3NJ0A

X-ray crystal structure of the pyl2-pyrabactin a complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
177
Chain Sequence
GLTDEEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRVVGGHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for selective activation of ABA receptors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
molecule keywords Abscisic acid receptor PYL2
total genus 46
structure length 177
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nj0A00
1XUVA 3F08A 5C9YA 4N3EA 4IHRA 3IE5A 1X53A 3ELIA 1B6FA 4DS8A 2KF2A 3KAZA 3P0LA 2VNEA 2L65A 2M89A 4IGWA 2E3OA 2KEWA 1UW5A 2BK0A 4A87A 2GKDA 1QMRA 1FM4A 3OJIA 3KB3A 3QSZA 1XDFA 3P51A 1BV1A 1XN5A 4LGBA 5E46A 2LUZA 4BK7A 1ZXFA 2LDKA 4M9BA 4A85A 3TL1A 1ICXA 2LF2A 4A8VA 1EM2A 3P9VA 4PSBA 2REZA 2L9PA 5JO2A 1JSSA 2A1LA 2Z9YA 3Q63A 3H3QA 2FLHA 3UJLA 4JDAA 2WQLA 3TVRA 4LA7A 4REJA 3H3SA 4JHHA 4LGAA 4REIA 2I9YA 3OQUA 2K5GA 3TVQA 4A80A 2KCZA 3KDIA 4DSCA 3C0VA 4LG5A 3K3KA 1XN6A 1BTVA 5JNNA 3NR4A 3TFZA 4N0GC 3NJ1A 4IH2A 4A84A 3Q6AA 5E4BA 3W9RA 5E4DA 1LN3A 2QPVA 5I9JA 5E4MA 1Z94A 2LEQA 3H3TA 4XRWA 4A8GA 3IJTA 2E3MA 3R6PA 1T17A 4A8UA 3KDHA 2N4BA 3GGNA 3NJOA 2LPXA 2Z9ZA 3NS2A 4DSBA 4QIPA 5AMWA 2RERA 1T27A 2LCGA 1LLTA 4A81A 4BK6A 2D4RA 2R55A 2Q3QA 4C9CA 3PUTA 4JDLA 4C9IA 3ZVUA 2NS9A 3QN1A 1VJHA 4XRTA 2M47A 3NEGA 2PCSA 3FO5A 3KAYA 3W9KA 2K7HA 4BKDA 5I8FA 3NMPA 3PU2A 3UQHA 2E3PA 1TXCA 2VQ5A 4A83A 3JRSA 4A86A 2RESA 2LIOA 2LGHA 3H3RA 3RD6A 3RT0C 4M9WA 3KDJA 4C94A 3KL1A 4GY9A 2FFSA 2IL5A 3NEFA 4IGXA 4B9RA 3NMHA 3KB0A 4Q0KA 3NMTA 3CNWA 4A88A 2E3SA 4MNSA 4RYVA 1TW0A 2EJXA 4BKCA 3Q64A 3WG8A 4FPWA 2PSOA 4JHIA 2MOUA 3OTLA 4REHA 1H2OA 2LAKA 2LE1A 2KTEA 4IGYA 3OH8A 4BTZA 1LN1A 2E3QA 1LN2A 2QIMA 3JRQB 4WVOA 4MA6A 1XFSA 4JHGA 1IFVA 3NMNA 2N4AA 3K90A 3UIDA 3NI8A 3NMVA 3NJ0A 4Z3LA 1KCMA 3KLXA 2E3RA 3RT2A 1E09A 5BRLA 2NN5A 4IH0A 5JO1A 4IGVA 4R7KA 2L8OA 4Y31A 4OICA 4MAPA 1FSKA 3E85A 2E3NA
chains in the Genus database with same CATH superfamily
1XUVA 3F08A 3GKEA 5C9YA 4N3EA 3HJFA 4IHRA 2ZYLA 3IE5A 1X53A 3ELIA 1B6FA 4DS8A 2KF2A 3KAZA 3P0LA 2VNEA 2L65A 2M89A 4IGWA 3DLHA 2E3OA 2KEWA 1UW5A 2BK0A 4A87A 2GKDA 1QMRA 1FM4A 3OJIA 4KPYA 3KB3A 3QSZA 1XDFA 3P51A 1BV1A 1XN5A 4LGBA 5E46A 2LUZA 4BK7A 1ZXFA 2LDKA 4M9BA 4QDFB 3TL1A 4A85A 1ICXA 2LF2A 4A8VA 1EM2A 3P9VA 4PSBA 2REZA 2L9PA 5JO2A 1JSSA 2A1LA 3DLBA 2Z9YA 3Q63A 3H3QA 2FLHA 4NCBA 4QCKA 3UJLA 4JDAA 2LAFA 2WQLA 3TVRA 4E6FA 3HK2A 4LA7A 4REJA 3H3SA 4JHHA 4LGAA 4REIA 2I9YA 3OQUA 2K5GA 3TVQA 4A80A 2KCZA 3KDIA 4DSCA 3C0VA 4LG5A 3K3KA 1XN6A 1BTVA 5JNNA 3HM9A 3NR4A 3TFZA 4N0GC 3NJ1A 4IH2A 4A84A 3NQNA 3Q6AA 3HO1A 5E4BA 3W9RA 5E4DA 1LN3A 2QPVA 5I9JA 5E4MA 1Z94A 2LEQA 3H3TA 4QDDA 4QDFA 4XRWA 4A8GA 3IJTA 2E3MA 3R6PA 1T17A 4A8UA 3KDHA 4N47A 2N4BA 3GGNA 3NJOA 2LPXA 2Z9ZA 3NS2A 4DSBA 4QIPA 5AMWA 2RERA 1T27A 2LCGA 1LLTA 4A81A 4BK6A 3HXMA 2D4RA 2R55A 2Q3QA 4C9CA 3PUTA 4JDLA 3GTEA 4C9IA 3ZVUA 2NS9A 4NCAA 3QN1A 1VJHA 4XRTA 2M47A 3NEGA 2PCSA 3FO5A 3KAYA 3W9KA 2K7HA 4BKDA 5I8FA 3NMPA 3PU2A 3UQHA 2E3PA 1TXCA 2VQ5A 4A83A 3JRSA 3TGOC 4A86A 2RESA 2LIOA 2LGHA 3H3RA 3RD6A 3RT0C 4M9WA 3GTSA 2YH6A 3KDJA 4C94A 3KL1A 4GY9A 2FFSA 4JHYA 2IL5A 3NEFA 4IGXA 3F73A 4B9RA 3NMHA 3KB0A 4Q0KA 3NMTA 3CNWA 4A88A 2E3SA 4MNSA 4RYVA 1TW0A 5EKQC 2EJXA 4BKCA 3Q64A 3WG8A 4FPWA 2PSOA 3GL0A 4N76A 4JHIA 2MOUA 3OTLA 4REHA 1H2OA 2LAKA 2LE1A 2KTEA 3GB4A 4IGYA 3OH8A 3GOBA 1LN1A 4BTZA 2E3QA 1LN2A 2QIMA 4N41A 3JRQB 4WVOA 4QDCA 4MA6A 1XFSA 4JHGA 1IFVA 3GL2A 3NMNA 2N4AA 3K90A 3UIDA 3NI8A 3NMVA 3NJ0A 4Z3LA 1KCMA 3KLXA 2E3RA 3RT2A 1E09A 3HVRA 5BRLA 2NN5A 4IH0A 5JO1A 4IGVA 4R7KA 2L8OA 4Y31A 4OICA 4MAPA 1FSKA 3E85A 2E3NA
chains in the Genus database with same CATH topology
1XUVA 3F08A 3GKEA 5C9YA 4N3EA 3HJFA 4IHRA 2ZYLA 3IE5A 1X53A 3ELIA 1B6FA 4DS8A 2KF2A 3KAZA 3P0LA 2VNEA 2L65A 2M89A 4IGWA 3DLHA 2E3OA 2KEWA 1UW5A 2BK0A 4A87A 2GKDA 1QMRA 1FM4A 3OJIA 4KPYA 3KB3A 3QSZA 1XDFA 3P51A 1BV1A 1XN5A 4LGBA 5E46A 2LUZA 4BK7A 1ZXFA 2LDKA 4M9BA 4QDFB 3TL1A 4A85A 1ICXA 2LF2A 4A8VA 1EM2A 3P9VA 4PSBA 2REZA 2L9PA 5JO2A 1JSSA 2A1LA 3DLBA 2Z9YA 3Q63A 3H3QA 2FLHA 4NCBA 4QCKA 3UJLA 4JDAA 2LAFA 2WQLA 3TVRA 4E6FA 3HK2A 4LA7A 4REJA 3H3SA 4JHHA 4LGAA 4REIA 2I9YA 3OQUA 2K5GA 3TVQA 4A80A 2KCZA 3KDIA 4DSCA 3C0VA 4LG5A 3K3KA 1XN6A 1BTVA 5JNNA 3HM9A 3NR4A 3TFZA 4N0GC 3NJ1A 4IH2A 4A84A 3NQNA 3Q6AA 3HO1A 5E4BA 3W9RA 5E4DA 1LN3A 2QPVA 5I9JA 5E4MA 1Z94A 2LEQA 3H3TA 4QDDA 4QDFA 4XRWA 4A8GA 3IJTA 2E3MA 3R6PA 1T17A 4A8UA 3KDHA 4N47A 2N4BA 3GGNA 3NJOA 2LPXA 2Z9ZA 3NS2A 4DSBA 4QIPA 5AMWA 2RERA 1T27A 2LCGA 1LLTA 4A81A 4BK6A 3HXMA 2D4RA 2R55A 2Q3QA 4C9CA 3PUTA 4JDLA 3GTEA 4C9IA 3ZVUA 2NS9A 4NCAA 3QN1A 1VJHA 4XRTA 2M47A 3NEGA 2PCSA 3FO5A 3KAYA 3W9KA 2K7HA 4BKDA 5I8FA 3NMPA 3PU2A 3UQHA 2E3PA 1TXCA 2VQ5A 4A83A 3JRSA 3TGOC 4A86A 2RESA 2LIOA 2LGHA 3H3RA 3RD6A 3RT0C 4M9WA 3GTSA 2YH6A 3KDJA 4C94A 3KL1A 4GY9A 2FFSA 4JHYA 2IL5A 3NEFA 4IGXA 3F73A 4B9RA 3NMHA 3KB0A 4Q0KA 3NMTA 3CNWA 4A88A 2E3SA 4MNSA 4RYVA 1TW0A 5EKQC 2EJXA 4BKCA 3Q64A 3WG8A 4FPWA 2PSOA 3GL0A 4N76A 4JHIA 2MOUA 3OTLA 4REHA 1H2OA 2LAKA 2LE1A 2KTEA 3GB4A 4IGYA 3OH8A 3GOBA 1LN1A 4BTZA 2E3QA 1LN2A 2QIMA 4N41A 3JRQB 4WVOA 4QDCA 4MA6A 1XFSA 4JHGA 1IFVA 3GL2A 3NMNA 2N4AA 3K90A 3UIDA 3NI8A 3NMVA 3NJ0A 4Z3LA 1KCMA 3KLXA 2E3RA 3RT2A 1E09A 3HVRA 5BRLA 2NN5A 4IH0A 5JO1A 4IGVA 4R7KA 2L8OA 4Y31A 4OICA 4MAPA 1FSKA 3E85A 2E3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUV A;  3F08 A;  5C9Y A;  4N3E A;  4IHR A;  3IE5 A;  1X53 A;  3ELI A;  1B6F A;  4DS8 A;  2KF2 A;  3KAZ A;  3P0L A;  2VNE A;  2L65 A;  2M89 A;  4IGW A;  2E3O A;  2KEW A;  1UW5 A;  2BK0 A;  4A87 A;  2GKD A;  1QMR A;  1FM4 A;  3OJI A;  3KB3 A;  3QSZ A;  1XDF A;  3P51 A;  1BV1 A;  1XN5 A;  4LGB A;  5E46 A;  2LUZ A;  4BK7 A;  1ZXF A;  2LDK A;  4M9B A;  4A85 A;  3TL1 A;  1ICX A;  2LF2 A;  4A8V A;  1EM2 A;  3P9V A;  4PSB A;  2REZ A;  2L9P A;  5JO2 A;  1JSS A;  2A1L A;  2Z9Y A;  3Q63 A;  3H3Q A;  2FLH A;  3UJL A;  4JDA A;  2WQL A;  3TVR A;  4LA7 A;  4REJ A;  3H3S A;  4JHH A;  4LGA A;  4REI A;  2I9Y A;  3OQU A;  2K5G A;  3TVQ A;  4A80 A;  2KCZ A;  3KDI A;  4DSC A;  3C0V A;  4LG5 A;  3K3K A;  1XN6 A;  1BTV A;  5JNN A;  3NR4 A;  3TFZ A;  4N0G C;  3NJ1 A;  4IH2 A;  4A84 A;  3Q6A A;  5E4B A;  3W9R A;  5E4D A;  1LN3 A;  2QPV A;  5I9J A;  5E4M A;  1Z94 A;  2LEQ A;  3H3T A;  4XRW A;  4A8G A;  3IJT A;  2E3M A;  3R6P A;  1T17 A;  4A8U A;  3KDH A;  2N4B A;  3GGN A;  3NJO A;  2LPX A;  2Z9Z A;  3NS2 A;  4DSB A;  4QIP A;  5AMW A;  2RER A;  1T27 A;  2LCG A;  1LLT A;  4A81 A;  4BK6 A;  2D4R A;  2R55 A;  2Q3Q A;  4C9C A;  3PUT A;  4JDL A;  4C9I A;  3ZVU A;  2NS9 A;  3QN1 A;  1VJH A;  4XRT A;  2M47 A;  3NEG A;  2PCS A;  3FO5 A;  3KAY A;  3W9K A;  2K7H A;  4BKD A;  5I8F A;  3NMP A;  3PU2 A;  3UQH A;  2E3P A;  1TXC A;  2VQ5 A;  4A83 A;  3JRS A;  4A86 A;  2RES A;  2LIO A;  2LGH A;  3H3R A;  3RD6 A;  3RT0 C;  4M9W A;  3KDJ A;  4C94 A;  3KL1 A;  4GY9 A;  2FFS A;  2IL5 A;  3NEF A;  4IGX A;  4B9R A;  3NMH A;  3KB0 A;  4Q0K A;  3NMT A;  3CNW A;  4A88 A;  2E3S A;  4MNS A;  4RYV A;  1TW0 A;  2EJX A;  4BKC A;  3Q64 A;  3WG8 A;  4FPW A;  2PSO A;  4JHI A;  2MOU A;  3OTL A;  4REH A;  1H2O A;  2LAK A;  2LE1 A;  2KTE A;  4IGY A;  3OH8 A;  4BTZ A;  1LN1 A;  2E3Q A;  1LN2 A;  2QIM A;  3JRQ B;  4WVO A;  4MA6 A;  1XFS A;  4JHG A;  1IFV A;  3NMN A;  2N4A A;  3K90 A;  3UID A;  3NI8 A;  3NMV A;  3NJ0 A;  4Z3L A;  1KCM A;  3KLX A;  2E3R A;  3RT2 A;  1E09 A;  5BRL A;  2NN5 A;  4IH0 A;  5JO1 A;  4IGV A;  4R7K A;  2L8O A;  4Y31 A;  4OIC A;  4MAP A;  1FSK A;  3E85 A;  2E3N A; 
#chains in the Genus database with same CATH topology
 1XUV A;  3F08 A;  3GKE A;  5C9Y A;  4N3E A;  3HJF A;  4IHR A;  2ZYL A;  3IE5 A;  1X53 A;  3ELI A;  1B6F A;  4DS8 A;  2KF2 A;  3KAZ A;  3P0L A;  2VNE A;  2L65 A;  2M89 A;  4IGW A;  3DLH A;  2E3O A;  2KEW A;  1UW5 A;  2BK0 A;  4A87 A;  2GKD A;  1QMR A;  1FM4 A;  3OJI A;  4KPY A;  3KB3 A;  3QSZ A;  1XDF A;  3P51 A;  1BV1 A;  1XN5 A;  4LGB A;  5E46 A;  2LUZ A;  4BK7 A;  1ZXF A;  2LDK A;  4M9B A;  4QDF B;  3TL1 A;  4A85 A;  1ICX A;  2LF2 A;  4A8V A;  1EM2 A;  3P9V A;  4PSB A;  2REZ A;  2L9P A;  5JO2 A;  1JSS A;  2A1L A;  3DLB A;  2Z9Y A;  3Q63 A;  3H3Q A;  2FLH A;  4NCB A;  4QCK A;  3UJL A;  4JDA A;  2LAF A;  2WQL A;  3TVR A;  4E6F A;  3HK2 A;  4LA7 A;  4REJ A;  3H3S A;  4JHH A;  4LGA A;  4REI A;  2I9Y A;  3OQU A;  2K5G A;  3TVQ A;  4A80 A;  2KCZ A;  3KDI A;  4DSC A;  3C0V A;  4LG5 A;  3K3K A;  1XN6 A;  1BTV A;  5JNN A;  3HM9 A;  3NR4 A;  3TFZ A;  4N0G C;  3NJ1 A;  4IH2 A;  4A84 A;  3NQN A;  3Q6A A;  3HO1 A;  5E4B A;  3W9R A;  5E4D A;  1LN3 A;  2QPV A;  5I9J A;  5E4M A;  1Z94 A;  2LEQ A;  3H3T A;  4QDD A;  4QDF A;  4XRW A;  4A8G A;  3IJT A;  2E3M A;  3R6P A;  1T17 A;  4A8U A;  3KDH A;  4N47 A;  2N4B A;  3GGN A;  3NJO A;  2LPX A;  2Z9Z A;  3NS2 A;  4DSB A;  4QIP A;  5AMW A;  2RER A;  1T27 A;  2LCG A;  1LLT A;  4A81 A;  4BK6 A;  3HXM A;  2D4R A;  2R55 A;  2Q3Q A;  4C9C A;  3PUT A;  4JDL A;  3GTE A;  4C9I A;  3ZVU A;  2NS9 A;  4NCA A;  3QN1 A;  1VJH A;  4XRT A;  2M47 A;  3NEG A;  2PCS A;  3FO5 A;  3KAY A;  3W9K A;  2K7H A;  4BKD A;  5I8F A;  3NMP A;  3PU2 A;  3UQH A;  2E3P A;  1TXC A;  2VQ5 A;  4A83 A;  3JRS A;  3TGO C;  4A86 A;  2RES A;  2LIO A;  2LGH A;  3H3R A;  3RD6 A;  3RT0 C;  4M9W A;  3GTS A;  2YH6 A;  3KDJ A;  4C94 A;  3KL1 A;  4GY9 A;  2FFS A;  4JHY A;  2IL5 A;  3NEF A;  4IGX A;  3F73 A;  4B9R A;  3NMH A;  3KB0 A;  4Q0K A;  3NMT A;  3CNW A;  4A88 A;  2E3S A;  4MNS A;  4RYV A;  1TW0 A;  5EKQ C;  2EJX A;  4BKC A;  3Q64 A;  3WG8 A;  4FPW A;  2PSO A;  3GL0 A;  4N76 A;  4JHI A;  2MOU A;  3OTL A;  4REH A;  1H2O A;  2LAK A;  2LE1 A;  2KTE A;  3GB4 A;  4IGY A;  3OH8 A;  3GOB A;  1LN1 A;  4BTZ A;  2E3Q A;  1LN2 A;  2QIM A;  4N41 A;  3JRQ B;  4WVO A;  4QDC A;  4MA6 A;  1XFS A;  4JHG A;  1IFV A;  3GL2 A;  3NMN A;  2N4A A;  3K90 A;  3UID A;  3NI8 A;  3NMV A;  3NJ0 A;  4Z3L A;  1KCM A;  3KLX A;  2E3R A;  3RT2 A;  1E09 A;  3HVR A;  5BRL A;  2NN5 A;  4IH0 A;  5JO1 A;  4IGV A;  4R7K A;  2L8O A;  4Y31 A;  4OIC A;  4MAP A;  1FSK A;  3E85 A;  2E3N A; 
#chains in the Genus database with same CATH homology
 1XUV A;  3F08 A;  3GKE A;  5C9Y A;  4N3E A;  3HJF A;  4IHR A;  2ZYL A;  3IE5 A;  1X53 A;  3ELI A;  1B6F A;  4DS8 A;  2KF2 A;  3KAZ A;  3P0L A;  2VNE A;  2L65 A;  2M89 A;  4IGW A;  3DLH A;  2E3O A;  2KEW A;  1UW5 A;  2BK0 A;  4A87 A;  2GKD A;  1QMR A;  1FM4 A;  3OJI A;  4KPY A;  3KB3 A;  3QSZ A;  1XDF A;  3P51 A;  1BV1 A;  1XN5 A;  4LGB A;  5E46 A;  2LUZ A;  4BK7 A;  1ZXF A;  2LDK A;  4M9B A;  4QDF B;  3TL1 A;  4A85 A;  1ICX A;  2LF2 A;  4A8V A;  1EM2 A;  3P9V A;  4PSB A;  2REZ A;  2L9P A;  5JO2 A;  1JSS A;  2A1L A;  3DLB A;  2Z9Y A;  3Q63 A;  3H3Q A;  2FLH A;  4NCB A;  4QCK A;  3UJL A;  4JDA A;  2LAF A;  2WQL A;  3TVR A;  4E6F A;  3HK2 A;  4LA7 A;  4REJ A;  3H3S A;  4JHH A;  4LGA A;  4REI A;  2I9Y A;  3OQU A;  2K5G A;  3TVQ A;  4A80 A;  2KCZ A;  3KDI A;  4DSC A;  3C0V A;  4LG5 A;  3K3K A;  1XN6 A;  1BTV A;  5JNN A;  3HM9 A;  3NR4 A;  3TFZ A;  4N0G C;  3NJ1 A;  4IH2 A;  4A84 A;  3NQN A;  3Q6A A;  3HO1 A;  5E4B A;  3W9R A;  5E4D A;  1LN3 A;  2QPV A;  5I9J A;  5E4M A;  1Z94 A;  2LEQ A;  3H3T A;  4QDD A;  4QDF A;  4XRW A;  4A8G A;  3IJT A;  2E3M A;  3R6P A;  1T17 A;  4A8U A;  3KDH A;  4N47 A;  2N4B A;  3GGN A;  3NJO A;  2LPX A;  2Z9Z A;  3NS2 A;  4DSB A;  4QIP A;  5AMW A;  2RER A;  1T27 A;  2LCG A;  1LLT A;  4A81 A;  4BK6 A;  3HXM A;  2D4R A;  2R55 A;  2Q3Q A;  4C9C A;  3PUT A;  4JDL A;  3GTE A;  4C9I A;  3ZVU A;  2NS9 A;  4NCA A;  3QN1 A;  1VJH A;  4XRT A;  2M47 A;  3NEG A;  2PCS A;  3FO5 A;  3KAY A;  3W9K A;  2K7H A;  4BKD A;  5I8F A;  3NMP A;  3PU2 A;  3UQH A;  2E3P A;  1TXC A;  2VQ5 A;  4A83 A;  3JRS A;  3TGO C;  4A86 A;  2RES A;  2LIO A;  2LGH A;  3H3R A;  3RD6 A;  3RT0 C;  4M9W A;  3GTS A;  2YH6 A;  3KDJ A;  4C94 A;  3KL1 A;  4GY9 A;  2FFS A;  4JHY A;  2IL5 A;  3NEF A;  4IGX A;  3F73 A;  4B9R A;  3NMH A;  3KB0 A;  4Q0K A;  3NMT A;  3CNW A;  4A88 A;  2E3S A;  4MNS A;  4RYV A;  1TW0 A;  5EKQ C;  2EJX A;  4BKC A;  3Q64 A;  3WG8 A;  4FPW A;  2PSO A;  3GL0 A;  4N76 A;  4JHI A;  2MOU A;  3OTL A;  4REH A;  1H2O A;  2LAK A;  2LE1 A;  2KTE A;  3GB4 A;  4IGY A;  3OH8 A;  3GOB A;  1LN1 A;  4BTZ A;  2E3Q A;  1LN2 A;  2QIM A;  4N41 A;  3JRQ B;  4WVO A;  4QDC A;  4MA6 A;  1XFS A;  4JHG A;  1IFV A;  3GL2 A;  3NMN A;  2N4A A;  3K90 A;  3UID A;  3NI8 A;  3NMV A;  3NJ0 A;  4Z3L A;  1KCM A;  3KLX A;  2E3R A;  3RT2 A;  1E09 A;  3HVR A;  5BRL A;  2NN5 A;  4IH0 A;  5JO1 A;  4IGV A;  4R7K A;  2L8O A;  4Y31 A;  4OIC A;  4MAP A;  1FSK A;  3E85 A;  2E3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...