L3HA 2OSLB 3ZDZE 2QR0A 4NQED 3VWJC 1DUZB 1RZJC 3B6SB 1RUML 1E27B 1A6ZB 1VGEH 4XPHL 5I1KL 1QLFA 4H1LB 5CZXD 2Y5TB 4I48B 4JRYE 5I8OL 4NJ9H 4YZFF 4Y4FC 2ZCHH 1RURL 3FQUA 1FIEA 1CG9B 3BD5A 2MCG1 4ODSL 2HTLC 3EO0A 5HGDA 3K0WA 5J1TC 5DHVH 1UZ8A 3C60A 3B2UC 1ZHNB 5IW1B 4PJFE 4L4JA 4YQXL 3D39B 1KCRL 4IIQB 1UB5B 2AKRA 4ZFFB 4D9RD 4DK6A 5DK0B 4Y4FA 1E28B 2EDXA 3NA4A 5KSBA 1X5LA 3OKNB 1FN4A 4OF3A 1CD1A 3WN5C 2A83A 4IMLB 5ENWA 3FQNB 3WV0A 5CJXA 3EHBD 3IDMA 4P9ML 4XBPA 3GB7B 4XVTH 5DD6B 2XWJA 1OTTD 2DQIH 4P57B 5CIPA 4I2XE 3HAEB 4U33A 3JWDH 1EFXA 2BNQE 2DQCL 3RPIA 1JI1A 4LK4A 1Z0MA 3FO1A 2NTFA 3QA3A 1I7TB 5F1IA 5F9OL 4RWYL 2UWEF 4YHNB 2WBWB 1KJ3H 5CSZB 2L0DA 4Y1AD 4JHBA 1MCPL 4HCRH 4PRHE 3Q48A 4P5TB 3DYOA 2NX5B 2GT9A 4G8GA 1Q8MA 5CP7B 2RCSL 3HUJB 2VAJA 1QUNA 3KPPA 5FDWA 4UBDC 5FB8A 3WJJC 3I6GB 5CJ8A 4I3SL 1MWAB 2DLTA 1S9VB 4UQ3B 2WNGA 1XGQB 4OZIA 1VGEL 4M43H 4MNQE 4TVPD 4DGIL 2K7QA 2HH0H 2FWOA 1KBGH 15C8H 3ALWA 2A6DA 5I1JL 4JKMA 3BVNB 2P5EE 2E7BA 4ZSOA 5IBTL 3U0TA 4KROD 3DOSA 3GHEL 5DVNA 1IM9D 1KEML 1U58A 1PG7H 1A64A 2CJUL 4OD3L 4X6FB 1F90L 3RQ3A 3SO3B 1ETZA 4C58B 4F2MB 5AZEH 3UJIH 4X7TB 3GEWB 5DJYB 4CMMA 2VDLH 1S7VA 3KR3L 5C08A 3ARDC 3CDFA 3EW3B 5HPMB 4DTGL 3GJFH 3P4MA 1E6OH 4I77H 1AJ7H 3UP1A 3DX6A 3MGAA 1BX2A 3BPCA 1L0QA 1KACB 1GGTA 2ZNXA 3RIAK 3SKJL 3VJ6B 5I19L 2DQEH 4NN7C 4NRZA 4HUXB 2B39A 5JQ6L 1FIGH 2F74B 3OKMA 5HXMA 4JN1H 1RZGA 1RUPL 1EEYB 4S10A 3KLHC 1JGVL 1HE7A 2R9HD 3FHAA 4U1HB 1CDGA 1MY7A 3QDJB 4ZDHB 5EUKA 4PG2A 4JFFB 1Q9KA 4RX4A 1T22A 1X5JA 2GTZB 4LVHC 2X4PB 4ODXA 3HCVA 3IETA 1KOAA 4HDIB 1G9NL 1MVUB 1OP9A 2XZZA 4GKSA 5DD1H 2FLBT 4O58L 1VEOA 2EEDA 3O9WD 3QFJB 5JXAL 5GGRY 4DUVA 1M05B 5E03A 5ELIA 1OSPH 4H25A 3D39E 4BM7A 3TO4C 3VXRD 1U92B 4JFYA 3MOAL 1G1YA 5KVDH 1Q72L 4PRIB 2R2BA 1SVZA 1FYHB 3O2VH 1A6TB 1IAKA 1ONQB 4NQSA 3TCLB 4BKLB 4YO0B 3DVFA 4KXZH 1CFTB 2FLRT 1F11B 3T0EE 4PPTA 1F42A 1UM5H 4ISVB 1ZT1B 3CFKA 4WO4C 3L3OA 2EE3A 3DUSA 4NFDA 3C8DA 1BZ9B 2CUIA 2WWMD 5F44A 3QI9D 5KN5A 3M1BB 5TE7L 5GZOC 5C9JA 5LXGL 3EOTL 3T0DA 5C0JA 4WHCA 1DFBL 4P2OD 3O2VL 5FUZL 2Q87A 3MRNB 3TYGH 5E8DL 2DMCA 5B8CC 2ADFH 2ZUQC 3RPKA 3QUMH 3MRMB 5ICXB 3O0RL 4WTWA 1BVLB 1N4XL 1TFHA 2VLJA 4I2XB 1AGEA 2ZCHL 3MRJB 1H3WM 3MUY1 4TSCH 3GIVB 5TE6L 1CK0L 4MZ3A 3GBMH 2V7HB 3SGKC 4DOHE 3HI6H 4F8TA 5D8JL 3GMOB 3FMGH 1A6AA 2PO6D 3HC3L 4U2ZA 1U95B 1W72A 3U83A 5A3IC 1T5WB 3ULUD 1KEGH 3V0AC 4MA8L 4B0MM 3VGAC 4DW2H 4R0LC 5FEBA 5IV2B 1YN7B 3L3JA 4U1KB 4P5MA 1H8NA 5F70A 1I1AA 4HBCH 2H26B 3D3VB 5BS0B 5TE6H 4W81A 2OTUA 3LKRB 4QWWD 1BLNA 5CD5D 2FHFA 5D7SL 1FDLH 1QHPA 2XN9B 3MRJA 3FMGL 5DUML 5DMIH 3BGMA 3RBSA 4BKLA 1QLEL 2IG2L 1KB5B 3MBEC 4ZUSB 2ZUQB 4XWOC 4Y7MA 4KV5F 3GIZL 3ZE1F 3NFNB 1LEKB 3S8WA 4GG8B 3T2PA 2DJ4A 2H3NA 3V6OE 5EU6E 4OCYH 5F9OH 5C9JB 3M1BA 3X3FH 1HINH 2VAAB 2YC1A 3MRIA 4EXPX 3DX8A 3TIDB 3QEQD 4XVJH 2WAHA 4HUUA 4AENA 1QTYT 2Z93B 3GMNA 3RL2A 3B2VH 3PE9A 1WAAF 4XMLL 3DO7B 1I1YA 4JLRA 4ODXB 1H8OA 5D7LA 2AK1L 1CXFA 2M1KA 2CDFA 3OL2A 2WZPD 4OUOA 4WEUD 1UH2A 4JFYB 3MMEB 2HT2D 3ARQA 3T08A 3IAGC 3ZKSD 3VI4E 1DFBH 2YZ8A 4H20H 5I73B 5IHBA 2BY2A 5KW9L 1IFHH 5KZCB 5LBSL 5MEND 4GXVL 1UM4H 2DQGH 3RJDA 3MJGX 1MCWM 2EEBA 2F15A 3MZTA 1IAOB 4QNPE 3PHOB 4MWFA 2I9TA 4Q0XL 5DA0B 1GL4B 1BAFH 1JWMA 4P0DA 5D1QA 2X4PA 5HPMA 3IDJB 3RZCA 4YFLI 4RISL 4C83A 5B8CB 3B5HA 5DHYA 4ZDHA 4F2MA 5J4MA 2AEPL 5HVHC 4G6MH 4OCRH 4HIEA 3AAZB 1EO5A 3MRLA 5HTSA 1FPTH 4EBQL 4PJBB 3I50L 4JO2L 3RX7A 2EEAA 1SJVA 2P24B 3T2QA 1JPFA 1U8PA 1FYTA 5HHXL 2JIXB 4FZEL 5DJDA 1N6QL 5IB4B 1JFQH 1FORH 3AM8A 3GSNB 5GSRA 1W2KT 4LSTH 4G7VL 4YEEA 3LQZA 1JGVH 1OARH 1RY7B 3GGWB 4G42B 4R9HA 4WRLA 2PNDA 5AD0A 4X7SH 4WJ5B 4P2QA 3MA7A 4OGXH 4X9GA 5JIPA 1LNUB 5FF6A 3HS0B 2JB5H 1UYWL 1J8HE 3KYNB 3VFPA 5GS0H 1H8SA 3D39D 4XCNA 4M62H 1Z9SA 1BZ7A 3BKYL 3TVMA 3X3GL 2ICWJ 5ANMA 3FOMA 1KC5H 1XGQA 4JM4L 3R8BB 4UQ3A 1EIBA 4YHNA 3S97C 5EZJA 3D25A 2NPLX 3OPZH 1LO0L 4LCWB 2OZ4A 2JK5A 2RFXA 5IBLC 3OKDB 1T2QL 5ALCL 5IVZB 1DBMH 5I71B 4XVUC 2O5ZL 5T1KD 3GI9H 3KPSE 4G80A 3HUJA 1XH3A 1T1YA 3EO9L 2DBLL 2HN7A 1A2YA 4J1UB 1HH6B 4UU9B 4EIZC 3K46A 5LBSH 1Z5LA 3MR9B 4X7DC 4EJ1C 2F58L 5IFAH 2CRYA 4OIIH 3Q6FA 1U8NB 4FHBD 4K94H 2NY7H 1T2QH 5ALCH 5AG8A 1B0WA 2XNAA 3AS1A 3BH8A 1C16A 3KPRB 2NY1D 4NO2A 5EO1A 5ISZE 4Q9QL 3WNLA 3RPIB 3HG1B 35C8L 4BUHA 4M6MH 1WTGT 3QISA 4YFEA 5HGBA 4WO4D 2XXCB 3S37H 1BVZA 2VXUL 3QT2A 2Q8AH 3ZKQD 5J0BA 5SX4I 1ZWIA 3W81A 3IDIB 4ZAKD 2R1YB 5IHUL 5EWIH 3ZHDA 4UUJA 3EJYD 5GPRA 1MHCB 3WSQL 4MJID 2NY7L 2NYYC 1H9VA 1N2RA 2R4RH 4NKOA 1FN4B 2CRIA 3S4SA 4OLYH 3VD7A 3SO5A 2D03H 4JR9L 4PGCB 4KK8D 4DGYH 2R2EA 5EN2A 2VDKH 4Y4FB 2EO9A 1G6RA 4G6JL 5F97E 2BVUA 2D0FA 5EU6A 2NY4B 2VZUA 4DZ8A 1JMXA 1A3RL 3QJHA 3L3HB 3BDYL 2C9AA 1G7QB 3CZFA 1F45A 1UZ8B 3C60B 3X12A 4OV6F 5CSGA 3Q5YA 2F5BL 4HC1L 3F7QA 4NP4H 2VZVA 4YDLB 4KROB 4P4KB 2OR9L 4QRRD 3SOBL 5E2VL 3FO0L 4RA0C 4L5FL 1C5DA 1UYWH 2Y5TA 3IKCA 4I48A 4V1DD 1WCBA 1I8KB 1LEGB 1A6ZA 1ACYH 4IOSD 3T0ED 5BJTA 5IB2A 5DD5L 4LF3B 1KIQA 4XGZB 5KVEH 3H9SE 1BQLL 1EH9A 1XCTA 2CXGA 2I9LB 3BJLA 1M4KA 4NKOB 2NZIA 1AHWA 4N0CC 1KN4H 1SYVB 5FCUL 2VR4A 3ZKMC 3UZQA 1M7IB 1MCWW 1JPST 3L5XH 4Y2OA 5AUMA 3UC0H 5K59E 3E6HB 4XTRD 1BQHG 4JFFE 1WICA 3ZKND 4MXQC 1RUKH 2QSQA 5DJ2A 5CGYD 1KTDA 3P2TA 2GSIA 1PYWB 4OV5A 1P4IH 3BZFB 3MNZA 1ZLUH 3MRGA 2Z31D 1VACB 3MV01 3LDBB 5IW3A 1JNLL 4YHLH 3CPLB 1U6AL 3BH9A 1MVFA 2H9GA 1IQWL 1CR9H 4HIHB 3QNYA 5EIIA 2HN7B 4J1UA 4EIGB 3P0YL 2UUDK 2RJMA 1AH1A 5HD8C 3HMWH 3I85A 1CVSC 5FGRA 4JM2C 5D2LA 2CKNA 3EOBA 3KPNA 4S2SA 5GGSA 3P40A 5TDNB 3P9MA 2NY5H 4HFWB 1OAQH 1A7RH 1JGLL 2F19H 2OXHA 3BP7A 3VW3L 1A21A 3FOMB 1A1MB 1I4FA 4ELMB 1ZEAH 4X99B 3TVMB 2C3WA 4ONHB 4ZTOH 5ADPH 5IJVA 4PRAA 1JYVA 4GRMA 4GRLB 2NY4C 2P8MB 4N5EC 1T89C 5C0DA 5KSUA 3RUGB 4JJHA 1OARL 4MNQD 3GMLB 1T5XA 4LSVL 1AIFB 2ADFL 3O8XB 4GG6B 3LQZB 3QRGL 1LO3H 3WD5H 3DI2B 4XNZC 1UB6B 3U7WH 2P5WD 4PRNB 4QHKI 3M07A 5IQ7L 1NBVH 4OZFB 3G6JB 2ADGB 3EBAA 1HHGB 1WIUA 5F7FA 3A0OA 1IC4L 4URTB 3EUUA 4NQXA 5BRZE 4YHPA 1J1XL 3V2AR 5K9OA 5JW3H 1NAMB 5IEHA 3EYFA 3PDGA 2B2XH 5F7HA 2C1OB 4Y5XC 1D9KD 3S88H 1I85A 2PXYD 4JFXB 5EBMA 3P4NB 3GSOA 1GGBL 3EO9H 5HY9A 5CUSL 4AEEA 1MCJA 1VEMA 2GITA 2ZJSL 5ADOL 3EYVA 1EO8H 4MDJA 3NACL 4WW2F 3VGGA 3O6KH 1U8IB 5HD8D 5JW4M 1C1EH 5HDOA 3OWEA 4YHYC 5MHSD 3BQUB 3TBYB 5FUCC 4A6YB 2GJZB 2V7NA 3GK8L 4O9HH 2YMXH 2UYLA 3QEQB 5IBLD 4JY6B 2HMIC 4G9FD 1GGCL 4BA8A 3S96B 5C2BL 4Y4KB 4FRWA 3EOTH 1NUDA 2KL6A 3K7UA 3ULVL 2D7PA 5CCKH 2ED7A 3SDCD 3QP3A 2J88L 4U3HA 2X7LB 5IG7A 2EE6A 3NIDF 2WBJB 4QHLB 1I7ZB 1RK1B 4M61B 4XNUL 2QLVB 2VDKL 1QQDB 3O3DB 1AFVL 3OXSB 4HWNA 1YC7A 1UQSA 4KXZI 2HFFA 1CLCA 2IQAA 3VXMD 3QG6B 5IOPA 5F7YC 2XQBL 3NFNA 1K85A 1NDGA 1XIWD 1NQBA 2WIIB 3UCRA 5F8QC 5SV4A 3VFOB 4APQA 2PW2B 3HI1A 5IVXF 1LD9A 1EJOH 5EBLA 2AJ3A 4UDUA 1T0MB 1CQYA 4OZHE 5DURD 4DQOL 2FX7L 3AS3A 1Z3GL 1Q9OB 1KCRH 1RVFH 3QFDB 3RDTC 4JDTH 5F7WC 4OZGE 4NC2B 2FECI 1PQZB 4DKFL 3D69B 4LASL 1MRDH 1S7XA 1IKNC 5HHQB 2NY2C 4HV8B 4P59L 4U0RC 3WFHB 4JVUA 12E8H 4WI6A 1VSCA 5HGAB 4RMTA 4PJ5A 1FORL 3MJ9H 1HHIB 1HINL 1RVFL 4HBQA 4OSUH 5DO2D 3V52L 5GZOD 1NPUA 5I76A 4R3SA 1NUFA 3AS2A 4K71C 3HKFA 4O4YL 1S8DA 2CLRB 3CVHB 1FFOB 2IPTL 1OHQA 5F6IC 4GRWH 4P59H 2O5XH 2BHYA 5BV7L 1FL5A 5IUSA 3IU3B 4M7KH 3BN9C 1IILE 5F88A 4O9HL 3P77B 1MCRA 4KV5E 3QDMB 4C4KO 1L0XA 3BPNC 1GOHA 4WY7L 4XNZB 4J3XA 2F54A 1MOEA 5CD5C 4LMQI 1OTSD 1SBSL 1L9MA 3STZA 1A6TA 1IAKB 3HB3C 4LFHD 3ULUC 5IHZB 1WZ1L 3FT2B 3F12B 3NA9H 3KXFD 3JWNC 1OLZA 4NIKB 1OAQL 2X1XR 3FFDB 4F80A 1DE4B 4K8RD 4IOIB 3MBXH 1VERA 1NFDA 3GSUA 1AQKL 5F6IB 3HG1D 3WFBH 1W0VA 3LS5H 1YEHH 1G7JB 1V05A 2DQJL 2IPKA 4CBPA 3MGOB 1CE6A 2J8UA 3UYOD 1UACL 5EUKB 2X1PA 1TVHA 2BNUB 4O02H 2FATL 4FFYH 1L7IH 4MJ2A 1TETH 2W59A 4P2RB 3SKMB 1T83A 4HIJA 5IHUH 5I1CH 1IEAB 4HUXA 5JHLH 5TGBA 4RGND 4UZGA 4IDJL 2QBWA 3B5TA 4AQOA 3QUZB 3PHSA 2XFXB 3DRTA 2CPCA 3DECA 2YHGA 2FJFB 4FQ2H 1FZOA 5C08B 5E0QA 3KJ6L 2EE9A 4YDJA 4BSWA 4BZ1H 3DMMB 4I3RL 4X0KA 1A9EB 1EFXD 2VDPL 2YEZA 4A6YH 5DSCB 2GAZB 4K7FB 2NMSA 1RIUL 5MP6L 1MRCL 3BKCH 4L9LB 4UOW0 3MODH 3L9RA 4YEFA 5GGRA 4DUXA 3MGTB 4NKMB 4LGPB 4BQ8A 1JNNL 2FX9H 4FG6C 3RVTD 4Y2DB 1CXKA 2ERJC 3EDFA 3DETD 3G6JF 1R0AL 3OHXA 1G7HB 4RBPK 2H2SD 3B9KD 1NCNA 4JDVB 2FD6H 2E7HA 1DLFL 2VDQL 1K8IB 2O26U 4KGLA 4CVXB 4KK6C 2X4SA 5HVWA 4LLYA 5HHME 3OBAA 3KPSB 1KENH 5DMGD 4U2YA 4OKVB 1F00I 3OZ9H 5CSBA 5IB1B 4DVBA 1ZSDB 3NZHL 1QVOB 1WBYB 2VDMH 5BW7C 2C1PA 3F7PC 3VFMB 1WIPA 5J6GA 5E70A 3UPRA 3AS0A 4TNVK 1FNGB 3BZEA 2V17L 4MLIA 2E6QA 2UY6A 5FUZH 3DXAD 3PQYD 2A1WH 4XCCH 1ZLWK 2V9TA 3VXNA 1AR1D 3RGVB 2FZ3B 2CR3A 5IR1A 5C0RH 5L0QB 4F7CA 4QXGH 3FONA 3HE6B 3MOQA 1ZLSH 5D1ZA 1U8OB 4RBPH 1U42A 3GRWL 3L3IB 3RHWK 4RMWA 3MJ8B 3RTQD 1ZVSB 2DQDH 5C07D 1TTGA 3WO4B 2APXA 4KQ4H 4DKEL 3AREB 2AV7B 5D7KE 1G7PA 5IESL 4F9LC 2NXYD 1JGLH 1JN6B 4IIQA 1SVCP 1RJZB 3L95A 2R23B 4MZ2A 5FOBA 2EDTA 4LPVA 5GGTA 4WHTB 5ACMA 5I6XB 1A7NH 5CHNB 5HGDB 4HH9A 1IC1A 2CGRH 5E5RB 1AQDB 4WCYH 1G7LA 3TZVC 1YECH 1AXSB 1QYGH 3ARWA 4U6XA 1X4XA 1K5NB 3SE4C 2OM5A 3LH2H 5L7XL 1ZA6A 3HAEH 3QDGE 4XHQA 3HPLB 1QLFB 2R2HB 3IFPB 4YNYB 1R3LB 1ZVYA 2MQ0A 5E7BA 1JNHA 1I7RB 1T7WA 4Y1AB 3AY4C 1I9JL 5D1QD 3FB6B 3QEQE 3RNKA 1RZJH 3BEVB 3QUXA 2R0ZH 3U1SL 3T8XA 1GVIA 4KKBC 3VXTB 2P45B 3MLTB 2OQJB 1XR9B 3S7GA 2GCYA 5F3HB 3CVHH 3V7AG 3GNMH 3HNTH 2B1AL 1F13A 5CP3H 4L8CA 1RK0A 4Y2DC 2ZCKH 4JG0H 4U6HA 2VITA 1BFTA 5DEZA 4CADB 2AXFA 1ZHKA 5D7LD 1HQ4A 5KSAC 3GUTA 1OB1A 1DJSA 1AE6H 4X9IA 3UTSE 4OQTA 5T1MB 2Z0BA 4PJIE 8FABB 2L4OA 4YAQA 1P4BH 3BO8B 1AP2B 5SWZE 5GS0D 2I25N 2DQJH 1UG9A 4TYUA 5I1DB 3P73A 4KUZH 3TBWB 2GY7B 4QY8A 4Q6IA 5DRNB 3MBEB 4TSCL 4PD4J 2ZPKH 2ZUYA 4I0PC 1BBDH 1T04B 1VCAA 1MRFL 2HRLA 3FQXA 1KCSL 3MV9B 4LAQL 5KS9A 1GRWA 5B39B 5C8JB 3I9GL 1DANT 4U7SA 4Y4FD 3VFTA 4JM2F 1QBLL 2A0LC 2IJ0C 5GRXG 1U93B 3BRGC 1FVEB 1NGQL 5E8EB 3C60D 3V5KB 4GW1A 4MX7A 5JOFB 1JMZA 1OY3B 4OZHA 3MLWH 5IBTH 4OFDA 1NC4A 4RGMC 4NWUH 4YGVB 4ZD3L 3VFGL 1J0HA 5JIHA 1HHJA 4YWGH 1S9KC 4MCZB 4KZDL 4UT6L 2EICA 2GKIA 5HPOA 4PRPD 5J13C 2YA2A 4HUMB 3QUMA 1CN4A 1H3TA 3H0TA 3TC9A 1CDYA 1JHKH 2IADA 2VSDA 5AEAA 2FIKA 1RJLA 4AMKL 2BP3A 3OGCA 5C0IB 1J5OL 4WFFD 4ESKA 1HXMB 1FC1A 3QG7L 5L6YL 3WN5A 4HIIA 5JHDD 3HNSL 4K23L 4G8EB 4HS3A 4R2GC 4H5SA 5MENA 1E4KA 4XBEL 1K4CB 4EN3B 3ARRA 3WXWL 5JO5B 3CXDL 5I2IA 4OB5L 5HHVL 3RY6A 2FO4A 4ZPTA 3AFLA 2J1KA 5HDQL 3JV6B 1WSST 2PR4L 2W0PA 1N6VA 2VKXA 2VQUA 2WUBH 2Z31B 4Q2ZA 4PTUB 5HDLA 5DUPH 4P2YA 1BAFL 3QQ4B 3T77A 4MJIE 1WBXA 3V0VB 3S37L 3I84A 1ZAGA 1MLBA 3KLHD 5A1AA 1UC6A 5C0RL 3DBXB 5LQBL 3T0XA 2DQFB 1S7QB 5DI8A 2EDLA 2M8XA 1CFBA 1UWGL 4NO5A 1FPTL 3RWHB 1QLEH 3VWJA 4LLUB 3FN3A 1IQDB 2EYSA 1G7MA 4C54A 3KYKH 1SEQL 1M71A 2ZSVB 1EEZB 4KUCD 1FLTX 2BC4A 5E2TH 2NXZD 2P7TB 4LCUB 1ED3A 5EORH 5EA0L 5JO5A 5SWZB 4DVRH 3NCJH 4PFEA 4WGWB 4N5UA 3U0PA 1S9XA 4RA3A 5MI0B 2W9DL 4F3FA 4YDVA 1WWAX 1CD9B 4JKKA 3U7YH 4GSDH 1B2WH 3LEXA 2AAVA 3O2DA 3W2DH 5DJCA 5FO8A 5DTFA 2VL5B 4IJ3B 4XPFH 4TUOA 1TJGH 4WI7A 4WW2B 3S98A 3EFFA 3TH2T 4G9FA 4P5KA 1QPPA 4N8CL 3WNMA 1UJ3C 3MNVA 2JCCA 2IAND 3DUUA 1MCLA 2A73A 2PTTA 3V6OC 4P2CG 4JHWL 1VFBB 1ZMYA 4MCZA 1RMFL 5DJ8A 4HD9A 4HCRL 3D1MC 4NFCA 5DMYA 3TZVA 4HWBA 4Z0BL 2CDGA 1KLGA 1KNOB 2GJ6A 3IGAA 3UEZA 2B7DT 3K80A 2XG5A 1G9MH 4KK5D 1PZ5B 5ESVB 5FV2A 4FQHA 3RIAF 3EGSB 3FT4B 4WFGD 3MLYH 1HZHH 1P4LA 3SPVA 5JQHC 4U1SA 1FVCA 1BREA 2H1PL 4XXDB 4X9BA 1FDLL 4PP2B 4WU5B 2I24N 1J05B 2MCPL 1U93A 2B4CC 4ONGL 5EZIL 4YXKH 3T0VA 3BUYA 4QYOB 4QCIA 2A77L 4UDTA 4XC3L 4JO2H 3UTSB 3JV0A 2B8OT 1GIGL 1FRGH 1X5ZA 3MLZL 4JN2B 3NFPB 1A5FL 5F3BA 4FFWC 1T04A 4I3GA 3K8KA 1ND0A 1MI5B 2NW2A 2E6PA 5TH2A 1A7QL 3F8UB 3SN6N 3GDBA 4Y89A 8CGTA 3C09C 3H9HB 5IVNA 1FZMA 1R3JB 3TN0B 5ID0A 1QBMH 3KPSD 2CO7B 3A67H 5DFVD 3RWJB 3BO8A 3BT2H 2EDRA 4JGUA 3LV3A 4P4RA 3VE0A 3WFBL 2VL4A 3ZE2F 5K9QI 4NM8H 4D9LH 4TRPL 5MEPB 1NMCB 4C57C 4JFDD 1F2XK 1T4KB 1ZHKB 1JTPA 3D48R 5DJZB 4IHOA 5ISZB 3B9AA 3HI5L 1A7OL 1YEDB 4WHDA 5EUOB 3LS4L 3MXWH 3SY0B 1A3RH 3T1WA 5DK2A 1RIHH 3PG2A 5DJXB 5J9PA 1P6FA 3BP4B 1NANH 2CIKB 4AL8L 4F58L 5SWSA 2OR9H 5CD3B 3SDDB 5HHPB 1UGNA 1TQCC 1A6UL 2V5RA 3C2SA 3VDAA 1KN2L 1YNTB 4UAOC 1AD9A 1NCUA 3MRFB 1NJ9B 3CJJA 3TYFA 1TJHL 4OD2A 1KJMA 3P3YA 2BRRL 3Q3GB 4Y1AA 3BDBA 3MO1B 4I5BA 1V8HA 5JIIA 4R96B 3C9NB 2YPKB 2HH0L 4BK5A 1A8JH 3PP4L 3KWWA 2VH5H 1YEIH 2EDYA 4LCWD 4EDXA 4ONFH 5IWLA 2N4IA 2ICWB 4OBSA 3TBTA 3B3IB 4R7DB 4BQCA 2AK4A 2CLZA 4FZ8L 2E9IA 3SKNA 3FOLB 2DTSA 1K2DA 2Q8AL 4RNRA 3ARBC 5FOBB 1N26A 4U49A 2PTVA 2HG5A 1HXYA 5FO9B 1R5VA 5KVFL 1NCDH 2P42B 3EFDL 3G6DH 3HE7D 3PGCA 5ICYA 3EOYG 1S5IL 3VH8A 4Z76B 2CIIB 3CVIL 2AABH 4YBLC 2QADB 3C8HA 3L3DA 2MPAL 2AJZB 5FO7A 1AGFB 1AGCA 2P46B 4PJ7E 5E8OB 4NYLB 4HC1H 4KVNL 5CEZE 2QEJA 3OX8B 4HWEL 1IBGL 2IANE 1JF1A 4YPGA 3HAEG 3PV6A 1IKFL 3UTTB 2HMID 2VLME 1T7VA 4RRPA 3WDIA 5TQ0H 5H94B 2C1PB 4YHMH 4QRQA 1LK3H 1ZSDA 2ITCB 3HC0B 4X98B 5TDPA 2ATPA 5C07A 5HBBA 3CIQA 4PJ9C 4XPGL 1KN2H 3VG0H 1QFHA 2FH8A 3RWEB 4YC2C 2X4SB 3F7YA 4W4NA 1AGFA 5FA3A 2AJZA 3FO9B 5TF0A 3CH1A 1NGWA 5IVOA 1H15B 1S7RB 3O6FB 4FZEH 1N6QH 1PSKH 3BFOA 4V2CB 1YPZA 2ESVD 1YECL 2OS7A 4YPGB 1GC1C 2NY6B 4N0CD 3BQUC 3N06B 3ZE0E 3O4LB 1J1PL 3ESUF 5HHOA 1LO5B 4GMSL 4U6YA 4K7PL 3V9FA 4MB5A 4YHZH 1UH3A 25C8L 1ES0B 4S1RL 3BN3B 3JUZA 3BISA 5E8OA 3MNWB 1YA5A 1KGCE 1OAYH 2HT3C 4KI1A 5DSCA 3RIFF 2EIEA 4MD4A 1A9EA 5KJRH 2ED9A 2RCSH 4XNYH 2X4UA 4OCMC 4HS8H 1FH5H 1FZOB 5ADOH 1J1PH 2VISB 4RFNC 5FK9A 3UO1L 3LOWA 2YKLL 1B3JA 3VGEA 2EC8A 4HH8A 2YD8A 4KZEL 4K55A 1UM4L 1OP5H 3PDOA 2O5XL 2L7UA 1SJHB 4JO1L 4M8QB 5FHAH 3HE7C 2HG5B 4BK4A 1WCQA 3GNML 3BGAA 3HNTL 4S0TD 5CAYB 1VADA 2CK0L 4IM8A 4P2RA 2VLLA 4X8XA 1DQLL 5ADPL 3JSSA 1K2DB 1B90A 5CJOL 3FOLA 1GGCH 4HS8L 1WFUA 4MGXA 1LE5B 1FSKC 4R90L 2BNUA 4K3GA 4AEIL 4Q9CA 1QSEE 1C7TA 5EB9A 2ICWA 2NY6C 3V6ZA 3VGFA 4GS7B 4X6CA 2RQ8A 4Y19E 5CD3A 5F8RC 4R2GB 4HZLA 5JW5A 5K9KB 4GJTB 4HZAA 3CC5B 3S36X 2FEEI 5TQ0L 4DWHA 2L7JA 1EGJH 1N64H 1S7WB 1YEDA 4PBWD 5T3ZE 2YOCA 3CZJA 3FB8B 3VFSB 4ZPVA 2IANA 5D1ZC 4E9LA 3U4EB 2HWZL 3T1FB 2EYTA 3TYFB 3CCHB 4UTAH 4ZQKA 5H2BA 2WQ8A 3FT2A 2ILLA 4P4RB 5HHPA 1G7IA 5C6PB 4WFFE 1PFCA 3STZB 3NTCL 1BZQK 1RHFA 1NAML 5HYIA 4P3DB 1EK3A 1BD2A 1EMTH 3TN0A 5ID0B 5J9PB 1QG3A 2DI9A 5IF0B 1LK2A 4LHUB 3QIBA 5DXWA 1IT9L 1ND0B 1BBJA 2NX5D 1A3QA 3HMWL 2DDQL 2FECL 4PJEF 4XPHH 5DRWB 3MLWL 3CX5K 2OR8A 1CGTA 4I18C 1UCBH 5K93A 5IIEB 4KMTL 2ARJB 5EU3A 2F19L 3BUYB 1QO3A 3OQ3B 4CMHC 5JOPE 1O5DT 4HBCL 4WFHD 4PY8J 4MA7L 3NPSB 4ZTOL 3C6SB 3G08A 5F1SA 3CFEA 4OCWH 5MP6H 3L7EA 2X5PA 3MOAH 3KXFA 1P7HL 4HJJH 3S9DB 4POUB 2IFFL 1SBBA 1VEPA 3I6KB 3QUKB 3X13B 5A43C 5E9DD 3FN9A 5LG1A 4KMTH 3X17A 4JN2A 5E6YA 4L8SC 5IMKB 1IE5A 1S7XB 4EI5B 2AV1B 2BNRE 2HVKA 3P9LB 4XHJC 2MTPA 1CT8B 4JY4A 2GTWA 3NIGF 2BVPB 1IAMA 1G9EA 1RV6X 3DUUB 4JHWH 3MNVB 2A9ML 2AEQH 4LCCC 5I9QB 1ZE3C 3QXUA 1J0JA 1D6EA 3LAFA 2VL5A 4XI5D 5DZNA 5L9DL 3EGSA 5HDQH 4FTVE 1DBAH 3V7AE 4ODWB 4GMTH 1RSFA 3CGTA 2Q76A 1KNOA 5CILH 4YDVB 3HE7A 4KRPB 1TDQA 2R0LH 4PJEB 2R1WB 5EU5A 4L29B 5I1LB 4M62L 3TM6A 1RZFL 3VD3A 5C86A 2P5EB 2HT4D 2QSVA 2AJVH 2V5MA 4M1GH 4O51B 2PTTB 3AXLA 5D8JH 4ONGH 3ES6B 5EZIH 5F7MC 2UUDH 3WLBB 1L0YA 4QHLA 1DBAL 2BY1A 2WBJA 3W11D 3L7FB 1OP3K 1NFDE 4PUBH 4IRJA 4RFEA 4EUPA 3ARGD 2XKUA 5FUOL 4NO5B 3RWHA 1R5WB 1Y18A 4Y16A 2WUCH 3WS6C 5I8CB 2OJEA 1KV3A 4G6FB 4F3FB 1KXVC 3G5VB 2VMFA 2FRGP 3QEQA 1T0NA 4MQTB 4L3CB 3BUTA 2IPUK 2QSTA 4HKXB 5FCSH 5C0BE 1VFOA 1G6VK 1U8IA 3GM8A 4Z95H 2X4QB 2FEEL 1HCFX 1IGTA 4LLDA 1KB9J 5GGVY 4MDJB 3CX5J 3EYVB 1TNMA 2AXHA 3B9EA 2A38A 3PNWB 5HY9B 1F90H 3UTQB 2HYMA 5EBMB 1DBBL 4O5LL 5GRJL 2I60L 1ERNA 2P47B 4JFPB 5HVFB 1WVZA 4WFGE 3RAJL 1ZT4A 1FFPB 5AAWA 1RJLB 4KHXL 1Q1JH 5BO1L 4HF5L 4ZFOB 1NL0H 4X4XB 2FO4B 2UZXB 1P53A 2YSSB 5SWQA 1CXEA 1IQWH 2FX7H 1K4CA 1CS6A 5EU5B 4PGDA 5KS9F 3U36A 2AQ3A 5IMLA 5FYJD 4FMFA 1NUNB 1NKOA 3RL1B 4OZHB 4XAWL 5HI3C 4UINL 3MZGB 1PVHA 1W72H 3RY4A 2MOVA 4B53A 4JFHD 4P2OA 3ILQD 4OCRL 3FAWA 4PGZA 4F37F 4Z7WA 2AJYH 4OKDA 5I0DA 1U8JB 5I73C 4IRSD 1FFQA 4MYWB 4HPYL 5J1SC 1YEEH 4OLUL 3I50H 3P9LA 1TQBB 3HE7B 4I0CC 4JZNA 3ZHLA 5D72L 4OLXL 5E1AA 5K9JH 4D0DA 4ODWA 1QLRB 1KEMH 2R0WL 5HI4D 4MX7B 5JOFA 5DZOA 3VXUE 1HK6A 1GGYA 4ZXBD 5JTWA 4P4KC 1GYAA 1BD2E 5F9JB 2H6PA 4YHOL 3KPMB 4HIHA 2JLLA 3KLDA 1Q0YH 4AZ8A 1RIVL 5IEKB 1UXWB 5EC1B 4EI5A 1MRFH 5HYQB 5KS9B 2DOCA 4M7JH 2XTJD 4EQ3A 1FV1A 4KQ3H 2DYPA 2CKBH 2VITB 1K4DA 3KDMA 2IC2A 3QJFB 1FJ1B 3BDYH 1I3UA 4ZAKA 2JJTC 5J12C 4I0PD 1MJJA 4P48A 3MLXH 3UJJL 4NZTL 4CUCA 1V3LA 4JRYA 1CFQB 3BEVA 3GMRA 1HHKA 3GJEA 2OJZH 4G8GD 4POZC 5IM7B 3TT1L 5JLZB 5MEOB 1AGBB 5BV7B 1NAKL 2F53D 3SGJC 1TTFA 2IANB 5C7XH 3TNNA 1FE8H 5FGBC 1KT2A 4FTVB 5F7DA 2YMXL 2NTSP 3HTLX 1GZQA 3SGKA 5KSVB 3QRFM 3BESR 1YZZA 3Q5TA 4KKCD 3ZTJH 2R8SL 5ITBH 1QRND 3U4AA 5C0CE 1J8HB 1SYSB 1ORSA 1D5IH 3VRJA 4NSKA 1MUJA 1X5HA 1HIMH 4ZPVB 4MS8D 1S78C 2LAGB 4EQ2A 2Y4SA 4XVJL 5D72H 5HJ3A 5K9JL 1SJHA 2V6HA 4Y0GA 2GJJA 1ZA3B 1IC4H 3IDYC 1SBSH 4HZLB 3QQ9C 5EOCH 4TTDD 4UILH 1MFEH 4PB9H 1K9TA 1U6AH 4NBZB 1MHCA 3ARUA 4UUJB 2Y7QB 1BQSA 4LDOB 4S1QL 4JZJB 4BSVA 3ZT7A 1QPXA 1U2HA 2YRPA 4R2GD 3HI6L 2DI8A 3VXNB 4XX1G 2MSPA 1UWGH 4F57H 2P49B 3H2WA 3VFVB 4X6DB 4DW2L 1N3NB 2E5EA 2XPGA 2ADJA 1TCRA 5ISZD 4JREC 3I3EA 5A16A 2NXZC 3TBSA 3MR9A 4LRIC 4MD4B 1OSPL 2NXYB 2BY3A 4LCIL 4AY0A 3FONB 4F7CB 3IJSA 3MV11 1GOGA 2HJLA 4UIMB 3ZDZF 4TTGA 4F57L 4XCCL 1RPQA 2ATPB 3MOBL 4CVXA 2BOCA 1J9CT 1UM5L 4NQCB 3BZEB 3S34L 3D25B 4ELMF 4F7TB 1IC5L 2K1MA 4OCYL 4GBXC 4KAQH 1S5HB 1NL0L 4PBVC 1OAYL 2Z92B 1G7HA 5I1AA 1NGWB 4FXLA 1FBIL 2W65B 3FO9A 3V4PL 1T1XB 1PZUB 1SJEB 4Y2DA 5IB1A 5JW4N 1BIIB 3F7YB 2XRAH 3MA7B 5D7JC 1OM3H 4N0RA 3P0VL 4WUUE 3TA3C 3WIHA 5MHSE 3MPCA 1R24B 3EDDA 1BOGA 4HW6A 1T1XA 3O4OC 2Z4QA 2H2SC 3B9KC 1F6AB 2F5BH 5D1XC 1WBZA 2H1PH 1P84K 4X8JA 1Q9LA 3WXWH 1QD0A 1KPRA 3L3GA 5J12B 4RAUB 2VIRB 2GY5A 2EECA 3TBVA 4XAKD 2I5YL 4MNGE 2P24A 2D31B 4MMXC 3DV6B 1JF1B 2W0LA 2A6IA 4QWWC 2MKLC 1EV2E 3D9AL 1NMAH 4HLZH 4FQ1H 4PY7A 4PRBA 5E7FA 1ZEAL 4HIEB 4U3XA 5FYJH 4P5TD 3U30B 2EE2A 3IU4H 2FJGA 4PLJC 5A16B 2J8UB 4UTAL 3O2DL 4JHAH 4OJFH 3MBED 4LHUG 3MRPA 3BXNB 5ICZA 3O81A 4KRPD 1AGDA 3CK0H 1KUMA 4AG4H 2DLEA 3PWNA 3O45B 2Y07H 2KZWA 1NCBL 3IJHA 1YDPB 1KCVL 2GW5A 2PW1B 5D7IF 3RGVC 3BRDA 1TIUA 3MACL 5MENE 1TNNA 1TENA 3WSQH 1XF2B 3UZVB 1F4YL 5CWSA 3ZT5A 2IPKB 3AGVA 1HEZB 5BZWB 3RVWD 1WFOA 4NHUA 5HHMD 2A2QT 1HI6A 4MHHI 5DJXA 2NR6D 3UBXI 2IGFL 4PS4L 2YK1H 4N8CH 4PJAB 2P5WE 1O7VA 3BD3A 3QO1A 3D6GA 4HWZB 4UNVA 1ORSB 1NGYB 3EHBC 3BEWA 1JYWA 5DFWH 2X42A 2QQKH 3MCLL 3GMRB 4RGMB 5E1HB 5F1NB 3RWJA 3G6AA 1T7YA 2WWMC 1GGIL 5ACZB 1YMMB 2ZG2A 2XN9A 3F7RA 5GRVK 3L6FA 1XIWC 3UBXA 5C2BH 1IGFH 2F58H 4LCCB 5I9QC 4WFED 5DJZA 2LFGA 5ISZA 4JFFD 4P5MB 5FKAA 5T3XH 2G60L 2EKSB 3P77A 4HV8A 1NC2D 4QXTA 1M6OA 1NMAL 5EULV 1MCIA 5KSBE 5MEPA 3TPKA 1Q9WA 3GBNL 4U7MA 3QFDA 7FABH 3GMOA 1RJCA 3U1SH 3ZE1E 3REVB 5D7KD 3LEYH 3QFJD 3DVIA 1FYTE 1CFVH 5JHDA 4Y16C 3QH3B 1TTUA 3QXVA 3OSKA 3KDMB 4KKBD 1J86A 4GW4B 5C0AE 4PG9B 2NY2D 3P9WB 4PJGB 3C6LC 4K3DL 1XGRA 5HYQA 1AE6L 4CNIB 3UTSA 3QG7H 5TFSL 5L6YH 1UXWA 1A6WL 1PJ9A 1UQSB 4G6JH 4NO0B 1U8JA 1D6VH 5DD3H 5FM5M 3GSVB 1FO0L 5B38B 1MHHA 1QQDA 5DQJB 3CFBB 3UTPE 3ZO0A 4QF1A 5FKPA 1ZT1A 1FVCB 4WW2A 3AREC 2FYYA 5I18H 1VDGA 4HKZA 4N90E 4ELME 4XB7A 1QLRA 3PIQA 3ARGA 3OTTA 4MSWA 3LEXB 4NQSB 5FO8B 1MFCH 3DWTA 5E1AB 3NCEB 1DBJL 4O02L 5C0FA 2OI9B 2A6KA 4LPTA 7CGTA 1M05A 5I71C 4EBQH 1QR4A 5LWYL 1ZHLA 4NJAL 5E2WL 3BQUA 4JANB 1A4KB 3VWKA 4EVNB 4ZFOA 2BC4B 2ERJB 2F53E 1M71B 1PG7W 4ODHH 4L3EB 2YRZA 5L0QC 3MUJA 2APBA 5IG7B 3W9EA 3LQAL 4MNGA 4OD1H 4RGOL 5JNYB 4Y4HC 4L8DB 2GYSA 3BPNB 2GITB 1PEZA 5BQ7B 4MQSB 3WD5L 2HKFH 2UZYB 3ULSB 4R6UA 5C0CA 1ZLSL 4JDZB 1RZGB 2DF3A 3CD4A 3OKMB 4G43A 1ED3B 1NBVL 1I3RB 3QZWG 3CUPB 4OLYL 4XP1L 3H3KA 1JHKL 4EI5D 2VE6B 1W72L 3P4MB 3EFDH 3G6DL 3THML 1S7QA 5DI8B 1JZ7A 2DQFA 3WIHL 5M95B 2F8OA 1RU9H 2IQ9H 3LS4H 2AK4E 4WFHE 4ZO6A 4ENED 5D96B 4WCYL 2AEIT 1A7BA 4S1DD 1IGCH 4LLDB 2WMPA 1NAMA 5IEHB 3MREB 1J10A 1K8DA 3NAAL 3TT3H 4N8VG 2X4QA 4RFEB 4EUPB 4L3EA 1J8HD 2EDHA 5MERB 1MFDL 4HXBH 4ZFZA 2YBRA 2NX5E 1JRHL 5GSVA 1FNHA 1ZVHA 1T20B 4LPCA 3BYYA 4L29A 5I1LA 1KCVH 1A1MA 1I4FB 4KTEH 5MENB 5E2UL 2A9NL 2LV4A 4KK9D 4M93B 1UA6H 2OJEB 3AMLA 4GG6A 3ZL4H 1RUQL 1C12A 3ULVH 5FB8B 5F7LB 3ARGB 4MSWB 5E4IA 4AK1A 2J3SA 1JTOA 2WK2A 3JVGC 2XTLA 5J11B 4Z5RB 1NLBL 5CP7A 5F9AC 4OLZH 9CGTA 3ES6A 4FZ8H 3QDMD 4WTXA 3TCXA 2MHAB 3WEXA 1PEWA 5HDBE 1MRCH 3BKCL 3GSVA 5B38A 3MQIA 4U6VH 4FQXB 4U1LB 2A9NH 3N1MC 2GTWB 3T65B 4D8PB 3VDCA 3U9UB 3VXOA 4CNIA 4NKDB 2BHUA 4EXKA 4IDLA 4PRDB 3RVUD 1JHTA 1TZIA 3CAFA 5ACLA 5F89B 1KIRB 4S1SH 2J6EA 2VR9A 2JIXD 3KXFB 4RMUA 4AH2A 3GKWH 2ZKHL 1JZ5A 3MFGB 2YRLA 4WVRA 1N0LA 4L9LC 5EIIB 3T2OA 1EUUA 4D0BA 3SOBH 1X6NA 1INDH 1CBVL 4AL8H 3LD8B 4FXKB 2YA1A 1A02N 1SJXA 4J3WA 1A7RL 1ZT7B 2P5WA 5FKAB 1KTLB 3F5WA 1JVKA 2C3HA 4TVSa 3H9YA 3RTQC 4D9RE 3I6LD 1FZKB 4MB4A 3TT3L 4LGRB 2NW3A 4RGNB 2C3XA 4AEIH 2EKJA 4X4YB 5D96C 1A7PL 3FB6A 3QYCA 3AM8C 4LQFL 1NGZB 3ARTA 2P48B 4O2FB 4CADA 3G5XA 4TNVF 3QJHB 3ARZA 1D6VL 4H1LG 3GJFB 4ZUVA 3ZLQC 1UA6L 1YC8A 2RAMA 1JWUB 4XCEA 3V8CA 3K8LA 5JW5B 4FQLL 1BMGA 1ULVA 4PJCE 3MLTA 1JNLH 2X41A 3I3DA 4X6CB 4JFHE 4OQ1A 2YD3A 5K9QG 3RI5F 3RVUC 5LAXA 2H2PD 3CCHA 4Z7QF 2R1YA 2EYTB 3ELAT 1IL1B 4KUZL 1N7ML 4Y4HB 1NGXA 4PJEE 4MQXD 2YXFA 5DLML 2BVYA 3AREA 3C5ZB 3OR7B 2R2HA 3KPRA 3NZ8B 1JZ4A 3OZ9L 4NN6B 3BH8B 3KYAA 1MHEA 2NY6D 1EAPA 1MWAH 3MRPB 4U6XB 2X70B 4DFIA 1MQKH 2HT3D 1T1WB 1I8MA 3BSZL 1I7UA 2ITDA 3PABA 3ZTNL 1G7LB 3MLYL 2BVOB 3NMEA 3NFSL 4XTRC 3SDCC 4FS0A 4PRBB 1SMOA 4YUEH 5I1CL 3QULA 1RHHA 5CLTA 1GZPA 1PG7X 4QRRB 2BOBA 5D2LE 1T2JA 2FB4H 4ALAL 3WFEH 4AM0A 5DS8B 4QGTA 2CMRH 3CNKA 5DT1H 4TTDC 4XT1C 4Y4KC 4HF5H 5EA0H 3ZDXE 5AYUL 1U8OA 3SGJA 2Z4QB 3HE6A 4JPKL 1RIUH 4MXWL 3ARBD 3MNWA 2P44B 4OM1L 1T1YB 1ZANH 2BZDA 3MRQA 1V3KA 1TCMA 4WJ5A 4Z7OE 4ZUTB 1CICD 1J5OH 1ZS8B 5TF1H 1BJ8A 3QDME 2H8PB 2RFXB 1ZGLP 4LCWA 5C09B 5GGUB 2FDBP 1FNGA 2W65A 5CIPH 3RWDA 1A7NL 2BMKA 5I1AB 1HKFA 4K9EL 5IT2L 3TWCL 3D5OF 4P46D 1MCKA 2FEDC 5GIRA 3GFUA 1P5UA 4JO3L 4L8BA 4JDTL 5EU6D 4YX2H 1JPFB 5FA3B 1YEEL 2YN3A 4OF6A 3NH7H 1UENA 4JKPL 4OUUA 3IKKA 3WXVL 2MQ3A 4JQVC 2OP4H 2VKWA 4LLYB 1XGPA 4Y19D 2HJLB 5MI0C 4X98A 1I8LC 3HC0A 4LOUC 3L3DB 3R4DA 1NGQH 1HOCB 5GJSL 2VDML 5H94A 4YBQD 2VC2H 3DVGA 3NIDE 3BMWA 3VI3E 3MACH 2G2RB 3ZDYE 2VZ3A 3V0WH 1SY6A 1N3NA 1I3GL 2YD2A 4M8VA 3ULUE 1LK3L 2I9TB 2VXVL 4K3EL 3SKUD 4NKQB 1C7SA 2GI7A 2G5BA 5BMFH 2ICEA 3MV7A 3DVNA 4LSRL 4PJBA 3OX8A 4KQ3L 4OQTL 3SKMA 1XGUB 5EBWB 2YK1L 4HCRA 1VFMA 3SBWC 3BE1L 4C56B 5DD3L 1QACA 2Y7QA 1EA9C 3LN4A 1TVHB 3T0EC 1AKJA 4M1CC 6FABL 2XKSA 3A6OA 5IROA 3GRWH 3K4ZA 1YPZE 2FJFA 3DRTB 4Z0XA 1KFAL 2C4FU 3A6CL 2FX9L 4KRPC 5HHXH 5CS7A 5I8OH 1GGIH 4NQCD 4QNPF 3TA3D 3IYLW 5C09E 2IH1A 4I5BB 1DE4A 4HIJB 1C5BH 5EG6C 4RNRB 1XFPA 2H32A 3DX9B 3MA9H 1N5YL 3NABL 1EEQA 4LLWB 4XPAL 2R56H 1JPTL 4OZHF 5F72S 3D0LA 2CDFB 3C2AL 2VXSL 4HXAH 1GHFL 4L8SB 2CKBB 3BW9B 15C8L 4MNHB 1I1YB 5CEYA 4LEXL 3KWWB 1H3GA 1YNLH 5C0NC 4V1DE 1KLFA 3IAQA 1BLNB 3SY0A 1FGVH 2YC1B 3N50A 1N5YH 2BNQD 2DLFH 2IEPA 4NCC2 3QDMA 1BFVH 5I6XC 3OPZL 3FN0L 1P7KB 4FFVD 3NGBC 4RRPG 1DUYB 1HSAB 1HDMA 4I8DA 4NGHH 1CFQA 3SQOH 4R7NB 1EGJA 3BP4A 5HGGS 3LIZH 5EO0B 5E8PB 1Z9OA 1OF2B 1C08B 3CVHL 5BVPH 3CSBA 5C0BB 3WUWA 1W8NA 2NW2B 4MAUL 3IT8D 2CK2A 5J6HB 4X80H 5C0AD 4I4WB 4LNRA 3HNVH 4TPRL 3DGGB 3EO1B 4OGYH 5IV2A 3T3PF 5FECB 3HA0A 1KXQE 3MJ7A 5KANG 4NM8L 4D9LL 3SDCB 4Y5VB 2WP3O 2J5LB 1K6QL 1PDKA 1PQZA 4W6YB 4QCIB 3LPGA 3LV3B 1A6AB 1Q9OA 2VZSA 4RFOH 4UV4L 1YPZF 1BZ9A 3RZWA 1QOKA 3MCG1 1N8ZB 3QUYD 1LD9B 1NC4D 5EBLB 4I2XA 1YEFL 3FT4A 2VLJB 4IOFD 1FL6A 4XVUD 1Y0LA 1QYGL 3H7BA 4LSQH 2V2WA 1E4XH 2CDGB 4M6OH 2BSRA 5J7CC 3RZCC 2ZG1A 1VPOL 4UV4H 3W0WA 3L5WA 1MCCA 5ETUA 3OXRA 5C08E 4OZGF 3NCBB 5DYOB 1PG7L 1IAIH 4JJ5A 2A73B 1G0XA 1RJYB 3DUSB 4PRHB 2C3VB 2EO1A 2WW8A 4L1HA 2C4XA 1U3HB 4HDIA 1CGSH 3FO0H 4OFYD 3RL1A 2E7CA 5CFHA 1QKZH 2DLHA 5IB3A 1U0QA 2DN7A 4JRYD 4I3RH 5IMLB 1TLKA 4KROC 3QG6A 5IOPB 1YMMD 2IAMD 3UYRH 3CSGA 3C08L 4H25B 2NY3B 2K7PA 2YSSA 2HFEB 3VMOA 2JCCB 2P7TA 2XV6B 5JMRA 1DSFH 1CU4L 1G6RL 4LLUA 1D5ZA 1CICA 2VQTA 1WIOA 4OZIF 4AEHH 4PV9B 3V5HB 5F7KC 4K23H 2Q8BH 2X4NB 5BVJB 3UTQA 3OAUH 5E6IB 1RUAL 3U4BL 3CXHK 2B0SL 4X5WA 3ARFA 1F4XH 1RUKL 1AY1L 2PO6B 4QRPB 3UJJH 1P1ZA 3QUZC 1V3JA 4LVEA 4E41A 4FQJL 3LN9A 2WUBL 2EYSB 4RFOL 5IMOA 4JO1H 4R26L 1YEGL 2PCPA 3QEGH 4NO0D 1T0NB 4PRNA 3OAUL 3QDHA 4EN3A 1H0DB 1A22B 2WM0A 2IWGA 3DBXA 2V5YA 2XQYG 1U8LB 2OL3B 1UB6A 3RWGA 2ATKB 4JFXA 4QOKE 4HIIB 2LQRA 1WBXB 1PKQA 1AIFA 2O5YH 5EZLB 2YPLD 1R5WA 1T5XB 1VB9A 5CINL 3OGCB 5I0ZA 1RI8A 3V4VH 1JPSL 2Z31A 1DLHA 2NNAB 4Q2ZB 4NQXB 4EZMA 3NGBB 1NMBL 3QUMB 1NEZB 1MREH 2LE9A 4G8GB 4LQ1A 1TZGH 5JDSB 3U79A 2BVQB 4GRMB 4OI7A 1FFRA 1W0WB 3MCKB 4D0CB 1MJ8H 1CXHA 4YBLB 2P5EA 4GQ9L 4ZSOE 2B4CL 4UT6H 1Q0YL 4LARH 1JHLH 5T1LD 1F3JB 1ZGLA 3KS0H 3ARYA 3QEUB 1DL7L 2XZAL 3I6GA 3K8MA 1V7ML 4JQIL 4YBHA 3V4VL 3QUZD 4UOJA 5L9DH 2OLDA 1F8TH 3MUGA 1XF4A 2ZCLL 2ZG3A 2VOTA 2GUOB 3D2UB 5GISL 2B1HH 2CLVA 4JFDB 4XVSL 1WK0A 1DVFA 1XAUA 3BPLB 4AIXA 5J1AA 2LAAA 4CN6A 4CJ0A 1LE9A 4WI3A 4YIQB 2DMKA 4KDTC 1VACA 5JR1L 5D71H 3MTRA 4DAGH 1LQSR 1J1XH 2W0FB 2ZCLH 2KH2B 3V6OA 3Q1SL 3PL6C 1UJ3A 1D9KC 5GGSB 3K4AA 3LKQA 3VFNA 1JK8B 2AKRB 4ZFFA 4XZUB 4XC1L 4ETQA 2CK0H 1JZ2A 3CLEH 5GS1C 5JPMA 4YLQT 2LU7A 2YUZA 3V5KA 2XWJB 3BYTA 3MRDA 3TEUA 3GB7A 4GBXD 1FVEA 5E2JA 1ZXQA 4FXGA 4DAGL 8FABA 2KDGA 4Z7VA 4YFLF 1ZANL 4UB0H 3VFTB 5T1MA 4JFZH 2EH8L 4BFEA 3RWCA 1OB1B 4P49A 4ZD3H 5D1XD 5EIVA 2VABB 4H1LA 5ILTL 3SCMD 1OGAE 4PV8B 3DV4B 5EU4B 4U6HB 3MC0A 2QR0B 1HKLH 1N7MH 1TJIL 3MBEA 2BNRA 2JB5L 1LK2B 5FAAA 3SJVB 3P73B 2RBLA 3EO0B 4BFIA 1H3VA 2R2CA 4QT5A 5L2JA 3WIFA 3DXAB 3PQYB 1QSEA 1IZJA 4KKAD 3DJ9A 4YFDB 1J18A 5JXEA 3PGDB 2DTMH 1IC7L 1S3KL 4WI5A 4LOUD 3OKEB 1KEGL 3L5HA 2W9EL 1F3RB 1MJ8L 2VN7A 1E6JL 3OKLA 4QTIH 4XMKL 4JFQA 1JNHB 2AEPH 3WKNA 4L8CB 1R3LA 4HHAA 3QUYC 1CTOA 4KTDL 1VKXB 4F8QA 1DBKL 3CC5A 1ZA6B 4XP4H 2ICWI 3G6JE 4M7ZB 5GISH 4ODUA 2W60B 3VFRB 3BHBB 2WUCL 4GAJL 4F7MB 2VDRL 4P4KA 4UINH 4C56E 4PTTB 4NC1E 5C3TA 2VLLB 5FA4A 3DLQR 1VADB 1OTTC 5CGYC 1CFSA 4HPOL 4YXKL 3IU4L 4POZD 3DSFL 5HHNA 3U46A 1P69B 1UM6H 5EUOF 1AXTL 4XPTH 4L4TE 2BSTB 2VH5L 5C6TH 3QPQC 4PGCA 1W0YT 1U8NA 1IM9B 1CU4H 1G6RH 4JFEA 3L3IA 1AXSA 1OGAD 4HAGA 4K9EC 1NCBH 1Z5LB 2EIZB 1FNLA 1FNFA 2EC9U 3D18A 4HH9B 3SCMC 3MRDB 4LIQH 1LEIB 1XH3B 2A9MH 4LVOB 3Q0HA 2DS4A 2I60H 4BZ2L 3TO4A 5KOVC 4ETQB 3BPLC 2ESVB 2XRAL 3INUL 4GXVH 1SY6H 2CUHA 3WO3B 5EO1B 1EHNA 5HHOB 3O8XC 4UBDD 1BQHA 2W0FA 1CE1H 1YPZB 5FXCH 1EJ6A 2XWTA 4HXBL 2J12B 1ZOXA 3BIKA 3N0PB 3X3FL 5IJKA 5DD0L 1H15A 4KJQC 2R69L 4XCNB 1LP9E 4F33A 3QQ9D 3INUH 4CW1A 5D5ME 4PJHF 1S9WB 1UCBL 4PYGA 5DHXB 3NPZB 4IRSC 2OTWA 3M45A 3NN8A 2E9WA 4XNXL 3ILQC 3SQOL 4ODTL 4KK8C 5DD0H 1NAKH 1TJHH 1EVUA 4JDVA 4KTDH 5IB5A 4H1LH 2VXUH 1RZKH 4KK9C 5DJDB 2J5LC 1EHLH 3QHZL 2DQTL 3UTTA 3R06A 1J0KA 4RMVA 4DVBB 1KELH 4CVUA 3DRQB 1WF5A 1CLYL 1NEZA 1AQKH 3VI3F 1GIGH 4PB0H 1OTSC 5EU7E 5F9DC 4MD5B 3LY6A 3KPSA 3P30L 2Q6WA 5I66A 1QRKA 3MRHB 3GGWA 3AAZA 2I07A 1GAFH 1QRNA 2IBGA 4FFYL 2NY1C 4L9LA 3W11C 3P4OA 4NZUL 1D5IL 4N1EA 2VLJD 2W9DH 5DHYB 3DMMA 1ZLVH 2F54D 3QDGB