3NJ8A

Crystal structure of t. gondii enoyl acyl carrier protein reductase with bound triclosan like inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
301
Chain Sequence
b'FPIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGEKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
molecule tags Oxidoreductase
source organism Toxoplasma gondii
publication title Identification and development of novel inhibitors of Toxoplasma gondii enoyl reductase.
pubmed doi rcsb
total genus 94
structure length 301
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nj8A00
1JWAB 2BRUA 2ZQZA 1H6CA 2QYTA 2VRBA 4D42A 3PI7A 4U8GA 4YT2A 3AFMA 2HK7A 1A4IA 2AQ8A 4NFHA 5GZ6A 4MKRA 1YQXA 4GPD1 4CM4A 1GUZA 3P2OA 4R5HA 3EZYA 3KBOA 3GRKA 3H3FA 3JQ7A 4KDEA 2CMDA 1C1XB 2I9PA 1SZJG 1T24A 2X0JA 1PJCA 3MJSA 1U8FO 5AYVA 5JO9A 3IKTA 3FCOA 4RPJA 1T2EA 1DRVA 5DULA 3V2HA 3FTPA 3MTJA 3TJRA 2X4GA 3ZNNA 4KTTE 3NEPX 3NT4A 2WDZA 4IJWA 3MJCA 3OIGA 3DHEA 2C29D 3SLKA 2Q50A 3G17A 3ZWOA 2H9IA 3F9IA 4L8VA 3ENKA 3UUWA 4Q3DA 1FDWA 2VNSA 3WLFA 2LDXA 4GWKA 3D4OA 3AM3A 4OXNA 4ALKA 4DBZA 5JXWA 4DLLA 3KVOA 2D4AA 4DPMA 1GEGA 4OKNA 1LLCA 4J0EA 1EFLA 1I30A 1VM6A 3HB5X 5DBIA 1ZSNA 1JKJA 3RBZA 2V7PA 1ZXLA 2FR0A 1Y7TA 2DBZA 1N2SA 3V5NA 1R12A 1KYQA 1NAIA 4OGWA 5JCJA 3W8EA 4EW6A 2WJPA 5FEUA 2UDPA 1K0UA 1B8UA 3OJFA 4YRAA 2I3AA 3D1LA 3WFJA 4GI2A 4E2ZA 1B3RA 5TSDA 1Q0QA 3LSYA 4EI2A 4UEKA 3TWOA 1MA0A 3VPXA 4BKOA 2R00A 3RUCA 1YS4A 3U4DA 3QA9A 4CMEA 3DQPA 3PWZA 1WPQA 1PWZA 4PLGA 9LDTA 5A4DA 4N54A 2XXBA 2BMAA 3IMFA 4FOSA 5ENVA 5A9TA 2FZEA 1E1MA 2EJWA 4TQGA 1LLDA 5B1YA 4FFOA 5MDHA 4BKUA 3AFNA 4KQWA 2UUOA 1GYQA 4DUPA 3TF5A 2RCYA 2Q4BA 2VNAA 3FR7A 2HMVA 1EUCA 4H15A 2PGDA 5G0TA 5I8WA 5H83A 1RM3A 1E3WA 3T4XA 3FI9A 1IOLA 4F46A 3ZHZA 3CZRA 1RPNA 2IZZA 4PLHA 1ADFA 5B4UA 3K2BA 3WNVA 3UCFA 4OXYA 2HK9A 1U3TA 5T6BA 3SLGA 3GG2A 4PLFA 4RVSA 1M75A 4PZCA 4O6VA 3KHUA 3R3JA 4GKBA 5FI3A 1PQPA 2IEBA 1LSJA 1X7DA 4GKVA 1ENZA 1VSVA 2GLXA 3GNQA 4CM8B 3QW2A 4JLWA 5K0ZA 4YQZA 4R1TA 1E6EA 1I33A 1NVGA 2DAPA 3AM4A 3FNHA 1Q7BA 5A3JA 2PZMA 5KVCA 1N7HA 1ZUD1 4XKJA 1ULUA 5C37A 2AQIA 4QT0A 1QR6A 3WQRA 3VAZA 1R6DA 2V6MA 4ALIA 1QLJA 3LF1A 1D8AA 2AXQA 5A9SB 3JQGA 3HADA 5KIAA 3GQVA 1YDWA 4AICA 4RVFA 1ISJA 4YJDA 3UVEA 2BGLA 3L9WA 1PJQA 4IQ8A 3HSKA 3ROKA 1HDRA 1PWXA 2DBRA 4FW8A 2HDHA 1Z7EA 3KLPX 3DOCA 4W9NA 4FJ2A 3NT2A 1E3JA 3JD4A 1ONOA 4DBVO 4YCAA 1NPTO 1PSDA 4G5HA 3R0IA 4GVXA 2GASA 2YFHA 4IDDA 4J49A 2FR1A 4IGEA 4ZICA 4KTVE 1ZVMA 4GH5A 1LNQA 4E2YA 2D5AA 3VKVA 4WLVA 4WECA 1KY4A 1I5RA 1WVGA 3BHJA 1ZO8A 3D64A 4Z0PA 1B8PA 3GEGA 2AEFA 4JCOA 2GGSA 3HUDA 3NRCA 4CLRB 1E7YA 5BQFA 5U4QA 3WGTA 3HFSA 3DFUA 4OQZA 3BMNB 3ZGYA 2PD6A 3DL2A 4A26A 2EGGA 1E7QA 1YB5A 4L9RA 1OFGA 4ZA2A 4W6ZA 3E6AA 4IJKA 4XIYA 1KVUA 4CLRA 1KERA 4CV2A 4OSPA 2DKNA 1EVZA 3BYZA 1J6UA 3FHLA 5K9ZA 1C1XA 1J49A 4FJ0A 4ZJUA 1VSUA 3FNEA 3QWIA 4E2WA 5F5LA 3D7LA 5KOIA 5HM8A 4OH1A 4BNMA 4D3DA 5JC1A 3GRPA 3NGLA 2EKQA 4IIVA 3IKVA 1NPYA 3O9ZA 1Z82A 4JGBA 3E18A 1AXGA 3NTRA 4PGFA 1JVSA 3HHPA 5DOVA 4M8SA 1JKIA 4I1IA 3B1KA 4B4WA 3U62A 5KKAA 1GPDG 3JQFC 1ONPA 3KYCB 4WOJA 4NQZA 2WE8A 1HF3A 2GYYA 4LCJA 4AJ4A 4YPOA 2DTXA 3EVNA 1DPGA 1KIFA 1ZFNA 4HADA 5FFFA 1R0KA 1EQ2A 2J8ZA 4KMSA 1IE3A 2C07A 4IDAA 1ZK2A 3TFOA 3I1JA 2ZB3A 3KRTA 5THQA 3NKLA 4HNGA 4N5NA 2YV2A 3I5MA 3F6YA 4AJOA 3ZDFA 4IS3A 4EUHA 3H9EO 2IZ1A 3OFSA 1KETA 1YH3A 4K28A 4MKZA 4MP6A 4QECA 4XJSA 3W6UA 1NQTA 1LXCA 3QY9A 4H16A 3BMQA 3PYXA 1DIAA 1W6UA 1C3VA 3RUAA 3UICA 4W7HA 3GDGA 4MIYA 2B5WA 2IYPA 4CV0A 1QG6A 4PIVA 3DBLB 4R1SA 1O5IA 3DOJA 4D46A 1NVMB 2WM3A 3CXRA 1OAAA 3HN7A 3Q11A 1T26A 4PZDA 5G4LA 2QW8A 5TGDA 4MIOA 4ZQBA 4RPHA 3K96A 1UDCA 3O03A 2EHDA 4RPGA 4DYVA 4ND5A 1C1DA 4LMPA 4RLSA 4B7CA 3OEYA 1ONNA 3OHSX 4IBOA 1JU9A 3VZPA 3ZV3A 4CMJA 3PQEA 3UCEA 3GMSA 3VVBA 3DMYA 4YT8A 3DC2A 3QLJA 4NFSA 1Q7GA 2GZ1A 2ZCVA 4OOFA 3I9MA 1X15A 1QKIA 3RWBA 2NNLD 1GUYA 4FB5A 3NDJA 1ENOA 5C3MA 2NVBA 5ENDA 3E9MA 3EGOA 3OECA 3NJ8A 4OYRA 2J3HA 3PQDA 1P77A 5I9NA 1V3TA 2I67A 5JDCC 5C7LO 1JAYA 1P9LA 3WLEA 3CEAA 1W0CA 5HS6A 4D41A 4A73A 2DFVA 3L4BC 4PG8A 2ZTMA 1HYHA 5KCZA 1PZEA 2FZWA 3WQQA 3JQAA 3PP8A 4IY1A 1DIHA 1FJHA 4JK3A 4UUMA 3FRJA 3LLSA 2BELA 3UGKA 3UAGA 2OBNA 4MVJI 2JHFA 3ULKA 5IN5A 4PVCA 1P33A 4KP7A 4P22A 5B37A 2DTEA 5LDHA 3EYWA 1LRJA 3PFFA 4J4HA 3I4CA 3WYCA 1KEWA 1PJLA 4BGIA 4B3IA 2YHIB 2Y0DA 3W6ZA 2A92A 1V6AA 2C7GA 2GN6A 4WOKA 3JQDA 2VT2A 4BNTA 3IJRA 1BGVA 4BO7A 1U2DA 3RC2A 3RROA 2O2SA 4BGUA 4GVLA 3G1UA 3VH4A 1P1IA 1HZZA 1ZSYA 2QRKA 1K3TA 1YOVA 2HJSA 3B6ZA 3WIEA 4FPXA 1QRRA 1WDMA 2VHYA 1YE3A 2HK8A 2X9NA 3DBVO 1GTMA 3L07A 2PY6A 4MVJP 4YR9A 2CUKA 4BO1A 1XGKA 3ZW9A 2CY0A 3ENNA 3HDYA 4WCFA 1PTJA 3R3SA 3GVPA 5JAQA 4ZU3A 1ZKMA 3PGJA 5EN4A 4J43A 2NLOA 3VDQA 1XQ1A 2P9GA 1Q0LA 3EAGA 3F47A 2EJVA 2Z1NA 2PR2A 1PJSA 2BFOA 4BKQA 1E3WB 2I65A 3BTSA 2ZIZA 2I6TA 2XXJA 1VC2A 2FWMX 4L4RA 2VCYA 3JQ7B 4J7XA 4TVBA 4BKRA 3MJ4A 1EZ4A 2Y68A 1LTHR 2NWQA 5A9RA 1NR7A 4MVJG 3HDQA 2QRLA 5KJEA 3RI3A 3DBHA 2E6UX 5I7VA 4B4OA 3WDSA 1LLQA 3KYCA 2EXXA 2NADA 3G79A 4XB1A 1YONA 2E48A 1LC3A 1WW8A 5L3ZA 3MJEA 1I3KA 1J5PA 4ILKA 1DLIA 1BTOA 3GEMA 4BNVA 2Q45A 4DQXA 2I66A 2BF7A 5I8ZA 4WCFB 1XIVA 3GGPA 4KWIA 4WJZA 4PG7A 3JD0A 4XIJA 2YDXA 1RM4A 1NPDA 1QYVA 1IB6A 3KB6A 3Q0EA 2OO5A 2C2XA 3RC9A 3ROQA 4BO6A 4GL4A 1O0SA 2O3RA 3C7CB 3KZVA 5COAA 5KWEA 1WDKA 1O94A 3LQFA 4Y67A 3Q9UA 3L4SO 1TT7A 1I2CA 1E3EA 1LSSA 1UUFA 3R6DA 5CAEA 3TZHA 4NIMA 3O26A 5HWSA 1GDHA 3RJ5A 1HE4A 4TRNA 2Q1TA 2PKRA 3DFZA 5L4LA 3EZLA 2O3SA 1CWUA 1G0OA 2VTEA 2JCXA 1BXKA 1GZ6A 1PGPA 3SXPA 1JN0A 2FP4A 4F6LA 3FF4A 1FXSA 4YT5A 3KETA 2GDZA 2C7VA 4P8RA 4DIBA 1JTVA 1GL3A 1LC0A 3U4IA 2Q99A 1DSSG 4E5PA 4CLHA 1DRUA 3GAZA 1E77A 1MV8A 2UAGA 3W8DA 3NV9A 1GV0A 1KEVA 2CF5A 3NDIA 5DDIP 3RUIA 1U2GA 1GZ3A 3GZNA 1VLLA 3P5SA 4J9UE 4RORA 4XQ9A 1BW9B 3GNSA 1WP4A 3UW3A 4YAIA 2QG4A 3ASUA 2LDBA 2B4RO 1VI2A 2G76A 1PZFA 3C7AA 4HFJA 5TX7A 1LI4A 1MXFA 4B3HA 2PNFA 1SB9A 5ICMA 2O4UX 4DWVA 2X0NA 4EJ6A 5JY6A 2Q1WA 3I9NA 3ZHXA 5TNXA 5IZCC 1WAMA 5TJ9A 5K6AA 3ITDA 1IHXA 4UUPA 3DZFA 3Q9NA 1NQOA 2HRZA 1ZK3A 1T2FA 4RLHA 4CJXA 1K89A 4B3JA 2NTVA 4I5FA 3E9QA 1RWBA 4NK5A 1K6XA 3C85A 4WCFC 3DAPA 1KOLA 1E3LA 4ALNA 3B70A 1PL6A 2HJRA 2EEZA 3L77A 2BFMA 4HWKA 4J16A 4QQRA 1Z7BA 3GFGA 4OHUA 1DAPA 1XR3A 1B7GO 2JD1A 3ZWMA 1PJBA 2B4TO 1NX6A 1EK6A 1UJMA 2Y1EA 1K5HA 3OJEA 1F12A 4TROA 4FCCA 7MDHA 1KVRA 1JLLA 2JFHA 4WPGA 4XB2A 4AJIA 2GCGA 3SJ7A 1A9ZA 1DB3A 1N1EA 1MP0A 3WMXA 1EE9A 3WTCA 3PHGA 1T1RA 4CM6A 2Y99A 3MWEB 2OP1A 4KUHA 3F3SA 1DJNA 1X14A 3RUFA 5DCUA 3PK0A 2GR9A 5A9SA 3DONA 5F21A 1WWKA 2GPTA 1JKFA 1XEAA 3FSRA 5DP1A 3VZRA 3N74A 4XGIA 1NVTA 1I8TA 2AMFA 1CERA 2VWPA 1GUFA 4LCEA 4N18A 3FWNA 4IJUA 1ADGA 4GAEA 4NBRA 2RH4A 4BNHA 1R4NA 3W4KA 1LQUA 1GR0A 1OMOA 4DC0A 4J7CA 3TQHA 4IDCA 5JDCA 2PLAA 2VUUA 4OXKA 4BQPA 1WNTA 1WMBA 5TF4A 4EITA 4NPCA 2D1YA 3V8BA 1PGJA 2Y0EA 3WX0A 1ISMA 3EW7A 1B2LA 3C1OA 1UZMA 3P2YA 3VKUA 4NFYA 1QYCA 1TT5B 3EDMA 4JP3A 1C0LA 1IHYA 3LC2O 1YQGA 2ZB8A 4RO0A 4PVDA 3RVDA 3JQ9C 5AXDA 4J4BA 4LGVA 3ROMA 1NFFA 1C0KA 3RFTA 3ANLA 4BKPA 1YJQA 2BGKA 3BHIA 2GN4A 2NV6A 4GLOA 4X54A 2F00A 3LLVA 1YBAA 4RF3A 1HZJA 4BO0A 3MWDB 3JD2A 4DQVA 2G1UA 1MFZA 1FF9A 4AJHA 4NU6A 1TLTA 3TN7A 5AVOA 2W4QA 4H7PA 1ZJYA 3OETA 1R4NB 2CVQA 3SEFA 3RBVA 4Z9YA 4BNGA 1E7SA 1NFRA 2YHUA 4HP8A 3JQBC 4MP3A 3KYBA 1R16A 1U7HA 3L6DA 2SCUA 3AUSA 4K1LA 1FDUA 4Y6SA 4R16A 5HS4A 3DDNA 3JQBA 1TXGA 3WBBA 2D3TA 3ZH2A 5DCYA 1IUKA 2ZQYA 4Y9DA 1FDSA 2HU2A 1DOHA 5HA5A 3IDSA 4OAQA 4BV9A 3U09A 1LU9A 1Y8RB 4D79A 1XLTA 3Q1LA 3IOYA 3WGIA 1ORRA 4LN1A 4XYBA 2VTDA 5LCXA 1HLPA 1ZW1A 3BA1A 4ZGWA 5JAZA 3CE6A 3PIDA 4RVUA 3GZNB 2I3GA 4GSLA 1I36A 4J6FA 3NGXA 4QX6A 1E3SA 4XQGA 3OQBA 1N9GB 1P45A 1L7EA 4Z9XA 5HTOA 4IINA 2GSDA 2W8ZA 3KSUA 1E92A 2YZ7A 5G4KA 3AU9A 4FFNA 4XGNA 3TNLA 2WD8A 4GMFA 4HFNA 3WWZA 3OIDA 1IZ9A 3FD8A 3MJVA 4H3VA 4DA9A 3D3WA 1RJWA 3ON5A 5IJZA 1J4AA 3FN4A 1OZAA 5EJ2A 3GMDA 4LVUA 1VL8A 2GN9A 2X5OA 3PPIA 1B15A 1HSZA 3IUSA 3F5QA 1WZEA 1L1FA 3TZCA 4B4VA 4YVFA 2B36A 4F3YA 4CR7A 1NQ5A 5FI5A 3ICPA 3ONDA 3RFXA 4AJLA 2HMUA 3OBBA 4R01A 5IDYA 2QYSA 4QTZA 4E12A 3ZWBA 4DLBA 5F5NA 2PA3A 2AHRA 2AG5A 2C82A 5BSHA 4MOWA 2JL1A 3OSUA 5CFZA 2HKIA 3AU8A 3VOSA 4R4JA 4MJLA 1LDGA 4O59O 3ZWAA 4CR6A 3WGZA 3PXXA 4DPLA 4NJMB 4FGWA 1JVBA 5G4KB 3ZW8A 4YWJA 2VHXA 2XOXA 1DXYA 1SB8A 5A5EA 2CNBA 4JBGA 1BDBA 4ND1A 1O95A 2HQ1A 1SPXA 4LW8A 1NNUA 2JD0A 4R68A 3KEOA 4BVAA 5B4TA 4I8XA 1UZLA 1PJ4A 4U6QA 3U3XA 1ZMTA 4ALLA 4BV8A 4S1VA 3DHYA 4TRMA 1M2WA 4YRBA 1DC4A 4NZ9A 5A3VA 3NTOA 1BVUA 1OBFO 5DNAA 3JV7A 5ILGA 1ISHA 3K31A 4W9NC 2X8LA 3DZJA 1AE1A 4E0BA 1U1IA 3ZI0A 2Y0CA 3TOXA 5T57A 5G0WA 4BO5A 4L4XA 2D5CA 3U49A 4ND4A 1U4SA 2YW9A 3W4JA 5DF1A 3RJ9A 4D45A 4B8WA 5DP2A 1E1KA 5B12A 1Z74A 4UVGA 2A94A 5K6AC 4AJ1A 2DFDA 1LRKA 1D7OA 3CKYA 3PHIA 1XG5A 4MP8A 3SVTA 2P2SA 4R54A 4I08A 3F1LA 3H8VA 3AUTA 1IL0A 3GVCA 3JD1A 1HDXA 4DYDA 1MUUA 5JY1A 4MVJE 4CM9A 1KC3A 2QZZA 4K26A 5JMWA 3WR5A 1P44A 3OP4A 2YQ4A 3IAHA 4ROSA 4MDHA 1LDYA 4IJVA 4XEHA 4FBGA 1P1RA 1NR1A 1MX3A 3EUWA 4HFMA 1Z45A 3KOUA 3H9UA 4XWYA 2O3UA 3WGYA 4BNZA 4LRTB 4JJGA 1GD1O 1V35A 2I5PO 2J5RA 3ST7A 1YL6A 2G17A 4WEOA 4DTIA 4IDFA 4QSMA 2X0RA 1Y6JA 1KEUA 3JQGB 1XWFA 1KEPA 1WLYA 2CD9A 2NQTA 2O3QA 4NBWA 2DUWA 2Q1UA 5CHEA 4TRRA 1AUPA 2FSVA 3JQ8B 2FRDA 4JNKA 5DT9A 1E1NA 3PLNA 4R3WA 4YQYA 3TRIA 2HO5A 2P9CA 2QIOA 3ASVA 3A4VA 3H2ZA 3GZ4A 2IYOA 3ZU2A 3A1NA 1E1LA 4HBGA 2XF8A 3TZKA 4GBJA 4PFJA 1F0YA 3GPDG 4LVCA 2VRCA 1MXHA 2ZYAA 2B83A 3V2UA 1Q0HA 4MVJH 4GLLA 1E6UA 1X7GA 3F4BA 2YFQA 4JBHA 1ADCA 4Z6KA 2VZ0A 3HG7A 3H9JA 5MGBA 4KDFA 4BNXA 4D3FA 4TVOA 4IIUA 5JFOA 1NM5A 4Q3NA 3KTDA 3CINA 4FOOA 5TJHA 1X0XA 1EDOA 2OORA 2DBVO 3GVHA 5HBRA 4BNIA 2E49A 3BMNA 5CEEA 4TWRA 3QP9A 4WKGA 4BO4A 4YJHA 1O8CA 4Z3DA 1I3LA 4RF5A 1RKXA 4J7UA 5KJFA 4ZN6A 4A03A 1PEDA 3LC1O 1EVIA 3F4LA 3PLRA 3DBLA 4MVJF 2YYYA 3K5PA 4EUFA 4ITUA 3B1JA 2DBQA 1YO6A 1V0JA 3MCVA 5AXCA 4U0JA 3FBTA 2RHCA 1HKUA 1EEHA 2JAPA 3ADPA 2Z1MA 4YAKA 3NTQA 4PG6A 4KWHA 5TC4A 3BTUA 4TSKA 3KEQA 3PHJA 3RAJA 5IFLA 4A27A 5IN4A 5BSGA 3W1VA 1HYEA 4GX2A 3DAFA 4UVHA 2PTGA 3D5QA 3QVOA 2JCYA 2CFCA 3LDHA 2AA3A 3CH6A 1WZIA 2YUTA 5L51A 3DZIA 1M76A 2BHLA 3VDRA 3X2FA 1XELA 1YWGO 3PFWO 5F3RA 3AUUA 3DZBA 3GN2A 4MVJM 1CIVA 2C54A 2VRCD 3H7AA 3I9LA 4KQXA 3TDKA 2Q46A 1EDZA 1HTBA 2QQ5A 3KYDA 1UH5A 1Y9EA 5AOVA 3TSCA 4TZTA 2Q1SA 1IULA 5U1PA 3ETEA 4XZ3A 2PK3A 2TMGA 3I9JA 4HFRA 2VWQA 3KLMX 4IXTA 2W2LD 5DBGA 3HWRA 4U5QA 4E33A 1TA4A 1SEVA 3C1TA 1DHRA 4M55A 2P5UA 3FNFA 4XYMA 4Y6PA 1YRLA 5DCWA 4O5OA 4CM7A 3PYLA 4ZQEA 1UDAA 2OMEA 1UXKA 2FPPA 3GEDA 4B79A 5I9LA 4CODB 2O2YA 4IS2A 3DHNA 3KO8A 1QXSA 4CQMA 4CUJA 3QVSA 1PL8A 4RQUA 1I32A 2Y93A 4O0LA 3ZV5A 5IDQA 2ZTUA 3GGGA 3VPGA 4R9SA 1SMKA 3VVCA 3IS3A 5BNIA 1LEHA 5U9CA 3A06A 3QVXA 4RVGA 3AK4A 1EBFA 1PS9A 2WTBA 4CUKA 2X9VA 5KTKA 1K6IA 2EKLA 2DU8A 2GZ3A 3QWHA 4YAEA 4E4YA 4CM4B 2O7QA 4G81A 3D3WB 3G49A 1VL6A 4N5LA 4CL3A 1LDNA 2NUAA 1VRWA 2O3TA 5BNFA 4AL4A 4OQYA 1QORA 2JD2A 3JYOA 4CV1A 2V6BA 4R3NA 1LA2A 1YL5A 3JSAA 3ABIA 4IQGA 3DAGA 3H5AA 3LF2A 1H9AA 3JQ8A 1N8KA 3OA2A 4FJ1A 4UEJA 4W7IA 3RUHA 3H4VA 4Q9NA 3O4RA 1GY8A 1XCBA 2PD4A 4J1SA 2H5LA 3K30A 4ZRNA 4BHTA 2ZB4A 5ER6A 1BHSA 3WGQA 3STHA 4YJFB 1NXQA 4BB6A 3G1TA 4BGEA 4CQLA 4HY3A 2UUPA 1SC6A 4WE3A 4YXFA 1TB4A 3OQ1A 1ZNQO 1ISIA 4II3A 1NFQA 3L6EA 1KBZA 4Q3BA 3PHLA 3CMCO 5DOZA 3L6OO 3LT1A 1R66A 4JN6B 1M67A 1DC3A 4CMAA 3GG9A 1DFIA 4FSHA 5HRUA 2EP5A 1U28A 1DEHA 4DL9A 4ONEA 2FOIA 4RJTA 8LDHA 3K2EA 4E3ZA 2C0CA 1X13A 1NQAO 2P91A 4YDRA 5J23A 4BNKA 2NVUB 3E5MA 4R51A 3CIFA 1H6BA 1W73A 3QWFA 3UN1A 5CDYA 1GPJA 5CDUA 3JD3A 1OOEA 4RF2A 5G2OA 1IZ0A 1ZK0A 5TS3A 5C7IO 1NBOA 1TVEA 3ROPA 2P5YA 4D0RA 1ISFA 2DQ4A 4RV9A 5A02A 1TT5A 3ZWYA 4AJNA 4YTEA 3W4IA 3GDFA 1IY8A 1CETA 4PN3A 1P0CA 1R15A 4YA6A 5ADHA 1A7KA 1N7GA 3ETDA 3AOEC 3OJ0A 4CPDA 1YBVA 3OH8A 4YT4A 1G1AA 4FFPA 3RCBA 4GMGA 3LT4A 3IJPA 4DQUA 2Q49A 4J2HA 2BFAA 1ML3A 4PRLA 5T67A 4L74A 1ZSVA 4NI5A 3DMTA 3S2FA 4A5OA 3WYBA 2HAEA 4UUNA 3G0OA 4CM1A 4ND3A 1NWCA 3ZU4A 4EEZA 5EPOA 2JFGA 1N9GA 2A35A 4IZIA 2VYVD 1DIRA 1P74A 1PS0A 2AQHA 1U3VA 1RYEA 5DZSA 2CSUA 3OICA 5AXAA 4AFNA 4YEDA 2VUSA 4Q3CA 5BR7A 3MEQA 3PZRA 1H94A 3WJ7A 2O3JA 4DREA 1QYWA 5F1OA 2P68A 5TQVA 4YACA 4FN4A 5JBIA 4BNUA 1HL3A 2NSDA 4ZRMA 3BHMA 3K6JA 3MJTA 3UXYA 2AE1A 4J9VA 3ONFA 4R69A 2HUNA 2BKAA 1YKFA 4AJ2A 4PLZA 4BMSA 3UFXA 3ZNPA 4CMIB 4LK3A 4F45A 4CLXA 3SX2A 4FR5A 3S8MA 1WXDA 2TMDA 1G0NA 3VHRA 1UZNA 5KJ1A 3OA0A 4FIZA 2GD1O 4J1TA 4B7UA 2EW2A 4Z0HO 4EJMA 4CMIA 1KS9A 4EGFA 3VC7A 4EZBA 1YVEI 2HMTA 4Z0TA 2DPGA 4WLEA 3GDOA 2YDYA 2FPIA 4BNNA 1V9LA 1BXZA 3RIHA 4DC1A 4XQCA 2O50A 3RC7A 2Y05A 2HMWA 4ALJA 1DIGA 1HETA 3U9LA 1QYXA 3QVWA 1GQ2A 4PLYA 4E21A 4PLVA 3I9KA 4MVJA 2CVOA 2VWGA 4ALMA 1BW9A 2VOEA 4ZQGA 1Y1PA 1UP7A 2Y67A 3RFVA 2OL4A 3WGHA 2OFPA 3ZCXA 3QRWA 1G6KA 5ITWA 3ITKA 1QMGA 1ZIDA 4JJFA 3RU9A 1WDLA 3JYNA 5T5QA 1PJ2A 4WLNA 1UXHA 2PZKA 3PIIA 4J0FA 3GK3A 4WASA 4WUVA 1ENYA 3IL2A 3GY0A 2GERA 2OBYA 5CDGA 3WFIA 1GCOA 1LBEA 3E5RA 1YGYA 1EBUA 4W4TA 4PCVA 2BGMA 5GMOA 1DAOA 2DPHA 3WGOA 3H6KA 1PIWA 5JDIA 3TZQA 4YJHB 5EERA 4TMFA 1YOVB 3JYPA 3T4EA 3D4PA 2QHXA 1TI7A 2C5AA 5IZ4A 4A2CA 3SBOA 4PLCA 4P38A 1VE9A 1T4DA 1YL7A 2P9EA 4B7XA 1GYRA 5JC8A 3INRA 1I24A 4FS3A 1VJ1A 4WCDA 2NU8A 3C8MA 3IQDB 2P4QA 1X1EA 3EVTA 2XAAA 3BMCA 3BAZA 1HLDA 1SAYA 3E48A 3H2SA 4J1QA 4GQAA 3HFGA 4S3MA 1MGOA 1U8XX 3VZQA 3I83A 4NBTA 4EBFA 4E5NA 1UDBA 3LT0A 1FMCA 1QSGA 1PQWA 3MTGA 5IDXA 1TEHA 2NU6A 2E4AA 2B0JA 2HRBA 2JKVA 2BI8A 3RD5A 3IP1A 3JCZA 1E3IA 1M6WA 3I6QA 4CR8A 3I4FA 3OM9A 1B3BA 2P4HX 3PWKA 4D3SA 2X6TA 3CZMA 1H93A 2Q2WA 4J90A 4BOYA 2EV9A 1LJ8A 2ZCUA 1HDGO 3QQPA 4NBUA 4RPKA 3AUAA 4OM8A 3RBXA 3WOHA 4AJPA 1LLUA 3RU7A 5JW6A 1QP8A 3JQCA 1B16A 1K2WA 2OGUA 4M89A 4QO8A 1GU7A 2NVWA 3COSA 4E6PA 1YB4A 1LUAA 5A1TA 2VYVA 3QHAA 1HXHA 4CMEC 5THKA 3WGGA 3PDUA 4RL6A 2E82A 3GAFA 2F1KA 2C59A 3Q6IA 4WLOA 1X0VA 3BIOA 4RCVA 1LDBA 3PTZA 1U5AA 1ARZA 1PJTA 2DTDA 3BMOB 2FY8A 2VOJA 2CDCA 2PFGA 3V2GA 3AOEA 4RVDA 3GVXA 4ESOA 1M66A 4CL8A 2ZYGA 1CRWG 2JFFA 3C1AA 4XQEA 1C14A 4HKTA 1RM0A 4XD2A 1HDZA 5ES3A 4JJIA 1L7DA 2IDZA 3U5TA 2FMUA 5C7OO 5L4NA 5EQDA 1H2BA 5CDSA 4DXHA 4FGSA 2BH9A 2DC1A 5H82A 4WGGA 1PS8A 2NM0A 1UXJA 1ZJZA 4XYEA 4I5GA 4NNJA 1SOWA 3TL2A 4C7JA 2VN8A 3PWSA 3GR6A 1U4OA 2J3KA 4P4GA 4RVHA 3QIVA 1VKOA 4IQ0A 4U0KA 5JYDA 2X22A 1PL7A 5JMPA 4O63O 3AM5A 1A9YA 2X58A 2HCTA 3E1KA 1F06A 3GOHA 1SEPA 5ICSA 4IXWA 1I2BA 2ZTLA 1PU2A 1VJ0A 3C24A 1UP4A 1DLJA 1PGOA 2DLDA 3OJLA 2EWMA 5BT9A 4YRDA 4AG3A 4BIIA 2VT3A 3HN2A 3SJUA 3DEYX 3M1AA 1HT0A 2B5VA 5DN9A 4R5MA 5KVVA 1ZZEA 1XKQA 2WWRA 3RUEA 1ZCJA 1ZXBA 4ND2A 3IP3A 4L4SA 4NHEA 2VZ8A 3A14A 1GQQA 1PR9A 4FDAA 4XRRA 3DR3A 4DGSA 1EK5A 5JO0A 3AI3A 3WIDA 1GFSA 1MC4A 4PLTA 1PQUA 1OC2A 3GH3A 4XA8A 3RKUA 3ZU3A 1GZ4A 1C0IA 2W98A 3N7UA 3WG9A 3P7MA 4XGKA 5KJCA 4I5EA 1Y5RA 1A72A 7ADHA 5KVSA 4E30A 4G2NA 2A9FA 2X86A 3VTFA 4YB8A 3QE3A 3EHEA 1C0PA 4XCVA 2JCVA 2WEKA 3PJFA 2NACA 2O7SA 3RSHA 4RQTA 1SOVA 4KUGA 4BS9A 3GHHA 4AJEA 3ZWPA 4E5MA 4W99A 3AWDA 4IUYA 1HE2A 4HV4A 2VYNA 2J5QA 2NTNA 3OMLA 3AW9A 4J1NA 1ZBQA 1B26A 3NAQA 3WWYA 2X0IA 3EK2A 1UXGA 2EP7A 2GRAA 3FPCA 5IZCA 3RUDA 1F14A 4JQCA 4DIOA 4GSKA 2WSBA 4D7AA 4PLWA 3ADOA 1NASA 1IPFA 3GUCA 1D1TA 2W2KB 1EUZA 4CM5A 2Z5LA 4CMBA 5JAMA 5L95A 3HDJA 1AXEA 1ENPA 2YY7A 4JX8A 4JIGA 3U0BA 3BTVA 3NDRA 3ANMA 1KVTA 3F46A 1XA0A 2Q4EA 1DO8A 2EERA 4EJ0A 2W2LA 5I7FA 4Y98A 1ZMOA 2EIHA 5LDGA 3W8FA 1HDOA 4Y8VA 4ZVVA 2WD7B 2Y1DA 1DJQA 2CVZA 4J2OA 4L73A 3UKOA 2J3JA 1RYDA 4HUJA 4TZKA 2Q2VA 4INAA 4UAGA 5A05A 3PYMA 1H0KA 3FPLA 4MPDA 4BNYA 5L7TA 1E5QA 4D43A 2HSDA 5G0SA 4L0QA 3VH1A 1R0SA 1S6YA 1PGQA 3H3JA 1HE5A 5TIIA 5G0UA 3LYLA 4A10A 2PV7A 2JAHA 1EVJA 1ZK1A 2WMDA 4HXYA 3BTOA 3I6IA 4NR0A 4QEDA 1XDWA 3WNQA 3WXBA 4GX1A 3CPSA 4M87A 3HB4X 1Y8QA 4LISA 2C5EA 5I9MA 3TPCA 3MOIA 2AW5A 1P3DA 1MG0A 3C7DB 3FNGA 3IIEA 1OC4A 2DT5A 4MINA 4OMUA 1P1KA 5KVQA 1NHWA 4DMLA 3F1KA 4OOEA 5FYDA 2YV3A 4BNLA 2PKQO 2V65A 3JQFA 3U4CA 1YB1A 4I5DA 2B69A 4KZPA 5L7WA 2G5CA 1MC5A 2VYND 3Q3CA 1HDCA 1XU9A 4IDEA 2Y1CA 3RC1A 5GY7A 3ZU5A 4AVYA 2WYWA 3D5TA 1JA9A 3ZZNA 2HMSA 3ZV6A 2WE7A 5AQ1A 1T4BA 3GGOA 1LDEA 4CM9D 5I7EA 3U4HA 4YAGA 3GLQA 4XDZA 2FR8A 5TLSA 2VHZA 3GPIA 1QV6A 3LU1A 5IXSA 2HLPA 3H9QA 5JPIA 1A7AA 5KNLA 2B35A 2Y66A 1QYDA 2GUGA 3ZWNA 4W82A 4NDNE 4PG5A 4YJGA 1CQJA 4EUEA 5T8KC 3S55A 3R1IA 3DZGA 3EC7A 1MB4A 3E8XA 2IODA 4R41A 3RQSA 3A9WA 3O8QB 5JNLA 4BQRA 2OZPA 1YBMA 4XR4A 5BSEA 1ULSA 3DZKA 5JCJD 1YDEA 3V1YA 5JDIC 2BI7A 3WSVA 4J3FA 2BD0A 4ZQFA 9LDBA 2D8AA 1Z73A 3AI1A 5GZ3A 3QSGA 5LC1A 2D2IA 3DWFA 5IXYA 5JE8A 3P19A 2ZKLA 2CZCA 3PEFA 3WBFA 1VKNA 2B37A 2AE2A 5CG2A 1CYDA 3E9NA 3OEWA 4LRSB 3JYQA 4RZHA 5CPBA 1OI7A 1I3NA 1H6AA 1U3WA 4P4NA 1A71A 4IDBA 5A04A 1GAEO 3INGA 3JTMA 3SC6A 1BMDA 1O89A 3N58A 3GN1A 2POQX 3S2IA 1Q7CA 2ZK7A 4I9HA 4RZIA 2VHWA 1I0ZA 2YJZA 3I9OA 2ZJ0A 4RPLA 3KSDO 2FSSA 3VPSA 1EVYA 2NTJA 5JYEA 4KOAA 3S1LA 4FD3A 4TKMA 2IEDA 3CUKA 4MKXA 5BSFA 2OXIA 2W2KA 5TRTA 4RGBA 3V1UA 1KY5A 3GA0A 1NAHA 3QVTA 4LSMA 4NG5A 4AJJA 3G3EA 4XDYA 2ILTA 1DFGA 3WICA 3KV3O 1P1FA 2D0IA 2UYYA 4NMHA 2OUIA 4U7WA 1LX6A 2EG9A 3PVZA 3AY3A 4K6CA 3VPHA 3DXFA 2WYVA 3GT0A 3QWBA 2IXAA 5BNTA 1U7TA 1PJ3A 3Q2IA 2EF1A 1P31A 2ZYDA 1QV7A 1MG5A 2Q3EA 4CV3A 4G65A 5CDTA 1B0AA 1MLDA 4Z9FA 3ZWVA 4DLAA 3DO5A 3CSDA 1UAYA 4CLOA 2V6FA 4DRYA 2R6JA 1T2CA 1ID1A 3K8ZA 3VTZA 4L75A 3WJAA 1BSVA 1VPDA 3S2EA 1N5DA 4QUKA 3Q2KA 2ZB7A 4CM3A 1S7CA 2YQ5A 4J91A 3AY6A 1GCUA 8ADHA 1IPEA 1Y8QB 4GX5A 4O1MA 4CQMB 1K6JA 4XYGA 3PQFA 1T1SA 4BO8A 4DVJA 4HNHA 4IZHA 3WQSB 3EY4A 3AOGA 4FFRA 2RH8A 4E5KA 1CDOA 1SNYA 1Q2XA 3UCXA 1O6ZA 4JBIA 2Y1GA 5CEJA 2FN7A 4MO2A 4DIFA 2O23A 2X9GA 1SCUA 3BMOA 4UREA 4XX0A 4CLEA 5A5FA 1ZEJA 3LC7O 2H1SA 3DTTA 3BMQB 5CP8A 3KYDB 1BWSA 4IPTA 5A03A 3INTA 3NX4A 1H2HA 4R1UA 3UOGA 2CDBA 4CMGA 1DIBA 1PGNA 3FBGA 2DM6A 4WNCA 3ORFA 5EQFA 4Q39A 3DBHB 2PZLA 1R4MB 2X23A 3OF2A 5EINA 4R9RA 2NU9A 4B8ZA 4NU5A 4QFDA 4FFMA 2PGLA 4YJFA 3QV1A 3O38A 3OIFA 1AN9A 4LMRA 4NJOA 2Y1FA 2RHRA 5L4SA 2PZJA 4XJTA 1H9BA 1Q1NA 3VH3A 2EGHA 4YAJA 4CMCA 1NYTA 1JAXA 3UH1A 5F1KA 1DDOA 1HEUA 3KUXA 5JS6A 2X5JO 1E0DA 2GO1A 4K9DA 4B4UA 3JQ9A 2AQKA 1BXGA 3IUPA 1R37A 3QJ5A 4OSOA 4QO7A 1JW9B 5FF9A 4XR9A 4UVDA 2YV1A 4Q3EA 4I9UA 3VPFA 1BG6A 4JXKA 3M2TA 3BMCB 4ID9A 3E82A 2ET6A 4C7KA 2J6IA 4PG4A 1EFKA 2UVDA 2CDAA 3GHYA 2CF6A 3GNTA 3TZ6A 1UXIA 4P4LA 3VZSA 3ZNOA 3PJDA 2PGJA 4E13A 1HE3A 4WEQA 4XRGA 5IG2A 2NQ8A 2VUTA 1P1HA 1KVQA 3ETGA 1P1JA 1IYZA 4YBZA 3CTMA 5EIOA 2D59A 4A7PA 1KVSA 5KKCA 1X1TA 3ANNA 1KC1A 2IXBA 4ZQHA 1YJ8A 2B4QA 1H5QA 3T7EA 1VJTA 3I52A 1SBYA 4EDFA 3HE3A 4M86A 4YJGB 3LK7A 1T2DA 4CQMD 1BDMA 2JHGA 1Z75A 2Z95A 3L9XA 1AHIA 3RKRA 4JROA 1I2ZA 5COBA 1ISGA 4E2XA 5ER9A 1O9BA 1F8FA 2Y1OA 1BRMA 2IRWA 2VZ9A 4UUOA 3RASA 4OJNA 2R2GA 4I9NA 1PX0A 2DUUA 1JWBB 1R0LA 3IC5A 3MZ0A 1NTOA 1I10A 2QRJA 2VHVA 4WLFA 2W90A 4ZD6A 5GZ1A 1DFHA 1MFPA 2X1HA 3KM0A 5CPFA 1HYGA 1YXMA 4LSWA 3OJOA 1Y8RA 1V3UA 4Q3AA 2VQ3A 4BO2A 3TFQA 4CQLB 2QX7A 4WLUA 3JQAD 3ZWWA 3MOGA 2JJYA 3ZHYA 3PJEA 1ADBA 3DB2A 3HDHA 4KUEA 3HZZA 2ZTVA 4BL5A 5IDWA 3LZ6A 4BMVA 1GQYA 1HWYA 2ZJ1A 2G0TA 4L76A 4II2A 3NT5A 2XPCA 4C4OA 1YQDA 4UVIA 2OP0A 2J3IA 4PZEA 4URFA 1DC5A 1JDJA 5AXBA 1T2AA 2RIRA 4CLOB 3V1TC 1AGNA 3DBRA 4WK6A 3GF4A 1N92A 1U3UA 4FQ8A 4UULA 1W8DA 2OOSA 3KXDA 3TOZA 4F6CA 3B1FA 3I3OA 5T8KA 3GVIA 3ZWXA 5EESA 1V3VA 2V6GA 4NBVA 4Z3KA 5A06A 1BXGB 1A5ZA 1W4ZA 2FHSA 1EE2A 5CEFA 4D0SA 4OKIA 4BO3A 1PZHA 3EMKA 3BZUA 3PGXA 4IMPA 3ZNQA 5C5IA 2GF2A 1F17A 1CEQA 2UV8A 1XQ6A 5I7SA 1D3AA 3NUGA 2J5KA 1M6HA 1B8VA 3K92A 2NU7A 5L7YA 3O8QA 4M54A 3GFBA 3HQ4O 1UR5A 3VH2A 2PKQP 4WNIA 4DPKA 2H6EA 2X7HA 3C3XA 2AG8A 1CQIA 4DMMA 3T7CA 1E7RA 4NK4A 4CMHA 3DTYA 1D1SA 3GC6A 5L53A 3CMMA 4IMRA 2E37A 1XSEA 1HDYA 1Y81A 5JLAA 4A0SA 2IZ0A 4E32A 2RBEA 1NP3A 3PRJA 1LRLA 4N5MA 1GADO 1C1DB 1XYGA 2G82A 2FPGA 1LSOA 1UP6A 2WYUA 3GUYA 6LDHA 3NJ4A 3PJGA 4IGFA 4OIMA 5FWNA 4XYLA 5G0VA 5DBFA 4NH4A 2H63A 4ZHSA 1EQUA 1GEEA 1CJCA 1DBVO 1FDTA 1P0FA 2PH3A 3DMTC 1UAGA 3H65A 3I23A 3B20A 4R1NA 4K6FA 4BNWA 2R00C 1GYPA 1GV1A 2BLLA 1E7WA 5IF3A 2OHXA 1FK8A 4UEOA 1PR3A 3KSZO 1J0XO 2I76A 3AY7A 4OO3A 4TKLA 2I99A 1RM5A 2C20A 3L0DA 3S2GA 2EKPA 3K9QO 1F8GA 4FC6A 4M49A 1EMDA 4FC7A 1N1GA 1ZEMA 1HSOA 1Y9AA 4D44A 4YYZA 3PZBA 4GGOA 3NYWA 1H6DA 3LVFO 5L45A 1U5CA 2YHIA 3SC4A 2PWZA 2AEMA 4E5YA 4EEXA 1T25A 4PRKA 2QZ9A 4OL9A 2PH5A 3UF0A 1DHTA 1WMAA 2VWHA 4TRJA 3WB9A 3AI2A 3JQAB 2BFPA 3UHAA 1V8BA 3JQ6A 5L40A 4GGPA 2GN8A 2WD7A 3JQEA 4MVJD 2Q2QA 1XU7A 3ZN2A 1A27A 4BNJA 1D4FA 4GWGA 3AJRA 3JYLA 2C2YA 4NJMA 1B14A 3HNPA 3M1LA 2AEJA 1E5LA 4PLPA 3D3EA 1I3MA 3H5RA 3M2PA 2O4CA 2O48X 4BMNA 1R4MA 2DVMA 1ZH8A 1LQTA 2A4KA 3WS7A 3ZHBA 4J4TA 4CLDA 3PDJA 3ZWCA 5ITVA 1I01A 2GNAA 3LT2A 4Y6RA 4BO9A 3M6IA 4GX0A 4M1QA 4QFCA 5ILOA 3D4NA 5JAIA 4U6SA 5EL0A 5IAAA 1QLHA 1ZK4A 3K73O 2X5KO 4RDIA 1Z6ZA 2EW8A 1XHLA 6ADHA 5KJ6A 4FFLA 4CMKA 3ICCA 4CM8A 3ZV4A 4IDGA 5T64A 3FR8A 2NVUA 4BUCA 1Y5MA 5H81A 3WSWA 3D0OA 3DBRB 1AHHA 1LDMA 4N7RA 1NWHA 1BVRA 4HX5A 3WYEA 1DRWA 4JP2A 4IM7A 3A28A 2IE0A 1DC6A 3FTNA 4MIEA 5COQA 2GZ2A 1A4UA 3FWZA 5F1PA 1E7MA 1PZGA 1E6WA 4CUZA 4E31A 5B4VA 1JQBA 4RF4A 1VL0A 3HJAA 3L4BA 3PHHA 1LSUA 1HRDA 5TT1A 4BGVA 1EUDA 4UVEA 5JSFA 3DZHA 3X2EA 3WMWA 5L9AA 1X7HA 3ONEA 3E03A 3OQ6A 4QXMA 5JCXA 3H5NA 4AJKA 4BB5A 3QWAA 3H9GA 2RAFA 5TT0A 3WTBA 1U9JA 3BXXA 4RDHA 1SO8A 3F5SA 5EMHA 3DOOA 4EYEA 2PD3A 5CG1A 2ZATA 3TL3A 4BNFA 1NHGA 1CF2O 1FDVA
chains in the Genus database with same CATH superfamily
4HB2A 3DKPA 3CF4G 4FCVA 3CZ5A 1SCUB 3E58A 3D7SA 1RCFA 2IT1A 3PI7A 4IJQA 4D42A 4C6TA 5LFAA 2OXRA 4WK2B 4DSZA 4DLZA 4CCSA 4DE5A 4CIYA 1YQXA 3RTBA 4F1WA 6REQB 4JLOA 3SQNA 1XXHA 1I9GA 3GRKA 3JQ7A 1XRRA 1KEEA 1N9ZA 4K2AA 2FQXA 3FVRA 1SZJG 1X94A 2X0JA 4CF5A 4RBNA 3MJSA 2MSCB 3IAS1 1QB7A 1IN4A 4FX5A 5AYVA 1A4RA 4MQ4A 4LWOA 5GQSA 1P6QA 1QM5A 1EGMB 4CW7A 3O7WA 1F48A 3M1YA 4HD8A 3V2HA 2H4ZA 1J0EA 2Z6UA 3DEKA 2OK8A 3FOAA 2P5SA 4IH4A 3X1YA 5LIRA 1Y98A 4BQSA 4TPKA 2H59A 4F1KA 4NNOA 3QPVA 3SN6A 2EZ8A 4IJWA 3E7WA 2FGKA 1O7JA 2I4TA 1OKKA 4LZZA 4TVKA 1B1CA 3FKJA 2PMDA 4NRDA 3SLKA 3TQQA 5HXAA 4PC6A 5LQCA 3HI4A 1ORDA 1E9EA 1DQNA 1PEKE 4D8YA 3BX1A 2H1WA 2AJLI 4X5OA 1AMOA 4GWKA 2XTZA 2B2CA 3Q7IA 5C1BA 5JXWA 3PEWA 1CBUA 5DZSA 1M1YB 2QGFA 3W2HA 3SXJA 2HYIC 5K3CA 4JV5B 1NMQA 1VM6A 2DWCA 3O4GA 1CK4A 4B6SA 3VQTA 4DSUA 4TTRA 3I3SR 5EHNA 2CBZA 5TQ2B 2ZT7A 2V7PA 3RBZA 3RVOA 1U7ZA 3L8DA 4F4JA 2Q6TA 1N2SA 1PG2A 4EG4A 3V5NA 3N75A 1KYQA 1EFPA 4L78A 2Q4OA 4HVTA 4DV5B 5KSOA 1HYBA 4IIHA 4RQAA 4H60A 2CE7A 4U63A 2PZ8A 4ARAA 4BB0A 4D3ZA 3F3MA 1XVAA 2GJ8A 1GVHA 2C78A 4JQYA 1TD9A 3BSWA 4E2ZA 4XD7A 5TSDA 4DM3A 5CFQA 4FQ5A 1RWNA 1J23A 3Q40A 2JFVA 2R00A 2V0CA 4RK5A 4BE9A 1K8RA 4GE0A 4J0QA 3EQ7A 4P08A 4D9NA 2Q9CA 4OXIA 3DQPA 1WPQA 5B64A 5BYAA 4KI7A 3GRCA 3R8XA 1RXYA 4GG1A 5CB6A 2AJDA 1MRSA 4N54A 5A4DA 5FB3A 1ZR4A 3DMRA 1QC5B 1FPMA 1Z12A 2JK1A 3AHIA 4GSYA 3U37A 2ZUUA 4ZEOA 1SCAA 2J9GA 1Y6FA 1RE1A 1Q11A 4P7FA 1W88A 2EJWA 1F5NA 3AVPA 4TQGA 5GONF 3A4YA 5B1YA 4KJZA 3K1AA 1E1DA 3IUBA 1IK6A 1GDDA 4HAXA 1FYFA 4KQWA 1F3OA 4WX2B 3WKAA 4BKUA 1GYQA 5CURA 5AI9A 2D5IA 2P0YA 3BDVA 2Z04A 1JIUA 2QMYA 1OX4B 2Q4BA 2Z2ZA 3KAQA 3QKIA 4G4SP 4BFZA 5KB3A 1D5WA 4HSEA 5JI2E 3UJDA 2QRPA 4MRPA 1C8BA 3PGA1 5G0TA 1ZIXA 3T4XA 5FWDA 4RU1A 4F3NA 3FI9A 1F6WA 2HBZA 3HGTA 3HABA 2ZU0C 3P2EA 5KTNA 4HWTA 3AVTA 1OUMA 4TV9B 5AKJA 3B3QA 3K2BA 2PRSA 1PI3A 4K9NA 4MYTA 3O95A 5MFPA 1JDPA 5AJHA 5HUJA 4JMLA 2OD7A 1WVMA 2YMLA 3GFRA 5F73A 4UARA 4PZCA 3W3ZB 3ZDYB 2AL7A 1HGXA 5EJ9A 3DDCA 5JZSA 4JVLA 2QTAA 4NLLA 3CNHA 1BE6A 2RHGB 2YNMD 1LSJA 2IY7A 1X7DA 1MIOA 1H3EA 3X1ZA 1ENZA 4D4IA 3FDZA 4KZKA 1FUKA 5AM4A 2GLXA 3I2IA 5F5XA 5K0ZA 4KXXA 4IVRA 3N2NA 1NQXA 3NHSA 4R1TA 421PA 1NVGA 3A6JA 1ISSA 2N42A 5A3JA 2MSKA 3NHBA 4INZA 4DA6A 4BVGA 5EHXA 1X80B 4C87A 2I4IA 5KQLA 1XA3A 3WQRA 3W7VA 3VAZA 1R6DA 2V6MA 1CY1A 3MIZA 2XIQA 4MRSA 4JWTA 4X1YA 1ABBA 1GGVA 3X44A 3D31A 3O9VA 5DYYA 3H4IA 4UDNA 3HYNA 5FTKA 3T41A 1SVIA 3CW2A 2ZZNA 1JYSA 3GQVA 2YINC 1D4AA 4K6GA 2BGLA 2XECA 4IQ8A 3KALA 5EMNA 4BX8A 2ZRIA 3Q6MA 3G2OA 8GPBA 1R6TA 3CN7A 1UMBA 2HDHA 4UPVA 4W9NA 5EIWA 4MDFA 2CMGA 3MPUA 2D3WA 1T9BA 3OUTA 1J1UA 3J7AC 2H4HA 3C3BA 4LYYA 1ONOA 4EP1A 1ADJA 1SG0A 4YCAA 3NFRA 5J2TB 5BVGB 2FVXA 4GVXA 4NV1A 1MTOA 5T3YA 2YFHA 5BMVB 4N3NA 4X8OA 5CLGA 5AW3A 4AUEA 1CR6A 2FR1A 2P7IA 3FPBA 4H1TA 4IGEA 1XBTA 3NETA 4JBYA 4Y3UA 2RHWA 3DMGA 4CFZA 1E8DA 2VHUA 1NNI1 5IJXA 4D1YA 1CZOA 2RARA 5TQJA 4R8RA 3V4ZA 3P9IA 3EYAA 4WZBE 1AO0A 4GKJB 1W4RA 4H1VA 4Z0PA 1FUEA 1B8PA 3GEGA 2WU0A 1WB5A 1II8A 3NRCA 3QVMA 3ZIAD 1KZYC 4HJRA 3U7GA 5DISB 2IU0A 5B5SA 1RYZA 3HFSA 5DSZA 2PBZA 3BMNB 6Q21A 4CU2A 2PD6A 1QH1A 2E5FA 3LHFA 3NTXA 3G68A 4MWCA 2EGGA 3A7EA 1T3GA 3PT9A 4KIUA 4JJ6A 3GV0A 1J1ZA 3BXEA 4W6ZA 4XIYA 4W5RA 2XKKA 3UZUA 2WA2A 3PVCA 1P29A 1NN5A 2DKNA 5K9ZA 4CETA 3SHQA 1J97A 4S1PA 4BLUA 5HF5A 4RK6A 2B61A 3H0CA 5HJ5A 6ABPA 1E89A 3OO0A 3ER9A 3U31A 1E3MA 1JR2A 2NTYC 4IOJA 3D7LA 3LUHA 1POXA 4Z7JA 4A0HA 1QGDA 4HX2A 1JTEA 4IIVA 4RZUA 1Z82A 5E6SB 1L8QA 2A7XA 4PGFA 4X60A 4GYYA 1TZ2A 3OPMA 1CUAA 1RBMA 4MEBA 5DOVA 1K5GA 2RDMA 3IEKA 4R8SA 5SZKB 3U62A 1REQA 1UBHS 1ONPA 2DFNA 2BTOA 3GLRA 1BJRE 4CT5A 2JGDA 2Y92A 3IHTA 4JB8A 2IV7A 4KXVA 8ATCA 4RTRA 4AS1A 4WACA 4I1SA 2DTXA 2BH2A 1CVIA 4YMVA 1DINA 3CLKA 2ZPTX 4HADA 4AZTA 5DIZA 1KPHA 2NZVG 2J8ZA 3DB1A 4R2LA 3W1EA 5DLQC 3QXXA 3O8RA 3EUEA 2ZB3A 4KO4S 5IJ0A 1T0UA 2I2WA 2RGYA 1C8VB 3OOYA 2BM8A 4N5NA 4V0ME 3I5MA 3F6YA 4I1YA 4AN4A 2ZDQA 3ZDFA 4KJXA 4ZO4A 4RJJA 3VR4A 1SU8A 3ND9A 3V1KA 1YH3A 5MF6A 2X7JA 4QFMA 4BQEA 1QF7A 1NQTA 2C83A 1CE8B 3D4LA 3L93A 3QY9A 4HYQA 4HZUB 4BEJA 2IV3A 4CL2A 4EGAA 1HC7A 1Z4KA 3PNLA 2C58A 1XZHA 3UICA 4RD0A 1E2GA 2XYGA 4B3DA 1WXEA 3GDGA 4F5EA 2AG6A 2ZI5A 2A67A 2GYWA 3B3AA 4F5DA 3EPJA 3G0DA 3NIFB 4M9CA 4OBWA 4XX1A 5IK2A 2ESRA 1YMUA 3D8HA 3E81A 3GPCA 1NVMB 4YRSA 2J9XB 1CUUA 1WBBA 3CXRA 1W85B 2WP8J 4H9GA 2H7VA 4B81A 4ZV7A 4HEQA 5DTMA 3SE0A 1BA3A 2H7YA 2J0SA 4ZQBA 3WA7A 2YOFA 4N41A 2QW1A 3E23A 5AK5A 2IPAB 4RPGA 1E63A 4XOUA 4F2DA 4DYVA 1E2EA 3ETCA 3UJPA 4LMPA 1XMJA 3VBEA 3PFNA 4EZEA 4C3UA 3V2IA 1I4LD 4EAQA 4DKXA 3FFXA 3I72A 3IDOA 3GMSA 3VVBA 2QLMA 3DMYA 4H1UA 4YDSA 1LWNA 5EIBD 3WLKX 5AVRA 2BEWB 2J9ZB 4LTDA 1CZUA 5KNCH 3HFRA 1X15A 1QKIA 1SQGA 3OT5A 2YZMA 5KO2A 1Z0UA 4EIWA 3KFXA 3NNDA 1F60A 4XSGA 2NVBA 1NF2A 3KPJA 4MXDA 2C2ZA 4TVSA 5J1SB 1VHJA 2OILA 2OCYC 3GXOA 3MT0A 2NT4A 4KVZA 2YS6A 2C84A 3Q7EA 2XSZD 3IGFA 2ILVA 3LYUA 3OECA 4D5EA 1P77A 4OGLA 1K3UB 1AKWA 4YH1A 2OO7A 3NZEA 4HAVA 3WISA 2JAXA 4FB4A 2H16A 4AB1A 3EXHB 4L15A 3CVUA 1YR1A 3CS3A 1OVMA 5JXHA 5AUPB 4RAQA 4PG8A 1PTJC 2IUUA 2CEAA 1SHJA 1HYHA 3FNIA 5KCZA 5F2OA 1ZH4A 1Y6GA 2DPMA 2TMYA 3H1PA 3PF9A 4IY1A 3K2QA 5JOQA 3FRJA 5HEKA 2BELA 2G72A 3EVDA 4WGFA 2IHNA 3CPHA 1G9SA 3G2LA 5JQGF 4NMMA 4KP7A 5B37A 2WIJA 5TMEA 5LDHA 1HZZC 4JI1B 1LRJA 4X6LA 5IM5A 4B80A 4J4HA 4E03A 3VO9A 1DGQA 1E98A 1YZVA 2OHFA 4DCSA 2O52A 2OXTA 2CZQA 5AI8A 3A58B 1YVUA 1QK4A 2VT2A 4LFBB 3IJRA 1MDFA 4AUKA 2EFYA 3K09A 3BF8A 1A5TA 4WKOA 1GZ7A 2O2SA 4A23A 1IIRA 1UDRA 4MGZR 4POAA 4Q1AA 3VH4A 2AMJA 1Z26A 1VPLA 2FPWA 3C3DA 4R3UC 4ARSA 4JXZA 1HZZA 5JAHA 3O91A 5DTRA 1OAKA 1Z56C 2AJBA 4P3OA 5FAXA 3DH0A 1YOVA 1M0SA 3KZCA 4X1KB 2J9YB 4MB0A 3KQKA 4DQKA 1QRRA 2IXDA 1WDMA 3R7SA 3Q3IA 2ADMA 4UD2A 5IVIA 3RVKA 3Q5DA 2CNWD 1KNXA 1CY2A 3L07A 4GYJA 1AZWA 2PY6A 3ILSA 2HHAA 3QF4A 4ZZ0A 3ZW9A 4JKOA 5CTAA 1OYWA 3FUCA 2PAFA 2YJ4A 4N39A 3FCSB 4JDUA 5F64A 3FPAA 5JAQA 3T0IA 5DI9A 3V8RA 4ENVA 4YV0A 4ZU3A 3PGJA 1L5GB 5EN4A 3BGVA 1FSZA 2QL6A 4PSCA 1XQ1A 4Q4AB 1GGEA 1Q0LA 2AF3C 1BYIA 2P9GA 4NBKA 2F3UA 4QE3A 2AX4A 2XDQA 3EAGA 3RANA 4JXXA 4QVGA 4UE2A 1UM9A 2PR2A 2BFOA 2I65A 3L1IA 1QHIA 3BTSA 4CKEA 3VVMA 2ZIZA 2XXJA 4L4RA 1V9SA 1VPWA 1YNOA 2XIJA 3Q3EA 3LXMA 4BKRA 3BULA 3MJ4A 4KFSA 3SAJA 5A9RA 1LTHR 1XRLA 1KK3A 2X8JA 3T4PA 1N0IA 1EVEA 4K9LA 3EA5A 3ER6A 1DE0A 1TZKA 1COZA 3WK5A 5DHUA 3SF8B 2CLHB 3TS1A 5I7VA 1Z7GA 4B85A 3TAXA 1QHFA 2V98A 4YP0A 2NADA 3WADA 1JJVA 2GZSA 4YQFA 1LC3A 3IIKA 3N39C 3T8YA 3BRWA 1VIYA 2WV7A 1COWD 3DMPA 1I3KA 2QN1A 5KYVA 2VF2A 4ILKA 2CJWB 4C9BA 4YMTA 1BWQA 1GZHB 4WY5A 1BTOA 1AF4A 4G5GA 4MPRA 2Q45A 4PEVA 4ZAYA 2I66A 4FFBB 4DQXA 3AL0C 2G67A 1L8AA 1XHEA 4PC1A 3GGPA 4WCFB 4WJZA 4PG7A 4XIJA 4TV8A 1RM4A 2O5RA 2PVSA 1QYVA 1IB6A 4DNPA 4EHDA 2R8EA 3FBWA 1GFZA 4FWBA 1XPRA 2OO5A 2C2XA 2OVBA 3LWZA 4BO6A 1U1DA 4GL4A 2WIBA 5COAA 1CQWA 2PHZA 3AB7A 3G02A 5BPFA 1EJBA 1O94A 3LQFA 2BTQA 2H5JA 2B8TA 2SHKA 2WG2A 3OC0A 3Q9UA 3ZHTA 1N2ZA 3PUZA 1Y3DE 4OA5A 3WDKA 1I5EA 3QM1A 1C7QA 3ONWA 4JGGA 1XNJA 5HWSA 1HQYE 3QYAA 1GDHA 2Q1TA 4BXOB 3DFZA 3VR2A 3EZLA 1TYAE 4AO8A 2OK7A 3F7NA 1BXKA 1RYHA 1G42A 2W6JD 4ZJYA 3RK1A 1PGPA 1JN0A 2FP4A 3VV3A 2ODPA 3E3LA 1FXSA 1JP7A 2HM7A 1KEKA 3MCAA 2RK4A 5DFAA 2Z56A 2OYSA 2JIMA 5IJ9A 1SIOA 1JHYA 1Z16A 3LGAA 1E3QA 1KH3A 1VG1A 1XROA 3IAAA 3GLHB 3U4IA 2Q99A 4LUCA 2E87A 1QP7A 1IEQA 3E9DA 2WJWA 1Q3KA 3HBJA 4CCYA 3PGLA 3QMWA 4E4TA 4LRYA 3BK2A 3FRIA 1S1CA 4TL6A 1MV8A 2WTEA 2H18A 2V5AA 3JS5A 5AM3A 1K7CA 3NV9A 4NS1A 1NP7A 3SX4A 1QDEA 4QLAA 4ED9A 4YHHB 3SNKA 4JU8A 3Q8WA 2L69A 4C0WA 5TGZA 2PVCA 4J9UE 1T6ZA 4P9NA 4OHMA 4R05A 3UW3A 4ILEA 2QG4A 3GH1A 1S9DA 1X1BA 3VZCA 3OVMA 3AI7A 4HFJA 5K0LA 3DL7A 4DA8A 1U7PA 5GOTA 3KNZA 1OLUB 2ZR8A 3ZG6A 3ADBA 1C30B 1FFGA 3HUEA 3I2KA 3U6BA 2PNFA 2GAJA 4X7BA 2UVQA 4LV8B 2E85A 1SB9A 2AZMA 3IT0A 3JRXA 5ICMA 2AXNA 5D6NA 4DR3B 1GKUB 4Q1FA 4TV9A 3DFKA 1JIIA 2Q4DA 3ESXA 2V74B 3HC7A 4HZIA 4EJ6A 4YRNA 1RI1A 4WZBB 2Q1WA 1E2FA 3ZHXA 1Q57A 5TJ9A 4RKQA 3ITDA 2IU6A 1TM5E 1RW4A 5CLHA 1YQ9A 1GNLA 2FMXA 3Q9NA 1NQOA 4U2FA 4IHJF 1AA6A 3KQWA 2XXAA 3AEUB 3JR7A 1Y80A 1NDHA 2BMVA 2CBXA 3JAKA 1KKMA 4IRMA 1GRQA 1K89A 4B3JA 1IM2A 1AS3A 1KFJB 2H4WA 4NK5A 1K6XA 2PYIA 1N4AA 2B82A 4ESHA 2DQKA 1JHZA 4WY2A 4ALNA 2AFVA 5JLJA 1N4DA 2JF0A 2ERCA 3LFUA 1T6BY 4L4UA 4HWKA 1SD1A 2CLDX 2YNMA 2G4LA 3CIOA 3ECCA 1RJDA 1OBHA 1Z7BA 4DJFC 1CP3A 3M6FA 5D7NA 1C1YA 3E53A 3S1AA 5A7FA 1YOBA 1SRRA 4IAOA 3ZWMA 5CX1A 5IAKA 2YJGA 1EK6A 1KJWA 3KB2A 4JB0A 3P9YA 5ALSA 2G5TA 2VVTA 3OJEA 4D74A 2P69A 3LUCA 3O0TA 7MDHA 2JFHA 4XB2A 2JGNA 2GCGA 2VUHB 1TRKA 3SJ7A 1N1EA 1MP0A 2FFQA 3AP2A 4JIMA 4RFSB 4TL8A 3VJMA 5I7RA 3OQOA 2O5CA 1ZY2A 1TU3A 3MWEB 8AT1A 4ZYXA 3NBYC 3HA7A 2AOWA 4ZC8A 3U4AA 1DJNA 5JS7A 1X14A 1MORA 1VOTA 3OM1A 4MJ7A 3ZZ0A 3DONA 4YMLA 2WMOB 4LOLA 2ZE8A 2GPTA 1JKFA 4HO1X 4R84A 1HY3A 1V2HE 4LF8B 3N74A 4XGIA 2Y0BA 4UAJA 4O4HF 1I8TA 3QFTA 4C76A 1VQ1A 3DQQA 1GUFA 2WJVA 4JL6A 4LCEA 4N18A 3TCKA 1XD8A 3NIWA 5DI3B 2VNHA 3X1MA 4LQ4A 3AFGA 4W5HA 2O06A 4YCNA 2WMYA 4GAEA 1SBHA 2F59A 4PV7A 4XUDA 4RS4A 5EE1A 3KKQA 4RD6A 2HA7A 2V7TA 5FORA 3KSAC 1W2WB 4J7CA 3TQHA 2R6CA 3IR7A 1AK9A 5JDCA 1R4AA 1FP7A 1WMBA 2V9PA 3N0XA 1U0FA 1UBFA 1PGJA 3TYXA 1KI4A 4ETIA 2OBLA 1HQDA 3DXXA 3INYA 5F2EA 4AY2A 1B2LA 1EZ1A 1IAVA 3TPZA 3S2ZA 3V4LA 1QAOA 1NKSA 3S68A 1C50A 2R6DA 3GZTB 2P7HA 1ZL2A 2IOHA 1IHYA 5G41A 5DGXA 3LC2O 3DZDA 2G83A 2PG3A 1G21E 3AEQB 2OD9A 4I46A 4PVDA 4A1FA 2GJSA 4J4BA 1X80A 1TPYA 2V7QA 1BMQA 3L7AA 1XVIA 1C0KA 4DRXA 4KI0A 4PYQA 1VHDA 4BKPA 1NXOA 3BREA 4KXUA 2XUOA 2H85A 5KYWA 1D2CA 2ZUEA 1J9ZA 4GLOA 1LQ2A 4NCAA 2NT3A 2ZJ4A 2P2GA 3MNFA 1PSWA 3VU9B 2P62A 2QORA 2G1UA 1ABFA 1MOSA 2KPOA 4OPMA 3EVAA 4K81B 4YONB 3WZLA 5JFGA 4I4NA 1JG1A 3G85A 4PFSA 4HTFA 4MJXA 2FEWB 3HB7A 1TTHA 4PANA 4MVXA 1FU8A 4Z4HA 3FX2A 1R1DA 4OSEA 2YXPX 4C3VA 2DUMA 1OT5A 1IK4A 2XZTA 4N01A 3VR3D 1FDRA 4QRDA 5DM60 1D09A 2IPXA 4A9AA 3EG9B 2HDNB 1WR8A 1UJ2A 4H08A 4G0UA 1AJEA 3RRMA 1FDUA 3ADDA 3JVIA 5HS4A 3JQBA 2RB5A 1PR1A 3A4MA 1D4OA 4CNBA 4OUKX 1WKCA 2D3TA 5DCYA 4YMSA 1B93A 1IUKA 1UOQA 2ZQYA 2NO0A 1FDSA 4AP9A 1R6BX 1AQNA 5HA5A 4BV9A 2FDCA 3U09A 1MR3F 3U40A 3HV2A 3IDZA 1XLTA 2PX8A 3D6FA 4XSHA 3CM0A 4Y2XA 2FRVA 2VTDA 1S2MA 2JZOA 4I36A 4YUXA 3NNSA 4UMVA 2OLJA 2BEWA 4RVUA 4J6FA 3AR3A 3NGXA 4QX6A 1E3SA 1F0PA 3AO0B 4XQGA 4HNVA 3K6SB 1N9GB 4WNAA 2RH5A 4V0LA 1LZLA 4QBTA 4MQEB 2CYCA 3RFFA 1S5PA 2E55A 4WDRA 4E09A 3QFRA 3KSUA 5H9VA 4M1SA 2YZ7A 5G4KA 3SGLA 4OHPA 3GLTA 4QRHA 4NESA 3OIDA 4ERXA 3K0KA 3MJVA 3TW4A 4DA9A 3U0VA 3ON5A 1E1YA 1RU3A 1J4AA 1VBMA 2IIQA 3ZJ4A 2XE8A 3RHTA 3EIFA 5DNEA 4V0SA 1P2SA 2X5OA 1UBMS 4QOGA 3STUA 1HSZA 4NYJR 3UHJA 4B6PA 4BX9A 1WZEA 2ZYWX 1R0WA 1PG0A 4F3YA 2R62A 3GEHA 2ZB2A 1WVIA 1H0RA 1Z39A 2R8BA 3ICPA 4XPIB 2O14A 1C7RA 1LPBB 2HRDA 3LBYA 3OBBA 4AKEA 3EMVA 5CVUA 5DX8A 5IDYA 4E12A 1VBFA 5DSXA 4M0DA 2QLBA 4J0HA 4DLBA 2B1RA 2K7ZA 3CBQA 3NXSA 5CB4A 2PA3A 2PS0A 2AG5A 1XMVA 3AYZB 3WB2A 5K3OA 3T54A 4L3VA 2C82A 2PX3A 4XWKA 1VIDA 5T6MA 5CFZA 4RLQA 5DTEA 5FPKA 4FZRA 4DNOA 4BAGA 4DDMA 3ZBUA 3MMXA 3O4JA 5FJJA 3GYBA 3EGXB 4LXXA 1Z6AA 2YVLA 3E9RA 4NBNA 2GJKA 2IKSA 4CR6A 3PQCA 4DPLA 2XQIA 1DP4A 4PQFA 1JQLB 4X92A 3T6KA 1JKXA 1QU3A 3FCUB 1JVBA 2L18A 3GIDA 4H0FA 4ZU1X 1DQRA 3LQ1A 4MEAA 4BTEA 2VDWA 5A5EA 2VHXA 1CNFA 2CNBA 1RHUA 2AKYA 4JI6B 3DE0X 1LBSA 1O6CA 3ANTA 2JD0A 3MFQA 1WXQA 4HI0E 2YWCA 1DTSA 4U6QA 3K16A 2RK6A 4TRMA 4UBNA 3SHOA 1KWKA 3H0KA 3KZOA 4OU5A 2Y1KA 3NTOA 1Q20A 3C3PA 3JV7A 3P52A 5ILGA 4MS3A 4EHAA 1ISHA 2SKCA 4Q00A 3K31A 4W9NC 1KQNA 4PXSA 1TMOA 1U1IA 2O8VA 5G0WA 2AOXA 4LXYA 3WGMA 2BTEA 1RS0A 1Y6RA 3U49A 1U4SA 2YW9A 3T7DA 1T0IA 3A2LA 3W4JA 3KKPA 1VZ3A 1PLKA 4ZJZA 4S1TA 4RA9B 4XCQA 1CJBA 1IHDA 1TVKB 1YNSA 4ISCA 3UUEA 5B12A 1W49A 2ZR7A 3AR8A 1AGRA 3H9BA 3UM9A 1YFLA 1Z34A 3HMQA 2CZGA 3HXQA 2A94A 2ZJAA 4N7JA 2WWGA 3ELYA 3OQJA 7AT1A 2ZDGA 4RFVA 4KRFA 1T0BA 1D7OA 3A1EA 3CKYA 4K6KA 4WZAA 2WJZB 2X0FA 3VOBA 4XWOA 3DMFA 3T3OA 1OLOA 2ZRGA 3ZYCA 4R54A 5CX4A 3F1LA 1H1DA 4BYMA 3H8VA 2KLBA 3GVCA 2C2BA 1PDVA 5J4HA 2FLVA 1L5OA 3KPVA 3CKKA 3D7MA 4IDPA 5GINE 1K06A 4BZWA 4CM9A 3MWJA 2WAXA 2II6A 1DUSA 5KYWB 3RARA 2XA2A 1UC5B 3OX3A 4CQJA 3WR5A 2ZTHA 1DWOA 3AHFA 3IT3A 1Y6QA 1QIMA 2WG1A 2CVPA 3OP4A 1VG9B 4HWPA 4EA9A 3C8DA 3TKAA 3FUXA 1SJ9A 5I01A 2UYGA 3EDYA 4MUMA 3RSOA 5JNUA 3EUWA 3I2GA 3E35A 3IBSA 1XCOA 1YZYA 4XWYA 4MICA 3WGYA 4MWGA 4A0RA 2WZBA 1GD1O 4EI8A 2Z58A 2I5PO 3ST7A 4C5AA 3I0NA 2G1AA 3Q6NA 2H7XA 5AW4A 4AS2A 2OWEA 4MV1A 5TF0A 2V3WA 1LVGA 1PR5A 1CUFA 4DDUA 1GTG1 3MQ2A 1OREA 4IOLA 1L4HA 4A82A 1Y7HA 5J3JA 1WLYA 1JRLA 2GILA 1ORVA 2JIZD 3A4TA 5JTTA 1B00A 5LBTA 2DKFA 2Q1UA 1X39A 4NS4A 4ZVPA 5HJ2A 4JNKA 1Y8ZA 2HK6A 4HX9A 2FDRA 3AERB 1PYDA 1QVVA 1FTWA 1ZUIA 3L8CA 5ALDA 2Q3MA 1C9KA 5BUCA 2BFBA 3FPKA 4XOIA 1E1LA 1PNTA 5HCIA 5I7AA 5LP1A 2XF8A 5E6UB 3ZX4A 3C0KA 3RR2A 3KOWA 3OFJA 1ITZA 5EWMA 1TYBE 4DHEA 1A98A 4PFJA 1F0YA 5JQGB 4FMPA 3V1LA 1SVOA 4LJ7A 1CEEA 1G2PA 1Q0HA 4GLLA 1E6UA 3AY0A 1R8YA 3AETA 2OFOA 2RB4A 1NM5C 2IWHA 3TQFA 3BJMA 3TLGA 1H2FA 2R8ZA 4BE7B 1TYDE 4MR9B 4PZUA 4RHEA 4X8LA 4PSUA 2JJQA 2JIBA 1RWMA 1U98A 3DXZA 3AEXA 4Q3NA 3TLYA 3CINA 1XCPA 1GNPA 1LPMA 3M9WA 1XQYA 4FOOA 2OCKA 4HAUA 1EDOA 4PU0A 2HRRA 4R1QA 1Q83A 3T1HB 3CUYA 2FMIA 2P2DA 1OI2A 1WUIS 3ITEA 4XVHA 3TG8A 3DJFA 4YN3A 3OIYA 4GL2A 3K32A 2FFAA 3PXCX 4RF5A 3I5YA 1YUBA 2H9YA 1GTJ1 5KJFA 3BMXA 2AI3A 3LC1O 4N0PA 4V0QA 1JLHA 3T9EA 3PLRA 5BR8B 4R8KA 3K5PA 4IGAA 3A6DA 1SQ5A 4IGIA 3JZIA 4ITUA 4MV0A 4Z49A 4ISBA 3C5HA 2XXAB 1OA1A 2B3TA 5AXCA 2RHCA 4ZO6A 1IN6A 2QRZA 3L79A 2XUJA 4JLAA 4QYSA 4ML3A 2Z1MA 4G1FA 4PRYA 4KWHA 4DUZB 1VRCA 3RGGA 3VAAA 3K5HA 4Q7JB 4Z4IA 2A1UA 2FOXA 5GJVC 1QZTA 1HYEA 5IBPA 3LGXA 3W1VA 3U16A 1P4AA 2PTGA 5D00A 3D5QA 3QVOA 4LY0A 4L8LA 2V4ZA 2CFCA 5C1OA 3BL8A 1CY0A 3NHRA 2QVYX 5IMSA 1AQJA 2QXTA 1WZIA 2YUTA 5L51A 1SC4A 1XELA 4ETMA 1EGAA 4WKPA 1N34B 3RYIB 1U65A 1ILEA 2A0UA 2ZGVA 1YWGO 3AR5A 5F3RA 4TWJA 2QD3A 2PUHA 2IYEA 4HVAA 4IHJB 1CIVA 2V7GA 3I9LA 3ND8A 4INPA 3TDKA 2Q46A 1EDZA 2R8RA 2VDVE 2G9QA 2V97A 2RH9B 2XQKA 3KYDA 3R2JA 4LJYA 4DCJA 2D6FA 3ODPA 4D8WA 3TSCA 3O74A 3KHTA 3F8WA 4TL9A 4GKKB 1IULA 2QLTA 1RXIA 3LXRA 4B3XA 3ETEA 2PK3A 2ZWMA 3PFBA 2IXFA 2CXUA 2VWQA 4IXTA 3GMTA 1X9IA 2WJ3A 1S3IA 5HFAA 1TA4A 3M81A 3VR3A 4NYIQ 1RI2A 2YJ3A 3FNFA 3GDWA 1QNLA 4DV4B 3B1WA 3EFBA 5JH7B 4ZQEA 5IUKC 4NVRA 2FPPA 2P9HA 5I9LA 3NOOA 2UXCB 4HDRB 5KINB 1UC8A 1GARA 2HC9A 1S96A 3N59A 3OUUA 1AS2A 1PHPA 1U0LA 2Y93A 4R2WA 3S81A 4O0LA 2XMPA 2PSDA 2QPOA 3GGGA 3GBVA 1CUXA 4GZ6A 2KSQA 3PD7A 4R9SA 5J5VA 3S1AB 1I1OA 5ALUA 1ODTC 2RGEA 4A8JC 4AKTA 1LEHA 3MBKA 3A06A 3O82A 5HGJA 1W1IA 3SS7X 2PH7A 4HG2A 4RVGA 5I48A 2WTBA 5CT6A 3NV7A 2X8JB 3OLVA 5GIPE 2PIDA 3KWJA 2EKLA 5IUNC 2ZRMA 2DU8A 4BMCA 3RJTA 4WAUA 4XJXA 4FMBB 4JR2A 3U44A 2ZJ5A 2CLSA 2ISQA 3VC3A 2NUAA 2VPYA 5BNFA 1JJ7A 3JAKB 1TW3A 1N2BA 2BFBB 5HOQA 3AVWA 1V7ZA 3K09C 4JUDX 1L4BA 1DUIA 1UFRA 4LJ5A 4R3NA 1LA2A 2V8OA 3ABIA 2R7LA 3CF6R 2QZ4A 3QG1A 2R84A 4A36A 2E4UA 3EDRA 3CX3A 4WZBA 5K0EA 4HDNB 3DFFA 2W6ID 1N8KA 1N3BA 1Q44A 3EC2A 5E38A 1J42A 3RUHA 3GLIE 2A57A 2I8LA 3O4RA 1GY8A 1XCBA 4BEVA 5F78A 2FAXA 4TKZA 1RHQA 4ZRNA 4ZZ1A 5FBHA 1TJ3A 2Z30A 4L0DA 3I8XA 4MGYR 1NXQA 1SHUX 3HB1A 3STHA 3AF2A 4HNAB 4HY3A 3EE6A 4CQLA 5JEEA 4PBSA 5A0TA 4WE3A 1N8NA 2P3QA 4P80A 3LNTA 5I5GA 4W9RA 1ISIA 5IC6A 1JIKA 3S8YA 1J9EA 3L6EA 2PKWA 3W3AH 3DZ8A 2FFRA 1ZD2P 4Q3BA 1M1NA 2W2VA 3CMCO 3LQYA 5DOZA 3L6OO 5FWYA 5AHRA 2V7EA 1SIBE 4D9MA 3LFTA 3PKIA 1F8XA 1QS0B 1VCHA 3GG9A 2G9NA 2YXDA 1J0BA 3WHPA 2ZIUB 4JC5A 2H4XA 4Q4AA 1DEHA 2X3UA 1CTQA 1R50A 2PDAA 2NUTA 2FOIA 1KMMA 1SXJD 3V4PB 1AKYA 4MQLA 3DOIA 2FQQA 2C0QA 1QO7A 1W2GA 1V45E 2WYOA 2QN9A 4DGQA 5J23A 1RWOA 4LVOA 2IH2A 3UT5A 3ZEAA 2WWXA 2ZUCA 1A2OA 1CULC 3YASA 4B7AA 3CIFA 4RS3A 4JBWA 5BV8A 5I45A 2HT6A 3T3HA 1NJ1A 1M83A 5CDYA 3U1VA 3BPSA 3K70B 2HPHA 4MR7B 5CDUA 2JLZA 1GUBA 1P81A 3JD3A 2DXIA 3HTXA 1IZ0A 1UK6A 3ZCPA 5KYTA 1FPQA 3W5JA 3I45A 3ZDDA 5C7IO 1VJ5A 3L0PA 1KU0A 2QMOA 4MW7A 1ZICA 1SXQA 1D9XA 1ECCA 2P5YA 4HQ6A 2RD2A 4ZIRB 1ISFA 1U6IA 1Z28A 3ERCA 5A02A 5LYYA 3OG9A 3OAAD 4S05A 3W4IA 1IY8A 1KDYA 1OI4A 3GXBA 5ADHA 2GESA 3KFVA 3BC1A 3OJ0A 4JSRA 5BN3B 3VTKA 1CRQA 1G1AA 3DP7A 4TV8B 3WYFA 4X65B 3C6KA 3FCAA 3IJPA 3O4VA 1UFQA 2Q49A 2ZFUA 5EXPA 3WAKA 1ML3A 4PRLA 4TWIA 4DQUA 5HKKA 3TN7A 2M6SA 1BS2A 3MUFA 1ZOOA 4L74A 2VPIA 3C2QA 1OWNA 1VJRA 1QRSA 1QU2A 1M0WA 1A9PA 1AUXA 4UUNA 4R1MA 4EEZA 1QH8A 5EPOA 1XZBA 2F9MA 2QE7D 3KJQA 4U9UA 5A4FS 5AW2A 4KR7A 3PB3A 1NG1A 2O7VA 4BRZA 4OXRA 2O2JA 4LF6B 1DIRA 3HU2A 1RLOA 5DV9A 4X41A 1ZISA 4WQMA 4YFVA 1SZCA 3KJHA 3IFSA 2CSUA 1O8BA 3D8BA 2YJ6A 1CY8A 1QIGA 2C9CA 1WQ3A 4MUKA 3UC5A 4X1IB 4AFNA 2WSSD 4YEDA 2VUSA 1ZU5A 4Q3CA 1RQGA 5E4YA 3DTVA 2VYFA 3PZRA 5AHWA 3WMRA 5DNDA 5F1OA 3WLRA 2A9OA 1K92A 5JQWA 3EXIA 3L3BA 3Q5EA 3FAZA 1FMFA 2EFCB 521PA 3RU2A 3ZX5A 1RFGE 4XM1A 3D7KA 2QLNA 4ZEWA 5BQ3A 4UBLA 2Q5JA 4R69A 5TVGA 3L1UA 3RK4A 2HUNA 3MG9A 2BKAA 4YP7A 3WMEA 3CUWA 2HCFA 2LCQA 4C4TA 3OM8A 1T2NA 4PLZA 4F84A 1OFVA 3UFXA 2CXOA 5EP2A 2JASA 4LK3A 4RNDB 4E7PA 4TYQA 5HHTA 5FUQA 3KZMA 4EHJA 3D81A 1NNEA 4GI5A 3TIIA 2IYNA 1WPRA 1WPGA 4KO1S 4OQQA 3ND7A 1KMNA 4DLUA 4X94A 3UMSA 2RE8A 2GDJA 2XQGA 4I14A 2GD1O 3KVRA 1O6FA 2ZWOA 1H0HA 1ZIYA 3NJRA 4J1TA 4B7UA 5EJ8A 1AGXA 1FNSA 5CTJA 4BLVA 5HZMA 3BE5A 1E2PA 3IQIX 3OJWA 3W9BA 4B48A 4BVEA 4EYGA 3LFHA 4EZBA 3P0RA 4EGJA 3IBFA 2M32A 4MAMA 2YDYA 1UKAA 1RRCA 4KMMA 2RGNA 5LQKA 3RIHA 4DC1A 3OOJA 1L5VA 4RADA 1A9SA 3ZDBA 3CLTC 4M8LA 1E58A 3RS3A 1PR4A 5HJEA 2GX6A 2VXBA 4GQBA 5IULC 2NP6A 2PFKA 3PNPA 3QVWA 2NYAA 3CZPA 1DXOA 3LP8A 2BDEA 3KAJA 4M9RA 1THTA 4PSAA 4QTUB 3JARA 3MCZA 1XO1A 3JQPA 1GG8A 2XUAA 2BFDB 5EP4A 2PMCA 3EOAI 1BW9A 4ZQGA 3AFHA 1Y1PA 1UP7A 3WQBA 2WKRA 2HFJA 2VF8A 3ZCXA 5BNWA 2WKQA 4HDSB 1H42A 1QMGA 1OZ0A 1JDBC 3DS8A 3U13A 3RU9A 1A7JA 3L7NA 5T5QA 1XXLA 2EDCA 4Q9IA 5T41A 2QM8A 3WK7A 3GD7A 4G0YA 2WJ6A 3CEHA 2QW0X 4GYKA 4WUVA 3IL2A 5M29A 3SQWA 1JILA 2GERA 5CDGA 3NM4A 1O95C 3SP1A 1OD6A 2QQ0A 3CLUD 4W4TA 5AD1A 2BM1A 4HYYA 1XX6A 4PGAA 3KPYA 3NBZC 2GNPA 4PCVA 3WHLA 4AQYB 4S0ZA 2IS1A 1KOFA 5GMOA 1M7HA 1PEAA 4O8CA 5JDIA 3SKXA 4HDQB 5EERA 4TMFA 3P0EA 5LL6P 3EG5A 2PXCA 4LKOA 2J0QA 2QHXA 2KS6A 1NF8A 4G0OA 1NU8A 2WQ7A 1J56A 4PLCA 4S1NA 4K03A 4S24A 4ZREA 1VE9A 1AMUA 3M9XA 1TUIA 1CYEA 1Q0RA 5FTWA 5B2EA 4B7XA 4YUWA 3KEFA 1KAOA 1N5MA 4H4CA 5JC8A 2ATCA 4REQA 1M54A 3I05A 4KNVA 2FZKA 2NU8A 1H1TA 1EWKA 3B5JA 1CQJB 1GT91 3C8MA 4LDQA 3LLCA 5EE3A 1TK3A 1XJQA 3EVTA 1OXBB 2XAAA 5C4IA 4S3MA 1ABEA 3QMMA 4Y2UA 1E2QA 1MGOA 2N0SA 5M7EA 2HB6A 1U8XX 3IEXA 2QVGA 5AKLA 3VYWA 3OPYI 2JKYA 3ACDA 4Y6LA 1O54A 1PT6A 3T7JA 2HA5A 5IDXA 1B6SA 4BMZA 1B6RA 1TEHA 3E3NA 4KYVA 1WD5A 1XZJA 3GWGA 2HRBA 3EZ6A 2BI8A 3I6MA 3NTUA 4O2AF 4OIFA 1FLDA 4QOEA 2BEUA 2EG5A 3K0EA 4ZARA 4WTOA 1RVV1 3U3MA 2B2NA 4KO8A 2PXHA 2PL5A 3ZWKA 1C7ZA 3BERA 1WA5A 1X86B 4YMWA 3GRRA 1H93A 4BMDA 4C7XA 4ER5A 5KQMA 1H4SA 3PCTA 4ZGBA 4RPKA 2G25A 3WYDA 2OKCA 3AR7A 4AJPA 4HN2A 1LLUA 1E94E 2QSYA 1AK2A 5JW6A 1K2WA 3NALA 3SIRA 2RAPA 4W5JA 3U39A 1YR2A 1NLMA 2NVWA 3COSA 4ENQA 5A1TA 3UG7A 1Z6TA 2VYVA 2UZ1B 4YIKA 3C7TA 3UJBA 3UMGA 3UJ9A 5D3QA 3W2TA 2J09A 3F3YA 2GXQA 3MS7A 1CZLA 2R1ZA 3HRIA 1X0VA 4WLOA 3DOUA 4V0NA 2H4JA 3BIJA 1T9HA 5BUZA 3F2IA 4EPXA