3NJ8A

Crystal structure of t. gondii enoyl acyl carrier protein reductase with bound triclosan like inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
301
Chain Sequence
FPIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGEKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and development of novel inhibitors of Toxoplasma gondii enoyl reductase.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
total genus 94
structure length 301
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nj8A00
4DC1A 5ES3A 4QUKA 4JBIA 1YL5A 3LQFA 3NUGA 4WCFA 5COAA 2NACA 5AQ1A 2YJZA 2Z1NA 1Z74A 3E9QA 4CJXA 3QRWA 4RPJA 2G17A 2EG9A 2PA3A 1RJWA 1Y5RA 4R68A 5KNLA 2E6UX 1ZCJA 2GF2A 3ZH2A 3UN1A 4IS2A 2EJVA 1CETA 4IIUA 3JQ6A 3VPFA 1UZLA 2WYVA 4R54A 4CLHA 4D3SA 2NVWA 3I9KA 1VE9A 2GR9A 3JQDA 3Q2IA 1LX6A 2B36A 1UR5A 3B6ZA 3QIVA 4Y9DA 1P74A 4IIVA 4OO3A 4E4YA 3K2EA 2IEBA 3M6IA 1GTMA 5EPOA 1GUYA 3RJ9A 5T6BA 2PV7A 5A03A 5JS6A 4R5MA 4A27A 4RVDA 1LSSA 1ML3A 1VPDA 2EW2A 3WTBA 1PU2A 5C7IO 4CV2A 1ISGA 1LA2A 1U2GA 2CDAA 4I5FA 2CUKA 1GCUA 4DBVO 2WM3A 3P19A 3COSA 2EHDA 2Q4EA 3QVOA 3RBVA 2Y99A 3GNQA 2C07A 4Y98A 3VAZA 1WW8A 2NSDA 4DGSA 1YDEA 4G65A 4GVXA 3VTFA 4MO2A 3M2TA 4XDYA 1AE1A 4HNHA 4M55A 1MX3A 2HJSA 4MJLA 2IYOA 3ZNNA 3C1TA 1LLCA 1T24A 5B4TA 4Y6SA 1U7HA 5G0TA 1XR3A 3AUAA 4BO8A 4Y67A 2A9FA 3AU9A 3DQPA 1EBFA 4B8WA 4EW6A 3D1LA 4XKJA 3WLEA 1C0LA 4HFNA 3QHAA 4XD2A 5KWEA 4J2OA 2X9GA 1LC0A 2O3QA 3F5SA 4LSWA 4NMHA 3W1VA 1IY8A 4J1SA 4CUJA 1QLJA 1ZK2A 4EEZA 3PYMA 2B0JA 3TQHA 2Z5LA 4XR4A 4AJOA 3ASVA 3ZWYA 4EUFA 2DVMA 3CMCO 4PLHA 2WMDA 1D8AA 1BDMA 2CMDA 5DOZA 4MVJA 4QEDA 2IXBA 4CM8B 4PLWA 3JQ8B 2PGDA 3PVZA 4GI2A 4QT0A 8LDHA 4CR8A 3E1KA 4DXHA 3BYZA 4GGPA 4RVGA 1Z73A 4IBOA 4I08A 1XKQA 1EUDA 3IIEA 1PL6A 3WGGA 5A9SB 4GMGA 4E3ZA 2HAEA 3ZZNA 1ISFA 2R6JA 4CQMA 4GH5A 5BT9A 3PWKA 3C7AA 4NNJA 1PR9A 3WYCA 1D4FA 4KUGA 4PGFA 3A28A 1BXGB 3JD3A 1H6AA 4PZEA 3PZBA 3BXXA 4CM7A 5C3MA 2X9NA 1ENPA 1XQ6A 3AY6A 1KOLA 2DUWA 3TOXA 5CAEA 1DC5A 5JYDA 3F46A 4NFHA 3MZ0A 4BNFA 1MG0A 3K5PA 4BUCA 4IQ8A 1YE3A 1PX0A 5I9NA 3GHYA 3AI3A 3CMMA 5GMOA 1WAMA 4RLHA 4ZGWA 4HXYA 1N7GA 5DNAA 2GUGA 1LDEA 5KTKA 3OJLA 3I4FA 3UXYA 1EZ4A 4GMFA 3DBRA 5IXSA 4AJPA 3TFOA 3C1AA 4LCJA 3UOGA 4DL9A 3DHNA 5C7OO 4Q3NA 1CJCA 2WYUA 4RZIA 1HF3A 1UP6A 3ZV5A 4BNKA 1UJMA 4HWKA 1HE4A 1R4MB 2DFDA 5KJCA 4RORA 3UAGA 2VZ8A 4Z9YA 2O3UA 4DIFA 3OA2A 4OOEA 2O4UX 1X0VA 4N7RA 4YQYA 3FWZA 5L4NA 1BSVA 2PZMA 1CQIA 3F4BA 4YXFA 1M2WA 4MKZA 2UDPA 1CDOA 3RBZA 2AQIA 5JXWA 5GZ1A 5ENVA 3L9XA 3UF0A 2IE0A 1DRUA 4DC0A 2DTXA 4YB8A 3INRA 3STHA 1JKIA 1Z7EA 2AG5A 2Y0DA 3DOJA 3KEOA 3KO8A 1DC6A 2HSDA 4MPDA 3ROMA 1G0OA 2I3GA 2DBQA 4HNGA 3CEAA 1EVIA 4ZQHA 3WWZA 4N5MA 4RQUA 2QRKA 1TT5B 4GBJA 1O6ZA 4DLAA 3BAZA 2FY8A 4OXYA 2NTJA 2ZB8A 4LVCA 1T4DA 4BVAA 1MXHA 1YJ8A 3LVFO 1C3VA 1JQBA 5F5LA 3WGTA 4XYMA 1C0KA 3WJ7A 2V6FA 4HBGA 1U1IA 1PJQA 1PQUA 3DBLA 1O9BA 5TS3A 4AJJA 1NYTA 3SLGA 4AJLA 3WYBA 4I9UA 4GX0A 5CDTA 4MVJG 5L7YA 2XOXA 1B8PA 4BKPA 4NH4A 3VH1A 3S8MA 5BNIA 3LU1A 1HLPA 4GX2A 4DPLA 4S3MA 3ZCXA 4E6PA 5JCJD 5EN4A 3IC5A 5IF3A 5G4KA 2WWRA 4DPKA 3DMTA 4LRTB 3VPGA 2DU8A 4JGBA 4W82A 5JAQA 4YRBA 4IJVA 5L4SA 1T1SA 1E3IA 1G1AA 3OJ0A 3TPCA 4JQCA 4MOWA 4WLUA 4RL6A 3OEYA 2DLDA 2JAPA 1U3TA 2NQ8A 8ADHA 5G2OA 1XELA 4PLTA 4IXTA 2A4KA 4TKMA 1UZMA 2VWQA 3LYLA 2ZKLA 2V65A 2EP7A 3D3WA 4FQ8A 2Y67A 1KEWA 4B3IA 5EESA 4II3A 1LI4A 3PFWO 1O5IA 3AFMA 5IJZA 4RDHA 4LN1A 3C24A 2Y66A 5IZCC 1LLQA 1DRVA 1E5QA 1OBFO 1ONPA 1YDWA 5JDIC 2XF8A 2R00C 1Q0QA 3TDKA 2AEJA 5DOVA 3EGOA 2EWMA 3DR3A 2GDZA 2X0IA 2FR1A 1L1FA 5I9LA 3A9WA 3OIDA 3FR7A 3FTPA 3LT0A 4OM8A 1EVZA 1P33A 3RKRA 1JWBB 4BKQA 2EERA 3IL2A 1XQ1A 3AUTA 3V5NA 1HSZA 2WDZA 2VHVA 1DIBA 4RQTA 4E5NA 2X7HA 2C5EA 4WCFC 1DAPA 5BSEA 3ZHXA 2PWZA 5GY7A 1QXSA 2Y0CA 1H93A 3KLPX 2NWQA 2EIHA 5H82A 3RC7A 4P4NA 2Y1FA 3FNGA 3HDYA 2Q46A 3WMXA 4BMNA 4ZVVA 1GYRA 2WJPA 1R15A 1ZK3A 1TLTA 1HYHA 4EUEA 1V3UA 2C7VA 4XRRA 5FWNA 1PSDA 4IDFA 5LC1A 1F17A 3M1AA 1QYXA 4JIGA 1NFRA 1PJCA 5A9TA 4MDHA 3NTOA 1W8DA 4BGEA 2Q45A 1X1TA 3S1LA 1UDBA 3KOUA 1I3MA 3QWFA 3PQEA 4HFJA 1NR7A 1E6WA 2YZ7A 3H5AA 2H6EA 4NQZA 3GC6A 3ENKA 3UKOA 1OZAA 1P1IA 3GZNA 5COQA 4AJKA 1B14A 5JCXA 3G17A 3RUEA 3R3SA 5KJEA 2NNLD 4J7CA 3FN4A 3JQFA 3BMOA 4M1QA 4MKXA 2I66A 3FWNA 5L3ZA 3OJEA 1BMDA 3KYCB 3BTVA 4MVJE 1ZEJA 1HT0A 2YUTA 4BO9A 4F6LA 2W4QA 1VL0A 2DC1A 3ULKA 1LC3A 1XIVA 1PGQA 3PI7A 1PZHA 4K6CA 3GLQA 3KSUA 3HDQA 4HADA 4OSPA 1T26A 1C1DB 2OZPA 3PDJA 4FDAA 4L76A 2ZTLA 4RGBA 3GVIA 2Q1SA 5TGDA 4EUHA 2NU8A 4ALMA 3G79A 3QJ5A 4CMCA 3EDMA 1JN0A 4YJHA 3TJRA 1LLDA 3NDIA 5C37A 1F06A 2UYYA 3GN1A 1ONOA 3I1JA 3QY9A 5JO9A 3WNQA 2YHIB 3HHPA 4RO0A 1P0CA 2ZQZA 1SB9A 4TZKA 2OL4A 3WICA 3JQ7B 5A4DA 2J8ZA 4NR0A 7MDHA 2WE7A 1YL7A 3AOEA 1P1FA 3EZYA 1HEUA 3VPSA 4CQLB 1K5HA 3LZ6A 4PLYA 3ZHYA 3ZWVA 5LDHA 2JD2A 1NQAO 3DC2A 4JP3A 3WDSA 1ZO8A 2IZ0A 1UXHA 2D8AA 1AN9A 4U0JA 5HBRA 4RF4A 4P4GA 4BKUA 1ZK1A 1PQPA 3AW9A 3JV7A 4WOJA 1I2BA 2VYVD 3GG9A 3U5TA 2FHSA 3U9LA 3JQBA 2IYPA 4QTZA 3HZZA 4JK3A 2HK7A 5DBIA 4MP6A 4DYDA 2A35A 2C5AA 3HFSA 1YO6A 3LT4A 1PR3A 4I5GA 1WDMA 1N9GA 4HV4A 3VKUA 5TJ9A 3FI9A 4CMIA 5TLSA 1ZSNA 2B5VA 4FGSA 1T2DA 1CYDA 1GPJA 3I52A 2FWMX 2C0CA 3JCZA 1KERA 3LDHA 3O38A 4WK6A 3E9NA 4KOAA 1ENZA 3HN2A 2OUIA 3ZU3A 3I23A 1KIFA 3ASUA 1B16A 1E7MA 2Y93A 1ENOA 4CLRB 3PGXA 4L4RA 3ZWBA 4BL5A 1HDXA 4BGVA 2FSSA 1WZIA 4LVUA 4ZICA 1VSVA 1R37A 2GD1O 4BNNA 2J3IA 5BSFA 4TMFA 4MIYA 2C29D 1E3EA 4ND1A 3DBRB 3INGA 2GZ1A 1DB3A 1WLYA 4OIMA 3ADPA 3ZWPA 1JA9A 1HKUA 2X4GA 2C54A 4J1NA 4ZRMA 3WOHA 4CPDA 1MG5A 2G82A 3ZI0A 4O5OA 3L77A 3V1TC 3QSGA 1NVGA 1ISJA 1VL6A 1GEEA 1R0LA 1RYEA 1UDCA 4LMPA 1DFIA 2HU2A 4WLOA 1M67A 2HKIA 1R66A 2EJWA 2WD8A 4J9UE 1C14A 2HMTA 1H94A 3K30A 3L9WA 3ZWNA 2O3JA 3PWZA 3D4OA 1U5AA 3NDRA 3Q6IA 4WECA 1NBOA 2H9IA 3PYLA 1U8XX 3GVPA 4RVFA 3GUCA 3DEYX 1TB4A 1FDWA 4M89A 1AHIA 1CWUA 4KMSA 1E1KA 3GF4A 4YT4A 2O2SA 1LQTA 2JFGA 1N7HA 3QQPA 2NU9A 3UFXA 1E6UA 3DDNA 2J5KA 3DZJA 1NFFA 4U7WA 1QP8A 3KSZO 3WNVA 4D44A 1V6AA 3PHGA 3GK3A 4B7UA 1ZMOA 4E0BA 1IHYA 1Y81A 3I6IA 4AJEA 4J4TA 3NEPX 2V6GA 1P3DA 5B1YA 1FMCA 2OBNA 4UVGA 3BMQB 4R16A 3M1LA 3JTMA 5KIAA 5B4VA 5I8WA 1PZFA 4K28A 3G1TA 5U4QA 1ZZEA 3U3XA 3PHIA 4TVBA 3P2OA 3RAJA 4XYLA 4XB1A 3A06A 3EZLA 4OHUA 1MB4A 2O3RA 4FC7A 1BVUA 3OH8A 2PH5A 3DWFA 3ZWWA 1UAGA 4J0FA 3DZGA 4F46A 4IJWA 4D46A 1KY5A 2QQ5A 1LRLA 4E2ZA 4L8VA 4Z9XA 1BXGA 1FK8A 4IXWA 3JYNA 1EE2A 3F47A 4WASA 3K9QO 2GZ2A 3LLSA 2AMFA 3V1YA 4AJ4A 1YBMA 1DEHA 2POQX 1EE9A 1NTOA 3I9LA 1NPDA 5A05A 3ZNPA 3ONDA 2W2KB 5EINA 3RASA 5JBIA 1IL0A 2BD0A 3JQFC 4QECA 2YHIA 4RVUA 2ZCVA 3W4IA 4CMIB 2FP4A 5I7FA 3PJGA 3TWOA 3TZQA 2X0RA 1HZJA 3GDGA 1NAIA 3PFFA 4LCEA 3L6EA 5HS4A 1Y5MA 4OJNA 1W73A 3WGYA 2V6MA 3UH1A 2Y05A 4H7PA 4NJMB 1ZKMA 1QMGA 4KZPA 2BFOA 4ALKA 1DC3A 4CR6A 4J91A 4PZDA 4XEHA 2EEZA 3RSHA 3PJFA 4KQXA 1PS8A 4GKVA 2AEMA 1YOVB 1JVSA 1KVTA 3JD4A 4RV9A 2HK8A 4PVDA 4O63O 4ALIA 2VUSA 1LJ8A 2NTNA 1P1KA 4JXKA 3SC6A 2YFHA 2BFMA 4BV8A 5JDIA 4A03A 1E3LA 1XGKA 2JHFA 3VTZA 4DIBA 3PWSA 3RUDA 4RPGA 3LC7O 5F1PA 3NTRA 4ILKA 3WFIA 1WMAA 1SAYA 1LDGA 3JQBC 4D41A 1ZW1A 4FJ0A 5T57A 4J7XA 3WGQA 3RKUA 2BGMA 4XRGA 3QVXA 4Z0PA 3MJEA 3AY7A 3V1UA 2C2XA 3SXPA 1A27A 2PR2A 3ZWXA 2CD9A 4BQPA 1LDNA 3MEQA 3OEWA 4BS9A 2F00A 3DZKA 2P5UA 4BNHA 1WZEA 2IZZA 3KYDA 2P5YA 3A1NA 1DIRA 3UCEA 4AFNA 5CEFA 3IUSA 1K6IA 3BMCA 1ARZA 3ONFA 4YQZA 5I8ZA 4D0RA 1LSUA 4BKOA 3TL3A 5IDYA 1V9LA 3F4LA 1ZJZA 1NHWA 3NT4A 3QVWA 1M76A 1KETA 3WX0A 3OECA 2Q3EA 1VRWA 2YDXA 2BF7A 3E18A 1FF9A 5LDGA 5CEEA 2B4TO 2VOJA 4IQGA 3HB4X 3V2HA 4HX5A 3S2FA 1GQYA 2O3SA 3PK0A 1Q1NA 3EY4A 1Q7BA 3I9MA 2PNFA 3VZSA 1HDRA 1ZSYA 5FI5A 3RI3A 2VWGA 1GPDG 4QFDA 1JKFA 1MGOA 1B2LA 1A72A 3DB2A 1P44A 1HWYA 4NHEA 4XJSA 4GLLA 1QYVA 1ZNQO 2ZB3A 1Z82A 1I8TA 1RPNA 3NYWA 3PDUA 1DDOA 1I36A 4YA6A 5CDSA 2HDHA 3GRKA 3BTSA 2BGKA 2JJYA 1WPQA 2W90A 4OQYA 4B7CA 2FRDA 4D79A 3OF2A 3P7MA 1HDOA 2XPCA 5CPBA 4C4OA 3Q9NA 3PJDA 4YJHB 2X1HA 2PZJA 4I9NA 1CRWG 2VHYA 3CTMA 1J4AA 4CMHA 4M54A 3KXDA 2YDYA 1ULSA 5HTOA 3VH2A 3ZV4A 4YVFA 5CPFA 1YB5A 3C7CB 3WLFA 4D3DA 5JYEA 5TIIA 4WOKA 3OIFA 4CM9D 1IUKA 4Q3DA 4K1LA 2SCUA 4EITA 3QE3A 1QYWA 3B1FA 1WMBA 5IXYA 4CQLA 5L40A 4R4JA 2EXXA 4IZIA 4B4VA 3WS7A 3RUFA 2X8LA 5F1OA 4J1QA 4FPXA 2BRUA 3D5TA 4AJIA 4CM9A 1GU7A 3GZNB 3TN7A 4BQRA 4DQUA 1KEVA 2JL1A 2X9VA 4J4HA 3AOGA 3I9JA 4LMRA 4DUPA 4PLGA 1T25A 1ADGA 3BMOB 4IDAA 4EGFA 1IB6A 3ABIA 2I65A 3U4DA 1E1MA 2HCTA 3PTZA 1TXGA 4BO6A 1U3UA 4CM1A 1VJTA 1JDJA 3H7AA 5IN4A 2VT2A 4CMGA 2P91A 4GX1A 1LRKA 4BB5A 2AA3A 4BGIA 3WGOA 1XWFA 2P68A 2WSBA 3GPDG 1PZGA 2GSDA 4IZHA 5U1PA 2DT5A 1SZJG 4EJMA 4CM4B 3LF1A 1ULUA 2HMUA 1WP4A 4XJTA 1DJNA 3DZHA 4Q3BA 3ZNOA 1PZEA 4BKRA 2HMWA 1NASA 2ZK7A 2JD0A 4ZQBA 4NK5A 5T5QA 3OFSA 3BHMA 5COBA 3V2UA 2NV6A 4CV1A 5TC4A 2ZJ1A 3L0DA 5DCWA 1YXMA 2QX7A 4Z0HO 2RH4A 6ADHA 1T2EA 3DOCA 4Z6KA 2HMVA 1G0NA 5TRTA 3FCOA 1P1HA 3ROQA 2VHXA 4XX0A 3AWDA 4YJGA 4D45A 3JYLA 3VZRA 5A04A 2V6BA 4WLEA 3WMWA 2OMEA 4J6FA 1Q0HA 3D4NA 2I6TA 5A9RA 1DHTA 2DQ4A 1OMOA 1NHGA 3ITKA 1F14A 1H6CA 1HE5A 3KBOA 4J0EA 5G0UA 3OP4A 1YH3A 5DF1A 1SBYA 1KVUA 4O1MA 1EQ2A 3KTDA 4P8RA 1DFGA 3C7DB 4O6VA 1MC5A 3OM9A 3WQQA 2QHXA 3ON5A 2QRJA 1C1XA 1BVRA 3CKYA 4YJDA 1FDSA 4LISA 2W2LD 4FD3A 1AUPA 1MFZA 3OETA 5A02A 1YWGO 4Q39A 1PGJA 3JYQA 4XR9A 4A73A 4FB5A 5KVCA 5TSDA 1LBEA 2EKPA 4L0QA 3CIFA 4Q3EA 1RM0A 3SC4A 1ZJYA 2YYYA 3GVHA 4HP8A 4DA9A 1IE3A 3B1KA 3H2ZA 3TZ6A 1RKXA 1X7GA 3O4RA 4K9DA 4IDEA 3B70A 3RWBA 3JYOA 4B4WA 3S2IA 1PGPA 5GZ6A 3C1OA 1T4BA 5JE8A 2GERA 3BHIA 4UVDA 5DCYA 5DZSA 5L51A 4XQGA 1WWKA 3BHJA 2B4RO 1NFQA 4XYBA 4AVYA 1VSUA 3IQDB 3O03A 3ETDA 3VDRA 4XIJA 5DULA 3U62A 2VZ0A 3I3OA 3G49A 3OIGA 4ZRNA 3U09A 4HKTA 2AXQA 3UHAA 1N1GA 4IUYA 4DMMA 3SEFA 5TQVA 5TT0A 1QSGA 2D1YA 3K8ZA 4HUJA 1HDCA 1BRMA 4C7KA 4N5LA 2UAGA 1K6JA 2HO5A 3M2PA 2VWHA 2FPPA 2X58A 4RPLA 1PS9A 5JDCA 3TZKA 3GY0A 1ZK4A 1LQUA 1WXDA 2EKQA 3EYWA 1QLHA 3WFJA 3CZRA 4BNJA 1H9BA 2JCXA 5L7WA 3K73O 4KQWA 5A5EA 1OC4A 1OC2A 3X2EA 9LDTA 5HA5A 2AE1A 2GN6A 3GR6A 5CDUA 3AY3A 3WBFA 2D3TA 4DTIA 1DLIA 1X14A 4MP3A 4CM5A 2JAHA 1NPTO 1N8KA 1Q7GA 1GUFA 1QKIA 2VUUA 3DOOA 4PLPA 1ZUD1 4BB6A 4XDZA 2R00A 1NX6A 1PJBA 4YT2A 4E13A 3P5SA 1VC2A 1H2BA 2VYNA 3NTQA 4DQVA 3DONA 4GAEA 4DRYA 2BFAA 5CFZA 4JBGA 3CPSA 1A7AA 2HLPA 1I32A 2YV2A 1GCOA 3LF2A 2TMDA 4TRJA 4WEQA 4GSKA 4J16A 3ZNQA 3K2BA 2I3AA 4ZQGA 2X23A 4GWKA 4TRRA 1MFPA 4ND4A 4R9SA 1NVMB 2EF1A 2JCYA 4I5EA 1UZNA 1YOVA 3BMCB 3SJUA 1R4MA 3LC1O 4E2XA 2Y0EA 3R3JA 2NADA 5AXBA 4NG5A 1MP0A 3E5RA 4O0LA 4U5QA 4DQXA 1SB8A 4E21A 2H1SA 1ORRA 4RF5A 1BWSA 1DOHA 4L4XA 2X5KO 4L9RA 1J49A 3VDQA 1A71A 3NV9A 2J5RA 1IHXA 4JP2A 3HWRA 1E3SA 2XXBA 4MVJF 5EJ2A 4R5HA 2PH3A 2GRAA 4QSMA 3ICPA 1SOWA 2JCVA 1HE3A 1SMKA 1UP7A 1IYZA 1X13A 4KTTE 4Q3CA 2YY7A 2IXAA 3L6OO 4ZU3A 4UEOA 1I5RA 5L45A 3U49A 2ZB4A 4MKRA 4ITUA 4WPGA 3TZHA 3F1KA 3IP3A 4YAKA 3KEQA 2E48A 3QVSA 1E77A 3GUYA 3RC9A 3IJPA 3RU7A 4CR7A 4E2YA 4NJMA 1XLTA 1HTBA 4M86A 1WVGA 2DPHA 2B37A 4YBZA 3U4HA 4PVCA 2OP0A 3C3XA 2QRLA 2BI7A 4PG4A 3HUDA 3OJOA 3WGHA 1GV1A 1HYGA 3ONEA 1KC1A 4P4LA 4BNXA 3VZPA 2PZKA 1F8FA 4XGNA 4BNMA 4CLEA 1PS0A 4E5YA 3NT5A 3JQGA 2E82A 1NQTA 4UEJA 3INTA 2CFCA 2D59A 3O8QA 3ZHZA 2Y1EA 5ILOA 1CIVA 3WQSB 1YQXA 2VT3A 1DPGA 1GDHA 5T67A 1EMDA 1IZ9A 1J5PA 2Q50A 3GN2A 4Y8VA 4J7UA 3UW3A 3VKVA 1A9ZA 1GZ4A 3DO5A 1ZK0A 2Q2QA 3RUHA 4YACA 4E33A 3AFNA 1DSSG 4CQMD 1UXIA 3KLMX 3RUAA 4FOOA 5JO0A 4PFJA 4BNUA 3KV3O 2DFVA 4E2WA 3NKLA 4I5DA 4CLOB 1T2AA 4YPOA 1NQ5A 2X22A 5DN9A 3U4CA 5EQDA 2NVUA 1ISMA 3WXBA 4K6FA 5L53A 1ZVMA 2IRWA 4KDFA 1I2CA 2JFFA 5IZ4A 2D5AA 1B26A 1Q0LA 4J49A 1ZEMA 2QIOA 1YONA 3DXFA 1BW9B 2UUOA 4H16A 1AHHA 4XGKA 1T1RA 3D5QA 2VQ3A 3MJVA 4O59O 1ZBQA 1TVEA 2I99A 1R0KA 5B12A 4FOSA 2C82A 2DKNA 1K2WA 1YBAA 4S1VA 3H3JA 3H9QA 3L6DA 3R6DA 3VOSA 3VZQA 4ALJA 4E5MA 1IPFA 1H6BA 3LLVA 1LSOA 2FMUA 3OICA 1KS9A 2OXIA 4ND5A 4YEDA 3Q2KA 4NJOA 5JSFA 5G0VA 1NWHA 4INAA 3AM5A 1EK5A 2VN8A 2O48X 2RHRA 3IUPA 1KVSA 3RROA 4AJ2A 5BQFA 2C20A 2IEDA 4IINA 4TZTA 1DIAA 3JSAA 3SVTA 2VRCD 2DBVO 1KVRA 3ZU5A 4CMJA 5BR7A 5B37A 1ADFA 1SEVA 3F9IA 4NZ9A 3F1LA 3K6JA 3K31A 4HFRA 4YR9A 2YQ4A 1LSJA 5I7VA 2GPTA 2YQ5A 1ISHA 2CVOA 4UUOA 3ST7A 2JD1A 5KJ1A 3MWEB 3HG7A 4MVJH 1YQGA 2OOSA 4LRSB 3ORFA 3WBBA 3PGJA 4DMLA 2G5CA 1EVJA 1BXKA 3DAPA 3WWYA 4UUPA 3H4VA 5FEUA 4OYRA 5T8KA 5JLAA 3DFUA 4E31A 5KVVA 1GFSA 2FR8A 4NBVA 4BNZA 4A26A 1S6YA 1HE2A 3A4VA 1RYDA 1SC6A 3CE6A 3BMNA 4B3JA 2B5WA 4QO8A 1XCBA 5F5NA 3GA0A 2VZ9A 4MINA 3GPIA 3D3EA 5G4LA 2DTDA 5KKAA 1MC4A 1O95A 4XQEA 4WNCA 1I24A 3CINA 1KBZA 2VYVA 2NM0A 2Y1GA 1GL3A 1K6XA 1Y8QB 4NU5A 1GQ2A 3F5QA 2BH9A 3MJTA 3DMYA 4R1UA 3QLJA 1DO8A 1YBVA 3RQSA 3CZMA 1RWBA 1A9YA 5KOIA 3G0OA 2ZJ0A 3TFQA 2NLOA 4L74A 4OXNA 3GMSA 1OAAA 4KUEA 3R1IA 1M66A 4U6QA 2ZIZA 1EUCA 1YRLA 2D4AA 3GMDA 1EEHA 3WGZA 1VJ1A 1B3BA 1BXZA 2PKQP 3I83A 5DDIP 3VVBA 1R12A 4CM3A 2TMGA 4CODB 2CNBA 4DYVA 1DIGA 3DFZA 3PLRA 1I10A 3B20A 1X7HA 2E49A 1B15A 1Q2XA 2D5CA 2ZB7A 2NQTA 4B8ZA 5IN5A 2Q2VA 2VTEA 2HUNA 4YRDA 4ZHSA 1R0SA 4JJFA 1E3WA 3LT1A 4J9VA 2Q1WA 9LDBA 4NPCA 2Y1DA 2BHLA 3IJRA 2W8ZA 3T4XA 1SPXA 1Q7CA 1YKFA 2FPIA 5EL0A 1CERA 5KVSA 4CV3A 3JQ9C 3GAFA 4XYEA 3WG9A 3VC7A 1GD1O 4P38A 4UULA 2PGJA 1AGNA 3HQ4O 1K0UA 2W98A 3D64A 4R3NA 4L75A 5ER9A 2NTVA 4GWGA 5EERA 4DPMA 2YV1A 4M49A 5BNTA 2FSVA 1PL8A 3GOHA 3VH3A 1V3VA 4NBWA 3F3SA 3FNEA 1E7RA 4OXKA 3JQAB 2O50A 2PFGA 3I6QA 4NFSA 1PJSA 5JPIA 3GT0A 5HM8A 2G76A 3ZWAA 1A5ZA 1QRRA 5JAZA 3HADA 4R3WA 4RVSA 4BO3A 4TRMA 4PLVA 5DCUA 3RVDA 1DAOA 1QV6A 1Z45A 3N74A 1T2FA 3D3WB 3HDHA 3VVCA 5K0ZA 1HETA 3GHHA 3FTNA 1B8VA 1TEHA 2AHRA 4RVHA 5EMHA 4A10A 4R69A 3KB6A 4WNIA 2CF6A 3DHYA 2D2IA 3ADOA 1SO8A 3GEMA 3GAZA 3DAFA 1S7CA 3L4SO 1SOVA 4C7JA 2BGLA 2Z95A 3DTTA 3Q9UA 3W6UA 3WGIA 1FDUA 4ND2A 4PG6A 1SNYA 1JAYA 2YV3A 4NDNE 2Q4BA 3FF4A 4FJ1A 4I9HA 4PRKA 4H3VA 5CP8A 1PGNA 4AICA 1C1XB 4CLXA 1TA4A 5G4KB 2OORA 1IOLA 3ICCA 5A3JA 4W7HA 1MV8A 2P9EA 1VKOA 1V35A 1E92A 1EBUA 3H6KA 3WYEA 1PWZA 1F0YA 2OHXA 3AUSA 1J6UA 1GAEO 2PZLA 4ALNA 5I7EA 5F21A 1YS4A 1TI7A 1ZMTA 3ANMA 1ZSVA 1HZZA 2EGGA 3SX2A 2Q99A 4PN3A 4WGGA 2OBYA 4WKGA 4CL3A 5T8KC 2C2YA 3H3FA 3FRJA 3MWDB 4D7AA 3PZRA 4F6CA 3ROKA 4TSKA 4E5KA 2RH8A 2WYWA 1B0AA 4WLNA 1U8FO 3RUCA 1WNTA 3GVXA 2QYSA 2CVZA 2AW5A 2UVDA 2ZYAA 1XHLA 5KVQA 4L4SA 4WEOA 4CM4A 2UV8A 2OP1A 1E3WB 1JW9B 2P2SA 3JQAA 4KDEA 1W4ZA 4GLOA 1XDWA 1LNQA 2AQ8A 1XEAA 4XWYA 1I01A 3MTJA 1EQUA 3P2YA 4XCVA 1LXCA 2G0TA 3NDJA 3Q0EA 3FHLA 4IDCA 2DBZA 2PK3A 4R51A 3VPHA 3KVOA 4DBZA 3E8XA 4BO7A 4E12A 1X1EA 2DUUA 3OMLA 3PQFA 1GY8A 2X5JO 4YTEA 5JMWA 5K9ZA 3D4PA 4AJHA 1UXGA 1J0XO 3AM3A 3U0BA 4OH1A 5CG2A 2ZYDA 3IKTA 3Q1LA 5THKA 4BO5A 2IDZA 5AVOA 4YT8A 4OQZA 1SEPA 3QV1A 4BNWA 3AI1A 3V8BA 4FCCA 3CSDA 3I4CA 1YGYA 4XYGA 4NI5A 5FYDA 3L07A 1L7EA 2YFQA 2J6IA 4YAGA 2AQKA 2PGLA 1R16A 4A0SA 4B79A 1O8CA 3E82A 4EZBA 1N1EA 5HRUA 2VWPA 1QYCA 3AK4A 3MJ4A 2J3KA 1GADO 1C0PA 5G0SA 4A7PA 1PJ4A 4LSMA 1E7QA 4R1SA 4U0KA 1NVTA 4GVLA 3MOGA 3LT2A 1ZXBA 2CF5A 3EMKA 2I5PO 1K89A 2QG4A 4NBTA 3WR5A 4Z3DA 1U28A 1RM4A 5ER6A 3KRTA 3ZGYA 4UVHA 1Y8QA 1UDAA 3S2EA 3W4KA 1LDMA 2JKVA 4PLFA 4R9RA 1HL3A 1ISIA 1NNUA 4FFOA 1O94A 3ZDFA 4Z3KA 1K3TA 5C5IA 3NRCA 2J3JA 1C0IA 2PLAA 1RM5A 5AXCA 4CUKA 4EDFA 5A9SA 2GN9A 1DLJA 4URFA 4CMKA 5DBFA 1NM5A 4RCVA 1U3WA 5EQFA 1DFHA 1PEDA 2GZ3A 3KETA 4CM8A 1QV7A 1Y8RA 2NUAA 4W4TA 4RZHA 2VNAA 4GPD1 5ICMA 3G1UA 5JAIA 1H9AA 5IDXA 3ROPA 1U4SA 1WDLA 2HJRA 2PD3A 2X0JA 1ZH8A 3CUKA 3PRJA 5DP1A 4CLOA 3PQDA 1GUZA 3SLKA 2V7PA 2R2GA 3GQVA 3KYDB 1E6EA 3HNPA 1TT5A 4ZQFA 1NWCA 2VHZA 3PXXA 1XU7A 4PLZA 2GCGA 2VRCA 4K26A 3PIDA 4PZCA 3OQ6A 4IJKA 5DBGA 5JW6A 2DAPA 4Q3AA 3D7LA 4FN4A 4XQCA 4MVJM 3QA9A 4IGFA 2EV9A 4Q9NA 1JLLA 5BSGA 3W8DA 3MJCA 4H15A 1HDYA 3PLNA 1IZ0A 1KVQA 1BW9A 1UXJA 2YW9A 3DBVO 3OBBA 4YYZA 1F8GA 3RFTA 1N92A 3I5MA 2FZEA 4EEXA 3JQ8A 3K92A 2VNSA 1X7DA 1HDGO 1D7OA 4AJ1A 1MA0A 3MCVA 1EDOA 4JLWA 2EKLA 4PLCA 5F3RA 2B4QA 2B69A 4YT5A 4BIIA 5MGBA 3TSCA 1HRDA 2O4CA 2A94A 5IDQA 4ZD6A 1Y9EA 1HDZA 1HYEA 2LDXA 4ESOA 3DMTC 1RM3A 1B3RA 4KWIA 5MDHA 3IKVA 1R4NA 2GN8A 1U7TA 2BLLA 3VPXA 4XA8A 5JY1A 1NP3A 3AOEC 4P22A 1VKNA 3GZ4A 4IDBA 2PY6A 1R4NB 2Q49A 4GX5A 1BGVA 1A4IA 1GYQA 7ADHA 1LTHR 1GYPA 2PD4A 2FZWA 4TVOA 4YAJA 4JROA 1KEUA 2AQHA 3BIOA 4JBHA 5H81A 3BMNB 3SJ7A 1GR0A 4WLVA 3UICA 1AXGA 5U9CA 3LC2O 1VM6A 1O89A 3F6YA 3IMFA 1YJQA 1ADBA 4BO4A 4MP8A 5EIOA 2G1UA 1GEGA 1TT7A 1UXKA 3H9GA 4OGWA 5A06A 3HB5X 4UUNA 5GZ3A 3GGPA 4B4OA 4R1NA 5KKCA 3KZVA 3TRIA 4TRNA 5AXDA 2VYND 1PJTA 2O3TA 3TZCA 4OL9A 3A14A 4DLLA 4WCDA 1HLDA 1F12A 1XSEA 4E5PA 3DZFA 1M6HA 3BMQA 4X54A 2E37A 4TWRA 1QORA 2Z1MA 3HE3A 1N5DA 1PGOA 3JD0A 1X0XA 2GNAA 3G3EA 3SBOA 3QWHA 5AOVA 3UVEA 1E7WA 2FPGA 5L7TA 3ETGA 3OSUA 4PIVA 1JVBA 3NX4A 4FW8A 3GFGA 1G6KA 3ZHBA 1GQQA 4BNIA 2ZTMA 5CG1A 4KP7A 1I3NA 1JKJA 3EHEA 3ZWOA 1FDVA 1FXSA 3D0OA 4WJZA 2BI8A 2I9PA 3UCFA 4YRAA 2JHGA 5ITWA 3IOYA 3O9ZA 4PRLA 2I76A 5AYVA 2W2KA 4QX6A 1BHSA 3AM4A 4W6ZA 1D3AA 1V8BA 2CDCA 3T7CA 3ZV3A 5HWSA 3PHHA 1JU9A 2VOEA 1NR1A 1BTOA 2LDBA 3OQ1A 5FF9A 4B3HA 4TKLA 3O8QB 3ENNA 2NVUB 1DXYA 1E1NA 3DZBA 1MUUA 4KTVE 5BSHA 1KYQA 4MVJD 4OSOA 3W8EA 2CY0A 1XA0A 5JFOA 4WCFB 5KCZA 3E5MA 1GZ3A 4BNLA 1OI7A 4HFMA 3JQEA 4XGIA 2BKAA 1H2HA 2EP5A 5I7SA 1P77A 4RJTA 3RUIA 4EYEA 1OFGA 5F1KA 3C85A 4PG5A 2HRBA 1CEQA 3EAGA 3HSKA 3IDSA 2W2LA 3AUUA 4ZN6A 4RLSA 4LGVA 4W9NA 4W9NC 4GQAA 3I9NA 3KYBA 4QXMA 1A7KA 3H2SA 3IP1A 4A2CA 2UUPA 3TOZA 2BFPA 1UUFA 4UEKA 1JAXA 1YB4A 2NU7A 3Q11A 1SCUA 5ADHA 4ND3A 4DVJA 2ILTA 4FGWA 1ONNA 2DPGA 3DBHB 1HXHA 2PKQO 1YB1A 4WE3A 4BOYA 3PHLA 4FFPA 3ZU4A 2AE2A 4R41A 3QWAA 4J2HA 3T4EA 4GL4A 3RU9A 1IPEA 2H5LA 4JX8A 3S55A 2O23A 1I3LA 3EVTA 4BV9A 1PWXA 4DLBA 3JQAD 4J1TA 3W4JA 1DRWA 3FNHA 3RCBA 4IQ0A 3CH6A 4MIEA 5A5FA 5CEJA 3HFGA 1M6WA 2HQ1A 3OJFA 4EBFA 3OHSX 4YJFA 3GG2A 3WIEA 4CUZA 2B35A 5TT1A 3WJAA 4FR5A 4YDRA 2QZZA 4FFLA 3FD8A 3E9MA 2Q1UA 4KWHA 1P1JA 5ENDA 3OA0A 1CF2O 3JD1A 3NGXA 3DHEA 4B7XA 2X86A 3RC1A 4BNVA 1PJLA 4HY3A 3DTYA 5ILGA 1H5QA 1EFKA 1QR6A 2J3HA 3MOIA 2P4QA 4FSHA 3FBTA 3RFVA 2HRZA 1BG6A 4FFRA 4AJNA 5DP2A 3PJEA 3UGKA 3JQCA 4IMPA 2X0NA 5H83A 2FOIA 5TX7A 4YAIA 3E48A 3C8MA 3DAGA 2GLXA 2X5OA 5BNFA 4AL4A 2XXJA 5JNLA 4FS3A 1NQOA 2DTEA 3JQ7A 1LLUA 4WLFA 3W8FA 2Q2WA 3JD2A 3U4IA 2RHCA 4YAEA 3GVCA 3AU8A 1D1SA 5A3VA 3WSWA 2Y68A 1NPYA 4BNGA 4DREA 5JC1A 3QW2A 4D0SA 1A4UA 4UUMA 4Y6RA 3DL2A 5I9MA 1ID1A 4BGUA 3HN7A 1I30A 2VRBA 2P9CA 3KM0A 4IJUA 1C1DA 3H65A 1MXFA 1ZIDA 3RD5A 4R01A 3KUXA 1PQWA 3GGOA 4B4UA 1H0KA 4XIYA 5IZCA 4PCVA 3NJ8A 3PEFA 4BHTA 3S2GA 1HSOA 4OKIA 3KYCA 4CLRA 2AG8A 2ZTVA 4Z0TA 2OGUA 2FN7A 3ZW9A 3VH4A 4NIMA 3GNSA 1Y9AA 3GH3A 1VLLA 5DT9A 1JTVA 1P31A 4OOFA 5HS6A 1KY4A 2J5QA 4CMEA 1EVYA 2QW8A 3FNFA 3ZW8A 3NT2A 1KC3A 2ZQYA 3ZU2A 3QP9A 1DBVO 4YJGB 2WEKA 3DZIA 4IY1A 1N9GB 4XB2A 4RF3A 2O7SA 2HK9A 4AG3A 5KJFA 4MVJI 2XAAA 3L4BC 4MVJP 4I8XA 4FBGA 1E0DA 3BTUA 3TNLA 4QQRA 1KEPA 1QG6A 2ZATA 1PL7A 2WE8A 1XG5A 3GFBA 1E7SA 1Y1PA 3BZUA 3GDFA 5G0WA 2O7QA 3H9UA 5J23A 2AEFA 3ITDA 2Y1CA 4G81A 5TJHA 4UAGA 4DIOA 3MTGA 2WD7A 3GEDA 2IZ1A 4FIZA 1LDYA 2E4AA 3KHUA 3PHJA 4OAQA 3RIHA 4TQGA 4BO2A 5B4UA 3ZV6A 4WUVA 1Y8RB 2VCYA 4EJ0A 1VI2A 3WSVA 1DC4A 4RF2A 3GGGA 4GSLA 1ADCA 2ZTUA 3HDJA 4JJIA 4R1TA 1PJ2A 1WDKA 4YCAA 4CMBA 3GDOA 5FFFA 4JCOA 3QWIA 4LW8A 5ICSA 3OQBA 2RAFA 4W99A 5A1TA 3PP8A 5KJ6A 1M75A 4DWVA 1Z6ZA 2EW8A 3IAHA 4XZ3A 4M8SA 1LEHA 5IFLA 4NFYA 4JN6B 2CZCA 3EK2A 1E5LA 3GRPA 4BMVA 2DM6A 4ZA2A 4RPKA 4D42A 1VL8A 1Y7TA 1I2ZA 3PYXA 4BMSA 1VJ0A 1EUZA 1DIHA 1ZFNA 1I0ZA 3HJAA 3RBXA 1XYGA 3O26A 3TL2A 1CQJA 2OFPA 4G2NA 2FR0A 1PIWA 5JDCC 6LDHA 4QFCA 2WTBA 3BTOA 4J90A 2WD7B 1Z75A 2C59A 4M87A 3ZN2A 3EVNA 1GZ6A 2HMSA 2RBEA 4PG7A 4RDIA 4F3YA 2BMAA 5ITVA 3UCXA 4ROSA 3FPCA 5IAAA 4J4BA 5IDWA 3H9EO 4ONEA 4QO7A 1NAHA 2VUTA 1LRJA 3MJSA 1FJHA 2CVQA 2EGHA 4RPHA 1MLDA 1U4OA 1XU9A 4ID9A 5JC8A 4NK4A 4BNYA 1E7YA 4D3FA 1P9LA 1U3VA 4PG8A 4E32A 2GO1A 1B7GO 4JJGA 2Q1TA 2I67A 5TNXA 4NBRA 3EUWA 1E3JA 4JNKA 5L95A 1I3KA 5C7LO 2GASA 2QZ9A 5TF4A 2B83A 3IS3A 4FJ2A 4IS3A 4J3FA 3JYPA 4LK3A 2NVBA 4J43A 3WB9A 1I33A 4OMUA 3ETEA 1EK6A 2BELA 1JWAB 5JY6A 3X2FA 1UP4A 3BA1A 4II2A 5L9AA 3VHRA 1W6UA 3LK7A 4EJ6A 5FI3A 1NXQA 1E1LA 3ANNA 2QYTA 3QWBA 3LSYA 1DJQA 5JMPA 4UVIA 4Z9FA 2P9GA 3NGLA 2PD6A 4U6SA 3QVTA 1V0JA 1GV0A 4E30A 3KSDO 1D1TA 4IDDA 2VTDA 1W0CA 2GYYA 1L7DA 4CL8A 4KUHA 2PKRA 4XQ9A 3GNTA 1U9JA 3FBGA 4OKNA 4MIOA 4IPTA 1X15A 3H5RA 3NJ4A 3WQRA 4G5HA 5L4LA 5THQA 4EI2A 2GGSA 4FFNA 4N18A 1U2DA 4CV0A 5JAMA 3E03A 3N7UA 3AI2A 5AXAA 3E6AA 1T2CA 4FFMA 5T64A 3N58A 2RCYA 3V2GA 3L4BA 3K96A 1P0FA 1LU9A 3H5NA 4GKBA 4IMRA 3W6ZA 1AXEA 3DBLB 5JCJA 3FSRA 4A5OA 2D0IA 1Y6JA 2ZYGA 5CDGA 2Y1OA 3FPLA 1ENYA 4BNTA 1P45A 4IDGA 1DHRA 2CSUA 2H63A 3UUWA 5LCXA 4UREA 1QYDA 1FDTA 3ANLA 1B8UA 2C7GA 3RC2A 4NU6A 2O2YA 4N5NA 1OOEA 3NAQA 1H6DA 1R6DA 1UH5A 5K6AA 5K6AC 4ALLA 2JFHA 2PTGA 1N2SA 4CM6A 3DBHA 2GN4A 4ZJUA 3CXRA 3JQ9A 4YJFB 4W7IA 4F45A 3RFXA 2F1KA 4YWJA 1BDBA 2IODA 3RJ5A 2NU6A 3H8VA 3WIDA 1IULA 4CLDA 3I9OA 4GGOA 3AJRA 3PPIA 4D43A 5CDYA 1EDZA 1YQDA 3GEGA 2ZCUA 4TROA 4L73A 4CMAA 1YVEI 2CDBA 3PIIA 4BO0A 4NBUA 3ZWCA 3EC7A 3Q3CA 2A92A 3R0IA 2RIRA 2OO5A 2ET6A 1UAYA 4Y6PA 1LDBA 1ZXLA 4BO1A 2YHUA 2VHWA 1V3TA 1Z7BA 4U8GA 3ZWMA 1O0SA 3H9JA 4UVEA 4ZQEA 5CHEA 1LUAA 3EW7A 1U5CA 1PTJA 2DBRA 2X6TA 1YL6A 4FC6A 5IG2A 1EFLA 3T7EA 4CQMB 2P4HX 4N54A 3FR8A 3WTCA 3B1JA 3JQGB 4I1IA 1PJ3A 4CMEC 3TF5A 4IM7A 4IGEA 1P1RA
chains in the Genus database with same CATH superfamily
4PQFA 4IX1A 1XDDA 5JECA 3R76A 1T8WA 4IVQA 3CNLA 4WCFA 1G5HA 3KEMA 3M33A 5COAA 5I51A 1X7ZB 2NACA 3L43A 3T54A 4C3ZA 3GH1A 1Z74A 2HMYB 1YQQA 1UPCA 4RZ2A 4FSDA 2H4WA 2EG9A 1DJPA 2GN0A 5HQTA 3NDPA 4TLBA 3BWMA 1O6GA 1C0EA 5KNLA 2FN9A 1L5ZA 1LJLA 4IS2A 2GFIA 3IXQA 2OFOA 3ZU6A 3VPFA 1LK0A 7MHTA 3KUCA 1NU6A 1UZLA 2V4MA 2WYVA 5CLLA 3AI7A 3FVVA 2NVWA 3HN6A 3KQMA 4D3SA 3SR3A 4ZMRA 1VE9A 4S2EA 4QDZA 1AHNA 5AW4A 1U7OA 3MOSA 4BVHA 2WU0A 3B6ZA 4CE6A 2X5NA 3RSZA 1P74A 1E4VA 4OGKA 2HJHA 3WGVA 4E4YA 4OF4A 5EPOA 1U7DA 2P2DA 3GLVA 3HH8A 2CNKA 3RJ9A 1FMFA 1UQRA 4AKEA 5B3KA 4QVGA 4CEJB 4R5MA 4G0MA 1PO7A 4RVDA 5DN6D 2ZSIA 4M9SA 3ER9A 2AR0A 2OXFA 2R68A 4I5FA 4GW3A 3OBIA 4JOSA 4DBVO 2A9KA 5FBQB 3P19A 5L3QA 3RBVA 3GNQA 2C07A 5BMOA 4Y2YA 2W7TA 4BVEA 2BGGA 1UFVA 4PC6A 3DFKA 3UBTA 2NSDA 3CRRA 4KXVA 4D96A 2XDYA 1PN3A 4YHBA 1YVDA 2YW2A 4MITA 1E2UA 1IN6A 2DFPA 4JU8A 3EXEA 4GI7A 1T5LA 5AOCA 2E3JA 4IJQA 4OHWA 1HI9A 2O2EA 4J0KA 2V98A 1EAYA 4KE9A 5B4TA 5D5QA 3FPHA 3MSXA 4NLLA 4TL9A 4UZEA 5G0TA 3RVNA 5IEJA 2RJ3A 4M1SA 2BP7A 2FK8A 4ZOQI 4IFEA 1DV1A 2VRWA 5IM4F 2VP4A 4RZ3A 4QOSA 2WUWE 4IOMA 2KS6A 5C32A 4O2RA 1A8SA 2MYTA 3MTEA 1Y5NA 4QVKA 4X1IA 2ANBA 4XKJA 1W0KD 4G5FA 1OAKA 2V1XA 3WLEA 3HBFA 4ZT3A 4QWWA 2X9GA 3F5SA 2JGFA 4RY9A 4LSWA 4RBNA 5F2OA 5B1DA 1CS4C 2V7QA 3C87A 5H9WA 4J1SA 4V2IA 5KMGB 1ZK2A 4EYKA 2YS7A 1HT3A 4LZOA 4AJOA 3O4GA 4R2LA 5E9AA 4BX3A 3PPXA 1BE8A 2C9DA 4EUFA 2AN1A 4EUKA 2WMDA 3GEEA 1M9NA 2Q3FA 1D8AA 2C4KA 5DOZA 4EYSA 4Y9RA 3FPJA 4MVJA 3R7BA 2OYCA 4RY8A 2XE6A 4U2GA 4H7EA 3TW8B 5KYYB 2DPXA 4C6SA 1YA4A 3F9RA 4KO1S 3Q98A 4YRGA 2GPYA 1E3QA 4RVGA 5BPHA 2PSDA 3E84A 4JBWA 3VR4H 3HBMA 1EUDA 3NOXA 2M6LA 4AZSA 2Y9PB 3D7MA 4C1NA 2HAEA 4PYJA 2OD7A 2R6JA 1WV0A 2FGKA 2HRQA 2JKYA 3A6JA 3AR6A 3HHEA 1W5FA 1PR9A 3PWKA 2F3PA 4URWR 2E1PA 4KUGA 1WULS 1J56A 1CJMA 2GKGA 1BZYA 3JD3A 3JVEA 1I3OA 1UBKS 4N6NA 3UAVA 2CV0A 4AN4A 3BXXA 5KX5F 1QIJA 1A4RA 3E2IA 4TWZA 2B4AA 1QFXA 3V46A 1XQ6A 1BKYA 1KOLA 3TIXB 1LBSA 1L5MA 4YP7A 5IF9A 2MSEB 3H0KA 3MZ0A 4C14A 1Q1BA 1MG0A 5ALUA 3NANA 4ER6A 2JLUA 1T1IA 3H17A 5B3LA 1GG5A 3SQWA 2V45A 5C5CA 3KKNA 3VOAA 2VHEA 4GRDA 1TAUA 2YRWA 5GM1A 4EWLA 1JGTA 4YIKA 4DDTA 4HXYA 2CNWA 2CXNA 2RHJA 3F90A 1L5OA 1N7GA 4IJ5A 2VP5A 3T3GA 3VYSB 3HP4A 2GUGA 1WZUA 1O94D 3ACBA 3I4FA 3FAZA 2I4TA 3UXYA 3SIRA 4CT5A 4EHLA 1KI4A 3CLRD 4GMFA 2J0QA 1ZA1A 2N3ZA 4V0RA 4L6CA 1SK9A 3FIUA 3DHNA 1QJCA 2YZ2A 5C7OO 4LF4B 1CJCA 2WYUA 4RZIA 1PNTA 4TYNA 4MUFA 5JALA 3SWWA 1UJMA 2ZSBA 1E96A 1DUVG 5AKZA 2HSGA 1A2OA 2QQ0A 3ELDA 3L8YA 4P3KA 5K5EA 5KJCA 5TQ0A 3OA2A 3QOXA 2M1ZA 3KIPA 1XMSA 5C1PA 1CHDA 3K2IA 4I4TF 5CLJA 5LBUA 2WMOB 1XTIA 4RH1A 1CQIA 1AK9A 3EXFB 4MIKA 1M2WA 2RI6A 4OI2A 1F2DA 3LX8A 4FX2A 5E6RA 4BJ1A 3P71T 3RDPA 4HLUC 3DWGA 2AQIA 3RBZA 5JXWA 3VRHA 4HHEA 2QN7A 1T3SA 1P7YA 2G1AA 1PAUA 5JS1A 1PBTA 2R5FA 5AQEA 1D07A 3W2FA 3Q0IA 4DR7B 1SY7A 2VCHA 4Z4HA 1ILEA 1SBNE 3NPAA 3ND7A 4LPKA 3AEQA 4XVQA 4ZREA 1F8XA 1M72A 4HNGA 2I3GA 1GGKA 4BZWA 4GP6A 1Q84A 2GEUA 3QVMA 1J0BA 4NC9A 3WWZA 4N5MA 1FFEA 4RQUA 5K0GA 1D09A 5FBWB 4DLAA 2YXPX 2WNIA 5ARBA 2FY8A 4OXYA 1OV6A 2P5TB 5LA6A 4RTRA 3SMVA 3ET5A 1LF0A 3R09A 1G20A 1C3VA 1JQBA 4AY3A 4O4HB 4JUAA 4XYMA 2V6FA 3M1YA 4HBGA 1P0QA 1PJQA 5FV7A 3EPLA 1QDLB 1G2QA 1O9BA 1YCDA 1T0JB 3WL8A 1NYTA 4D9KA 3BERA 1SCKA 3WLKX 1PG0A 5KOJA 4JU9A 4F3RA 1K4KA 1SCAA 3S8MA 1KNQA 2ERYA 4PSAA 2V54A 4FCTA 3TLCA 4BP1A 4NZNA 2GBLC 2HJGA 5CH8A 3LHKA 5FL3A 3ZCXA 4ZHQB 5JCJD 2FW1A 5EN4A 5IF3A 3RU2A 1K3UB 2WWRA 5HF9A 3WKEA 1QP7A 4EX6A 5IKMA 3KJZA 3VPGA 2EW1A 5JAQA 4JGBA 3SYNA 2ATXA 4I14A 3GZTB 3NRJA 3KU4A 4HB0A 2HSWA 4JL8A 4LJLA 2P4EA 4MHOA 3VOTA 1E3IA 1G1AA 1KKMA 2AOWA 3JQRA 4I81A 4WLUA 3AFIA 3OEYA 3A31A 5AHXA 4HGZA 2NQ8A 3AYZB 3C8UA 4NX2A 5G2OA 5JYBA 1PV1A 3U7GA 4ZHQF 4W5WA 4YRTA 3RRZA 4AP5A 1GFIA 1TKCA 1CJVC 4TKMA 3FH0A 1UZMA 2ZKLA 4FQ8A 4LDQA 1C3JA 1T91A 2O9JA 3GAAA 4KQEA 4M2LA 4QPPA 1KEWA 2HWKA 3AXTA 4RAOA 3RSQA 2F8MA 5CITA 4UEWA 2OMKA 4GZ6A 4II3A 1VHDA 2W2VA 3EEIA 4EKNB 4YAFA 1K3FA 2HCRA 5EIBD 2O05A 1PD1A 1ZPDA 5BWBA 3C24A 3HKDA 3F7NA 3E0QA 4L6IA 4RK1A 3SXJA 2V7TA 3UG6A 3B3JA 5DASA 5JDIC 2KWIA 2QTAA 3ADKA 3O8NA 5J63A 2ZDGA 3TDKA 2AEJA 1MB3A 2YMLA 1YS1X 2QTCA 2EWMA 2ZYSA 5DXAA 2WWFA 2OQVA 3ETNA 3UK0A 3WOVA 1D9ZA 1WUKS 4MQFB 4MYHA 1ICIA 4UBMA 1ICEA 1ODKA 2CNNA 2QLMA 1CUDA 3A9WA 3FR7A 4YAWA 3W9BA 4M7WA 1GTRA 2IV7A 2H1WA 1JWBB 4BKQA 1HLFA 2EERA 4DV4B 3IL2A 2WT9A 1BMTA 3K72B 4RQTA 3CPEA 2A78A 2FPRA 2A5YB 3PNQA 3H8JA 3K0CC 1TVKA 1JVNA 1GFZA 2OG1A 4OVKA 1QXSA 4L72A 2JLVA 3DMRA 5H82A 1ZRHA 4LBVA 4RMJA 5IC5A 3LUDA 1BKSB 1ADYA 3HDYA 2C9BA 2Q46A 4I1VA 4MV0A 4DR4B 4NENB 1YHNA 2W48A 2WNHA 3OC0A 4MWZA 2WI8A 1R15A 4QPDA 5CLIA 2DGDA 1A69A 1TLTA 1HYHA 1U02A 1EFPA 3GLKA 4P2GA 1V3UA 2HLNA 1YBHA 3R3XA 5KSOA 3WWEA 3JPYA 3AG5A 3EC1A 1PSDA 2MWMA 5E2IA 5TVGA 3FUXA 5AKLA 2HNAA 3OX3A 3M1AA 3UA3A 4EY6A 2GN1A 2IIBA 1NFRA 2AJTA 4ZZ0A 5JH7A 1DBRA 4YCBA 2ZJAA 1EI9A 3ADDA 4KGDA 4MDHA 3NTOA 4QDOA 5LP6C 4MEJA 3ZJTA 1CS0A 1CJTC 2BEKA 2FCAA 2B2CA 5BVHA 1X1TA 2L2QA 1MORA 3V00A 3GA7A 4HEJA 1KR5A 4HGRA 4HFJA 2QAGC 2WVJA 2H6EA 3H1PA 3BL5A 2PLFA 4Z7OB 2I91A 2BR3A 4HDAA 2A0KA 1IUOA 2JFUA 5CFOA 1C81A 3QPAA 3CT6A 1TYEB 3LGSA 1EIZA 2VDWA 4MPPA 3G17A 4EW1A 3UMCA 4EF6A 5CA1B 2DG2A 1SC4A 3SG0A 1VB5A 5DHSA 1VGRA 4NZYA 4M1QA 4QYTA 4JUFA 4RTLA 1NM5C 2I7TA 2C2MA 3E9RA 5L3ZA 3FWNA 4R7ZA 2GTPA 4QUDA 1J23A 2I7XA 3BL8A 2JI9A 3I3SR 3KYCB 1SBQA 2CFRA 3BSFA 3BTVA 4IXDA 4KXUA 3TVYA 1HT0A 3GUHA 5GVRA 4YRZA 3RADC 2IOYA 3ULKA 1XIVA 2P67A 4MMXB 2CZGA 4K6CA 3GLQA 1QMPA 3BGIA 4WA7A 3T3MB 3G0CA 3RV4A 2NSLA 2F2TA 2FLWA 4FDAA 1XKXA 4L76A 3OQMA 4RGBA 3T5BA 4EUHA 5KINB 4PAQA 1JEOA 3QJ5A 4Y2GA 3AZQA 3N70A 3SZRA 4CMCA 1JN0A 1TM4E 4YJHA 3IMGA 1K63A 3UTDA 3FYUA 2UYYA 1F20A 1TO2E 3I1JA 5JO9A 3AZOA 1V41E 1RI2A 4B09A 3VSCA 1RMYA 4RO0A 2VF7A 5DTMA 4MVCA 1UKVY 3GJ4A 1L4LA 3OZCA 3B3QA 1JKXA 3ZWQA 4OHRA 3T9AA 2XT9A 3EZYA 1LNSA 4DCMA 4KR6A 3P9IA 2O0MA 2OBFA 4NBNA 4WIAA 4YP0A 1K5HA 2HRCA 5D2CA 5DU2A 5KU7A 4JLSA 3R24A 2V4ZA 3ZWVA 1QHSA 4B6JA 3WDSA 4GUAA 4M6WA 1SHJA 1ZO8A 3LVRE 1E99A 2D06A 2FN4A 2UZAA 2ZIFA 3TL6A 1L7AA 3KQKA 1GTJ1 3AG6A 3A1DA 4WADA 4XJVA 4IH1A 3I62A 2XT6A 2AYYA 1PQPA 1E8MA 2JJ8A 4R1QA 4OLHA 1XLTC 2FHSA 2GCOB 3JQBA 1VL5A 3A1VA 5B1IA 2WTUA 3P9QA 4G86A 3DMFA 4CKEB 4B87A 3LUGA 3Q1KA 5AR1A 3O8OB 4BLQA 3CVVA 3G88A 4DYDA 2C5AA 1JBEA 3UM9A 1WDMA 4BP3A 3L8CA 1N9GA 4W1QA 1J7KA 4X7PA 3ONWA 5C9ZA 3BK2A 3FI9A 3LY5A 2HWWA 3O92A 3IKTA 4IIYA 2V0GA 2ZI7A 3EOAI 2B5VA 3WO0A 4PZYA 1MOSA 2BR4A 5KUTA 3ISVA 2FWMX 2JLSA 2ORIA 2R5WA 3LDHA 2XB9A 4Q5IA 1MAVA 2AMLA 3DLIA 4MWOA 3RYHB 4X7RA 4FEAA 2I54A 2P4UA 1PT8A 1RXWA 1PHPA 4FN5A 1WMDA 4HWTA 4MRVA 5LQDA 4R2XA 2BWJA 5AMXA 3MS7A 3I23A 3HXKA 1T29A 4H31A 3U19A 3A6ZA 1T5DX 3L1IA 3NQ41 1ENOA 1QHHA 2BSAA 3K0SA 3E5HA 3MJDA 4QQKA 4L4RA 2ISCA 3DVAB 4XWKA 5H5JA 1YFJA 3LBHA 1TTPB 2HV9A 4LVUA 5AI6A 2I4MA 3WK6A 4YI3A 1R37A 1BE6A 1UQUA 1U8CB 2GD1O 4OXIA 4KITB 3ZBTA 3W5DA 1JXOA 3HRKA 1WXGA 1Q1QA 5HJEA 2PX6A 5ELMA 3E3NA 4C7BA 3ZZ1A 1NV8A 3DBRB 3W9YA 1TTHA 4CKCA 2WVAA 2GZ1A 4UHDA 4C0JA 5LZ2A 4RXUA 1WLYA 1IBCA 2C00A 5CLQA 2OXCA 3GGCA 3ZWPA 1JA9A 3LRXA 4CPDA 4D9BA 4EGSA 2MMGA 1BE1A 1PK9A 5FWXB 4X44A 1PEKE 2YMMA 1ZD1A 4MX8A 1D5WA 4L78A 3ZX5A 2PKWA 1MAWA 5DHQA 4NYMQ 1T0BA 4LSZA 3GLIA 2LP4Y 3IIIA 3T4UA 3NNSA 4EGAA 5K6TA 1GEEA 1UDCA 5HZKA 3LS2A 1AQJA 3HLKA 1M67A 1E9RA 3KL2A 4YRRA 2JVIA 2OZEA 1O6CA 4J9UE 4NMWA 4MKHA 4QARA 1KY2A 5DHUA 4B85A 3ZWNA 2XZDA 3NG1A 5DMHA 4QASA 3D4OA 1U5AA 4WECA 4G9BA 1NBOA 3BSWA 4X3OA 3R4VA 5IJXA 4V1CI 1DE0A 4F9EA 2FX3A 1TB4A 2BEJA 4NP6A 1AHIA 2XT0A 4KXNA 3GLGB 1NLUA 3GF4A 1L5VA 5L3SA 3B1WA 3WNDA 2B1QA 4YT4A 2O2SA 2GPAA 2J5XA 1EK1A 2OWEA 4JLOA 4D26A 2A2ZA 3RSFA 4L3OA 2AF3C 3QQPA 2IGTA 1S5PA 2NU9A 3UC5A 4QHTA 1M6VB 2WK1A 4A3SA 2WICA 3A32A 4DY6A 1AO3A 5IJ9A 4XUEA 2QR2A 5AJYA 3MGAA 2RGCA 4JI4B 5FOUA 3TFWA 1PX2A 2YWJA 4OFXA 2Q9AA 4B7UA 1A4XA 4E0BA 3I6IA 3LCRA 2NZVG 5I45A 4J4TA 1GXSB 4HVTA 1NKVA 1DG1G 1NVBA 1P3DA 1X39A 2V6GA 3AKYA 3KQTA 4PEVA 4B17A 5B1YA 4R16A 1EJBA 4X24A 3OX2A 1NQWA 4M0LA 5I8WA 4K28A 1XXHB 5AI4A 3KK0A 4TVBA 1P9NA 2ZWPA 1T0UA 5C4MA 1KGDA 1ZG3A 5AK4A 4OP2A 1DBPA 2OAP1 2OOKA 2PUHA 3A06A 1T8UA 4WK2B 5AM2A 3CEHA 1Z4KA 1WU7A 1YRYE 5SYMA 1KOFA 2WDPA 1MPTA 4OYYA 4V0OA 1QB8A 3CLSD 3OH8A 2NU9B 1QQ6A 2W0SA 1RAAA 1UBJS 1WF3A 4X8MA 2PS1A 4MLPA 4F46A 2VSXA 3OOJA 3IOMA 5LYJB 2J0EA 4MRAA 4I1OA 3BFJA 4Q9HA 1R9NA 3WBJA 2QU8A 2YVLA 4ZVQA 1SUEA 4LXIA 3F47A 4Q24A 1YZUA 3W2HA 1PWHA 4Q1VA 4WASA 1X8XA 2EC5A 3DE2X 1ECBA 3LLSA 2Q8NA 4AJ4A 1BE0A 5ICEA 1NPDA 5JBIA 2RAPA 3RASA 1TFRA 1N2IA 5JVDB 3JQFC 3W4IA 3K6RA 1VPWA 2EQBA 3VSAA 1U8AA 3OUUA 3TZQA 3DG9A 3CNOA 2QL5A 1R1DA 1WUHS 3VAZA 3S8YA 1RAEA 2IPNA 3EGCA 2XX3A 3L6EA 1JAZA 3MIIA 4RK6A 2GPSA 3V9PA 3PUWA 4OUKX 1K8XB 1DZ3A 2Y05A 4H7PA 1WQ1R 1AGRA 2DZDA 1DC3A 4XCQA 1UZAA 1YKSA 4XEHA 4YROA 5BT8A 2EEZA 3PJFA 4KQXA 1IXYA 3W5SA 1VLZA 2XYGA 4GKVA 1YOVB 4MS3B 3E27A 1KVTA 3FTQA 1GU0A 4RV9A 4ARVA 3DLPX 4O63O 2JC3A 3P27A 5JDIA 3EA4A 2RK4A 3SC6A 2BFMA 3QVJA 3A9VA 1X9HA 4V0QA 5CH3A 3VTZA 4DIBA 2IW3A 3RUDA 4MVWA 1U04A 3OSZA 2QM0A 3K4HA 1NN0A 3WFIA 1CVIA 3NUQA 4LMAA 5IP5A 1I6WA 1VJ5A 2VTKA 3CLVA 1ZAYA 4HNRA 4LGCA 1JFVA 3CLUD 2H5EA 3OQIB 3UJ3X 3OTOB 1ND5A 1ZD5A 4H6PA 3RVRA 2ZXFA 2YZMA 3D0QA 3ONVA 4Z0PA 6Q21A 3MJEA 2GEDA 1SVMA 3CKKA 2WA1A 4JXJA 4EI9A 4JKOA 2C2XA 3KB1A 1R50A 1RRPA 1A27A 3M6UA 2PR2A 4BQPA 5FUXA 3VX3A 4RHYA 5BQPA 3DOEA 4BS9A 5DNUA 3H2GA 4BNHA 5H4HA 2IZZA 4JB2A 4WN3A 5F98A 3JAWB 3EOZA 3VV3A 3DKRA 3KSRA 2FG5A 2P3OA 3TM5A 1HK7A 3BMCA 4C4SA 5I8ZA 1XNJA 1LSUA 1OZGA 2O2CA 3L0ZA 1BXRB 2BKUA 2O0HA 4S05A 5CFLA 1TU0A 3DTNA 5AI8A 3TLEA 2OEPA 2VXCA 3PDIA 3V4PB 3VKGA 1N5MA 1OYWA 4N49A 2E7ZA 2VOJA 1T4GA 3ANYB 4IQGA 3V2HA 4HX5A 5BQOA 1Q1NA 1SUSA 4UHHA 3EY4A 3FWYA 5ERGB 4FMDB 2PNFA 1HDRA 1ZI6A 2YRFA 3PRHA 1TECE 4G9EA 3OOEA 4IV0A 3RI3A 1J2JA 1JKFA 1OX4A 2XTZA 4HAYA 4L08A 1QOQB 1A72A 5IK2D 3KHKA 4JX9A 1QVWA 1JQKA 1EVLA 1P2DA 1ST2A 2VSQA 4XJSA 1PF7E 5BUSA 4EJ2A 1G6OA 4LWQA 1QYVA 2D1QA 2ZB3A 4N0DA 1G5PA 2CVFA 2Q29A 1RYNA 3E9EA 1C4KA 1CZLA 4KXMA 4DOMA 1JG6A 2ID8A 5CDSA 4CIDA 1RZRA 5TPZD 3EMDA 4F5YA 2P40A 4UW9A 2HDHA 3FCXA 2C5GA 3GRKA 3QE0A 4RENA 4OQYA 2DSTA 4WNYA 4B7CA 2BGTA 3BXZA 2ZRJA 4HGPA 4D79A 1XVUA 2YJTD 2FDXA 3PXEA 1VIYA 4IX9A 3GJQA 3SYTA 1HDOA 1SCQA 2PFKA 2XPCA 1MGPA 1E9FA 3PE3A 5DVZA 1RQXA 4C4OA 3O9VA 3CIOA 4ENSA 1AQLA 5JWOA 2DPMA 3SEZA 2YVKA 3ZK7A 4KRFA 3CTMA 1J4AA 3H2JA 4DMKA 3KXDA 4AY6A 4YN3A 1ULSA 1X3SA 5BV0A 4MGHA 4YVFA 2C7BA 2ORVA 1NXWA 5CPFA 1YB5A 2QPTA 5BYKA 3C7CB 3TCKA 1WBDA 3RVPA 1CSEE 4WZBE 5TIIA 1N0VC 3RYIA 1GGVA 2OAGA 4HAOA 4GS5A 4WOKA 1Z47A 3EASA 3UJ8A 3OWXA 4MWTA 5CFPA 1JX6A 4FK8A 3ABSB 2XCUA 2WWHA 2SCUA 4EITA 1K9SA 1WE2A 3IJEB 3NTVA 2ADMA 3NWBA 4E46A 4H7DA 5IXYA 4CQLA 4R4JA 4B4VA 1ZUNB 3TM4A 4I6JA 1L3CA 3D8SA 1ZUHA 1UJCA 4H4CA 4UATA 4N12A 2IXGA 5KNDH 2GILA 2ZVQX 4LYDA 3S3TA 3TN7A 2Q5CA 4OPMA 3C74A 3QEJA 3B3FA 3R5TA 4U02A 5H02A 2P6UA 1EB8A 3ZDBA 1SUIA 5BYBA 4DUPA 3DE6X 4N47A 4FZJA 3O2NA 3BMOB 1JDBB 2FEAA 4IDAA 3RTGA 1XAHA 2C4MA 3NUZA 4AY2A 1L8OA 2CLKB 4WDQA 3VR3D 5CXXA 3UMGA 1SQ6A 1UK7A 4LRWA 2Y6VA 3F6CA 4UNRA 1UM8A 2PBRA 2IW1A 3TTTA 3AVTA 4YRIA 1Q14A 2IY7A 1QG4A 1Z5PA 3EZFA 3ER8A 1XJWA 1TZBA 3LLMA 4FGJA 5IN4A 3SZ3A 3T7KA 3W2GA 3GP8A 1UCFA 2WUGA 1OI4A 4D4GA 1W0JA 1CY6A 2D2XA 3ABOB 3T7TA 2Q3JA 1JLKA 1UODA 1XWFA 2WSBA 1FU7A 2FB9A 4PAWA 4YRNA 1PZGA 5EZYA 1M74A 4IIDA 1SCJA 3TYXA 3K0AB 5EXXA 1GKYA 4YV7A 4YV2A 2DT5A 4HXGA 2OC4A 5DN6A 4YMGA 1SZJG 4GM4A 1LW6E 2Q41A 4GKAA 5HCNA 1RWOA 2Q9BA 3FOZA 4OLFA 1FJGB 3LF1A 1CQIB 2J3LA 2WVHA 4ZEXA 2XCIA 2L19A 3QX9A 5I3ZA 1RFGE 1VJRA 1VRCA 1GPWB 1LJUA 3G5TA 3ZNOA 4N40A 3EG9A 1XI2A 1NNI1 3KVVA 3EQZA 4A8JC 4NK5A 1BCRB 5K6RA 1TZCA 3OFSA 3GP5A 3BHMA 4HDSA 3THYB 1CLEA 3B9RA 3ZXUB 3OFKA 2I1LA 5HILA 3CCBA 3HJUA 4O4JB 4RGVA 5KYTA 3LPNA 5L8VA 1FRQA 1KK3A 5AVQA 4LFCB 4KFCA 1PR5A 3D8TA 4FOPA 2QX7A 3ZQUA 1AQYA 1FC0A 2AZTA 2RH4A 7GPBA 1V5GA 3R0VA 1P7VA 2FE4A 3TBFA 1VJGA 2B20A 2VDLB 3HCFA 3CLUC 4YMVA 2QTLA 3ZUGA 3MCUA 3WIOA 1JDSA 2HW8A 3AWDA 4MSUA 3F98A 3N2ZB 4D45A 3E05A 4GBED 2F1HA 4F60A 2V6BA 4ZMSA 3THWB 4B3SB 3X43A 4O2BA 4A2CA 3BCUA 3D4NA 4JVLA 5A9RA 2EFGA 5JSZB 2HX1A 2DQ4A 3C15C 5EHZA 2IZ5A 1NHGA 2PPLA 3COYA 1H6CA 3NIWA 4R6WA 1WY7A 3NWOA 1RVDA 2PUGA 1QHGA 3HLTA 1YH3A 5DF1A 5CYGA 1XJ5A 4FWBA 2O0LA 5KNDD 3GPBA 2WWWA 1DFGA 3AESB 3C7DB 3GRZA 2RHLA 4R31A 1Z5GA 2YXDA 3OPYA 1B2RA 3EPJA 3CKYA 2OV4A 4LGYA 5DM70 4C4YA 3R8FA 4PC1A 1Z38A 5IVKA 3EEYA 2FDRA 2BOVA 1UEXC 1NOIA 1ZA2A 2F3RA 1G20B 1MFZA 2X19A 3BHNA 4XWTA 2BM8A 4OHPA 4Q39A 4LFBB 5KKNB 1W25A 1G5TA 4U3JA 1ZM4A 1A8PA 3C6YA 3PUYA 2GBGA 4PTYA 2EKPA 4I6GA 3KOZA 1T6ZA 3C8HA 4O4IF 1EUDB 5CDFE 4E6EA 2ID7A 2JK0A 4DLUA 3U80A 1Z2NX 2AUMA 1IUPA 3NALA 4NAVA 2YYYA 3R9XB 3GVHA 4NE2A 3OX4A 2OV2A 3OJXA 1WD7A 1X7GA 4AYXA 5T4EA 4IJ6A 4PS0A 4CIVA 1UC4B 3JYOA 1IWOA 3IT2A 4B4WA 3LUJA 1KDOA 2BGNA 1PGPA 4REMA 5GZ6A 3NTXA 4BDSA 3VU9B 1SUCA 2YOFA 3TB6A 1JIQA 3KOYA 4UVDA 5K03A 2CLMB 3S70A 5L51A 2JASA 3QPCA 2H7CA 1FFDA 4TV9A 1PSZA 2B4RO 1JYEA 1WSDA 3ZTWA 5JRDS 3RAGA 4AVYA 3HRIA 4B31A 4C07A 2OENG 1VKRA 1M2VB 3BWBA 3IQDB 2OXTA 3VDRA 3QU9A 3L8DA 2P0YA 3UHAA 3PDIB 3HO6A 4ZVLA 4X1IB 2P30A 4XGQA 3PFIA 1DUSA 1GNQA 2D7JA 2H54A 5GONF 3UB4A 1XBTA 3A8TA 4E4TA 1WCWA 1EFAA 2X15A 2VWHA 3CCCA 2J67A 1XC7A 1CR4A 3EGXB 5CIYA 3PSHA 3TZKA 3FUUA 1ODJA 1NLZA 1WXDA 1BGXT 2O8BA 4JS0A 4JEMA 2EZUA 1QLHA 3EYWA 2UKDA 1BH6A 1GDDA 3U3ZA 3DMGA 3QW4B 4KN9S 2XWJI 5K3CA 2GN6A 2HCBA 3GR6A 3VC1A 1YZNA 1AMOA 3LTEA 5ES4B 1SCIA 2VPWA 2QVCA 1U0OC 5FORA 3CH4B 2I7CA 3OM8A 4QDTA 4EGCB 5JHGB 1HKHA 3UWSA 1FLAA 2PXAA 2OA0A 3C4VA 1KAQA 4MP3A 3PQ5A 4DKJA 1QZXA 4I4IA 5EHQA 1LK5A 1URPA 2VUUA 4PLPA 2FJUA 2G4CA 3G9XA 5DSZA 5DTQA 1UK9A 1JT2A 2BHRA 1MRZA 3IPYA 4H0FA 4DDKA 4ZODA 3P5SA 2WPDA 1H2BA 4G3XA 2NIPA 4NL4H 3B7PA 4BRSA 4DRYA 2ADOA 5KTMA 3D59A 2FLKA 1A7AA 4NF2A 4F85A 2I8CA 2HLPA 1X1RA 1I2AA 1NATA 3LF2A 3FRHA 5FPSA 4B2PA 2XB6A 4J16A 4HT3B 4O2LA 2RH5A 2I3AA 4RA6A 3EGVA 5E7QA 1YA6A 4HAUA 1KO4A 4ZJPA 1IBSA 3BKWA 4KR2A 1NJ5A 2F64A 2IS4A 2JCYA 3GB9A 3HS3A 3HKEA 1DCTA 3BMCB 1R4MA 2J4DA 4FBLA 3RT7A 1NI5A 2V9PA 3R7LA 3RVSA 4WBSA 1MP0A 2YASA 4YMSA 3MGGA 3CNBA 3GLGE 3R6LA 4DLSA 2ZRAA 1XRMA 4DQXA 3HXMA 4E21A 5HMLA 2E1RA 4XI9A 2GM9A 1V39A 1VOTA 2NZWA 4HD8A 2QJWA 2X2EA 2X5KO 3IDFA 4L02A 3DW1X 4MW4A 1IJFA 1A71A 2J5RA 1IHXA 3L49A 1AB6A 4JP2A 1T9BA 1M8FA 3VU3A 4R5HA 3ZXXA 1QU2A 1L4GA 2QVLA 1HZZC 1PT9A 3I9FA 2VAMA 4NMLA 2EJCA 1BXRA 1K92A 4ND8A 1B43A 1IYZA 4Q3CA 3MFYA 1I5RA 2UVPB 5L45A 3DTVB 4PQRA 4WPGA 1T9KA 2WOOA 3F1KA 3Q9SA 4RJKA 4YAKA 5C7IO 1E77A 3P0FA 1E9DA 5CX1A 2HV8A 2A9QA 4NJMA 1LV8A 3GEIA 1XLTA 1SUBA 1RHRA 3IPXA 3PNOA 1WVGA 1HFEL 4E2FA 3G6WA 5LPNA 2FWRA 2OYRA 1RTKA 3S68A 1MU0A 3TDMA 3U4HA 4BMXA 5FULA 4HQ6A 2BI7A 4ZEVA 5CX1B 3HUDA 2OCLA 2VH1A 1CQXA 1E6CA 4K9LA 1R0WA 2PZFA 1KC1A 3NS7A 3NYIA 1U9IC 4RIIA 4F2HA 1F8FA 4BNMA 4C2UA 3HUUA 3SNKA 4E5YA 1SHZA 2AOXA 5B36A 1L6RA 1FFXB 2W2TA 4R2JA 2WKRA 4ND8B 5IJ9B 3INTA 2CFCA 3ETCA 2EU8A 2Y1EA 2NPFA 2C4HA 3CPJB 5ILOA 1NA5A 4EBBA 2HSZA 2VT3A 1KDZA 2XKBA 1COWD 5T67A 2ZIWB 4D8VA 3PFBA 1GZ4A 1R5NA 2P65A 1MB0A 3DO5A 3G7UA 1UBTS 3GCGA 5EIAA 3ZW7A 3RUHA 2V0NA 3NMUF 4DJFC 2FYTA 2QJTA 1JYSA 2XMCA 3FIJA 3MJHA 1K6MA 3B3AA 3IEUA 3RFCA 1G3MA 3RUAA 1V1MB 2UYGA 1V5WA 3MWYW 2WIJA 4FOOA 5L3QB 4TQ9A 4RHCA 1JHVA 3W6NA 3U7IA 3CLSC 1C9MA 3WB0A 4X00A 2OHFA 1X8JA 2YIMA 1DPFA 4YPOA 4HL6A 2X22A 3ODPA 1M5TA 3SAJA 5K3FA 1ISMA 5L53A 1GPYA 2IRWA 1AV7A 4KDFA 3ZQJA 1RYBA 3RO7A 1QQBA 2O2GA 3V1MA 5HRAA 1Q0LA 1KEEA 2QIOA 4BE4A 1O8BA 2E4WA 3RFUA 4JLJA 1QANA 2UZ3A 4XGKA 1T1RA 3D5QA 4JDPA 2F8SA 1M1NA 1YZKA 4Y9TA 3VUEA 2I99A 3B52X 4MV7A 3PQ2A 1D6NA 1CUFA 1SD1A 2DKNA 2C7PA 1K2WA 4S1VA 1OU0A 3GJ3A 2AHOA 4K3VA 1M2KA 2QN1A 4F84A 1TMGE 1IWBB 1ZOLA 3LLVA 5AW5A 4QYSA 3OICA 2OXIA 2CVPA 2UZ4A 2VG8A 3A70A 4GIBA 2WIKA 3HYRA 5BRAA 1NJGA 2VJDA 1DQYA 3QKIA 3FOCA 1DCMA 1EGHA 3EF3A 4INAA 4YUAA 4GDMA 2RHRA 3FCYA 2WT8A 1QQAA 2HPHA 2RGUA 2RHWA 2A4MA 3RROA 4YJ3F 3ETLA 3G02A 2WC1A 2OB2A 1Z22A 2DFLA 1EX7A 1O58A 2C20A 5AVXA 2H29A 3MAJA 1EGMB 1FMTA 3L82B 3PC8C 4M99A 4WKOA 5B37A 2PUFA 1ADFA 3F9IA 1Q1ZA 4HFRA 3K6JA 2R7KA 3BSYA 4KZKA 3LYAA 4EW3A 4I50F 4UUOA 2AN9A 3LP6A 4FLEA 3SX4A 5BXYA 3HG7A 3T5AA 4LRSB 3WZMA 3ORFA 2DFNA 2JFQA 4D9NA 3WK9A 1EVJA 3QYPA 3WWYA 4TV8B 4ZOCA 4I99A 3VNVA 3DXZA 4E31A 5KVVA 2DOKA 2XSZA 3HKBB 4GBGA 4TYPA 4MWDA 4BNZA 1KBQA 5FWYB 2XUJA 3IE0A 1DQRA 5KTRA 1HE2A 5EXTA 3L0SA 1NUUA 1U7UA 2R60A 2WAMA 5DO9A 5BMVF 3AVQA 4Q15A 3KOXA 2VSOA 5K3SA 2VS1A 1XCBA 4QO8A 5F5NA 3VPAA 3TUZC 5CLFA 2M98A 1NR5A 1PR1A 1WABA 1A82A 1H8HD 2ZRIA 3ITNA 5B3AA 5G4LA 2ZRMA 1Z4LA 5C4IA 4EI7A 1YR9A 1MC4A 1HQCA 2VSFA 1I7PA 1YRQA 5A2GA 3LGXA 3NDBB 3O4HA 5AI9A 4MW0A 2AGVA 3N6XA 2I2BA 2VP3A 3OLWA 2G4LA 4KBFA 2FEPA 4WNCA 2E0IA 1B6TA 4NNPA 5DV9A 1I24A 1MX9A 3CINA 1KBZA 4OHZA 1FVHA 1PFQA 1JI3A 1W0KA 4R84A 5JSKA 1K6XA 1Y8QB 1GQ2A 3EFHA 1D2HA 5D00A 3JALB 1JE1A 3LK6A 5CIWA 2QN6A 3RQSA 2VHCA 3PVCA 3QNMA 4OTZA 1RWBA 3E61A 1WR8A 1YRWA 5KOIA 1VIMA 4P4SA 3NAGA 2ZJ0A 3RNOA 5FOTA 1OFTA 4JZYA 5TMEA 1OAAA 1LLFA 4HH1A 1XTSA 4IYJA 4KUEA 4AM8A 3L8GA 1SHKA 3V4FA 4E4RA 1PNQA 2BM0A 2I7VA 2WV9A 2ZJ6A 3ENZA 4P1ZA 5AW0A 3GMDA 1EEHA 1U0FA 2YWCA 3OZTA 4C0SA 2RJOA 4AN1A 3H5OA 1R12A 5HFJA 4CM3A 2CNBA 1DIGA 3R20A 1XZEA 3P4YA 1GP2A 1R3DA 3DFZA 3RS5A 3EZ9A 3B20A 1X7HA 1Y80A 4B3CA 2XWBF 4Y0NA 1IOWA 2PBZA 1Z6QA 4GYJA 1YI1A 3W34A 4BMYA 2JPDA 3NLLA 5IN5A 3OLXA 2BRUC 5E6UA 3G0HA 1FZTA 4YRDA 2H7YA 4ZHSA 2J0UB 1PP4A 3OCXA 1JXAA 3LT1A 3DEHA 3Q87B 2WHPB 3W3AA 2WFZA 3LUKA 4FYJA 2BHLA 1NUSA 1YKFA 2FPIA 1TD9A 4FWIB 4WOCA 1CERA 3SYKA 3OVMA 5KVSA 2ZUFA 3KKZA 3ISTA 4O3MA 4OAPA 4J7AA 2XGSA 4EGJA 2R8RA 2HWYA 4XAQA 4U39A 4ZWNA 4JYPA 3H3XA 1W49A 2W98A 2Q6LA 4R3NA 5DM2A 2QZPA 5ER9A 1Z4MA 3ACCA 1UC5B 3IBYA 1NULA 4YRSA 2LCQA 1WOMA 4NENA 1V3VA 4OJMX 4WXMA 1RLMA 2EVWX 1I4DD 3RWOA 5KTTA 4OXKA 4OI0A 3VPBA 1M8GA 1PJSA 4ZYUA 2G9QA 3JRWA 2EG5A 1E18A 1V8DA 1USWA 1WXQA 3ZCRA 3O7MA 4ZU6X 1X80A 3FWPA 4LF9B 2ZBGA 5H8WA 1XD8A 1QV6A 2FPXA 5DI3B 3VVCA 3BB3A 1MIHA 5CVUA 3FTNA 5LDDC 5KSYA 1TEHA 1UF9A 2AHRA 2Z09A 1LBHA 2BDUA 4RVHA 1XD2B 5I9TA 4FGLA 3T0GA 4JT8A 4R69A 4F3KA 2E21A 4MH0R 3E23A 1JLSA 2CF6A 4K9KA 4DFDA 1P17A 3ZXSA 2BFWA 3RH0A 1QH1A 1U0RA 2Q3CA 3GEMA 3MB5A 5K1ZA 4AXXA 1VMEA 1QTRA 3DAFA 1S7CA 2R66A 2PV0A 3OOSA 1DELA 1XD9A 4HRXA 4IVNA 3DTTA 1KMHB 2G9VA 3OTWA 3WGIA 4DZRA 1QFJA 3R3HA 4XLZA 3BILA 3PGVA 4WZ6A 4FJ1A 4BVKA 4H3VA 2B21A 2M2IA 2LV8A 1C1XB 2Q0QA 3I58A 4FMDF 4HS9A 4S0ZA 1XLWA 5G4KB 3ZK9A 1M0WA 4OI4A 4PU0A 4ZGWA 3C3EA 3HXTA 5A3JA 4TTJA 1YULA 2R4QA 2DWPA 1MV8A 3FGNA 3MINA 2R1ZA 3G2QA 1MPXA 2GZDA 1OT5A 1F0YA 3MWKA 4L8GA 3TGLA 1BO6A 4HWOA 4DYHA 1EXMA 4INJA 1Z5UA 1MH9A 4U2FA 4A4DA 2PL9A 5KQSA 3G8DA 2PZLA 1EB9A 4EHIA 1SXJC 3ANTA 2G83A 1Z2DA 2GAOA 4G25A 4Y9SA 3C6MA 2Q99A 2I3ZA 2SHKA 1L1EA 1M6EX 3HA5A 4CL3A 2C2YA 1W581 4JIMA 4B2IA 3ESAA 1ZC3A 5DBOA 4RS3A 4QULA 3KCNA 3EARA 3D6UA 4F8JA 3EMBA 3RUCA 1V1RA 2QYSA 5HIIA 2X8WA 5FR1A 3ZDYB 1LI5A 1FVOA 2UVDA 2ZYAA 3SM9A 4L3WA 5KVQA 1T2NA 4WEOA 1DOZA 4HB3A 2UV8A 2OP1A 3MWFA 2A9VA 1CZUA 1R0BA 4X1KA 3LVQE 4KDEA 4GLOA 4G07A 2H11A 5J59A 1XDWA 1M6NA 4NV1A 4DIKA 2ZJ5A 1XEAA 1QJ4A 1I01A 2EX0A 2HREA 1BS9A 3PC8A 4MV9A 4BWVA 3P2YA