3NJAA

The crystal structure of the pas domain of a ggdef family protein from chromobacterium violaceum atcc 12472.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
GIGSWVLHMESGRLEWSQAVHDIFGTDSATFDATEDAYFQRVHPDDRARVRRELDRHVLGDRPFDVEYRIVRPDGQVRELLERNHIQRQASGQVDHLWGTVIDMTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GGDEF family protein
publication title The crystal structure of the PAS domain of a GGDEF family protein from Chromobacterium violaceum ATCC 12472.
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 20
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.100 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3njaA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3njaA01
1GSWA 1OTEA 2J80A 1D06A 4LLOB 2PYPA 2VV7A 3F1OB 2M1CA 3HJKA 3B33A 3LI9A 1XJ6A 2VV8A 4EERA 3E4QA 2OOLA 1OTBA 1S4SA 2PR6A 2Z6DA 2V1AA 1GSXA 1T19A 1LL8A 1MZUA 5IU1A 1OJGA 4HOIA 3F1PB 2WKQA 2OWHA 3NHQA 1UGUA 2WKPA 4GHIA 4BBVA 3T50A 5HD3A 3C8CA 2EA9A 5F5YA 5DJUA 4R6LA 4GHIB 5G4ZA 4MN6A 3K3DA 3VOLA 3LIDA 1S67L 4NXBA 3P7NA 3BY8A 2OWJA 2QHKA 3ICYA 3C2WA 2P7JA 4EESA 2QWSA 2VLGA 2KX6A 2W27A 2D02A 3KX0X 1DP8A 4H6JA 2V0UA 2PDRA 4I5SA 3LICA 4JGQA 3H7WA 4EQ1A 1OJ5A 5F68A 3F1NA 4H6JB 5EFWA 3UMDA 4GCZA 3RH8B 1LT0A 1VB6A 3K3CA 1WA9A 4LRXC 3F1NB 4BBUA 3VE4A 1V9ZA 1DP9A 1JNUA 3E4PA 2BASA 1BYWA 4WLAA 4BBTA 4MN5A 1N9OA 4EW7A 1XJ2A 4L9FA 3F1OA 1N9LA 3MJQA 2PD8A 1NWZA 2JN7A 3BY9A 3NOPC 4PKYG 2ZOIA 5J3WA 3CLOA 3D72A 4HI4A 2VV6A 4KUOA 3F1PA 2K7SA 1S4RA 3IS2B 3EWKA 4I3AA 2KDKA 4NXGA 1P0ZA 1ODVA 5F6AA 1XFNA 4HJ4A 1OTAA 2PYRA 3VE3A 2B02A 3EEHA 4L9EA 1LSWA 1S1YA 5HWTA 4RQ9A 4R38A 4XT2B 1OTDA 4DJ3A 3MR0A 4HJ3A 1G28A 3UMEA 1F98A 4E04A 4I38A 4GW9A 5HD5A 2L1MA 1DP6A 3LI8A 3NOUC 4WF0A 5DJTA 1LSVA 3LIAA 4HP9A 3G6OA 4HIAA 4LPZA 1S66L 2I9VA 3OLOA 4YWZA 1TS8A 4HQAA 4HY8A 4I39A 5DKLA 3H9WA 2QKPA 1V9YA 5J4EA 2W0NA 3GECA 1T1AA 5G4YA 4KUKA 2A24B 2Z6CA 3LYXA 2ZOHA 4HHDA 4NXEA 3GDIA 4WUJA 3A0VA 4EEUA 4R3AA 2L0WA 2L4RA 2INWA 3UB6A 3ULFA 1P97A 2V0WA 2H28A 4HNBA 3RTYA 3MQOA 2VEAA 4JGRA 2JHEA 4EXOA 3ZQ5A 4EEPA 2ZBBA 1EW0A 4HJ6A 3HJIA 4PKYA 4JGOA 4HH3A 1KOUA 4WN5A 3IS2A 1DRMA 4WL9A 3SW1A 3CAXA 3A0SA 4NXFA 5J7EA 3E4OA 2HV1A 3LUQA 2PD7A 4HH2A 3NOTC 1OT6A 3LIBA 4JGPA 1LSXA 3NJAA 5HWWA 3UB9A 2V9AA 4KQDA 1TS6A 4XT2A 3PYPA 3IBRA 4I3JA 5F69A 4HP4A 4I3IA 2GJ3A 3UB8A 1XJ4A 1XJ3A 3FG8A 2R78A 5KIZA 3UE6A 1OT9A 4LRYC 4B9OA 4LRZE 2YKFA 1T18A 3PHYA 1GSVA 3MXQA 5AVFA 5DKKA 4F3LA 3MFXA 2PHYA 1S1ZA 4L9GA 5HSQA 1Y28A 1T1CA 4F3LB 1D7EA 1T1BA 2A24A 2QJ5A 2V1BA 4R70A 3UB7A 4DJ2A 5HZHA 2PR5A 3A0RA 3CWFA 1TS0A 4EETB 1UWPX 5TBMA 1TS7A 3LIFA 2QJ7A 1N9NA 5A8BA 5IS1A 3LIEA 5HDCA 5TBMB 3MQQA 2YKHA 5HDDA 3BWLA 3H82A 3H7WB 1OTIA 5HWVA 2D01A 5AVEA 1F9IA 2WKRA 1UWNX 3H82B 4GS9A 5HDSA 5I5LA 3FC7A 4M4XA 4K08A 4GS9B 1X0OA 2CMNA 1XFQA
chains in the Genus database with same CATH superfamily
1SS2A 1MPLA 1GSWA 2X02A 4Y5FA 1XGJA 1K0KA 2J80A 4OQIA 1Z09A 4PAUA 2PYPA 1NLZA 3B33A 1KVLA 2DNSA 2JE5A 3LI9A 3MFDA 3C7VA 3IF6B 5CGXA 2Z6DA 5DFXA 3M2KA 3PBTA 1MKMA 1K56A 3A3IA 1MZUA 4JKTA 3HLEA 3NCKA 3IXDA 2CG7A 4DE3A 1ZKJA 2JRAA 3F1PB 3SH7A 2OWHA 1ERMA 3NHQA 2ZYCA 3A3JA 3AGDA 2BLSA 3LEZA 1ESIA 2EFXA 1H0MA 4ZAMA 3HCYA 3C8CA 5F5YA 2HDUA 4R6LA 4GHIB 5G4ZA 4KKDA 2RL3A 3VOYA 5A92A 2JBFA 3C7UA 5JYPA 4GDNA 2IWBA 1E88A 3P7NA 3AGFA 4FH4A 3BY8A 1CKLA 1YT4A 2JKTM 4UEYA 4HBUA 4X53A 2QHKA 3W2ZA 3M7PA 4KZ4A 3A3DA 5HAPA 4EESA 2P7JA 5DTSA 1NY0A 3IF6C 4QHCA 3ZNYA 2ZQ7A 2VZWA 2KRIA 4AYMA 1SRZA 3LR0A 5FAPA 4ZJ3A 2D02A 2DMWA 2VGLS 3LICA 3QHYA 1P9WA 1ZC2A 2J9OA 3T4QA 2BTFP 4WEJA 3MKFA 1FILA 5F68A 2W3FA 4H6JB 2HDQA 4BQMA 5EVEA 3CPTB 3T1XA 2QZ6A 4LRXC 5HYTB 3F1NB 5TFQA 1MWTA 2C6WB 2XRNA 3VE4A 3FKVA 1C3BA 1JNUA 3E4PA 5FQQA 4Z1WA 4BBTA 3UO9A 3G32A 4X56A 5DVAA 5M1AA 1BSGA 4Y0OA 2Y2QA 4MBFA 2Y8HA 1H2PP 4R23A 3KO6A 2ZL1B 3T4LA 3PAEA 1TDGA 1CI9A 3NOPC 3ZLDA 2O9CA 1NZUA 2CC1A 3PAGA 5DN5A 4WMCD 1YLZA 4FH2A 1VETA 1NLYA 2K7SA 1HTZA 1S4RA 3IS2B 1NRJA 3WS4A 4NXGA 4O7DA 3T5OA 1O07A 4LGWA 3N4IA 1XFNA 4IBRA 4UQIS 1L0GA 4D2OA 3B3XA 2J8YA 2H10A 2B02A 1IYPA 3FZCA 3MSHA 2RCXA 1YLYA 4G3VA 4WMCA 2OAQ1 4RQ9A 4R38A 4LFUA 3MR0A 1G28A 4GW9A 2L1MA 1QO6A 3G34A 5FAQA 4CSYA 3T4TA 5C5KA 3MQLA 3G6OA 5IHVA 4IGDA 2NUTC 4R3BA 1ES5A 1S66L 2I9VA 4ID4A 3CI6A 3C4OA 3E0YA 4YWZA 2G7IA 1PRQA 1GCEA 2WKIA 3QNBA 2WYXA 5EECA 3V50A 4GB7A 2WZZA 1IKGA 1T1AA 3N6IA 3FKWA 2J3TD 5EUAA 4DE2A 2A24B 3NY4A 1PI5A 3WS1A 2ZM8A 4N1XA 1BLSA 2CG6A 3OEDC 2W1TB 5GLDA 5FEGA 4JPMA 4WUJA 4DJZA 4WZ4A 3MQ0A 4D60A 2R9WA 4JF6A 1BTLA 1QGBA 2H28A 4U0TA 4U3TA 5EVLA 2JHEA 2XA7M 2V8EA 1BT5A 2ZBBA 1G6AA 3K2NA 3O88A 4LV3A 1VEUA 3NBLA 2PU4A 1KOUA 3PXPA 3VMAA 2W3DA 4GJ4A 1XPBA 1Q3XA 3W4PA 4KZ9A 5A91A 1FSWA 3LR4A 2Y8RA 4EBLA 4K0WA 2IWCA 4NXFA 5D3OA 1O9AA 4JXSA 1HFIA 2WKHA 2HV1A 4MEZA 5FEFA 4ETXA 1YMXA 5JYOA 2GNXA 3OCNA 3ZG0A 3LIBA 2YBYA 2EX9A 3HBRA 3DTKA 1LSXA 3NJAA 2W3GA 5HWWA 2X01A 3VP4A 1MY8A 2W3EA 1TS6A 1XA1A 4XT2A 4XXRA 3PYPA 2EWWA 1YLWA 3LY3A 3EGDC 1MWRA 5EM0A 3ITAA 1NWVA 2XRBA 4ZJ2A 5EVIA 1XJ4A 1IFQA 1XJ3A 4HEFA 1Z6FA 3B47A 2HPBA 3HLDA 1EI5A 4WM9A 4ZH1D 3ERBA 1U5MA 2YKFA 4DE0A 3UB5P 3ZFZA 4NG2A 1GSVA 2DCFA 3EEAA 3OPRA 4F3LA 4Y0TA 1S1ZA 1Z92B 3GV9A 4L9GA 5HSQA 3SZTA 1OJVA 4BD1A 1T1BA 4O8GA 3V67A 3B42A 4JXVA 2PAVP 4EUZA 1KDSA 4OPZA 2X71A 3UB7A 3ZNTA 4DJ2A 5HZHA 2PR5A 3CWFA 1TS0A 2PT7A 1L0EA 1UWPX 3QP4A 1ZG6A 3OZHA 4MSLA 3UDXA 1PNEA 3LIEA 3NIAA 4IVKA 4X68A 3CITA 4MLLA 3E2LA 4QJGA 5HDDA 1GKGA 2V2FF 3IU3I 3KYQA 2XK1A 1G68A 4KQOA 5KSCA 3WS5A 1SKOA 4FOFA 1OTIA 2A49A 2VGKA 2J3WA 3HUNA 5HWVA 2D01A 5CTMA 2I2LA 1TVFA 2ZQ8A 3UE0A 1XX2A 1LY2A 1F9IA 4OVDA 3PR6A 1MC0A 2WKRA 4YINA 1H04P 1CQAA 1A0KA 3T1QB 1PZOA 1W63M 2XD1A 2O0YA 3CG5A 5HDSA 4AYDA 4IBXA 4EWFA 5L2FA 1X0OA 1YLPA 5GHZA 3W4QA 4ZRRA 1VM1A 3IH9A 4N9LA 2V1ZA 1M40A 1L0DA 1D06A 3LR3A 4P6BA 1F2KA 1RCJA 3WSXA 3ZG8B 1EWZA 1ELVA 1SZVA 4GNUA 3GTCA 4KG5A 1ONGA 1S4SA 2PR6A 2V1AA 1GSXA 1T19A 3C4PA 3GR2A 1JTDA 3WS0A 3C30A 5IU1A 1PW1A 2Y2KA 1VETB 4A5WB 3T1RA 4DXCA 4ESPA 5HAQA 3VV4A 1TD5A 3HUMA 4WBGA 2RLQA 5HD3A 4MMNA 4IUHA 4QB8A 2EA9A 5DJUA 2HP6A 1TPGA 1ALQA 1MWSA 2ZMFA 3HLBA 1WYCA 2V8FA 3DAVA 3VOLA 3F6KA 4NXBA 1OPXA 5AQ9A 2BZMA 1HZOA 3O3VA 1YAXA 3O8EB 2XH9A 5FDHA 2OWJA 3KYEA 1F5MA 2GX5A 3C2WA 4CLCB 1KDWA 2QWSA 4UA6A 1XKZA 1FR1A 2WGIA 1P9RA 4LCLA 3FGTA 2V0UA 4I5SA 3C5AA 4JGQA 3H7WA 3SH9A 2PBDP 2Q0OA 4BD0A 4B4XA 4MBKA 2Y2HA 5EFWA 3D4FA 3CZDA 3KYZA 1LHYA 2VA0A 3K3CA 1GHQB 4Y2FA 4ZJ1A 2ZMAA 3T4KA 5CECA 4E6WA 2G2WA 1VVCA 4OOLA 3V39A 3BLMA 1BYWA 4WLAA 2G7UA 4LV1A 1GA0A 4MN5A 4B2SA 4ETZA 2XA7S 4QU3A 3A3EA 5E2GA 3F1OA 3TJZC 2B18A 4CLCC 4RX3A 4ZBEA 3ZG7B 4Y13A 1DY6A 1RP5A 1N9LA 4KENB 3ZYTA 4DMZA 2EFUA 2RKZA 3IX4A 3S7NA 5HPIA 1OK3A 5DN4A 5J3WA 2XD5A 3CLOA 3EJHA 4K91A 1VEUB 4HI4A 2V20A 2VV6A 4JXWA 4KUOA 1ONHA 2A55A 2EWVA 1K4FA 4FCFA 3NULA 2OV5A 1PYYA 3L7HA 5E2FA 2UWXA 2KDKA 3VFHA 1ODVA 1QMFA 4DN0A 4OQHA 4R4RA 2E8JA 3G2ZA 5TR7A 4HJ4A 2FFYA 1OTAA 3P01A 3DTEA 4EUVA 1VHMA 5FQKA 4P87A 1H03P 3AGEA 1W79A 3IWIA 2Z2LB 1IYSA 4L9EA 2XLNA 3RXXA 5CX7A 1FCOA 3SW0X 4XT2B 4DJ3A 4L0LA 3HUOA 2WGVA 5HD5A 1KGGA 1TEMA 1EROA 5EVIB 1TPMA 4GDBA 4S2IA 3KSHA 4HIAA 2EX6A 3EGXC 4OH0A 5K5BA 1ZG4A 2HDSA 1CJFA 4GOGA 1FCMA 4UA9A 1ES3A 5EV0A 1TS8A 3JPUA 3ITBA 4HQAA 4HY8A 3PBOA 4I39A 5DKLA 4F4OC 5FQJA 2FH5A 4S2NC 4DF6A 1V9YA 2W0NA 1W5DA 4WZ5A 4KUKA 2Z2MB 5I94A 3MXSA 3HLFA 2YRAA 3QP5A 4XUZA 3ISGA 2Z6CA 2IA2A 1K54A 3INBC 4G3WA 5FDSA 3G2YA 2ZQDA 2M7VA 1HLUP 4R3AA 3UPPA 2L4RA 4KZ7A 4BWIA 2JC7A 4A5RA 1YSQA 1GA9A 3T4JA 5FA7A 3HLCA 3UE3A 1PWCA 4PM8A 3RTYA 2P08A 4Z9QA 1H5XA 3FV7A 4JGRA 2P74A 3UPNA 4EXOA 2HDRA 3OOVA 4EEPA 1MWUA 1SKOB 1K55C 4HJ6A 4OPYA 3WWXA 2ZC3B 4JGOA 4HH3A 4YFMA 4KZ3A 1PFLA 5J8XA 3G4PA 5DFYA 3IX8A 1DRMA 3A3FA 2QPNA 5CHJA 3SW1A 3CAXA 3A0SA 1XXMA 2XR0A 2ZC4B 2XWBF 2OLVA 4II7A 1PW8A 4C16A 4B2RA 4HH2A 2WAEA 4LENA 1XP4A 4JGPA 3DBAA 3G35A 3R7WA 2ZM2A 2C5WB 2V9AA 1FCNA 3IBRA 3VFFA 1YMSA 4OLGA 4I3JA 1JVJA 5F69A 4JHSA 4E3JA 5TGFA 4YNXA 3HL9A 3FG8A 1VVDA 4U0XA 5FO8C 3BFFA 1VQQA 1KE3A 4LRYC 2Y2IA 3S4XA 1T18A 3PHYA 1YKDA 4KQQA 1T1CA 2ZQ9A 3ZD1A 4ARZB 2K31A 1K57C 3SOIA 4E3NA 3O87A 2V1BA 4JF4A 3OPPA 4R70A 4K0XA 3NECA 1KE0A 5TBMA 5CXWA 5F82A 1CEGA 3DWKA 4E3MA 3U2AA 5IS1A 5FATA 3JVUA 1WYBA 4KG6A 3KSIA 4DE1A 2YKHA 1JTGA 4OQGA 5EM1A 5F1GA 1H2QP 1FOFA 3H82A 3H7WB 5M19A 3BEBA 1E3UD 3QP2A 5AVEA 3VP2A 1TPNA 4K12A 5U47A 2HZ5A 4GS9A 1IOUA 4UA7A 4NEED 5I5LA 3FC7A 2WAFA 3IX0A 4FD8A 3UDIA 2CMNA 1XFQA 2Y4AA 1W8QA 1PPQA 2GZAA 5L07A 1NXYA 5HAIA 4N1HA 3BFGA 3ZG5A 2ZC5B 5BOHA 4NKPA 1HCCA 5DF7A 3F1OB 2M1CA 4PHTA 1E3UA 3IF6A 2MCZA 3BQAA 3RFBA 4CQHA 3WRZA 2VV8A 4EERA 1W63Q 3CJMA 1N9BA 1LI9A 1ERQA 3TW8A 1K6SA 1SKFA 2IZ3A 4P85A 3N7WA 3CUEC 2WADA 4LV0A 3ZHHA 5HX9A 1YLTA 1UGUA 1RLHA 4GHIA 5HFOA 1IYOA 3BFDA 2ZD8A 4BBVA 3T50A 4E3LA 2XRDA 1W8YA 4YNRA 2IZ4A 3RJUA 2Y2LA 4MN6A 2XSSA 3R4KA 3K3DA 4CJNA 3BYDA 3Q81A 2FZ0A 2V8CA 4E3KA 1S67L 3MZEA 2QYBA 5HZPB 4S2OA 4B88A 1E5GA 2EXBA 2XF3A 4KZBA 4F94A 3ZDJA 3T12B 2BG1A 2WGWA 1H8YA 2Y79A 2H5SA 2VLGA 2ZMVA 4IJGA 2KX6A 2W27A 2B95A 4KQRA 3KX0X 5A93A 1DP8A 4H6JA 3PTEA 3EQUA 5LBRA 2Y2MA 1OJ5A 4IVIA 2E8IA 1G4FA 3Q7ZA 3UY6A 3F1NA 3D3OA 4OLDA 4DRTA 3RJ3D 3C38A 4C6YA 2Y8SA 3KZJA 3IWOA 3ZD2A 3BLSA 3UNWA 1DP9A 1TF1A 5CEDA 4GD6A 2Y91A 2BASA 4AFIA 2P9VA 4P0MA 4WEKA 5IT5A 1GHIA 1BZAA 5HL6A 4MDZA 3OBFA 4H8RA 4L9FA 3HREA 2CKUA 3K3TA 2WK0A 2XDMA 3PBSA 2PD8A 3HLGA 5DTTA 1ES4A 1NWZA 2JN7A 4X69A 3BY9A 3N8RA 3DTIA 5FQ9A 3IF5A 4PKYG 1ZHHB 3BQ8A 4OP8A 3JYIA 1MD7A 1H8ZA 4BJPA 4M3KA 3Q7VA 1HFHA 1SDNA 5AQ7A 3FYZA 3ZVTA 4I3AA 5E43A 1J9MA 3LO7A 4DKIA 4Q0IA 4BL2A 3UN7A 3EQVA 4IHQA 5CERA 3VE3A 4MNRA 2B5RA 2P04A 3UE1A 4ZDXA 2J7VA 3EEHA 2VGJA 2Y2PA 5E2EA 1LSWA 1S1YA 3FPWA 1K38A 4MCWA 1ZJKA 2Y2JA 3IX3A 1OTDA 2VK3A 4MUCA 3NC8A 4KZAA 5GL9A 4I38A 4N7EA 1DP6A 1PI4A 2Y55A 1CI8A 5DJTA 3W8KA 4G3KA 1KGEA 4HP9A 4GZBA 4BENA 5EPHA 3L89M 2VX8A 3OLOA 3LR5A 4X25A 1KE4A 3VP0A 5AQBA 4QY6A 5CEBA 4P6ZM 1FSYA 2ACGA 5J4EA 4OOMA 3GECA 3W4OA 3CHWP 1CEFA 1LI0A 2A2LA 4S2MA 1STZA 3IWQA 4FSFA 1BULA 2HGVA 2OAP1 4OONA 3OC2A 1I5QA 4E3IA 4KZ5A 5FQIA 1RGZA 1SHVA 1K25A 2ZOHA 1FR6A 4NXEA 1Y54A 4GLQA 3GDIA 1GHMA 3A0VA 4EU0A 1FBRA 2H0TA 5KZHA 2L0WA 2W3HA 2INWA 3LGOA 4BMWA 1N4OA 3UB6A 3ULFA 2V0WA 3VSKA 1JWVA 4QD4A 3SH8A 2LOJA 1C1ZA 3MQOA 1GPZA 2VJWA 2VEAA 1OJWA 1WE4A 4LCMA 4R3JA 3V3SA 5FASA 5F1FA 3HJIA 5AQAA 2PU2A 3VP1A 2JGXA 4ZTKA 3T1SA 5FAOA 1SDEA 3OCLA 4J38B 3TG9A 1J3WA 4WL9A 1NYMA 4ME4A 3U4LP 2ZJ9A 1K6RA 3BW6A 2JGWA 2ZC6B 4KZ8A 4E6XA 4E3OA 2PD7A 4EBNA 3NOTC 1OT6A 2JKGA 2AVXA 4YIZA 4AYIA 4PMAA 4PM7A 4KQDA 3CMZA 4IEDA 3KSGA 4XUXA 1E25A 1PIOA 4I3IA 3UB8A 3M6HA 2ZQCA 3LCEA 2UV0E 2JCHA 2J3TC 1OT9A 4B9OA 4LRZE 1E4DA 1YQSA 3UDFA 1PWGA 3MXQA 5DKKA 2M7UA 5G18A 2B5ID 2UWNA 3Q07A 1NRFA 3MFXA 2KOIA 3R62A 3PBQA 3WRTA 2XROA 5CHUA 2A3UA 3MXRA 4F3LB 4RVAA 4S2PA 1MD8A 4WJG2 1IKIA 3VP3A 2PRFA 3A0RA 1HVBA 1Y4OA 3V5MA 1GHPA 3SS4A 3NFPI 4JBFA 3QNCA 1TS7A 2ZQAA 2KMSA 3G30A 4OPRA 2WGWB 5CRFA 3OPHA 4RA7A 5HDCA 1TDLA 2X2ZA 3OP8A 5GLBA 3BWLA 3JVVA 2EX2A 1W7FA 5EVIC 1IEMA 4APLA 3G31A 5HL1A 5GLCA 5MC7A 1CF0A 5FI2A 1UWNX 3ZGAB 5E2HA 5AJGA 3OPLA 4Q8IA 4M4XA 1NYYA 4K08A 3RXWA 2O9AA 4BWCA 2P9VB 5L10A 1ACFA 2NUPC 4BLMA 1OTEA 4LV2A 2Q9MA 4LLOB 3BFCA 5EE8A 2VV7A 3HJKA 3N8SA 2W80A 3FGRA 1S0WA 2HP5A 3IQAA 4FTXA 4IUKA 1XJ6A 3M6BA 3E4QA 4OP5A 2OOLA 3DWZA 4B4ZA 1OTBA 1BLPA 1JWPA 2JKRI 1LL8A 2G2UA 3SS5A 1I2WA 4CLCD 1AWIA 3BECA 4RX2A 1OJGA 4DXBA 5HPFA 3Q7VB 4HOIA 3Q82A 5JPMG 2WKQA 4FXGG 3VWOA 3I7JA 2WKPA 5DF8A 2EX8A 2XWJI 2RKYA 1G4GA 3KSFA 4JF5A 3EOIA 3VOZA 4DDSA 1K4EA 2ZLYA 4S2KA 5GHYA 4BL3A 1MBLA 2EXAA 3D9YA 3LEQA 3LIDA 3NDEA 1OMEA 1LL5A 4CLCA 1S6RA 1L2SA 4S2LA 3MZFA 3ICYA 3TOIA 3QP8A 2O9BA 4WYYA 3E2KA 4P6ZS 5EOOA 2WIIC 5M18A 4YOFA 4PPRA 2PDRA 2O99A 4EQ1A 3NI9A 1LLBA 4UAAA 4GCZA 3UMDA 3RH8B 1LT0A 3E98A 1VB6A 3GSGA 1WA9A 3S22A 4R4SA 2DRWA 1XGIA 4BBUA 2HJ9C 1FQGA 4Y7PA 1V9ZA 2K2NA 3GXEA 1JWZA 1FIKA 3GRJA 4X1MA 4S2JA 4PZ5A 2KLIA 1N9OA 3VSLA 4JXGA 4EW7A 4JLFA 1XJ2A 2IWDA 1YSPA 1LL9A 5HYPA 2JKTI 5CGSA 4GN2A 3MF0A 3IHAA 5HYUB 2QMIA 3L9KA 1I2SA 2WZXA 3MJQA 3BM6A 4C75A 4N9KA 1CK3A 1U60A 2ZOIA 3S7OA 1G5UA 3D72A 5I0QB 3TE8A 5EVID 3O86A 3F1PA 2W1RA 4S2NA 1BUEA 1QMEA 3QP1A 3EWKA 2GDNA 3PBNA 1H3QA 1L3LA 3GQZA 2OLUA 1P0ZA 3IH8A 1YM1A 5F6AA 5FI7A 4HBTA 4Q0JA 3GMWA 5EOEA 4PO7A 1HD8A 2PYRA 3FWLA 4OPQA 2Y2GA 1AXBA 5FL3A 1NJ4A 3IXGA 1OK2A 2XQZA 3LFVA 5HWTA 2XQWC 5KMWA 1RGYA 3N8LA 4HJ3A 3UMEA 1F98A 4E04A 3WSYA 2LB5A 2JKFA 3LI8A 3DTMA 4B93A 3IXHA 1KGFA 3NOUC 4WF0A 1OJYA 1LSVA 1K55A 3LIAA 1XA7A 4Y0UA 3HLWA 1OK1A 4WELA 4LPZA 4O01A 4EV4A 2O39C 1PWDA 5GLAA 3SS3A 1GKNA 4PM5A 3H9WA 2QKPA 4NK3A 3CPTA 3CALA 1DJAA 2VGLM 4FUWA 1O7EA 3BFEA 5G4YA 1UOTP 5TJJA 1D1JA 1OK9A 3TSGA 1DJBA 3MS6A 3LYXA 4HHDA 5FQMA 2Y2OA 2QY0A 1YPRA 4MBHA 2Q9NA 4EEUA 2OSUA 3TRCA 4O0PA 5F83A 4PM6A 4Y17A 4LOSA 5CHMA 2I72A 1P97A 2ZL1A 3ZG9B 2PBYA 5L09A 5A90A 4HNBA 2J9PA 3ZQ5A 3IT9A 4EQIA 1EW0A 2XGNA 4PKYA 4RYEA 1MXOA 3ZRZA 4WN5A 4NETA 3HVFA 2WKEA 2XFSA 3IS2A 3V3RA 3OXUD 1K57A 2WUQA 1MKIA 1L0FA 4X1LA 5KSHA 5J7EA 2HF6A 4X55A 3E4OA 4QPRA 2RL0A 4WZ5C 3UPOA 3LUQA 4HESA 3P09A 4EBPA 3GVBA 1PZPA 2Y8TA 3BJNA 4Y15A 3ZVWA 1K54C 3UB9A 3MBZA 3BRMA 5DTKA 4UQIM 3S1YA 3GOVA 1BLCA 5CGWA 4Q0HA 3MZDA 1SCWA 4HP4A 3R7WB 3DW0A 3MMHA 3S7PA 2GJ3A 3CI0J 4CLCE 4MN7A 3M2JA 2R78A 5KIZA 5HARA 3UE6A 4GD8A 4KZ6A 3MKEA 4OQ0A 2Y59A 4ARZA 5AVFA 4R0QA 3QP6A 2PHYA 4GKUA 4X6TA 4OOYA 1Y28A 4QWOA 3KXVA 2Y2NA 3T4SA 4DDYA 1D7EA 2A24A 2QJ5A 5L8MA 3IBJA 2MCYA 2HJEA 2EC3A 1BLHA 4KG2A 2W1TA 2XEPA 5GHXA 4OKPA 3PBRA 4EETB 2XFTA 3O5YA 1G6OA 2FFFB 1KVMA 2ERJA 3LIFA 1E8BA 2H0YA 2QJ7A 2HP9A 4UHUA 1N9NA 3Q1FA 5A8BA 4C3QA 4ONTD 3P98A 1YLJA 5FI6A 4LOTA 5TBMB 3MQQA 5FSRA 3LY4A 1ESUA 3WS2A 4N92A 2JKRM 2ZM0A 1NZOA 2VKSA 3CUEA 3IHBA 2LB9A 4Y3IA 5CTNA 4CPKA 4AYEA 1Q2QA 5DF9A 3NDGA 3FPVA 4PM9A 2MJ6A 1QUBA 2RLPA 1ZTUA 3H82B 1M6KA 5HW3A 1ES2A 1Q2PA 4QY5A 3S7QA 3ZLEA 1H8MA 3TVJA 1IELA 3IXBA 3T4OA 2EHFA 1DJCA 1K56D 3ZCZA 4GS9B 2W81A 1IYQA 2ZC7A 2R9XA 4R1GA
chains in the Genus database with same CATH topology
2NUPC 1GSWA 4Y5FA 1OTEA 2J80A 1D06A 4LLOB 4PAUA 4NKPA 2PYPA 1NLZA 2VV7A 3LR3A 3F1OB 2M1CA 4PHTA 3HJKA 3FGRA 3WSXA 3B33A 4IUKA 3BQAA 3RFBA 4CQHA 3LI9A 1XJ6A 2VV8A 4EERA 3E4QA 1W63Q 2OOLA 1OTBA 1S4SA 2PR6A 2Z6DA 2JKRI 2V1AA 5DFXA 1GSXA 1T19A 1LL8A 3PBTA 1MKMA 3TW8A 1MZUA 4CLCD 3C30A 5IU1A 1OJGA 5HPFA 3CUEC 4HOIA 3F1PB 2WKQA 2OWHA 3NHQA 1UGUA 2WKPA 4GHIA 3VV4A 3KSFA 1TD5A 4BBVA 3T50A 3HCYA 5HD3A 3C8CA 4MMNA 4IUHA 2EA9A 4YNRA 3EOIA 5F5YA 5DJUA 4R6LA 4GHIB 5G4ZA 4MN6A 2XSSA 3R4KA 3K3DA 2ZMFA 2FZ0A 3VOLA 3LIDA 1S67L 3F6KA 2QYBA 3P7NA 4NXBA 1OPXA 4CLCA 3BY8A 2JKTM 4UEYA 1YAXA 2OWJA 2QHKA 3W2ZA 1F5MA 3ICYA 2GX5A 3C2WA 2P7JA 4CLCB 4EESA 2Y79A 2O9BA 2QWSA 2VLGA 2VZWA 2ZMVA 4P6ZS 1P9RA 4IJGA 3LR0A 2KX6A 2W27A 3FGTA 2D02A 2DMWA 3KX0X 1DP8A 2VGLS 4H6JA 4YOFA 2V0UA 2PDRA 4I5SA 2O99A 3EQUA 3LICA 4JGQA 3H7WA 5LBRA 1P9WA 4EQ1A 3T4QA 1OJ5A 4WEJA 5F68A 2W3FA 3F1NA 4H6JB 3D3OA 5EFWA 4GCZA 3UMDA 3RH8B 3KYZA 1LT0A 3E98A 1VB6A 3C38A 2VA0A 3K3CA 4Y2FA 1WA9A 2Y8SA 4LRXC 3T4KA 3F1NB 4BBUA 2HJ9C 2XRNA 4OOLA 1V9ZA 3VE4A 1DP9A 1TF1A 1JNUA 2K2NA 3E4PA 2BASA 4AFIA 1BYWA 4Z1WA 4WLAA 2G7UA 4BBTA 4WEKA 4MN5A 5IT5A 2KLIA 5HL6A 1N9OA 4ETZA 4MDZA 4EW7A 1XJ2A 2XA7S 1YSPA 2JKTI 3MF0A 3OBFA 3F1OA 2Y8HA 4L9FA 3TJZC 2B18A 4CLCC 1N9LA 3MJQA 3PBSA 2PD8A 3KO6A 3T4LA 1NWZA 3ZYTA 2JN7A 4DMZA 3BY9A 3NOPC 4PKYG 2ZOIA 1ZHHB 3S7NA 3S7OA 5HPIA 3BQ8A 3ZLDA 2O9CA 5J3WA 3CLOA 4BJPA 3D72A 4HI4A 3TE8A 2VV6A 1NLYA 4KUOA 3F1PA 2W1RA 2K7SA 1S4RA 2EWVA 3IS2B 1NRJA 3EWKA 3PBNA 1H3QA 4I3AA 2KDKA 4NXGA 1P0ZA 4Q0IA 1ODVA 4DN0A 5F6AA 1XFNA 4Q0JA 4UQIS 4HJ4A 1OTAA 3EQVA 3P01A 4PO7A 4IHQA 4EUVA 2PYRA 1VHMA 3VE3A 2P04A 2B02A 3EEHA 5FL3A 4L9EA 1LSWA 1S1YA 3FPWA 3LFVA 4G3VA 5CX7A 4MCWA 2OAQ1 5HWTA 4RQ9A 4R38A 4XT2B 1OTDA 4DJ3A 3MR0A 4L0LA 4HJ3A 1G28A 3UMEA 1F98A 4E04A 4I38A 4GW9A 5HD5A 3WSYA 2LB5A 4N7EA 2L1MA 1DP6A 3LI8A 4B93A 3NOUC 4WF0A 5DJTA 1LSVA 3T4TA 4G3KA 3LIAA 5C5KA 4HP9A 3KSHA 3G6OA 4HIAA 4WELA 3EGXC 2NUTC 4LPZA 1S66L 2I9VA 2VX8A 3OLOA 4O01A 5K5BA 3LR5A 3CI6A 3E0YA 4YWZA 1TS8A 4HQAA 4HY8A 3PBOA 4I39A 5DKLA 4P6ZM 3H9WA 2QKPA 2FH5A 1V9YA 5J4EA 2W0NA 2VGLM 1T1AA 3GECA 4OOMA 2J3TD 5G4YA 2A2LA 4KUKA 1STZA 5TJJA 2A24B 4FSFA 2HGVA 2OAP1 3OC2A 2Z6CA 3LYXA 2ZOHA 4HHDA 2IA2A 4NXEA 2W1TB 4GLQA 3GDIA 4WUJA 4G3WA 3A0VA 4EU0A 4EEUA 2M7VA 3MQ0A 2L0WA 4R3AA 2L4RA 2W3HA 2INWA 4BWIA 3TRCA 4O0PA 4BMWA 3UB6A 1YSQA 3ULFA 1P97A 2V0WA 3T4JA 2H28A 3UE3A 4HNBA 3RTYA 3MQOA 2P08A 2VJWA 2VEAA 4JGRA 2JHEA 2XA7M 4EXOA 3OOVA 3ZQ5A 4EEPA 2ZBBA 1EW0A 3K2NA 3HJIA 4HJ6A 4PKYA 4JGOA 4HH3A 1KOUA 3PXPA 4WN5A 3OCLA 2W3DA 4GJ4A 5DFYA 3IS2A 1DRMA 4WL9A 3SW1A 3CAXA 4ME4A 3A0SA 3LR4A 2Y8RA 5KSHA 4NXFA 5J7EA 3BW6A 2HF6A 3E4OA 4II7A 4QPRA 2HV1A 3LUQA 4ETXA 2PD7A 2GNXA 4HH2A 3OCNA 3NOTC 1OT6A 3LIBA 2Y8TA 4YIZA 3BJNA 4JGPA 1LSXA 3DBAA 3NJAA 2W3GA 3R7WA 5HWWA 3UB9A 2W3EA 2V9AA 4KQDA 1TS6A 4XT2A 3PYPA 2EWWA 4UQIM 3IBRA 3KSGA 3EGDC 4I3JA 5F69A 4Q0HA 3R7WB 4HP4A 3MMHA 4I3IA 3S7PA 2GJ3A 3UB8A 1XJ4A 1IFQA 1XJ3A 4CLCE 4MN7A 3FG8A 2R78A 3B47A 5KIZA 3UE6A 2J3TC 1OT9A 4LRYC 4B9OA 4LRZE 2YKFA 1T18A 3PHYA 4ARZA 1GSVA 3MXQA 5AVFA 5DKKA 3EEAA 1YKDA 2M7UA 4F3LA 3MFXA 2KOIA 2PHYA 1S1ZA 3PBQA 4L9GA 5HSQA 1Y28A 1T1CA 2XROA 4ARZB 2K31A 3T4SA 4F3LB 1D7EA 1T1BA 2A24A 2QJ5A 4O8GA 3V67A 2V1BA 5L8MA 3B42A 3IBJA 4R70A 2HJEA 3UB7A 4DJ2A 5HZHA 2PR5A 3A0RA 3CWFA 1TS0A 2W1TA 2PT7A 3PBRA 4EETB 1UWPX 3O5YA 1G6OA 5TBMA 1TS7A 4MSLA 3LIFA 2QJ7A 1N9NA 5A8BA 3U2AA 5IS1A 3LIEA 5HDCA 3JVUA 2X2ZA 5TBMB 3MQQA 3CITA 3KSIA 2YKHA 5HDDA 3BWLA 3JVVA 2JKRM 3KYQA 2VKSA 3CUEA 4KQOA 2LB9A 4Y3IA 3H82A 3H7WB 4FOFA 4APLA 1OTIA 2J3WA 5HWVA 2D01A 5DF9A 5MC7A 3FPVA 2I2LA 2MJ6A 5AVEA 1F9IA 1ZTUA 3PR6A 1MC0A 2WKRA 1UWNX 3H82B 4GS9A 3S7QA 1IOUA 4NEED 1W63M 3ZLEA 1H8MA 2O0YA 5HDSA 5I5LA 5AJGA 3FC7A 3T4OA 4M4XA 4K08A 4GS9B 2O9AA 4BWCA 1X0OA 2CMNA 1XFQA 4ZRRA 2GZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSW A;  1OTE A;  2J80 A;  1D06 A;  4LLO B;  2PYP A;  2VV7 A;  3F1O B;  2M1C A;  3HJK A;  3B33 A;  3LI9 A;  1XJ6 A;  2VV8 A;  4EER A;  3E4Q A;  2OOL A;  1OTB A;  1S4S A;  2PR6 A;  2Z6D A;  2V1A A;  1GSX A;  1T19 A;  1LL8 A;  1MZU A;  5IU1 A;  1OJG A;  4HOI A;  3F1P B;  2WKQ A;  2OWH A;  3NHQ A;  1UGU A;  2WKP A;  4GHI A;  4BBV A;  3T50 A;  5HD3 A;  3C8C A;  2EA9 A;  5F5Y A;  5DJU A;  4R6L A;  4GHI B;  5G4Z A;  4MN6 A;  3K3D A;  3VOL A;  3LID A;  1S67 L;  4NXB A;  3P7N A;  3BY8 A;  2OWJ A;  2QHK A;  3ICY A;  3C2W A;  2P7J A;  4EES A;  2QWS A;  2VLG A;  2KX6 A;  2W27 A;  2D02 A;  3KX0 X;  1DP8 A;  4H6J A;  2V0U A;  2PDR A;  4I5S A;  3LIC A;  4JGQ A;  3H7W A;  4EQ1 A;  1OJ5 A;  5F68 A;  3F1N A;  4H6J B;  5EFW A;  3UMD A;  4GCZ A;  3RH8 B;  1LT0 A;  1VB6 A;  3K3C A;  1WA9 A;  4LRX C;  3F1N B;  4BBU A;  3VE4 A;  1V9Z A;  1DP9 A;  1JNU A;  3E4P A;  2BAS A;  1BYW A;  4WLA A;  4BBT A;  4MN5 A;  1N9O A;  4EW7 A;  1XJ2 A;  4L9F A;  3F1O A;  1N9L A;  3MJQ A;  2PD8 A;  1NWZ A;  2JN7 A;  3BY9 A;  3NOP C;  4PKY G;  2ZOI A;  5J3W A;  3CLO A;  3D72 A;  4HI4 A;  2VV6 A;  4KUO A;  3F1P A;  2K7S A;  1S4R A;  3IS2 B;  3EWK A;  4I3A A;  2KDK A;  4NXG A;  1P0Z A;  1ODV A;  5F6A A;  1XFN A;  4HJ4 A;  1OTA A;  2PYR A;  3VE3 A;  2B02 A;  3EEH A;  4L9E A;  1LSW A;  1S1Y A;  5HWT A;  4RQ9 A;  4R38 A;  4XT2 B;  1OTD A;  4DJ3 A;  3MR0 A;  4HJ3 A;  1G28 A;  3UME A;  1F98 A;  4E04 A;  4I38 A;  4GW9 A;  5HD5 A;  2L1M A;  1DP6 A;  3LI8 A;  3NOU C;  4WF0 A;  5DJT A;  1LSV A;  3LIA A;  4HP9 A;  3G6O A;  4HIA A;  4LPZ A;  1S66 L;  2I9V A;  3OLO A;  4YWZ A;  1TS8 A;  4HQA A;  4HY8 A;  4I39 A;  5DKL A;  3H9W A;  2QKP A;  1V9Y A;  5J4E A;  2W0N A;  3GEC A;  1T1A A;  5G4Y A;  4KUK A;  2A24 B;  2Z6C A;  3LYX A;  2ZOH A;  4HHD A;  4NXE A;  3GDI A;  4WUJ A;  3A0V A;  4EEU A;  4R3A A;  2L0W A;  2L4R A;  2INW A;  3UB6 A;  3ULF A;  1P97 A;  2V0W A;  2H28 A;  4HNB A;  3RTY A;  3MQO A;  2VEA A;  4JGR A;  2JHE A;  4EXO A;  3ZQ5 A;  4EEP A;  2ZBB A;  1EW0 A;  4HJ6 A;  3HJI A;  4PKY A;  4JGO A;  4HH3 A;  1KOU A;  4WN5 A;  3IS2 A;  1DRM A;  4WL9 A;  3SW1 A;  3CAX A;  3A0S A;  4NXF A;  5J7E A;  3E4O A;  2HV1 A;  3LUQ A;  2PD7 A;  4HH2 A;  3NOT C;  1OT6 A;  3LIB A;  4JGP A;  1LSX A;  3NJA A;  5HWW A;  3UB9 A;  2V9A A;  4KQD A;  1TS6 A;  4XT2 A;  3PYP A;  3IBR A;  4I3J A;  5F69 A;  4HP4 A;  4I3I A;  2GJ3 A;  3UB8 A;  1XJ4 A;  1XJ3 A;  3FG8 A;  2R78 A;  5KIZ A;  3UE6 A;  1OT9 A;  4LRY C;  4B9O A;  4LRZ E;  2YKF A;  1T18 A;  3PHY A;  1GSV A;  3MXQ A;  5AVF A;  5DKK A;  4F3L A;  3MFX A;  2PHY A;  1S1Z A;  4L9G A;  5HSQ A;  1Y28 A;  1T1C A;  4F3L B;  1D7E A;  1T1B A;  2A24 A;  2QJ5 A;  2V1B A;  4R70 A;  3UB7 A;  4DJ2 A;  5HZH A;  2PR5 A;  3A0R A;  3CWF A;  1TS0 A;  4EET B;  1UWP X;  5TBM A;  1TS7 A;  3LIF A;  2QJ7 A;  1N9N A;  5A8B A;  5IS1 A;  3LIE A;  5HDC A;  5TBM B;  3MQQ A;  2YKH A;  5HDD A;  3BWL A;  3H82 A;  3H7W B;  1OTI A;  5HWV A;  2D01 A;  5AVE A;  1F9I A;  2WKR A;  1UWN X;  3H82 B;  4GS9 A;  5HDS A;  5I5L A;  3FC7 A;  4M4X A;  4K08 A;  4GS9 B;  1X0O A;  2CMN A;  1XFQ A; 
#chains in the Genus database with same CATH topology
 1SS2 A;  1MPL A;  1GSW A;  2X02 A;  4Y5F A;  1XGJ A;  1K0K A;  2J80 A;  4OQI A;  1Z09 A;  4PAU A;  2PYP A;  1NLZ A;  3B33 A;  1KVL A;  2DNS A;  2JE5 A;  3LI9 A;  3MFD A;  3C7V A;  3IF6 B;  5CGX A;  2Z6D A;  5DFX A;  3M2K A;  3PBT A;  1MKM A;  1K56 A;  3A3I A;  1MZU A;  4JKT A;  3HLE A;  3NCK A;  3IXD A;  2CG7 A;  4DE3 A;  1ZKJ A;  2JRA A;  3F1P B;  3SH7 A;  2OWH A;  1ERM A;  3NHQ A;  2ZYC A;  3A3J A;  3AGD A;  2BLS A;  3LEZ A;  1ESI A;  2EFX A;  1H0M A;  4ZAM A;  3HCY A;  3C8C A;  5F5Y A;  2HDU A;  4R6L A;  4GHI B;  5G4Z A;  4KKD A;  2RL3 A;  3VOY A;  5A92 A;  2JBF A;  3C7U A;  5JYP A;  4GDN A;  2IWB A;  1E88 A;  3P7N A;  3AGF A;  4FH4 A;  3BY8 A;  1CKL A;  1YT4 A;  2JKT M;  4UEY A;  4HBU A;  4X53 A;  2QHK A;  3W2Z A;  3M7P A;  4KZ4 A;  3A3D A;  5HAP A;  4EES A;  2P7J A;  5DTS A;  1NY0 A;  3IF6 C;  4QHC A;  3ZNY A;  2ZQ7 A;  2VZW A;  2KRI A;  4AYM A;  1SRZ A;  3LR0 A;  5FAP A;  4ZJ3 A;  2D02 A;  2DMW A;  2VGL S;  3LIC A;  3QHY A;  1P9W A;  1ZC2 A;  2J9O A;  3T4Q A;  2BTF P;  4WEJ A;  3MKF A;  1FIL A;  5F68 A;  2W3F A;  4H6J B;  2HDQ A;  4BQM A;  5EVE A;  3CPT B;  3T1X A;  2QZ6 A;  4LRX C;  5HYT B;  3F1N B;  5TFQ A;  1MWT A;  2C6W B;  2XRN A;  3VE4 A;  3FKV A;  1C3B A;  1JNU A;  3E4P A;  5FQQ A;  4Z1W A;  4BBT A;  3UO9 A;  3G32 A;  4X56 A;  5DVA A;  5M1A A;  1BSG A;  4Y0O A;  2Y2Q A;  4MBF A;  2Y8H A;  1H2P P;  4R23 A;  3KO6 A;  2ZL1 B;  3T4L A;  3PAE A;  1TDG A;  1CI9 A;  3NOP C;  3ZLD A;  2O9C A;  1NZU A;  2CC1 A;  3PAG A;  5DN5 A;  4WMC D;  1YLZ A;  4FH2 A;  1VET A;  1NLY A;  2K7S A;  1HTZ A;  1S4R A;  3IS2 B;  1NRJ A;  3WS4 A;  4NXG A;  4O7D A;  3T5O A;  1O07 A;  4LGW A;  3N4I A;  1XFN A;  4IBR A;  4UQI S;  1L0G A;  4D2O A;  3B3X A;  2J8Y A;  2H10 A;  2B02 A;  1IYP A;  3FZC A;  3MSH A;  2RCX A;  1YLY A;  4G3V A;  4WMC A;  2OAQ 1;  4RQ9 A;  4R38 A;  4LFU A;  3MR0 A;  1G28 A;  4GW9 A;  2L1M A;  1QO6 A;  3G34 A;  5FAQ A;  4CSY A;  3T4T A;  5C5K A;  3MQL A;  3G6O A;  5IHV A;  4IGD A;  2NUT C;  4R3B A;  1ES5 A;  1S66 L;  2I9V A;  4ID4 A;  3CI6 A;  3C4O A;  3E0Y A;  4YWZ A;  2G7I A;  1PRQ A;  1GCE A;  2WKI A;  3QNB A;  2WYX A;  5EEC A;  3V50 A;  4GB7 A;  2WZZ A;  1IKG A;  1T1A A;  3N6I A;  3FKW A;  2J3T D;  5EUA A;  4DE2 A;  2A24 B;  3NY4 A;  1PI5 A;  3WS1 A;  2ZM8 A;  4N1X A;  1BLS A;  2CG6 A;  3OED C;  2W1T B;  5GLD A;  5FEG A;  4JPM A;  4WUJ A;  4DJZ A;  4WZ4 A;  3MQ0 A;  4D60 A;  2R9W A;  4JF6 A;  1BTL A;  1QGB A;  2H28 A;  4U0T A;  4U3T A;  5EVL A;  2JHE A;  2XA7 M;  2V8E A;  1BT5 A;  2ZBB A;  1G6A A;  3K2N A;  3O88 A;  4LV3 A;  1VEU A;  3NBL A;  2PU4 A;  1KOU A;  3PXP A;  3VMA A;  2W3D A;  4GJ4 A;  1XPB A;  1Q3X A;  3W4P A;  4KZ9 A;  5A91 A;  1FSW A;  3LR4 A;  2Y8R A;  4EBL A;  4K0W A;  2IWC A;  4NXF A;  5D3O A;  1O9A A;  4JXS A;  1HFI A;  2WKH A;  2HV1 A;  4MEZ A;  5FEF A;  4ETX A;  1YMX A;  5JYO A;  2GNX A;  3OCN A;  3ZG0 A;  3LIB A;  2YBY A;  2EX9 A;  3HBR A;  3DTK A;  1LSX A;  3NJA A;  2W3G A;  5HWW A;  2X01 A;  3VP4 A;  1MY8 A;  2W3E A;  1TS6 A;  1XA1 A;  4XT2 A;  4XXR A;  3PYP A;  2EWW A;  1YLW A;  3LY3 A;  3EGD C;  1MWR A;  5EM0 A;  3ITA A;  1NWV A;  2XRB A;  4ZJ2 A;  5EVI A;  1XJ4 A;  1IFQ A;  1XJ3 A;  4HEF A;  1Z6F A;  3B47 A;  2HPB A;  3HLD A;  1EI5 A;  4WM9 A;  4ZH1 D;  3ERB A;  1U5M A;  2YKF A;  4DE0 A;  3UB5 P;  3ZFZ A;  4NG2 A;  1GSV A;  2DCF A;  3EEA A;  3OPR A;  4F3L A;  4Y0T A;  1S1Z A;  1Z92 B;  3GV9 A;  4L9G A;  5HSQ A;  3SZT A;  1OJV A;  4BD1 A;  1T1B A;  4O8G A;  3V67 A;  3B42 A;  4JXV A;  2PAV P;  4EUZ A;  1KDS A;  4OPZ A;  2X71 A;  3UB7 A;  3ZNT A;  4DJ2 A;  5HZH A;  2PR5 A;  3CWF A;  1TS0 A;  2PT7 A;  1L0E A;  1UWP X;  3QP4 A;  1ZG6 A;  3OZH A;  4MSL A;  3UDX A;  1PNE A;  3LIE A;  3NIA A;  4IVK A;  4X68 A;  3CIT A;  4MLL A;  3E2L A;  4QJG A;  5HDD A;  1GKG A;  2V2F F;  3IU3 I;  3KYQ A;  2XK1 A;  1G68 A;  4KQO A;  5KSC A;  3WS5 A;  1SKO A;  4FOF A;  1OTI A;  2A49 A;  2VGK A;  2J3W A;  3HUN A;  5HWV A;  2D01 A;  5CTM A;  2I2L A;  1TVF A;  2ZQ8 A;  3UE0 A;  1XX2 A;  1LY2 A;  1F9I A;  4OVD A;  3PR6 A;  1MC0 A;  2WKR A;  4YIN A;  1H04 P;  1CQA A;  1A0K A;  3T1Q B;  1PZO A;  1W63 M;  2XD1 A;  2O0Y A;  3CG5 A;  5HDS A;  4AYD A;  4IBX A;  4EWF A;  5L2F A;  1X0O A;  1YLP A;  5GHZ A;  3W4Q A;  4ZRR A;  1VM1 A;  3IH9 A;  4N9L A;  2V1Z A;  1M40 A;  1L0D A;  1D06 A;  3LR3 A;  4P6B A;  1F2K A;  1RCJ A;  3WSX A;  3ZG8 B;  1EWZ A;  1ELV A;  1SZV A;  4GNU A;  3GTC A;  4KG5 A;  1ONG A;  1S4S A;  2PR6 A;  2V1A A;  1GSX A;  1T19 A;  3C4P A;  3GR2 A;  1JTD A;  3WS0 A;  3C30 A;  5IU1 A;  1PW1 A;  2Y2K A;  1VET B;  4A5W B;  3T1R A;  4DXC A;  4ESP A;  5HAQ A;  3VV4 A;  1TD5 A;  3HUM A;  4WBG A;  2RLQ A;  5HD3 A;  4MMN A;  4IUH A;  4QB8 A;  2EA9 A;  5DJU A;  2HP6 A;  1TPG A;  1ALQ A;  1MWS A;  2ZMF A;  3HLB A;  1WYC A;  2V8F A;  3DAV A;  3VOL A;  3F6K A;  4NXB A;  1OPX A;  5AQ9 A;  2BZM A;  1HZO A;  3O3V A;  1YAX A;  3O8E B;  2XH9 A;  5FDH A;  2OWJ A;  3KYE A;  1F5M A;  2GX5 A;  3C2W A;  4CLC B;  1KDW A;  2QWS A;  4UA6 A;  1XKZ A;  1FR1 A;  2WGI A;  1P9R A;  4LCL A;  3FGT A;  2V0U A;  4I5S A;  3C5A A;  4JGQ A;  3H7W A;  3SH9 A;  2PBD P;  2Q0O A;  4BD0 A;  4B4X A;  4MBK A;  2Y2H A;  5EFW A;  3D4F A;  3CZD A;  3KYZ A;  1LHY A;  2VA0 A;  3K3C A;  1GHQ B;  4Y2F A;  4ZJ1 A;  2ZMA A;  3T4K A;  5CEC A;  4E6W A;  2G2W A;  1VVC A;  4OOL A;  3V39 A;  3BLM A;  1BYW A;  4WLA A;  2G7U A;  4LV1 A;  1GA0 A;  4MN5 A;  4B2S A;  4ETZ A;  2XA7 S;  4QU3 A;  3A3E A;  5E2G A;  3F1O A;  3TJZ C;  2B18 A;  4CLC C;  4RX3 A;  4ZBE A;  3ZG7 B;  4Y13 A;  1DY6 A;  1RP5 A;  1N9L A;  4KEN B;  3ZYT A;  4DMZ A;  2EFU A;  2RKZ A;  3IX4 A;  3S7N A;  5HPI A;  1OK3 A;  5DN4 A;  5J3W A;  2XD5 A;  3CLO A;  3EJH A;  4K91 A;  1VEU B;  4HI4 A;  2V20 A;  2VV6 A;  4JXW A;  4KUO A;  1ONH A;  2A55 A;  2EWV A;  1K4F A;  4FCF A;  3NUL A;  2OV5 A;  1PYY A;  3L7H A;  5E2F A;  2UWX A;  2KDK A;  3VFH A;  1ODV A;  1QMF A;  4DN0 A;  4OQH A;  4R4R A;  2E8J A;  3G2Z A;  5TR7 A;  4HJ4 A;  2FFY A;  1OTA A;  3P01 A;  3DTE A;  4EUV A;  1VHM A;  5FQK A;  4P87 A;  1H03 P;  3AGE A;  1W79 A;  3IWI A;  2Z2L B;  1IYS A;  4L9E A;  2XLN A;  3RXX A;  5CX7 A;  1FCO A;  3SW0 X;  4XT2 B;  4DJ3 A;  4L0L A;  3HUO A;  2WGV A;  5HD5 A;  1KGG A;  1TEM A;  1ERO A;  5EVI B;  1TPM A;  4GDB A;  4S2I A;  3KSH A;  4HIA A;  2EX6 A;  3EGX C;  4OH0 A;  5K5B A;  1ZG4 A;  2HDS A;  1CJF A;  4GOG A;  1FCM A;  4UA9 A;  1ES3 A;  5EV0 A;  1TS8 A;  3JPU A;  3ITB A;  4HQA A;  4HY8 A;  3PBO A;  4I39 A;  5DKL A;  4F4O C;  5FQJ A;  2FH5 A;  4S2N C;  4DF6 A;  1V9Y A;  2W0N A;  1W5D A;  4WZ5 A;  4KUK A;  2Z2M B;  5I94 A;  3MXS A;  3HLF A;  2YRA A;  3QP5 A;  4XUZ A;  3ISG A;  2Z6C A;  2IA2 A;  1K54 A;  3INB C;  4G3W A;  5FDS A;  3G2Y A;  2ZQD A;  2M7V A;  1HLU P;  4R3A A;  3UPP A;  2L4R A;  4KZ7 A;  4BWI A;  2JC7 A;  4A5R A;  1YSQ A;  1GA9 A;  3T4J A;  5FA7 A;  3HLC A;  3UE3 A;  1PWC A;  4PM8 A;  3RTY A;  2P08 A;  4Z9Q A;  1H5X A;  3FV7 A;  4JGR A;  2P74 A;  3UPN A;  4EXO A;  2HDR A;  3OOV A;  4EEP A;  1MWU A;  1SKO B;  1K55 C;  4HJ6 A;  4OPY A;  3WWX A;  2ZC3 B;  4JGO A;  4HH3 A;  4YFM A;  4KZ3 A;  1PFL A;  5J8X A;  3G4P A;  5DFY A;  3IX8 A;  1DRM A;  3A3F A;  2QPN A;  5CHJ A;  3SW1 A;  3CAX A;  3A0S A;  1XXM A;  2XR0 A;  2ZC4 B;  2XWB F;  2OLV A;  4II7 A;  1PW8 A;  4C16 A;  4B2R A;  4HH2 A;  2WAE A;  4LEN A;  1XP4 A;  4JGP A;  3DBA A;  3G35 A;  3R7W A;  2ZM2 A;  2C5W B;  2V9A A;  1FCN A;  3IBR A;  3VFF A;  1YMS A;  4OLG A;  4I3J A;  1JVJ A;  5F69 A;  4JHS A;  4E3J A;  5TGF A;  4YNX A;  3HL9 A;  3FG8 A;  1VVD A;  4U0X A;  5FO8 C;  3BFF A;  1VQQ A;  1KE3 A;  4LRY C;  2Y2I A;  3S4X A;  1T18 A;  3PHY A;  1YKD A;  4KQQ A;  1T1C A;  2ZQ9 A;  3ZD1 A;  4ARZ B;  2K31 A;  1K57 C;  3SOI A;  4E3N A;  3O87 A;  2V1B A;  4JF4 A;  3OPP A;  4R70 A;  4K0X A;  3NEC A;  1KE0 A;  5TBM A;  5CXW A;  5F82 A;  1CEG A;  3DWK A;  4E3M A;  3U2A A;  5IS1 A;  5FAT A;  3JVU A;  1WYB A;  4KG6 A;  3KSI A;  4DE1 A;  2YKH A;  1JTG A;  4OQG A;  5EM1 A;  5F1G A;  1H2Q P;  1FOF A;  3H82 A;  3H7W B;  5M19 A;  3BEB A;  1E3U D;  3QP2 A;  5AVE A;  3VP2 A;  1TPN A;  4K12 A;  5U47 A;  2HZ5 A;  4GS9 A;  1IOU A;  4UA7 A;  4NEE D;  5I5L A;  3FC7 A;  2WAF A;  3IX0 A;  4FD8 A;  3UDI A;  2CMN A;  1XFQ A;  2Y4A A;  1W8Q A;  1PPQ A;  2GZA A;  5L07 A;  1NXY A;  5HAI A;  4N1H A;  3BFG A;  3ZG5 A;  2ZC5 B;  5BOH A;  4NKP A;  1HCC A;  5DF7 A;  3F1O B;  2M1C A;  4PHT A;  1E3U A;  3IF6 A;  2MCZ A;  3BQA A;  3RFB A;  4CQH A;  3WRZ A;  2VV8 A;  4EER A;  1W63 Q;  3CJM A;  1N9B A;  1LI9 A;  1ERQ A;  3TW8 A;  1K6S A;  1SKF A;  2IZ3 A;  4P85 A;  3N7W A;  3CUE C;  2WAD A;  4LV0 A;  3ZHH A;  5HX9 A;  1YLT A;  1UGU A;  1RLH A;  4GHI A;  5HFO A;  1IYO A;  3BFD A;  2ZD8 A;  4BBV A;  3T50 A;  4E3L A;  2XRD A;  1W8Y A;  4YNR A;  2IZ4 A;  3RJU A;  2Y2L A;  4MN6 A;  2XSS A;  3R4K A;  3K3D A;  4CJN A;  3BYD A;  3Q81 A;  2FZ0 A;  2V8C A;  4E3K A;  1S67 L;  3MZE A;  2QYB A;  5HZP B;  4S2O A;  4B88 A;  1E5G A;  2EXB A;  2XF3 A;  4KZB A;  4F94 A;  3ZDJ A;  3T12 B;  2BG1 A;  2WGW A;  1H8Y A;  2Y79 A;  2H5S A;  2VLG A;  2ZMV A;  4IJG A;  2KX6 A;  2W27 A;  2B95 A;  4KQR A;  3KX0 X;  5A93 A;  1DP8 A;  4H6J A;  3PTE A;  3EQU A;  5LBR A;  2Y2M A;  1OJ5 A;  4IVI A;  2E8I A;  1G4F A;  3Q7Z A;  3UY6 A;  3F1N A;  3D3O A;  4OLD A;  4DRT A;  3RJ3 D;  3C38 A;  4C6Y A;  2Y8S A;  3KZJ A;  3IWO A;  3ZD2 A;  3BLS A;  3UNW A;  1DP9 A;  1TF1 A;  5CED A;  4GD6 A;  2Y91 A;  2BAS A;  4AFI A;  2P9V A;  4P0M A;  4WEK A;  5IT5 A;  1GHI A;  1BZA A;  5HL6 A;  4MDZ A;  3OBF A;  4H8R A;  4L9F A;  3HRE A;  2CKU A;  3K3T A;  2WK0 A;  2XDM A;  3PBS A;  2PD8 A;  3HLG A;  5DTT A;  1ES4 A;  1NWZ A;  2JN7 A;  4X69 A;  3BY9 A;  3N8R A;  3DTI A;  5FQ9 A;  3IF5 A;  4PKY G;  1ZHH B;  3BQ8 A;  4OP8 A;  3JYI A;  1MD7 A;  1H8Z A;  4BJP A;  4M3K A;  3Q7V A;  1HFH A;  1SDN A;  5AQ7 A;  3FYZ A;  3ZVT A;  4I3A A;  5E43 A;  1J9M A;  3LO7 A;  4DKI A;  4Q0I A;  4BL2 A;  3UN7 A;  3EQV A;  4IHQ A;  5CER A;  3VE3 A;  4MNR A;  2B5R A;  2P04 A;  3UE1 A;  4ZDX A;  2J7V A;  3EEH A;  2VGJ A;  2Y2P A;  5E2E A;  1LSW A;  1S1Y A;  3FPW A;  1K38 A;  4MCW A;  1ZJK A;  2Y2J A;  3IX3 A;  1OTD A;  2VK3 A;  4MUC A;  3NC8 A;  4KZA A;  5GL9 A;  4I38 A;  4N7E A;  1DP6 A;  1PI4 A;  2Y55 A;  1CI8 A;  5DJT A;  3W8K A;  4G3K A;  1KGE A;  4HP9 A;  4GZB A;  4BEN A;  5EPH A;  3L89 M;  2VX8 A;  3OLO A;  3LR5 A;  4X25 A;  1KE4 A;  3VP0 A;  5AQB A;  4QY6 A;  5CEB A;  4P6Z M;  1FSY A;  2ACG A;  5J4E A;  4OOM A;  3GEC A;  3W4O A;  3CHW P;  1CEF A;  1LI0 A;  2A2L A;  4S2M A;  1STZ A;  3IWQ A;  4FSF A;  1BUL A;  2HGV A;  2OAP 1;  4OON A;  3OC2 A;  1I5Q A;  4E3I A;  4KZ5 A;  5FQI A;  1RGZ A;  1SHV A;  1K25 A;  2ZOH A;  1FR6 A;  4NXE A;  1Y54 A;  4GLQ A;  3GDI A;  1GHM A;  3A0V A;  4EU0 A;  1FBR A;  2H0T A;  5KZH A;  2L0W A;  2W3H A;  2INW A;  3LGO A;  4BMW A;  1N4O A;  3UB6 A;  3ULF A;  2V0W A;  3VSK A;  1JWV A;  4QD4 A;  3SH8 A;  2LOJ A;  1C1Z A;  3MQO A;  1GPZ A;  2VJW A;  2VEA A;  1OJW A;  1WE4 A;  4LCM A;  4R3J A;  3V3S A;  5FAS A;  5F1F A;  3HJI A;  5AQA A;  2PU2 A;  3VP1 A;  2JGX A;  4ZTK A;  3T1S A;  5FAO A;  1SDE A;  3OCL A;  4J38 B;  3TG9 A;  1J3W A;  4WL9 A;  1NYM A;  4ME4 A;  3U4L P;  2ZJ9 A;  1K6R A;  3BW6 A;  2JGW A;  2ZC6 B;  4KZ8 A;  4E6X A;  4E3O A;  2PD7 A;  4EBN A;  3NOT C;  1OT6 A;  2JKG A;  2AVX A;  4YIZ A;  4AYI A;  4PMA A;  4PM7 A;  4KQD A;  3CMZ A;  4IED A;  3KSG A;  4XUX A;  1E25 A;  1PIO A;  4I3I A;  3UB8 A;  3M6H A;  2ZQC A;  3LCE A;  2UV0 E;  2JCH A;  2J3T C;  1OT9 A;  4B9O A;  4LRZ E;  1E4D A;  1YQS A;  3UDF A;  1PWG A;  3MXQ A;  5DKK A;  2M7U A;  5G18 A;  2B5I D;  2UWN A;  3Q07 A;  1NRF A;  3MFX A;  2KOI A;  3R62 A;  3PBQ A;  3WRT A;  2XRO A;  5CHU A;  2A3U A;  3MXR A;  4F3L B;  4RVA A;  4S2P A;  1MD8 A;  4WJG 2;  1IKI A;  3VP3 A;  2PRF A;  3A0R A;  1HVB A;  1Y4O A;  3V5M A;  1GHP A;  3SS4 A;  3NFP I;  4JBF A;  3QNC A;  1TS7 A;  2ZQA A;  2KMS A;  3G30 A;  4OPR A;  2WGW B;  5CRF A;  3OPH A;  4RA7 A;  5HDC A;  1TDL A;  2X2Z A;  3OP8 A;  5GLB A;  3BWL A;  3JVV A;  2EX2 A;  1W7F A;  5EVI C;  1IEM A;  4APL A;  3G31 A;  5HL1 A;  5GLC A;  5MC7 A;  1CF0 A;  5FI2 A;  1UWN X;  3ZGA B;  5E2H A;  5AJG A;  3OPL A;  4Q8I A;  4M4X A;  1NYY A;  4K08 A;  3RXW A;  2O9A A;  4BWC A;  2P9V B;  5L10 A;  1ACF A;  2NUP C;  4BLM A;  1OTE A;  4LV2 A;  2Q9M A;  4LLO B;  3BFC A;  5EE8 A;  2VV7 A;  3HJK A;  3N8S A;  2W80 A;  3FGR A;  1S0W A;  2HP5 A;  3IQA A;  4FTX A;  4IUK A;  1XJ6 A;  3M6B A;  3E4Q A;  4OP5 A;  2OOL A;  3DWZ A;  4B4Z A;  1OTB A;  1BLP A;  1JWP A;  2JKR I;  1LL8 A;  2G2U A;  3SS5 A;  1I2W A;  4CLC D;  1AWI A;  3BEC A;  4RX2 A;  1OJG A;  4DXB A;  5HPF A;  3Q7V B;  4HOI A;  3Q82 A;  5JPM G;  2WKQ A;  4FXG G;  3VWO A;  3I7J A;  2WKP A;  5DF8 A;  2EX8 A;  2XWJ I;  2RKY A;  1G4G A;  3KSF A;  4JF5 A;  3EOI A;  3VOZ A;  4DDS A;  1K4E A;  2ZLY A;  4S2K A;  5GHY A;  4BL3 A;  1MBL A;  2EXA A;  3D9Y A;  3LEQ A;  3LID A;  3NDE A;  1OME A;  1LL5 A;  4CLC A;  1S6R A;  1L2S A;  4S2L A;  3MZF A;  3ICY A;  3TOI A;  3QP8 A;  2O9B A;  4WYY A;  3E2K A;  4P6Z S;  5EOO A;  2WII C;  5M18 A;  4YOF A;  4PPR A;  2PDR A;  2O99 A;  4EQ1 A;  3NI9 A;  1LLB A;  4UAA A;  4GCZ A;  3UMD A;  3RH8 B;  1LT0 A;  3E98 A;  1VB6 A;  3GSG A;  1WA9 A;  3S22 A;  4R4S A;  2DRW A;  1XGI A;  4BBU A;  2HJ9 C;  1FQG A;  4Y7P A;  1V9Z A;  2K2N A;  3GXE A;  1JWZ A;  1FIK A;  3GRJ A;  4X1M A;  4S2J A;  4PZ5 A;  2KLI A;  1N9O A;  3VSL A;  4JXG A;  4EW7 A;  4JLF A;  1XJ2 A;  2IWD A;  1YSP A;  1LL9 A;  5HYP A;  2JKT I;  5CGS A;  4GN2 A;  3MF0 A;  3IHA A;  5HYU B;  2QMI A;  3L9K A;  1I2S A;  2WZX A;  3MJQ A;  3BM6 A;  4C75 A;  4N9K A;  1CK3 A;  1U60 A;  2ZOI A;  3S7O A;  1G5U A;  3D72 A;  5I0Q B;  3TE8 A;  5EVI D;  3O86 A;  3F1P A;  2W1R A;  4S2N A;  1BUE A;  1QME A;  3QP1 A;  3EWK A;  2GDN A;  3PBN A;  1H3Q A;  1L3L A;  3GQZ A;  2OLU A;  1P0Z A;  3IH8 A;  1YM1 A;  5F6A A;  5FI7 A;  4HBT A;  4Q0J A;  3GMW A;  5EOE A;  4PO7 A;  1HD8 A;  2PYR A;  3FWL A;  4OPQ A;  2Y2G A;  1AXB A;  5FL3 A;  1NJ4 A;  3IXG A;  1OK2 A;  2XQZ A;  3LFV A;  5HWT A;  2XQW C;  5KMW A;  1RGY A;  3N8L A;  4HJ3 A;  3UME A;  1F98 A;  4E04 A;  3WSY A;  2LB5 A;  2JKF A;  3LI8 A;  3DTM A;  4B93 A;  3IXH A;  1KGF A;  3NOU C;  4WF0 A;  1OJY A;  1LSV A;  1K55 A;  3LIA A;  1XA7 A;  4Y0U A;  3HLW A;  1OK1 A;  4WEL A;  4LPZ A;  4O01 A;  4EV4 A;  2O39 C;  1PWD A;  5GLA A;  3SS3 A;  1GKN A;  4PM5 A;  3H9W A;  2QKP A;  4NK3 A;  3CPT A;  3CAL A;  1DJA A;  2VGL M;  4FUW A;  1O7E A;  3BFE A;  5G4Y A;  1UOT P;  5TJJ A;  1D1J A;  1OK9 A;  3TSG A;  1DJB A;  3MS6 A;  3LYX A;  4HHD A;  5FQM A;  2Y2O A;  2QY0 A;  1YPR A;  4MBH A;  2Q9N A;  4EEU A;  2OSU A;  3TRC A;  4O0P A;  5F83 A;  4PM6 A;  4Y17 A;  4LOS A;  5CHM A;  2I72 A;  1P97 A;  2ZL1 A;  3ZG9 B;  2PBY A;  5L09 A;  5A90 A;  4HNB A;  2J9P A;  3ZQ5 A;  3IT9 A;  4EQI A;  1EW0 A;  2XGN A;  4PKY A;  4RYE A;  1MXO A;  3ZRZ A;  4WN5 A;  4NET A;  3HVF A;  2WKE A;  2XFS A;  3IS2 A;  3V3R A;  3OXU D;  1K57 A;  2WUQ A;  1MKI A;  1L0F A;  4X1L A;  5KSH A;  5J7E A;  2HF6 A;  4X55 A;  3E4O A;  4QPR A;  2RL0 A;  4WZ5 C;  3UPO A;  3LUQ A;  4HES A;  3P09 A;  4EBP A;  3GVB A;  1PZP A;  2Y8T A;  3BJN A;  4Y15 A;  3ZVW A;  1K54 C;  3UB9 A;  3MBZ A;  3BRM A;  5DTK A;  4UQI M;  3S1Y A;  3GOV A;  1BLC A;  5CGW A;  4Q0H A;  3MZD A;  1SCW A;  4HP4 A;  3R7W B;  3DW0 A;  3MMH A;  3S7P A;  2GJ3 A;  3CI0 J;  4CLC E;  4MN7 A;  3M2J A;  2R78 A;  5KIZ A;  5HAR A;  3UE6 A;  4GD8 A;  4KZ6 A;  3MKE A;  4OQ0 A;  2Y59 A;  4ARZ A;  5AVF A;  4R0Q A;  3QP6 A;  2PHY A;  4GKU A;  4X6T A;  4OOY A;  1Y28 A;  4QWO A;  3KXV A;  2Y2N A;  3T4S A;  4DDY A;  1D7E A;  2A24 A;  2QJ5 A;  5L8M A;  3IBJ A;  2MCY A;  2HJE A;  2EC3 A;  1BLH A;  4KG2 A;  2W1T A;  2XEP A;  5GHX A;  4OKP A;  3PBR A;  4EET B;  2XFT A;  3O5Y A;  1G6O A;  2FFF B;  1KVM A;  2ERJ A;  3LIF A;  1E8B A;  2H0Y A;  2QJ7 A;  2HP9 A;  4UHU A;  1N9N A;  3Q1F A;  5A8B A;  4C3Q A;  4ONT D;  3P98 A;  1YLJ A;  5FI6 A;  4LOT A;  5TBM B;  3MQQ A;  5FSR A;  3LY4 A;  1ESU A;  3WS2 A;  4N92 A;  2JKR M;  2ZM0 A;  1NZO A;  2VKS A;  3CUE A;  3IHB A;  2LB9 A;  4Y3I A;  5CTN A;  4CPK A;  4AYE A;  1Q2Q A;  5DF9 A;  3NDG A;  3FPV A;  4PM9 A;  2MJ6 A;  1QUB A;  2RLP A;  1ZTU A;  3H82 B;  1M6K A;  5HW3 A;  1ES2 A;  1Q2P A;  4QY5 A;  3S7Q A;  3ZLE A;  1H8M A;  3TVJ A;  1IEL A;  3IXB A;  3T4O A;  2EHF A;  1DJC A;  1K56 D;  3ZCZ A;  4GS9 B;  2W81 A;  1IYQ A;  2ZC7 A;  2R9X A;  4R1G A; 
#chains in the Genus database with same CATH homology
 2NUP C;  1GSW A;  4Y5F A;  1OTE A;  2J80 A;  1D06 A;  4LLO B;  4PAU A;  4NKP A;  2PYP A;  1NLZ A;  2VV7 A;  3LR3 A;  3F1O B;  2M1C A;  4PHT A;  3HJK A;  3FGR A;  3WSX A;  3B33 A;  4IUK A;  3BQA A;  3RFB A;  4CQH A;  3LI9 A;  1XJ6 A;  2VV8 A;  4EER A;  3E4Q A;  1W63 Q;  2OOL A;  1OTB A;  1S4S A;  2PR6 A;  2Z6D A;  2JKR I;  2V1A A;  5DFX A;  1GSX A;  1T19 A;  1LL8 A;  3PBT A;  1MKM A;  3TW8 A;  1MZU A;  4CLC D;  3C30 A;  5IU1 A;  1OJG A;  5HPF A;  3CUE C;  4HOI A;  3F1P B;  2WKQ A;  2OWH A;  3NHQ A;  1UGU A;  2WKP A;  4GHI A;  3VV4 A;  3KSF A;  1TD5 A;  4BBV A;  3T50 A;  3HCY A;  5HD3 A;  3C8C A;  4MMN A;  4IUH A;  2EA9 A;  4YNR A;  3EOI A;  5F5Y A;  5DJU A;  4R6L A;  4GHI B;  5G4Z A;  4MN6 A;  2XSS A;  3R4K A;  3K3D A;  2ZMF A;  2FZ0 A;  3VOL A;  3LID A;  1S67 L;  3F6K A;  2QYB A;  3P7N A;  4NXB A;  1OPX A;  4CLC A;  3BY8 A;  2JKT M;  4UEY A;  1YAX A;  2OWJ A;  2QHK A;  3W2Z A;  1F5M A;  3ICY A;  2GX5 A;  3C2W A;  2P7J A;  4CLC B;  4EES A;  2Y79 A;  2O9B A;  2QWS A;  2VLG A;  2VZW A;  2ZMV A;  4P6Z S;  1P9R A;  4IJG A;  3LR0 A;  2KX6 A;  2W27 A;  3FGT A;  2D02 A;  2DMW A;  3KX0 X;  1DP8 A;  2VGL S;  4H6J A;  4YOF A;  2V0U A;  2PDR A;  4I5S A;  2O99 A;  3EQU A;  3LIC A;  4JGQ A;  3H7W A;  5LBR A;  1P9W A;  4EQ1 A;  3T4Q A;  1OJ5 A;  4WEJ A;  5F68 A;  2W3F A;  3F1N A;  4H6J B;  3D3O A;  5EFW A;  4GCZ A;  3UMD A;  3RH8 B;  3KYZ A;  1LT0 A;  3E98 A;  1VB6 A;  3C38 A;  2VA0 A;  3K3C A;  4Y2F A;  1WA9 A;  2Y8S A;  4LRX C;  3T4K A;  3F1N B;  4BBU A;  2HJ9 C;  2XRN A;  4OOL A;  1V9Z A;  3VE4 A;  1DP9 A;  1TF1 A;  1JNU A;  2K2N A;  3E4P A;  2BAS A;  4AFI A;  1BYW A;  4Z1W A;  4WLA A;  2G7U A;  4BBT A;  4WEK A;  4MN5 A;  5IT5 A;  2KLI A;  5HL6 A;  1N9O A;  4ETZ A;  4MDZ A;  4EW7 A;  1XJ2 A;  2XA7 S;  1YSP A;  2JKT I;  3MF0 A;  3OBF A;  3F1O A;  2Y8H A;  4L9F A;  3TJZ C;  2B18 A;  4CLC C;  1N9L A;  3MJQ A;  3PBS A;  2PD8 A;  3KO6 A;  3T4L A;  1NWZ A;  3ZYT A;  2JN7 A;  4DMZ A;  3BY9 A;  3NOP C;  4PKY G;  2ZOI A;  1ZHH B;  3S7N A;  3S7O A;  5HPI A;  3BQ8 A;  3ZLD A;  2O9C A;  5J3W A;  3CLO A;  4BJP A;  3D72 A;  4HI4 A;  3TE8 A;  2VV6 A;  1NLY A;  4KUO A;  3F1P A;  2W1R A;  2K7S A;  1S4R A;  2EWV A;  3IS2 B;  1NRJ A;  3EWK A;  3PBN A;  1H3Q A;  4I3A A;  2KDK A;  4NXG A;  1P0Z A;  4Q0I A;  1ODV A;  4DN0 A;  5F6A A;  1XFN A;  4Q0J A;  4UQI S;  4HJ4 A;  1OTA A;  3EQV A;  3P01 A;  4PO7 A;  4IHQ A;  4EUV A;  2PYR A;  1VHM A;  3VE3 A;  2P04 A;  2B02 A;  3EEH A;  5FL3 A;  4L9E A;  1LSW A;  1S1Y A;  3FPW A;  3LFV A;  4G3V A;  5CX7 A;  4MCW A;  2OAQ 1;  5HWT A;  4RQ9 A;  4R38 A;  4XT2 B;  1OTD A;  4DJ3 A;  3MR0 A;  4L0L A;  4HJ3 A;  1G28 A;  3UME A;  1F98 A;  4E04 A;  4I38 A;  4GW9 A;  5HD5 A;  3WSY A;  2LB5 A;  4N7E A;  2L1M A;  1DP6 A;  3LI8 A;  4B93 A;  3NOU C;  4WF0 A;  5DJT A;  1LSV A;  3T4T A;  4G3K A;  3LIA A;  5C5K A;  4HP9 A;  3KSH A;  3G6O A;  4HIA A;  4WEL A;  3EGX C;  2NUT C;  4LPZ A;  1S66 L;  2I9V A;  2VX8 A;  3OLO A;  4O01 A;  5K5B A;  3LR5 A;  3CI6 A;  3E0Y A;  4YWZ A;  1TS8 A;  4HQA A;  4HY8 A;  3PBO A;  4I39 A;  5DKL A;  4P6Z M;  3H9W A;  2QKP A;  2FH5 A;  1V9Y A;  5J4E A;  2W0N A;  2VGL M;  1T1A A;  3GEC A;  4OOM A;  2J3T D;  5G4Y A;  2A2L A;  4KUK A;  1STZ A;  5TJJ A;  2A24 B;  4FSF A;  2HGV A;  2OAP 1;  3OC2 A;  2Z6C A;  3LYX A;  2ZOH A;  4HHD A;  2IA2 A;  4NXE A;  2W1T B;  4GLQ A;  3GDI A;  4WUJ A;  4G3W A;  3A0V A;  4EU0 A;  4EEU A;  2M7V A;  3MQ0 A;  2L0W A;  4R3A A;  2L4R A;  2W3H A;  2INW A;  4BWI A;  3TRC A;  4O0P A;  4BMW A;  3UB6 A;  1YSQ A;  3ULF A;  1P97 A;  2V0W A;  3T4J A;  2H28 A;  3UE3 A;  4HNB A;  3RTY A;  3MQO A;  2P08 A;  2VJW A;  2VEA A;  4JGR A;  2JHE A;  2XA7 M;  4EXO A;  3OOV A;  3ZQ5 A;  4EEP A;  2ZBB A;  1EW0 A;  3K2N A;  3HJI A;  4HJ6 A;  4PKY A;  4JGO A;  4HH3 A;  1KOU A;  3PXP A;  4WN5 A;  3OCL A;  2W3D A;  4GJ4 A;  5DFY A;  3IS2 A;  1DRM A;  4WL9 A;  3SW1 A;  3CAX A;  4ME4 A;  3A0S A;  3LR4 A;  2Y8R A;  5KSH A;  4NXF A;  5J7E A;  3BW6 A;  2HF6 A;  3E4O A;  4II7 A;  4QPR A;  2HV1 A;  3LUQ A;  4ETX A;  2PD7 A;  2GNX A;  4HH2 A;  3OCN A;  3NOT C;  1OT6 A;  3LIB A;  2Y8T A;  4YIZ A;  3BJN A;  4JGP A;  1LSX A;  3DBA A;  3NJA A;  2W3G A;  3R7W A;  5HWW A;  3UB9 A;  2W3E A;  2V9A A;  4KQD A;  1TS6 A;  4XT2 A;  3PYP A;  2EWW A;  4UQI M;  3IBR A;  3KSG A;  3EGD C;  4I3J A;  5F69 A;  4Q0H A;  3R7W B;  4HP4 A;  3MMH A;  4I3I A;  3S7P A;  2GJ3 A;  3UB8 A;  1XJ4 A;  1IFQ A;  1XJ3 A;  4CLC E;  4MN7 A;  3FG8 A;  2R78 A;  3B47 A;  5KIZ A;  3UE6 A;  2J3T C;  1OT9 A;  4LRY C;  4B9O A;  4LRZ E;  2YKF A;  1T18 A;  3PHY A;  4ARZ A;  1GSV A;  3MXQ A;  5AVF A;  5DKK A;  3EEA A;  1YKD A;  2M7U A;  4F3L A;  3MFX A;  2KOI A;  2PHY A;  1S1Z A;  3PBQ A;  4L9G A;  5HSQ A;  1Y28 A;  1T1C A;  2XRO A;  4ARZ B;  2K31 A;  3T4S A;  4F3L B;  1D7E A;  1T1B A;  2A24 A;  2QJ5 A;  4O8G A;  3V67 A;  2V1B A;  5L8M A;  3B42 A;  3IBJ A;  4R70 A;  2HJE A;  3UB7 A;  4DJ2 A;  5HZH A;  2PR5 A;  3A0R A;  3CWF A;  1TS0 A;  2W1T A;  2PT7 A;  3PBR A;  4EET B;  1UWP X;  3O5Y A;  1G6O A;  5TBM A;  1TS7 A;  4MSL A;  3LIF A;  2QJ7 A;  1N9N A;  5A8B A;  3U2A A;  5IS1 A;  3LIE A;  5HDC A;  3JVU A;  2X2Z A;  5TBM B;  3MQQ A;  3CIT A;  3KSI A;  2YKH A;  5HDD A;  3BWL A;  3JVV A;  2JKR M;  3KYQ A;  2VKS A;  3CUE A;  4KQO A;  2LB9 A;  4Y3I A;  3H82 A;  3H7W B;  4FOF A;  4APL A;  1OTI A;  2J3W A;  5HWV A;  2D01 A;  5DF9 A;  5MC7 A;  3FPV A;  2I2L A;  2MJ6 A;  5AVE A;  1F9I A;  1ZTU A;  3PR6 A;  1MC0 A;  2WKR A;  1UWN X;  3H82 B;  4GS9 A;  3S7Q A;  1IOU A;  4NEE D;  1W63 M;  3ZLE A;  1H8M A;  2O0Y A;  5HDS A;  5I5L A;  5AJG A;  3FC7 A;  3T4O A;  4M4X A;  4K08 A;  4GS9 B;  2O9A A;  4BWC A;  1X0O A;  2CMN A;  1XFQ A;  4ZRR A;  2GZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...