3NJ0A

X-ray crystal structure of the pyl2-pyrabactin a complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
177
Chain Sequence
b'GLTDEEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRVVGGHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Structural basis for selective activation of ABA receptors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 46
structure length 177
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nj0A00
2NS9A 2LEQA 3Q64A 4JHIA 4BK7A 4LG5A 4JHGA 2KTEA 4DSCA 5JNNA 2L8OA 3K90A 3NMPA 2FLHA 2WQLA 5I9JA 3NEGA 2E3OA 1QMRA 4BKDA 5JO2A 3E85A 4DSBA 2KEWA 5JO1A 1LN3A 4JDLA 3WG8A 3P9VA 3UIDA 1Z94A 3QN1A 4MAPA 1EM2A 2K7HA 1X53A 4A80A 3NS2A 4PSBA 2VQ5A 4A81A 4XRWA 3P0LA 2LGHA 2Z9ZA 3RT2A 1XFSA 2PSOA 3KDJA 2E3RA 1KCMA 1FSKA 2RERA 1LN2A 2KF2A 2PCSA 2RESA 2Z9YA 2E3NA 3IE5A 4M9BA 4N0GC 4A8GA 4C9CA 4IGWA 1XDFA 4C94A 5E4DA 3CNWA 1LN1A 2NN5A 2FFSA 4MA6A 4QIPA 3PUTA 4MNSA 3KAYA 2I9YA 2L9PA 4BKCA 3GGNA 2MOUA 4GY9A 1TW0A 4R7KA 2EJXA 5AMWA 2L65A 2A1LA 1BV1A 4REIA 4BTZA 4XRTA 3KL1A 1XUVA 2LPXA 3H3QA 3UJLA 4B9RA 2BK0A 3PU2A 1XN5A 3KLXA 3P51A 4IGXA 2E3QA 3H3SA 1BTVA 3ZVUA 1H2OA 1T17A 3NJ0A 5E4MA 4A87A 3H3RA 3RT0C 2LUZA 5I8FA 2IL5A 3W9RA 3UQHA 2LF2A 2M89A 4IH0A 3TFZA 4IGYA 4N3EA 1TXCA 1T27A 2LAKA 3KDIA 3TVRA 4A84A 5E4BA 3Q6AA 3C0VA 3NMTA 2GKDA 4BK6A 1XN6A 4M9WA 2N4AA 4REHA 4JHHA 5E46A 4A8UA 3NJ1A 2Q3QA 3NMNA 3TL1A 3K3KA 3JRQB 2K5GA 2LE1A 3KDHA 3NR4A 3QSZA 2KCZA 3NI8A 3F08A 2M47A 1LLTA 3Q63A 3KB3A 2LIOA 4REJA 5BRLA 5C9YA 2QPVA 1E09A 1B6FA 1ICXA 4Q0KA 3R6PA 3RD6A 2N4BA 3OH8A 3OJIA 3IJTA 2LCGA 4LGBA 3JRSA 3W9KA 4A86A 3NMHA 4A85A 4IH2A 4FPWA 3FO5A 4OICA 2REZA 1JSSA 3ELIA 3TVQA 4A88A 4RYVA 4WVOA 4IHRA 3KB0A 4DS8A 4C9IA 1FM4A 4Z3LA 3NEFA 4JDAA 3NMVA 1ZXFA 4Y31A 2E3MA 2QIMA 4A8VA 1IFVA 3OQUA 1VJHA 3KAZA 3OTLA 4LGAA 4IGVA 3NJOA 2LDKA 4LA7A 4A83A 2E3SA 3H3TA 2R55A 2VNEA 2E3PA 2D4RA 1UW5A
chains in the Genus database with same CATH superfamily
2NS9A 2LEQA 3Q64A 4JHIA 4QDDA 4BK7A 4LG5A 4JHGA 2KTEA 4DSCA 5JNNA 2L8OA 3K90A 3NMPA 2FLHA 2WQLA 5I9JA 3NEGA 2E3OA 1QMRA 4BKDA 4KPYA 5JO2A 4JHYA 3E85A 4DSBA 2KEWA 5JO1A 1LN3A 3GL0A 4JDLA 3WG8A 4QDFB 4QCKA 3P9VA 3UIDA 1Z94A 3QN1A 3NQNA 1EM2A 4MAPA 2K7HA 1X53A 4A80A 3NS2A 4PSBA 2VQ5A 4A81A 5EKQC 4XRWA 3P0LA 2LGHA 2Z9ZA 3RT2A 1XFSA 2PSOA 3KDJA 2E3RA 1KCMA 1FSKA 4NCBA 2RERA 1LN2A 2KF2A 2PCSA 2RESA 2Z9YA 2E3NA 3IE5A 4M9BA 4N0GC 4A8GA 4C9CA 4IGWA 1XDFA 4C94A 5E4DA 3CNWA 1LN1A 2NN5A 2FFSA 4MA6A 4QIPA 3PUTA 4MNSA 3KAYA 2I9YA 2L9PA 4BKCA 3GGNA 2MOUA 4GY9A 1TW0A 4R7KA 2EJXA 5AMWA 2L65A 4E6FA 2A1LA 3HVRA 1BV1A 4REIA 4BTZA 4XRTA 3KL1A 1XUVA 2LPXA 3DLBA 3HXMA 3H3QA 3GL2A 3UJLA 4B9RA 2BK0A 3PU2A 1XN5A 3HJFA 3KLXA 3P51A 4IGXA 2E3QA 3H3SA 3GTEA 1BTVA 3ZVUA 1H2OA 1T17A 3NJ0A 5E4MA 4A87A 3H3RA 3RT0C 2LUZA 5I8FA 2IL5A 3W9RA 3UQHA 2LF2A 2M89A 4IH0A 3TFZA 4IGYA 4N3EA 1TXCA 1T27A 2LAKA 3KDIA 3TVRA 4A84A 5E4BA 3TGOC 3Q6AA 3C0VA 3NMTA 2GKDA 4BK6A 1XN6A 4M9WA 2N4AA 4REHA 3F73A 2YH6A 4JHHA 3HM9A 5E46A 4A8UA 4N41A 3NJ1A 4QDCA 2Q3QA 3NMNA 3TL1A 3K3KA 3JRQB 2K5GA 2LE1A 3KDHA 3NR4A 3QSZA 2KCZA 3GOBA 3F08A 2M47A 1LLTA 3NI8A 4NCAA 3Q63A 2ZYLA 3KB3A 3GKEA 2LIOA 4REJA 5BRLA 5C9YA 2QPVA 1E09A 1B6FA 1ICXA 4Q0KA 3R6PA 3DLHA 3RD6A 2N4BA 3OH8A 2LAFA 3OJIA 4QDFA 3IJTA 3HO1A 2LCGA 4LGBA 3JRSA 3W9KA 4A86A 3NMHA 4A85A 4IH2A 4FPWA 3FO5A 3GTSA 4OICA 2REZA 1JSSA 3ELIA 3TVQA 4A88A 4RYVA 4WVOA 4IHRA 3KB0A 4DS8A 4C9IA 1FM4A 4Z3LA 3NEFA 4JDAA 3NMVA 1ZXFA 3GB4A 4Y31A 2E3MA 2QIMA 4A8VA 1IFVA 3OQUA 1VJHA 3KAZA 3OTLA 4LGAA 4IGVA 3NJOA 4N47A 4N76A 2LDKA 4LA7A 4A83A 2E3SA 3H3TA 2R55A 2VNEA 2E3PA 3HK2A 2D4RA 1UW5A
chains in the Genus database with same CATH topology
2NS9A 2LEQA 3Q64A 4JHIA 4QDDA 4BK7A 4LG5A 4JHGA 2KTEA 4DSCA 5JNNA 2L8OA 3K90A 3NMPA 2FLHA 2WQLA 5I9JA 3NEGA 2E3OA 1QMRA 4BKDA 4KPYA 5JO2A 4JHYA 3E85A 4DSBA 2KEWA 5JO1A 1LN3A 3GL0A 4JDLA 3WG8A 4QDFB 4QCKA 3P9VA 3UIDA 1Z94A 3QN1A 3NQNA 1EM2A 4MAPA 2K7HA 1X53A 4A80A 3NS2A 4PSBA 2VQ5A 4A81A 5EKQC 4XRWA 3P0LA 2LGHA 2Z9ZA 3RT2A 1XFSA 2PSOA 3KDJA 2E3RA 1KCMA 1FSKA 4NCBA 2RERA 1LN2A 2KF2A 2PCSA 2RESA 2Z9YA 2E3NA 3IE5A 4M9BA 4N0GC 4A8GA 4C9CA 4IGWA 1XDFA 4C94A 5E4DA 3CNWA 1LN1A 2NN5A 2FFSA 4MA6A 4QIPA 3PUTA 4MNSA 3KAYA 2I9YA 2L9PA 4BKCA 3GGNA 2MOUA 4GY9A 1TW0A 4R7KA 2EJXA 5AMWA 2L65A 4E6FA 2A1LA 3HVRA 1BV1A 4REIA 4BTZA 4XRTA 3KL1A 1XUVA 2LPXA 3DLBA 3HXMA 3H3QA 3GL2A 3UJLA 4B9RA 2BK0A 3PU2A 1XN5A 3HJFA 3KLXA 3P51A 4IGXA 2E3QA 3H3SA 3GTEA 1BTVA 3ZVUA 1H2OA 1T17A 3NJ0A 5E4MA 4A87A 3H3RA 3RT0C 2LUZA 5I8FA 2IL5A 3W9RA 3UQHA 2LF2A 2M89A 4IH0A 3TFZA 4IGYA 4N3EA 1TXCA 1T27A 2LAKA 3KDIA 3TVRA 4A84A 5E4BA 3TGOC 3Q6AA 3C0VA 3NMTA 2GKDA 4BK6A 1XN6A 4M9WA 2N4AA 4REHA 3F73A 2YH6A 4JHHA 3HM9A 5E46A 4A8UA 4N41A 3NJ1A 4QDCA 2Q3QA 3NMNA 3TL1A 3K3KA 3JRQB 2K5GA 2LE1A 3KDHA 3NR4A 3QSZA 2KCZA 3GOBA 3F08A 2M47A 1LLTA 3NI8A 4NCAA 3Q63A 2ZYLA 3KB3A 3GKEA 2LIOA 4REJA 5BRLA 5C9YA 2QPVA 1E09A 1B6FA 1ICXA 4Q0KA 3R6PA 3DLHA 3RD6A 2N4BA 3OH8A 2LAFA 3OJIA 4QDFA 3IJTA 3HO1A 2LCGA 4LGBA 3JRSA 3W9KA 4A86A 3NMHA 4A85A 4IH2A 4FPWA 3FO5A 3GTSA 4OICA 2REZA 1JSSA 3ELIA 3TVQA 4A88A 4RYVA 4WVOA 4IHRA 3KB0A 4DS8A 4C9IA 1FM4A 4Z3LA 3NEFA 4JDAA 3NMVA 1ZXFA 3GB4A 4Y31A 2E3MA 2QIMA 4A8VA 1IFVA 3OQUA 1VJHA 3KAZA 3OTLA 4LGAA 4IGVA 3NJOA 4N47A 4N76A 2LDKA 4LA7A 4A83A 2E3SA 3H3TA 2R55A 2VNEA 2E3PA 3HK2A 2D4RA 1UW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS9 A;  2LEQ A;  3Q64 A;  4JHI A;  4BK7 A;  4LG5 A;  4JHG A;  2KTE A;  4DSC A;  5JNN A;  2L8O A;  3K90 A;  3NMP A;  2FLH A;  2WQL A;  5I9J A;  3NEG A;  2E3O A;  1QMR A;  4BKD A;  5JO2 A;  3E85 A;  4DSB A;  2KEW A;  5JO1 A;  1LN3 A;  4JDL A;  3WG8 A;  3P9V A;  3UID A;  1Z94 A;  3QN1 A;  4MAP A;  1EM2 A;  2K7H A;  1X53 A;  4A80 A;  3NS2 A;  4PSB A;  2VQ5 A;  4A81 A;  4XRW A;  3P0L A;  2LGH A;  2Z9Z A;  3RT2 A;  1XFS A;  2PSO A;  3KDJ A;  2E3R A;  1KCM A;  1FSK A;  2RER A;  1LN2 A;  2KF2 A;  2PCS A;  2RES A;  2Z9Y A;  2E3N A;  3IE5 A;  4M9B A;  4N0G C;  4A8G A;  4C9C A;  4IGW A;  1XDF A;  4C94 A;  5E4D A;  3CNW A;  1LN1 A;  2NN5 A;  2FFS A;  4MA6 A;  4QIP A;  3PUT A;  4MNS A;  3KAY A;  2I9Y A;  2L9P A;  4BKC A;  3GGN A;  2MOU A;  4GY9 A;  1TW0 A;  4R7K A;  2EJX A;  5AMW A;  2L65 A;  2A1L A;  1BV1 A;  4REI A;  4BTZ A;  4XRT A;  3KL1 A;  1XUV A;  2LPX A;  3H3Q A;  3UJL A;  4B9R A;  2BK0 A;  3PU2 A;  1XN5 A;  3KLX A;  3P51 A;  4IGX A;  2E3Q A;  3H3S A;  1BTV A;  3ZVU A;  1H2O A;  1T17 A;  3NJ0 A;  5E4M A;  4A87 A;  3H3R A;  3RT0 C;  2LUZ A;  5I8F A;  2IL5 A;  3W9R A;  3UQH A;  2LF2 A;  2M89 A;  4IH0 A;  3TFZ A;  4IGY A;  4N3E A;  1TXC A;  1T27 A;  2LAK A;  3KDI A;  3TVR A;  4A84 A;  5E4B A;  3Q6A A;  3C0V A;  3NMT A;  2GKD A;  4BK6 A;  1XN6 A;  4M9W A;  2N4A A;  4REH A;  4JHH A;  5E46 A;  4A8U A;  3NJ1 A;  2Q3Q A;  3NMN A;  3TL1 A;  3K3K A;  3JRQ B;  2K5G A;  2LE1 A;  3KDH A;  3NR4 A;  3QSZ A;  2KCZ A;  3NI8 A;  3F08 A;  2M47 A;  1LLT A;  3Q63 A;  3KB3 A;  2LIO A;  4REJ A;  5BRL A;  5C9Y A;  2QPV A;  1E09 A;  1B6F A;  1ICX A;  4Q0K A;  3R6P A;  3RD6 A;  2N4B A;  3OH8 A;  3OJI A;  3IJT A;  2LCG A;  4LGB A;  3JRS A;  3W9K A;  4A86 A;  3NMH A;  4A85 A;  4IH2 A;  4FPW A;  3FO5 A;  4OIC A;  2REZ A;  1JSS A;  3ELI A;  3TVQ A;  4A88 A;  4RYV A;  4WVO A;  4IHR A;  3KB0 A;  4DS8 A;  4C9I A;  1FM4 A;  4Z3L A;  3NEF A;  4JDA A;  3NMV A;  1ZXF A;  4Y31 A;  2E3M A;  2QIM A;  4A8V A;  1IFV A;  3OQU A;  1VJH A;  3KAZ A;  3OTL A;  4LGA A;  4IGV A;  3NJO A;  2LDK A;  4LA7 A;  4A83 A;  2E3S A;  3H3T A;  2R55 A;  2VNE A;  2E3P A;  2D4R A;  1UW5 A; 
#chains in the Genus database with same CATH topology
 2NS9 A;  2LEQ A;  3Q64 A;  4JHI A;  4QDD A;  4BK7 A;  4LG5 A;  4JHG A;  2KTE A;  4DSC A;  5JNN A;  2L8O A;  3K90 A;  3NMP A;  2FLH A;  2WQL A;  5I9J A;  3NEG A;  2E3O A;  1QMR A;  4BKD A;  4KPY A;  5JO2 A;  4JHY A;  3E85 A;  4DSB A;  2KEW A;  5JO1 A;  1LN3 A;  3GL0 A;  4JDL A;  3WG8 A;  4QDF B;  4QCK A;  3P9V A;  3UID A;  1Z94 A;  3QN1 A;  3NQN A;  1EM2 A;  4MAP A;  2K7H A;  1X53 A;  4A80 A;  3NS2 A;  4PSB A;  2VQ5 A;  4A81 A;  5EKQ C;  4XRW A;  3P0L A;  2LGH A;  2Z9Z A;  3RT2 A;  1XFS A;  2PSO A;  3KDJ A;  2E3R A;  1KCM A;  1FSK A;  4NCB A;  2RER A;  1LN2 A;  2KF2 A;  2PCS A;  2RES A;  2Z9Y A;  2E3N A;  3IE5 A;  4M9B A;  4N0G C;  4A8G A;  4C9C A;  4IGW A;  1XDF A;  4C94 A;  5E4D A;  3CNW A;  1LN1 A;  2NN5 A;  2FFS A;  4MA6 A;  4QIP A;  3PUT A;  4MNS A;  3KAY A;  2I9Y A;  2L9P A;  4BKC A;  3GGN A;  2MOU A;  4GY9 A;  1TW0 A;  4R7K A;  2EJX A;  5AMW A;  2L65 A;  4E6F A;  2A1L A;  3HVR A;  1BV1 A;  4REI A;  4BTZ A;  4XRT A;  3KL1 A;  1XUV A;  2LPX A;  3DLB A;  3HXM A;  3H3Q A;  3GL2 A;  3UJL A;  4B9R A;  2BK0 A;  3PU2 A;  1XN5 A;  3HJF A;  3KLX A;  3P51 A;  4IGX A;  2E3Q A;  3H3S A;  3GTE A;  1BTV A;  3ZVU A;  1H2O A;  1T17 A;  3NJ0 A;  5E4M A;  4A87 A;  3H3R A;  3RT0 C;  2LUZ A;  5I8F A;  2IL5 A;  3W9R A;  3UQH A;  2LF2 A;  2M89 A;  4IH0 A;  3TFZ A;  4IGY A;  4N3E A;  1TXC A;  1T27 A;  2LAK A;  3KDI A;  3TVR A;  4A84 A;  5E4B A;  3TGO C;  3Q6A A;  3C0V A;  3NMT A;  2GKD A;  4BK6 A;  1XN6 A;  4M9W A;  2N4A A;  4REH A;  3F73 A;  2YH6 A;  4JHH A;  3HM9 A;  5E46 A;  4A8U A;  4N41 A;  3NJ1 A;  4QDC A;  2Q3Q A;  3NMN A;  3TL1 A;  3K3K A;  3JRQ B;  2K5G A;  2LE1 A;  3KDH A;  3NR4 A;  3QSZ A;  2KCZ A;  3GOB A;  3F08 A;  2M47 A;  1LLT A;  3NI8 A;  4NCA A;  3Q63 A;  2ZYL A;  3KB3 A;  3GKE A;  2LIO A;  4REJ A;  5BRL A;  5C9Y A;  2QPV A;  1E09 A;  1B6F A;  1ICX A;  4Q0K A;  3R6P A;  3DLH A;  3RD6 A;  2N4B A;  3OH8 A;  2LAF A;  3OJI A;  4QDF A;  3IJT A;  3HO1 A;  2LCG A;  4LGB A;  3JRS A;  3W9K A;  4A86 A;  3NMH A;  4A85 A;  4IH2 A;  4FPW A;  3FO5 A;  3GTS A;  4OIC A;  2REZ A;  1JSS A;  3ELI A;  3TVQ A;  4A88 A;  4RYV A;  4WVO A;  4IHR A;  3KB0 A;  4DS8 A;  4C9I A;  1FM4 A;  4Z3L A;  3NEF A;  4JDA A;  3NMV A;  1ZXF A;  3GB4 A;  4Y31 A;  2E3M A;  2QIM A;  4A8V A;  1IFV A;  3OQU A;  1VJH A;  3KAZ A;  3OTL A;  4LGA A;  4IGV A;  3NJO A;  4N47 A;  4N76 A;  2LDK A;  4LA7 A;  4A83 A;  2E3S A;  3H3T A;  2R55 A;  2VNE A;  2E3P A;  3HK2 A;  2D4R A;  1UW5 A; 
#chains in the Genus database with same CATH homology
 2NS9 A;  2LEQ A;  3Q64 A;  4JHI A;  4QDD A;  4BK7 A;  4LG5 A;  4JHG A;  2KTE A;  4DSC A;  5JNN A;  2L8O A;  3K90 A;  3NMP A;  2FLH A;  2WQL A;  5I9J A;  3NEG A;  2E3O A;  1QMR A;  4BKD A;  4KPY A;  5JO2 A;  4JHY A;  3E85 A;  4DSB A;  2KEW A;  5JO1 A;  1LN3 A;  3GL0 A;  4JDL A;  3WG8 A;  4QDF B;  4QCK A;  3P9V A;  3UID A;  1Z94 A;  3QN1 A;  3NQN A;  1EM2 A;  4MAP A;  2K7H A;  1X53 A;  4A80 A;  3NS2 A;  4PSB A;  2VQ5 A;  4A81 A;  5EKQ C;  4XRW A;  3P0L A;  2LGH A;  2Z9Z A;  3RT2 A;  1XFS A;  2PSO A;  3KDJ A;  2E3R A;  1KCM A;  1FSK A;  4NCB A;  2RER A;  1LN2 A;  2KF2 A;  2PCS A;  2RES A;  2Z9Y A;  2E3N A;  3IE5 A;  4M9B A;  4N0G C;  4A8G A;  4C9C A;  4IGW A;  1XDF A;  4C94 A;  5E4D A;  3CNW A;  1LN1 A;  2NN5 A;  2FFS A;  4MA6 A;  4QIP A;  3PUT A;  4MNS A;  3KAY A;  2I9Y A;  2L9P A;  4BKC A;  3GGN A;  2MOU A;  4GY9 A;  1TW0 A;  4R7K A;  2EJX A;  5AMW A;  2L65 A;  4E6F A;  2A1L A;  3HVR A;  1BV1 A;  4REI A;  4BTZ A;  4XRT A;  3KL1 A;  1XUV A;  2LPX A;  3DLB A;  3HXM A;  3H3Q A;  3GL2 A;  3UJL A;  4B9R A;  2BK0 A;  3PU2 A;  1XN5 A;  3HJF A;  3KLX A;  3P51 A;  4IGX A;  2E3Q A;  3H3S A;  3GTE A;  1BTV A;  3ZVU A;  1H2O A;  1T17 A;  3NJ0 A;  5E4M A;  4A87 A;  3H3R A;  3RT0 C;  2LUZ A;  5I8F A;  2IL5 A;  3W9R A;  3UQH A;  2LF2 A;  2M89 A;  4IH0 A;  3TFZ A;  4IGY A;  4N3E A;  1TXC A;  1T27 A;  2LAK A;  3KDI A;  3TVR A;  4A84 A;  5E4B A;  3TGO C;  3Q6A A;  3C0V A;  3NMT A;  2GKD A;  4BK6 A;  1XN6 A;  4M9W A;  2N4A A;  4REH A;  3F73 A;  2YH6 A;  4JHH A;  3HM9 A;  5E46 A;  4A8U A;  4N41 A;  3NJ1 A;  4QDC A;  2Q3Q A;  3NMN A;  3TL1 A;  3K3K A;  3JRQ B;  2K5G A;  2LE1 A;  3KDH A;  3NR4 A;  3QSZ A;  2KCZ A;  3GOB A;  3F08 A;  2M47 A;  1LLT A;  3NI8 A;  4NCA A;  3Q63 A;  2ZYL A;  3KB3 A;  3GKE A;  2LIO A;  4REJ A;  5BRL A;  5C9Y A;  2QPV A;  1E09 A;  1B6F A;  1ICX A;  4Q0K A;  3R6P A;  3DLH A;  3RD6 A;  2N4B A;  3OH8 A;  2LAF A;  3OJI A;  4QDF A;  3IJT A;  3HO1 A;  2LCG A;  4LGB A;  3JRS A;  3W9K A;  4A86 A;  3NMH A;  4A85 A;  4IH2 A;  4FPW A;  3FO5 A;  3GTS A;  4OIC A;  2REZ A;  1JSS A;  3ELI A;  3TVQ A;  4A88 A;  4RYV A;  4WVO A;  4IHR A;  3KB0 A;  4DS8 A;  4C9I A;  1FM4 A;  4Z3L A;  3NEF A;  4JDA A;  3NMV A;  1ZXF A;  3GB4 A;  4Y31 A;  2E3M A;  2QIM A;  4A8V A;  1IFV A;  3OQU A;  1VJH A;  3KAZ A;  3OTL A;  4LGA A;  4IGV A;  3NJO A;  4N47 A;  4N76 A;  2LDK A;  4LA7 A;  4A83 A;  2E3S A;  3H3T A;  2R55 A;  2VNE A;  2E3P A;  3HK2 A;  2D4R A;  1UW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...