3NJAA

The crystal structure of the pas domain of a ggdef family protein from chromobacterium violaceum atcc 12472.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
GIGSWVLHMESGRLEWSQAVHDIFGTDSATFDATEDAYFQRVHPDDRARVRRELDRHVLGDRPFDVEYRIVRPDGQVRELLERNHIQRQASGQVDHLWGTVIDMTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GGDEF family protein
publication title The crystal structure of the PAS domain of a GGDEF family protein from Chromobacterium violaceum ATCC 12472.
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 20
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.100 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3njaA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3njaA01
1XJ3A 4YWZA 4GCZA 5HD3A 3H7WB 4KUKA 3NHQA 3F1PB 1UWNX 1G28A 1DRMA 1XJ2A 5DJTA 4EESA 2PR6A 5DKKA 5EFWA 4F3LB 3UB9A 3F1NA 3OLOA 3IS2A 2QJ5A 3E4OA 3UE6A 4KUOA 2HV1A 2P7JA 1P0ZA 5F69A 1XJ4A 4EXOA 5HDCA 4GHIA 2W27A 4I5SA 2PD8A 3A0RA 3ULFA 5AVFA 1XJ6A 1JNUA 2ZOHA 3HJIA 5J3WA 3LIEA 4HP9A 1OTDA 2V9AA 3ZQ5A 4HOIA 2YKFA 4NXBA 4K08A 4WL9A 4WLAA 2PHYA 1N9LA 3EEHA 4NXEA 1OJ5A 5F6AA 4BBTA 4DJ2A 3F1OB 1F9IA 3LI8A 1KOUA 3P7NA 4EETB 2A24A 3MQOA 3IBRA 1GSXA 4PKYA 5F5YA 3UB7A 4KQDA 3NOTC 4GS9B 4I3IA 1WA9A 1TS0A 2PR5A 4RQ9A 3VE3A 2OOLA 1S1ZA 5J4EA 2JN7A 3C2WA 4HIAA 2INWA 4MN6A 3RTYA 2D01A 1Y28A 1T1AA 4EEUA 3CAXA 3PHYA 2VEAA 2PYRA 4I3AA 4HH2A 3GECA 1V9ZA 4HJ4A 3B33A 4NXFA 4H6JA 3K3CA 1DP9A 5HWVA 1V9YA 4HY8A 3H82A 2B02A 3LIBA 2ZOIA 1S4RA 4HQAA 3NOUC 1LSVA 3E4QA 4I3JA 3UMEA 1TS6A 3MR0A 4EW7A 2L1MA 3EWKA 1OTAA 3GDIA 4B9OA 1T1CA 2VLGA 2JHEA 5DJUA 3D72A 1GSVA 2OWJA 4JGPA 3F1NB 5HWWA 5J7EA 3IS2B 3T50A 5DKLA 4I39A 3VE4A 2BASA 1T19A 3LIFA 2WKQA 3UMDA 5I5LA 4GHIB 3LI9A 3FC7A 1OT9A 1GSWA 3LUQA 2VV7A 5F68A 3CWFA 4EERA 5HD5A 2KDKA 1XFNA 4JGQA 5G4ZA 2V0WA 3K3DA 4EQ1A 4JGRA 2CMNA 2ZBBA 1TS7A 1S1YA 1S66L 2A24B 2WKRA 2J80A 4R6LA 2I9VA 4E04A 2L4RA 4L9FA 2PYPA 3HJKA 5HDDA 5TBMA 4XT2A 3PYPA 2H28A 4LRXC 4GW9A 3BY9A 3H7WA 5A8BA 3E4PA 4HP4A 4BBVA 2D02A 3F1PA 4DJ3A 2L0WA 4LRYC 1TS8A 2V0UA 4F3LA 3MXQA 1N9OA 1MZUA 1ODVA 4WN5A 1OT6A 1NWZA 4L9GA 3NJAA 4H6JB 4I38A 3UB6A 5HZHA 3LIAA 1LSWA 3BY8A 1OTBA 2QKPA 4R70A 2V1AA 3H82B 2VV8A 4R3AA 5HSQA 5AVEA 1T18A 3A0VA 1D06A 3CLOA 4WF0A 1BYWA 1X0OA 3A0SA 3KX0X 2PD7A 4HJ6A 4HNBA 1F98A 3ICYA 2GJ3A 3LIDA 3MJQA 1LL8A 3RH8B 5KIZA 2EA9A 1OTEA 2QJ7A 2R78A 1UGUA 1DP6A 4HJ3A 3F1OA 4M4XA 3BWLA 1VB6A 4LLOB 1P97A 1OJGA 2V1BA 5HWTA 3NOPC 4R38A 4GS9A 4LPZA 2M1CA 1T1BA 4JGOA 1OTIA 1LT0A 2VV6A 1DP8A 2Z6CA 2W0NA 2QHKA 2PDRA 3UB8A 4EEPA 1S4SA 4L9EA 1LSXA 4WUJA 2K7SA 3LICA 5HDSA 4NXGA 4LRZE 1UWPX 3FG8A 3LYXA 2WKPA 2QWSA 1N9NA 3H9WA 4HHDA 5IS1A 3VOLA 3C8CA 2Z6DA 3MFXA 3MQQA 1S67L 4MN5A 1D7EA 2YKHA 4BBUA 3G6OA 4HH3A 2KX6A 5G4YA 1EW0A 2OWHA 4HI4A 4PKYG 5IU1A 5TBMB 4XT2B 1XFQA 3SW1A
chains in the Genus database with same CATH superfamily
3QP4A 5CECA 3CUEA 3MMHA 1H04P 2ZM0A 3H7WB 1NLZA 1IOUA 2PR6A 5DKKA 3S4XA 5DF8A 3UB9A 4MBHA 1H2QP 2IWCA 3IS2A 4Y3IA 1ZHHB 2R9XA 2QJ5A 4O8GA 3E4OA 5CHUA 2Y2NA 4GZBA 4KG5A 3MFDA 1KE3A 2G7IA 2LOJA 3RJ3D 4KUOA 3G32A 4Y7PA 1P0ZA 3PBRA 1PZPA 5E2FA 3OPLA 1QGBA 5FSRA 4MNRA 3AGDA 5GHZA 1FBRA 2VKSA 2XWBF 4BWCA 2PD8A 3W2ZA 2UWXA 5AVFA 3HJIA 2Y2MA 5HAIA 1NLYA 2V20A 4OLDA 2V9AA 1IYSA 2HDSA 4Y17A 4K08A 3T4QA 2WK0A 1P9WA 1NZOA 3UY6A 2JKTI 3EEHA 3F1OB 3HUNA 1F9IA 3B3XA 1KOUA 2WKHA 2A24A 3IBRA 5HL1A 1WYBA 3JVVA 4APLA 4OOMA 5BOHA 3Q1FA 4I3IA 4X1MA 1TF1A 1H8YA 1TS0A 3WRTA 4JF5A 1NYMA 5DTSA 3SW0X 2NUTC 1YLWA 1S1ZA 5J4EA 5FI7A 1VEUA 3G34A 2INWA 2XQZA 3EGDC 1GHQB 2D01A 2XF3A 1T1AA 3OPPA 4WZ5C 3NCKA 1E3UD 3PHYA 3LGOA 4IBRA 3VP0A 4ONTD 1G4FA 5HPIA 4E6WA 5EVIA 2W1TB 4CQHA 1XP4A 1V9ZA 3B33A 4Y15A 1CI9A 3FPVA 1LHYA 2GDNA 4UAAA 1IYQA 5L8MA 1NRFA 4GN2A 1SKOB 4LV0A 1WYCA 5L10A 5GHYA 4UQIS 4JXGA 1S4RA 1KGEA 5EE8A 4FOFA 3CITA 3O88A 1L0GA 4I3JA 3UMEA 1M40A 2W3DA 1GHPA 3ZRZA 1ES3A 3OPRA 4EW7A 1K57A 4X55A 2L1MA 3PBNA 2RKYA 2OLVA 2XWJI 5FQMA 3QP1A 3EWKA 1OTAA 2ZLYA 1K6RA 1PZOA 5FO8C 5F82A 4B9OA 2PAVP 3ZHHA 5DN5A 1KDSA 2JHEA 3MQLA 2WGVA 2C5WB 4RYEA 1MWTA 4JGPA 5F1FA 2FH5A 3IXHA 2ZC4B 3LY3A 5DKLA 1M6KA 1XX2A 1CEFA 5I94A 1T19A 4OPQA 3HLCA 2WKQA 1HLUP 4Y2FA 4S2NC 3TW8A 4YOFA 4GHIB 3PR6A 2VJWA 1Z92B 1OT9A 3U2AA 1PRQA 1HCCA 4C16A 1F5MA 4G3WA 2VV7A 4EERA 1F2KA 2QMIA 4GOGA 4PM6A 3TSGA 4BWIA 3SOIA 4K91A 4GB7A 1N9BA 2HP9A 4KZBA 4JGQA 3DWKA 2VGKA 4FXGG 4KZAA 3Q07A 1XGJA 2W3FA 4WBGA 3K3DA 3QP8A 4Z1WA 4JGRA 3PTEA 2CMNA 2CG7A 1TS7A 2HGVA 1KGGA 4BLMA 4WMCD 2Y2HA 4R6LA 4E04A 4LV3A 4DDYA 4L9FA 3KYQA 3LO7A 2EX9A 4CSYA 3KYZA 4J38B 4LRXC 3UE1A 2M7VA 2Y2IA 3H7WA 3HBRA 3QP6A 2D02A 1KDWA 1AWIA 1Y4OA 1U5MA 4ZH1D 3QP5A 3BFFA 2V0UA 1JVJA 2QZ6A 5AQBA 4DF6A 3E0YA 4JBFA 3ZLEA 1E4DA 3N6IA 2O9BA 1NXYA 2B95A 4R1GA 1CI8A 5DFYA 4D2OA 2X71A 3W4QA 1OK3A 3G2ZA 1DJAA 3KSIA 3BQ8A 4I38A 5TR7A 3T4KA 3EJHA 3LIAA 1LSWA 1OTBA 2QKPA 4R70A 2V1AA 4UQIM 2KOIA 5AVEA 2BG1A 3BECA 1T18A 3A0VA 3BFGA 3CLOA 3NDGA 3T4OA 1QO6A 3A0SA 1IYPA 3KX0X 1E3UA 3IHAA 4HNBA 3IX8A 3ICYA 1OK1A 1ACFA 1FOFA 4WZ5A 4EBLA 2EA9A 4WEJA 1MKIA 2QJ7A 3FKVA 1DP6A 3F1OA 4AYMA 1ALQA 5FA7A 4H8RA 4B2RA 4DDSA 5LBRA 1LY2A 1MXOA 1K0KA 2BLSA 5CEBA 1ZJKA 5HWTA 3SS4A 3NOPC 3C7VA 2W80A 1XA1A 4JGOA 1OTIA 1LT0A 1YMSA 3T4SA 1BLPA 2W0NA 3FKWA 5IHVA 1FQGA 3B47A 1K25A 1ZTUA 2XRNA 3R4KA 3OXUD 4F4OC 3OC2A 5CGWA 4JF4A 3VP3A 3ZFZA 1YPRA 5CHJA 4BMWA 4EV4A 3HLBA 3DW0A 4LRZE 5DVAA 1UWPX 1KE0A 5FAOA 4BENA 3LYXA 4ZRRA 2QWSA 4R23A 4RA7A 5A90A 1H0MA 4NG2A 1O7EA 2Y8SA 3KZJA 2I2LA 4OOLA 3VOLA 3A3JA 1K55C 1YQSA 2HPBA 1S67L 2W1TA 3GVBA 3WRZA 1D7EA 3TOIA 2YKHA 2XROA 1HZOA 5IT5A 4MSLA 1SKOA 4FCFA 1LI0A 5CX7A 3F6KA 3LEQA 5EOOA 2ZQ9A 3VFHA 4HI4A 3LFVA 3ITAA 4Q0HA 1XFQA 4X25A 3Q81A 2WUQA 1XJ3A 2HP6A 2XH9A 4GKUA 3IBJA 1TPMA 5AQAA 3MBZA 2FFYA 2UWNA 4KG2A 1RP5A 2RKZA 3F1PB 1TDGA 5CHMA 5DJTA 2C6WB 3CG5A 3BLSA 1OPXA 5DTKA 2K31A 3ZG0A 3NC8A 5EFWA 1ERMA 4WMCA 3LEZA 3G30A 1KVMA 4OP5A 5EOEA 5CGXA 3ZCZA 3IH9A 2JCHA 1BLHA 3SH8A 3BLMA 1YT4A 2RCXA 4DE3A 1IEMA 1DY6A 2W81A 1NYYA 3L89M 1XA7A 4GHIA 3KXVA 2W27A 3A3DA 4DXBA 1NRJA 1MWUA 3D9YA 3RXXA 4E3LA 3ULFA 2X2ZA 3M2KA 1JNUA 4G3VA 3MS6A 3LIEA 5HYUB 1EI5A 2CKUA 4HP9A 4LCMA 5FATA 1OTDA 3ZQ5A 1C3BA 3DAVA 1YLYA 5GLDA 2V8FA 2XFSA 3ZYTA 2XSSA 5GLAA 2GX5A 2FFFB 2PHYA 3IX3A 5HARA 2ZC3B 4PPRA 4DJ2A 1OK2A 1XKZA 3ZVWA 2AVXA 1ES4A 3P7NA 4AYEA 3L7HA 4ETZA 4MEZA 1J3WA 3MQOA 1PWGA 3O86A 3C4OA 5DTTA 5FEGA 1W63Q 3NOTC 2WIIC 1SHVA 2W1RA 3OEDC 1WA9A 4JXWA 1SCWA 5CTMA 2PR5A 1OK9A 3NIAA 3PBQA 3VE3A 1CK3A 4UA6A 3T1RA 2JN7A 4KZ7A 4KZ6A 3WWXA 2JRAA 1K4EA 2OAP1 4DE1A 3V3RA 4QD4A 1Y28A 1PW1A 1ZKJA 4UA7A 3IF5A 2BZMA 2IZ4A 2VEAA 4LV2A 4ME4A 4HESA 3UPNA 4HH2A 4ARZB 3GECA 3Q7VB 3T1XA 2G7UA 2ZMFA 4KZ8A 4PM5A 1O07A 4UEYA 5EPHA 3IXGA 3IXDA 3ZG7B 3S1YA 4JHSA 4HY8A 1RLHA 2J7VA 2J9PA 4N92A 5G18A 2ZMAA 3EQVA 5I0QB 4Q0IA 4BJPA 3ZG8B 4JF6A 1TVFA 3LIBA 3KSGA 3FZCA 3LR3A 4HQAA 3N4IA 4NK3A 1K6SA 3P09A 5FDHA 4U0XA 4EQIA 4Y5FA 2W3GA 2ACGA 4Y0UA 3IF6B 2OAQ1 1QMFA 1K55A 4IBXA 1GSVA 4KQOA 2JBFA 2VZWA 4MMNA 3C4PA 1YLPA 1L2SA 5L07A 4QU3A 2BASA 3TJZC 3LIFA 3EQUA 1TDLA 3UPPA 3OPHA 3CALA 5EECA 3HCYA 3IHBA 3FC7A 2A49A 1SDEA 3LUQA 1MC0A 4R4SA 5A92A 4PO7A 2MCZA 4RX3A 3BEBA 5F83A 1IYOA 3IX4A 3IF6C 1XFNA 1W5DA 5G4ZA 4F94A 2P9VB 2PRFA 4EQ1A 4MBFA 3MXRA 2ZBBA 2EC3A 1S1YA 1CEGA 1YM1A 1PPQA 2J80A 2IA2A 1ES5A 3I7JA 2I9VA 2ZM8A 3O87A 3T4JA 3S7QA 3EEAA 3PBSA 3T5OA 4WJG2 3HJKA 4IUHA 4UHUA 2JKGA 4YNRA 1OJYA 4N1XA 4BD0A 2HF6A 5JPMG 3PYPA 2H28A 3BM6A 5A8BA 4E3JA 2OSUA 3E4PA 4KG6A 2PBDP 3BJNA 3F1PA 3FYZA 4DJ3A 2L0WA 4LOSA 2XEPA 4AYIA 2WGIA 1YSPA 1N9OA 3M2JA 1ODVA 1IFQA 4XUZA 2WZXA 1MD8A 1QMEA 1CKLA 4L9GA 4H6JB 4XUXA 1ESUA 2M7UA 4B2SA 2ZC7A 1YLZA 3UE3A 3R7WB 3C38A 3D4FA 4KZ5A 5HYTB 1JWZA 3HLEA 5KSHA 4YIZA 2HZ5A 4DRTA 4YFMA 4QY5A 3IX0A 4R3BA 1X0OA 3PBOA 3V5MA 2PD7A 5JYPA 3SS5A 1PWDA 4D60A 3BFEA 1W8QA 2QY0A 1PIOA 3L9KA 4U3TA 1OTEA 3T12B 4Z9QA 4OQGA 1BSGA 4M4XA 4CLCE 2DCFA 2O99A 2V1BA 5TFQA 2NUPC 4P6BA 3NULA 2M1CA 3HUOA 1YSQA 3C7UA 4MBKA 3DTIA 2Z2MB 1DP8A 4QJGA 4ZDXA 3UB8A 5FQQA 4QY6A 4N1HA 1TEMA 4ZTKA 4PM8A 5L09A 4IVIA 4WUJA 1G5UA 1GKNA 3M7PA 2Y91A 3LICA 5HDSA 4Q8IA 4WM9A 1KE4A 4KZ3A 2EHFA 1GA9A 3BYDA 2WAFA 4S2JA 3ZG9B 2Y8TA 3ERBA 2XRDA 5GL9A 1NJ4A 3O3VA 2Y2PA 3S7NA 1E8BA 3BFDA 2Z6DA 4ARZA 3MQQA 3Q7VA 1Q2QA 4MN7A 2RLPA 3UDIA 3NY4A 4M3KA 1BZAA 3FWLA 4E3OA 2EFXA 2XQWC 3JPUA 4E6XA 5IU1A 2JKRM 4KZ4A 3OCNA 3AGFA 2HJEA 1XXMA 3IQAA 2WZZA 4YWZA 5HD3A 5M19A 2ZQAA 2H10A 4KUKA 3E2LA 1Z6FA 5DF7A 4FUWA 1G28A 1DRMA 1XJ2A 3IF6A 4ID4A 4EESA 4Y13A 5EM0A 4F3LB 1TD5A 5GLCA 4GJ4A 1DJCA 5CXWA 3OLOA 1MBLA 3TE8A 4YNXA 2XLNA 4NEED 5E2GA 1I2SA 2XK1A 4K0XA 4Y0OA 4AYDA 3N8LA 5FQKA 3UB5P 1PI4A 3MF0A 3UDFA 5HDCA 1IELA 1S0WA 2I72A 1KVLA 2HDQA 3NBLA 1GPZA 1YMXA 1SKFA 4QWOA 4MCWA 1FIKA 3UNWA 1PWCA 2DRWA 5FL3A 1XJ6A 3E2KA 5J3WA 3RFBA 1CJFA 1Y54A 2XD1A 4GDNA 3ZG5A 3RJUA 3ZNYA 2YKFA 2B18A 2IZ3A 2P9VA 3OP8A 2XGNA 3WSXA 1L0EA 5DFXA 4NXEA 1OJ5A 5F6AA 1IKGA 3C30A 2VK3A 1H8MA 2Y2GA 3ZD1A 4OLGA 2W3HA 3HUMA 2B5ID 3TVJA 3KSHA 5F5YA 4KQDA 4DMZA 1HVBA 2KRIA 2KLIA 4BQMA 1ZG4A 2OOLA 2JE5A 3EGXC 1LL9A 4JLFA 1FR6A 1GHMA 1SDNA 4HIAA 4MN6A 1ZC2A 3RTYA 1EROA 3WSYA 4S2OA 3PAGA 4N9LA 1GA0A 2PYRA 4I3AA 5CEDA 1W7FA 4E3IA 3WS4A 4OOYA 4EBNA 1E25A 4HJ4A 4GD8A 4H6JA 2A2LA 1DP9A 2XDMA 1V9YA 3R7WA 1D1JA 3VWOA 1JTGA 2DNSA 2EX6A 3QHYA 3GQZA 5FAPA 3IWOA 2X02A 3NOUC 1LSVA 3E4QA 4LOTA 3NFPI 1VHMA 4Q0JA 3MR0A 5HL6A 3D3OA 4LCLA 2P74A 5K5BA 4IUKA 3MKEA 4B93A 1UOTP 4ETXA 1N4OA 2ZQDA 3DTKA 4GLQA 1E5GA 1T1CA 1NWVA 5E2EA 3D72A 4ZJ3A 3F1NB 5J7EA 2ZQCA 3S7PA 3QNBA 1I2WA 3LR5A 3NDEA 1RGZA 4HEFA 1FSWA 2A3UA 3UMDA 5GLBA 2WKEA 5I5LA 5DF9A 1G6OA 1GSWA 1Z09A 2Y55A 3HL9A 2ZQ8A 3QNCA 3K3TA 1OMEA 2EX2A 4BD1A 3U4LP 5HD5A 1K54C 2VA0A 5HAPA 4NKPA 1HD8A 4RVAA 1ELVA 1GKGA 2EWWA 2ZL1B 2Y8HA 4PMAA 1BULA 5GHXA 2WKRA 4X53A 1FSYA 2L4RA 3WS0A 2OV5A 5HDDA 2H0YA 4N7EA 4KQRA 1YAXA 1RGYA 4L0LA 3VSLA 5MC7A 1XPBA 5KZHA 2Y2LA 5M18A 1SS2A 2J3WA 3BY9A 4HP4A 1W79A 4OQ0A 2GZAA 3IH8A 3KSFA 4HBUA 3MXSA 4II7A 2Z2LB 2VX8A 5E2HA 1YLTA 4A5RA 4EBPA 1MY8A 2JKFA 3MXQA 4F3LA 1ERQA 2XFTA 1VVDA 4RX2A 1FCNA 3HLGA 4QPRA 1OT6A 3VMAA 5FAQA 3NJAA 4A5WB 3T4TA 4C6YA 3MZDA 3UB6A 3VSKA 1PI5A 1EWZA 1AXBA 2Y2KA 3H82B 2LB5A 3N7WA 1KGFA 4X6TA 3G4PA 2VV8A 4ZJ1A 3BQAA 3JYIA 3GTCA 5HSQA 4X1LA 1K4FA 1D06A 4KKDA 5JYOA 1BYWA 2G2WA 4LGWA 3WS5A 5EVEA 4HJ6A 2V8CA 3NI9A 2GJ3A 5AQ7A 4OPRA 3MJQA 5HZPB 4IJGA 4C3QA 3ISGA 4K12A 5KIZA 5HAQA 1PYYA 2O9CA 1STZA 5CERA 5FASA 2R78A 4ZAMA 4PAUA 2J9OA 4HJ3A 2WKIA 4LFUA 3HLFA 1BTLA 4OPZA 3S7OA 1NZUA 4X68A 5FI2A 4LLOB 1P97A 4R3JA 5D3OA 4EU0A 2EX8A 4LPZA 1XGIA 2ERJA 3LY4A 3CPTB 2VV6A 2V2FF 3ZDJA 4XXRA 2JKRI 2JGXA 4S2IA 1FR1A 1NY0A 2EXBA 5FQ9A 1H5XA 1Q2PA 1S4SA 1LSXA 2Q9NA 4FH4A 2K7SA 3TG9A 4MLLA 1WE4A 4NXGA 2PBYA 4EUVA 1LL5A 3FG8A 3ZVTA 3HREA 3PBTA 2UV0E 4DKIA 3H9WA 3HLDA 4HHDA 2Y59A 1FILA 1K56D 3RXWA 3ZLDA 3FV7A 3INBC 2Y79A 4MN5A 3N8SA 5AQ9A 1OJWA 4OONA 2B5RA 2RL3A 2O0YA 3P01A 3G6OA 3V3SA 3SS3A 1IKIA 1H3QA 4QHCA 3TRCA 3GR2A 2Y2JA 4O0PA 3IWIA 4B88A 5TBMB 3LR4A 4XT2B 3CJMA 3SW1A 3NECA 2E8IA 4GCZA 1HTZA 1K38A 3O5YA 3CZDA 3VOYA 3CHWP 1BT5A 4C75A 3NHQA 1P9RA 3A3EA 3VP1A 1UWNX 1K54A 3FGTA 4P0MA 4NETA 2Y2OA 1RCJA 2WADA 3F1NA 3DWZA 2BTFP 4IVKA 4EWFA 2ZQ7A 3Q7ZA 1J9MA 3UE6A 4PM9A 2HV1A 2P7JA 2O9AA 2IWBA 1VETB 5E43A 5F69A 1W63M 4DJZA 4WELA 1XJ4A 2WAEA 1PW8A 4P85A 4EXOA 3VV4A 4CJNA 4I5SA 3SZTA 1DJBA 3A0RA 3CI0J 3VP2A 4CLCB 4WZ4A 4QB8A 2ZOHA 2Y2QA 2V8EA 2KMSA 3CMZA 3O8EB 1VM1A 3C5AA 4G3KA 4HOIA 4JXSA 5DN4A 2HDRA 3A3FA 3OZHA 4NXBA 4WL9A 3M6BA 4WLAA 1C1ZA 3GSGA 1L3LA 2CC1A 3GXEA 1N9LA 4BL3A 1BLCA 5F1GA 4S2PA 4BBTA 2ZL1A 5FI6A 1MPLA 3ZNTA 3KYEA 3VP4A 2RL0A 3LI8A 4K0WA 1FCOA 2WGWB 3SH9A 4EETB 1OJVA 4GD6A 2HDUA 5FEFA 1O9AA 5TGFA 1GSXA 4PKYA 2ZMVA 1W8YA 3UB7A 4X56A 4GS9B 4E3MA 3MQ0A 3E98A 4EUZA 1PFLA 2JC7A 5AJGA 2XRBA 4PM7A 2LB9A 4RQ9A 3BFCA 4CLCC 3S22A 4R4RA 2P04A 3C2WA 4OPYA 2EXAA 5A91A 1LI9A 5HX9A 3LR0A 1G4GA 3IU3I 3MZFA 3T1SA 2WYXA 3JVUA 1MWSA 2J8YA 2Q9MA 4CLCD 4EEUA 3CAXA 5M1AA 2V1ZA 3EOIA 3BW6A 5EV0A 3W4OA 4KENB 4HBTA 2VGJA 2ZD8A 2JKTM 1ONGA 2H5SA 3HVFA 1YKDA 2O39C 2DMWA 2EFUA 2OLUA 4NXFA 3K3CA 4OKPA 4LV1A 3DTEA 2MJ6A 5HWVA 5KSCA 2J3TC 2XR0A 4FH2A 1L0FA 3H82A 5A93A 5FDSA 2PU2A 5FQJA 3IWQA 2W3EA 2B02A 4FD8A 2ZOIA 2HJ9C 2J3TD 4B4ZA 4S2LA 3T4LA 1GHIA 1K56A 4P6ZS 4O7DA 2JGWA 1MKMA 1VQQA 1TS6A 2EWVA 4O01A 1ES2A 3W8KA 3N8RA 4ZBEA 5U47A 3UPOA 3OOVA 3GDIA 1H03P 4DN0A 5J8XA 4ZJ2A 3OCLA 2VLGA 5DJUA 2OWJA 2IWDA 1MD7A 1SZVA 4LENA 5HWWA 1JTDA 3IS2B 1JWPA 3LCEA 2X01A 3T50A 2HP5A 4P87A 5TJJA 5CGSA 4I39A 4N9KA 1Q3XA 2A55A 3CPTA 3VE4A 5HYPA 4IGDA 1H2PP 4ESPA 3LI9A 3V39A 3CUEC 1HFIA 3BRMA 2RLQA 4OQIA 2FZ0A 1GCEA 4WEKA 5F68A 3CWFA 2G2UA 1HFHA 2E8JA 4PZ5A 3FPWA 2KDKA 4FTXA 1JWVA 1L0DA 4OQHA 2XD5A 3OBFA 2V0WA 3PAEA 5EVLA 1I5QA 4BL2A 3MSHA 1SRZA 4DXCA 2Y4AA 5L2FA 1S66L 2A24B 1CF0A 2PT7A 5EUAA 4FSFA 4E3KA 1CQAA 1FCMA 2PYPA 5TBMA 2Y8RA 4XT2A 2VGLS 3KO6A 3A3IA 4OVDA 4AFIA 4Y0TA 2XA7S 4GNUA 2CG6A 4GW9A 4JXVA 2PU4A 4MUCA 3ZGAB 4BBVA 1VEUB 1E88A 4LRYC 3VOZA 1TS8A 2ZC6B 3IXBA 1YLJA 4KZ9A 5C5KA 1MZUA 4S2NA 1PNEA 5EVIB 4WN5A 1NWZA 2H0TA 4E3NA 2R9WA 1VETA 5HZHA 3BY8A 1G68A 3GRJA 3UDXA 1BUEA 4R3AA 3ZD2A 2P08A 4WF0A 2ZM2A 3G35A 3AGEA 4CLCA 4P6ZM 2YRAA 4JPMA 4IHQA 3V50A 5FQIA 3GV9A 2QYBA 3V67A 1F98A 2K2NA 3LIDA 1ESIA 3G31A 1LL8A 3M6HA 3RH8B 1LLBA 3MZEA 4PHTA 3ITBA 4IEDA 5EVIC 2MCYA 1TPNA 3WS2A 1UGUA 2QPNA 1QUBA 3P98A 3BWLA 3VFFA 2WGWA 2GNXA 4MDZA 5KMWA 1VB6A 1OJGA 3SH7A 5EVID 4R38A 2ZC5B 4GS9A 3UE0A 3GOVA 1T1BA 3T1QB 3CI6A 4WYYA 3UN7A 2Z6CA 4S2MA 1S6RA 2QHKA 1H8ZA 2PDRA 2ZJ9A 1MWRA 4EEPA 1TPGA 1ONHA 3R62A 1A0KA 4GDBA 3MKFA 4KQQA 5CRFA 4L9EA 3GMWA 3DBAA 3PXPA 1K57C 1G6AA 5EM1A 2WKPA 1N9NA 1VVCA 4OH0A 3IT9A 4JKTA 4CPKA 4DE2A 4U0TA 3G2YA 2Q0OA 5IS1A 3C8CA 3MFXA 4B4XA 5HW3A 3W4PA 3QP2A 2YBYA 3DTMA 3HLWA 4X69A 4OP8A 5HPFA 4BBUA 2ZYCA 3K2NA 4DE0A 5CTNA 4UA9A 3B42A 4HH3A 2KX6A 5G4YA 1EW0A 1BLSA 4R0QA 2OWHA 3Q82A 4S2KA 3UO9A 3FGRA 2VGLM 4PKYG 5HFOA 1ZG6A 4YINA 1U60A 2XA7M 3WS1A
chains in the Genus database with same CATH topology
1XJ3A 4YWZA 4GCZA 3CUEA 5HD3A 3MMHA 3IBJA 3O5YA 3H7WB 4KUKA 3NHQA 1NLZA 1P9RA 3F1PB 1IOUA 1UWNX 1G28A 1DRMA 1XJ2A 5DJTA 1OPXA 4EESA 3FGTA 2PR6A 2K31A 5DKKA 5EFWA 4F3LB 1TD5A 4GJ4A 3UB9A 3F1NA 3OLOA 3IS2A 4Y3IA 1ZHHB 4O8GA 2QJ5A 3TE8A 3E4OA 3UE6A 4NEED 4KUOA 2HV1A 2P7JA 1P0ZA 2O9AA 5F69A 3PBRA 1W63M 4WELA 1XJ4A 3MF0A 4EXOA 5HDCA 4GHIA 2VKSA 3VV4A 2W27A 4I5SA 4BWCA 2PD8A 1NRJA 3W2ZA 3A0RA 4MCWA 3ULFA 5AVFA 5FL3A 4CLCB 2X2ZA 1XJ6A 1JNUA 4G3VA 2ZOHA 3HJIA 1NLYA 5J3WA 3RFBA 3LIEA 4HP9A 1OTDA 2V9AA 3ZQ5A 4G3KA 4HOIA 2YKFA 4NXBA 4K08A 2B18A 4WL9A 4WLAA 3T4QA 3ZYTA 2XSSA 1P9WA 3WSXA 2GX5A 2PHYA 1N9LA 2JKTI 3EEHA 5DFXA 4NXEA 1OJ5A 5F6AA 4BBTA 4DJ2A 3C30A 3F1OB 1H8MA 1F9IA 3LI8A 1KOUA 3P7NA 4ETZA 4EETB 2W3HA 2A24A 3MQOA 3IBRA 1GSXA 4PKYA 2ZMVA 3JVVA 3KSHA 4APLA 4OOMA 5F5YA 1W63Q 3UB7A 4KQDA 3NOTC 4GS9B 4I3IA 4DMZA 3MQ0A 2W1RA 1WA9A 3E98A 1TF1A 1TS0A 2PR5A 2KLIA 5AJGA 2LB9A 4RQ9A 3PBQA 3VE3A 2OOLA 2NUTC 4CLCC 1S1ZA 5J4EA 3EGXC 2JN7A 2P04A 3C2WA 4HIAA 2OAP1 3LR0A 2INWA 4MN6A 3RTYA 3EGDC 2D01A 1Y28A 3JVUA 3WSYA 1T1AA 4CLCD 4EEUA 3CAXA 3PHYA 3EOIA 2VEAA 2PYRA 3BW6A 4I3AA 4ME4A 5HPIA 4HH2A 4ARZB 2JKTM 3GECA 2W1TB 4CQHA 1V9ZA 2G7UA 2ZMFA 4HJ4A 1YKDA 2DMWA 3B33A 4NXFA 4UEYA 4H6JA 2A2LA 3K3CA 1DP9A 3FPVA 2MJ6A 5HWVA 3R7WA 1V9YA 2J3TC 4HY8A 5L8MA 3EQVA 3H82A 4Q0IA 2W3EA 2B02A 4BJPA 3LIBA 2ZOIA 3KSGA 2HJ9C 4UQIS 2J3TD 1S4RA 3LR3A 4FOFA 4HQAA 3T4LA 3CITA 3NOUC 1LSVA 3E4QA 4I3JA 3UMEA 2W3DA 1VHMA 4Q0JA 4P6ZS 1MKMA 1TS6A 3MR0A 5HL6A 4EW7A 3D3OA 2EWVA 4O01A 5K5BA 2L1MA 4IUKA 3PBNA 4B93A 4Y5FA 2W3GA 3EWKA 1OTAA 3OOVA 3GDIA 4ETXA 4GLQA 2OAQ1 4DN0A 3OCLA 4B9OA 1T1CA 2VLGA 2JHEA 5DJUA 3D72A 1GSVA 2OWJA 4JGPA 4KQOA 3F1NB 5HWWA 5J7EA 2FH5A 3IS2B 3S7PA 3T50A 2VZWA 4MMNA 3LR5A 5TJJA 5DKLA 4I39A 3VE4A 2BASA 1T19A 3TJZC 3LIFA 3EQUA 2WKQA 3UMDA 4Y2FA 5I5LA 3TW8A 5DF9A 4YOFA 4GHIB 1G6OA 3PR6A 3LI9A 3HCYA 2VJWA 3CUEC 3FC7A 1OT9A 3U2AA 1GSWA 1MC0A 3LUQA 4PO7A 1F5MA 4G3WA 2FZ0A 2VV7A 4WEKA 5F68A 3CWFA 4EERA 4BWIA 3FPWA 5HD5A 2KDKA 1XFNA 4JGQA 5G4ZA 2VA0A 2W3FA 3OBFA 2V0WA 3K3DA 4NKPA 4EQ1A 4Z1WA 4JGRA 2EWWA 2CMNA 2ZBBA 1TS7A 1S1YA 2HGVA 2Y8HA 1S66L 2A24B 2WKRA 2J80A 2IA2A 4R6LA 2I9VA 4E04A 2PT7A 3T4JA 2L4RA 4L9FA 3KYQA 4FSFA 3EEAA 3PBSA 3S7QA 2PYPA 3HJKA 4IUHA 5HDDA 5TBMA 2Y8RA 4XT2A 4N7EA 4YNRA 2VGLS 3KO6A 3KYZA 2HF6A 4AFIA 1YAXA 2XA7S 5MC7A 4L0LA 3PYPA 2H28A 4LRXC 4GW9A 2J3WA 3BY9A 2M7VA 3H7WA 5A8BA 3E4PA 4HP4A 4BBVA 3BJNA 2GZAA 2D02A 3KSFA 3F1PA 4DJ3A 4II7A 2L0WA 2VX8A 4LRYC 1TS8A 2V0UA 3E0YA 3ZLEA 4F3LA 3MXQA 5C5KA 1YSPA 1N9OA 2O9BA 1MZUA 1ODVA 1IFQA 4WN5A 5DFYA 4QPRA 1OT6A 1NWZA 4L9GA 3NJAA 3T4TA 4H6JB 2M7UA 3KSIA 3BQ8A 4I38A 3UB6A 3T4KA 3UE3A 3R7WB 3C38A 5HZHA 3LIAA 1LSWA 3BY8A 1OTBA 2QKPA 4R70A 2V1AA 3H82B 2LB5A 2VV8A 4R3AA 4UQIM 3BQAA 5HSQA 2KOIA 5AVEA 5KSHA 4YIZA 1T18A 3A0VA 2P08A 1D06A 3CLOA 4WF0A 1BYWA 1X0OA 3PBOA 3T4OA 3A0SA 4CLCA 4P6ZM 3KX0X 2PD7A 4IHQA 4HJ6A 4HNBA 3V67A 2QYBA 1F98A 3ICYA 2GJ3A 2K2NA 3LIDA 3MJQA 1LL8A 4IJGA 3RH8B 4PHTA 5KIZA 2EA9A 2O9CA 1OTEA 4WEJA 1STZA 2QJ7A 2R78A 1UGUA 4PAUA 1DP6A 4HJ3A 3F1OA 4CLCE 4M4XA 3BWLA 2GNXA 4MDZA 3S7OA 5LBRA 1VB6A 2O99A 1P97A 4LLOB 1OJGA 2V1BA 5HWTA 2NUPC 3NOPC 4EU0A 4R38A 4GS9A 4LPZA 2M1CA 1T1BA 1YSQA 4JGOA 1OTIA 1LT0A 2VV6A 3CI6A 1DP8A 2Z6CA 3T4SA 2W0NA 2QHKA 2PDRA 3UB8A 4EEPA 2JKRI 3B47A 1ZTUA 2XRNA 1S4SA 3R4KA 4L9EA 1LSXA 4WUJA 2K7SA 3DBAA 3OC2A 3LICA 3PXPA 5HDSA 4NXGA 4BMWA 4EUVA 4LRZE 1UWPX 3FG8A 3LYXA 3PBTA 2WKPA 4ZRRA 2QWSA 1N9NA 3H9WA 2Y8TA 4HHDA 5IS1A 2Y8SA 3S7NA 2I2LA 4OOLA 3C8CA 3VOLA 2Z6DA 4ARZA 3ZLDA 3MFXA 3MQQA 1S67L 2W1TA 2Y79A 4MN5A 4MN7A 1D7EA 2YKHA 2XROA 5HPFA 4BBUA 3K2NA 2O0YA 3B42A 5IT5A 3P01A 3G6OA 4HH3A 2KX6A 1H3QA 4MSLA 5G4YA 1EW0A 3TRCA 2OWHA 5CX7A 3F6KA 4O0PA 3FGRA 2VGLM 4HI4A 4PKYG 5IU1A 5TBMB 3LFVA 2JKRM 3LR4A 4Q0HA 2XA7M 4XT2B 1XFQA 3OCNA 3SW1A 2HJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ3 A;  4YWZ A;  4GCZ A;  5HD3 A;  3H7W B;  4KUK A;  3NHQ A;  3F1P B;  1UWN X;  1G28 A;  1DRM A;  1XJ2 A;  5DJT A;  4EES A;  2PR6 A;  5DKK A;  5EFW A;  4F3L B;  3UB9 A;  3F1N A;  3OLO A;  3IS2 A;  2QJ5 A;  3E4O A;  3UE6 A;  4KUO A;  2HV1 A;  2P7J A;  1P0Z A;  5F69 A;  1XJ4 A;  4EXO A;  5HDC A;  4GHI A;  2W27 A;  4I5S A;  2PD8 A;  3A0R A;  3ULF A;  5AVF A;  1XJ6 A;  1JNU A;  2ZOH A;  3HJI A;  5J3W A;  3LIE A;  4HP9 A;  1OTD A;  2V9A A;  3ZQ5 A;  4HOI A;  2YKF A;  4NXB A;  4K08 A;  4WL9 A;  4WLA A;  2PHY A;  1N9L A;  3EEH A;  4NXE A;  1OJ5 A;  5F6A A;  4BBT A;  4DJ2 A;  3F1O B;  1F9I A;  3LI8 A;  1KOU A;  3P7N A;  4EET B;  2A24 A;  3MQO A;  3IBR A;  1GSX A;  4PKY A;  5F5Y A;  3UB7 A;  4KQD A;  3NOT C;  4GS9 B;  4I3I A;  1WA9 A;  1TS0 A;  2PR5 A;  4RQ9 A;  3VE3 A;  2OOL A;  1S1Z A;  5J4E A;  2JN7 A;  3C2W A;  4HIA A;  2INW A;  4MN6 A;  3RTY A;  2D01 A;  1Y28 A;  1T1A A;  4EEU A;  3CAX A;  3PHY A;  2VEA A;  2PYR A;  4I3A A;  4HH2 A;  3GEC A;  1V9Z A;  4HJ4 A;  3B33 A;  4NXF A;  4H6J A;  3K3C A;  1DP9 A;  5HWV A;  1V9Y A;  4HY8 A;  3H82 A;  2B02 A;  3LIB A;  2ZOI A;  1S4R A;  4HQA A;  3NOU C;  1LSV A;  3E4Q A;  4I3J A;  3UME A;  1TS6 A;  3MR0 A;  4EW7 A;  2L1M A;  3EWK A;  1OTA A;  3GDI A;  4B9O A;  1T1C A;  2VLG A;  2JHE A;  5DJU A;  3D72 A;  1GSV A;  2OWJ A;  4JGP A;  3F1N B;  5HWW A;  5J7E A;  3IS2 B;  3T50 A;  5DKL A;  4I39 A;  3VE4 A;  2BAS A;  1T19 A;  3LIF A;  2WKQ A;  3UMD A;  5I5L A;  4GHI B;  3LI9 A;  3FC7 A;  1OT9 A;  1GSW A;  3LUQ A;  2VV7 A;  5F68 A;  3CWF A;  4EER A;  5HD5 A;  2KDK A;  1XFN A;  4JGQ A;  5G4Z A;  2V0W A;  3K3D A;  4EQ1 A;  4JGR A;  2CMN A;  2ZBB A;  1TS7 A;  1S1Y A;  1S66 L;  2A24 B;  2WKR A;  2J80 A;  4R6L A;  2I9V A;  4E04 A;  2L4R A;  4L9F A;  2PYP A;  3HJK A;  5HDD A;  5TBM A;  4XT2 A;  3PYP A;  2H28 A;  4LRX C;  4GW9 A;  3BY9 A;  3H7W A;  5A8B A;  3E4P A;  4HP4 A;  4BBV A;  2D02 A;  3F1P A;  4DJ3 A;  2L0W A;  4LRY C;  1TS8 A;  2V0U A;  4F3L A;  3MXQ A;  1N9O A;  1MZU A;  1ODV A;  4WN5 A;  1OT6 A;  1NWZ A;  4L9G A;  3NJA A;  4H6J B;  4I38 A;  3UB6 A;  5HZH A;  3LIA A;  1LSW A;  3BY8 A;  1OTB A;  2QKP A;  4R70 A;  2V1A A;  3H82 B;  2VV8 A;  4R3A A;  5HSQ A;  5AVE A;  1T18 A;  3A0V A;  1D06 A;  3CLO A;  4WF0 A;  1BYW A;  1X0O A;  3A0S A;  3KX0 X;  2PD7 A;  4HJ6 A;  4HNB A;  1F98 A;  3ICY A;  2GJ3 A;  3LID A;  3MJQ A;  1LL8 A;  3RH8 B;  5KIZ A;  2EA9 A;  1OTE A;  2QJ7 A;  2R78 A;  1UGU A;  1DP6 A;  4HJ3 A;  3F1O A;  4M4X A;  3BWL A;  1VB6 A;  4LLO B;  1P97 A;  1OJG A;  2V1B A;  5HWT A;  3NOP C;  4R38 A;  4GS9 A;  4LPZ A;  2M1C A;  1T1B A;  4JGO A;  1OTI A;  1LT0 A;  2VV6 A;  1DP8 A;  2Z6C A;  2W0N A;  2QHK A;  2PDR A;  3UB8 A;  4EEP A;  1S4S A;  4L9E A;  1LSX A;  4WUJ A;  2K7S A;  3LIC A;  5HDS A;  4NXG A;  4LRZ E;  1UWP X;  3FG8 A;  3LYX A;  2WKP A;  2QWS A;  1N9N A;  3H9W A;  4HHD A;  5IS1 A;  3VOL A;  3C8C A;  2Z6D A;  3MFX A;  3MQQ A;  1S67 L;  4MN5 A;  1D7E A;  2YKH A;  4BBU A;  3G6O A;  4HH3 A;  2KX6 A;  5G4Y A;  1EW0 A;  2OWH A;  4HI4 A;  4PKY G;  5IU1 A;  5TBM B;  4XT2 B;  1XFQ A;  3SW1 A; 
#chains in the Genus database with same CATH topology
 3QP4 A;  5CEC A;  3CUE A;  3MMH A;  1H04 P;  2ZM0 A;  3H7W B;  1NLZ A;  1IOU A;  2PR6 A;  5DKK A;  3S4X A;  5DF8 A;  3UB9 A;  4MBH A;  1H2Q P;  2IWC A;  3IS2 A;  4Y3I A;  1ZHH B;  2R9X A;  2QJ5 A;  4O8G A;  3E4O A;  5CHU A;  2Y2N A;  4GZB A;  4KG5 A;  3MFD A;  1KE3 A;  2G7I A;  2LOJ A;  3RJ3 D;  4KUO A;  3G32 A;  4Y7P A;  1P0Z A;  3PBR A;  1PZP A;  5E2F A;  3OPL A;  1QGB A;  5FSR A;  4MNR A;  3AGD A;  5GHZ A;  1FBR A;  2VKS A;  2XWB F;  4BWC A;  2PD8 A;  3W2Z A;  2UWX A;  5AVF A;  3HJI A;  2Y2M A;  5HAI A;  1NLY A;  2V20 A;  4OLD A;  2V9A A;  1IYS A;  2HDS A;  4Y17 A;  4K08 A;  3T4Q A;  2WK0 A;  1P9W A;  1NZO A;  3UY6 A;  2JKT I;  3EEH A;  3F1O B;  3HUN A;  1F9I A;  3B3X A;  1KOU A;  2WKH A;  2A24 A;  3IBR A;  5HL1 A;  1WYB A;  3JVV A;  4APL A;  4OOM A;  5BOH A;  3Q1F A;  4I3I A;  4X1M A;  1TF1 A;  1H8Y A;  1TS0 A;  3WRT A;  4JF5 A;  1NYM A;  5DTS A;  3SW0 X;  2NUT C;  1YLW A;  1S1Z A;  5J4E A;  5FI7 A;  1VEU A;  3G34 A;  2INW A;  2XQZ A;  3EGD C;  1GHQ B;  2D01 A;  2XF3 A;  1T1A A;  3OPP A;  4WZ5 C;  3NCK A;  1E3U D;  3PHY A;  3LGO A;  4IBR A;  3VP0 A;  4ONT D;  1G4F A;  5HPI A;  4E6W A;  5EVI A;  2W1T B;  4CQH A;  1XP4 A;  1V9Z A;  3B33 A;  4Y15 A;  1CI9 A;  3FPV A;  1LHY A;  2GDN A;  4UAA A;  1IYQ A;  5L8M A;  1NRF A;  4GN2 A;  1SKO B;  4LV0 A;  1WYC A;  5L10 A;  5GHY A;  4UQI S;  4JXG A;  1S4R A;  1KGE A;  5EE8 A;  4FOF A;  3CIT A;  3O88 A;  1L0G A;  4I3J A;  3UME A;  1M40 A;  2W3D A;  1GHP A;  3ZRZ A;  1ES3 A;  3OPR A;  4EW7 A;  1K57 A;  4X55 A;  2L1M A;  3PBN A;  2RKY A;  2OLV A;  2XWJ I;  5FQM A;  3QP1 A;  3EWK A;  1OTA A;  2ZLY A;  1K6R A;  1PZO A;  5FO8 C;  5F82 A;  4B9O A;  2PAV P;  3ZHH A;  5DN5 A;  1KDS A;  2JHE A;  3MQL A;  2WGV A;  2C5W B;  4RYE A;  1MWT A;  4JGP A;  5F1F A;  2FH5 A;  3IXH A;  2ZC4 B;  3LY3 A;  5DKL A;  1M6K A;  1XX2 A;  1CEF A;  5I94 A;  1T19 A;  4OPQ A;  3HLC A;  2WKQ A;  1HLU P;  4Y2F A;  4S2N C;  3TW8 A;  4YOF A;  4GHI B;  3PR6 A;  2VJW A;  1Z92 B;  1OT9 A;  3U2A A;  1PRQ A;  1HCC A;  4C16 A;  1F5M A;  4G3W A;  2VV7 A;  4EER A;  1F2K A;  2QMI A;  4GOG A;  4PM6 A;  3TSG A;  4BWI A;  3SOI A;  4K91 A;  4GB7 A;  1N9B A;  2HP9 A;  4KZB A;  4JGQ A;  3DWK A;  2VGK A;  4FXG G;  4KZA A;  3Q07 A;  1XGJ A;  2W3F A;  4WBG A;  3K3D A;  3QP8 A;  4Z1W A;  4JGR A;  3PTE A;  2CMN A;  2CG7 A;  1TS7 A;  2HGV A;  1KGG A;  4BLM A;  4WMC D;  2Y2H A;  4R6L A;  4E04 A;  4LV3 A;  4DDY A;  4L9F A;  3KYQ A;  3LO7 A;  2EX9 A;  4CSY A;  3KYZ A;  4J38 B;  4LRX C;  3UE1 A;  2M7V A;  2Y2I A;  3H7W A;  3HBR A;  3QP6 A;  2D02 A;  1KDW A;  1AWI A;  1Y4O A;  1U5M A;  4ZH1 D;  3QP5 A;  3BFF A;  2V0U A;  1JVJ A;  2QZ6 A;  5AQB A;  4DF6 A;  3E0Y A;  4JBF A;  3ZLE A;  1E4D A;  3N6I A;  2O9B A;  1NXY A;  2B95 A;  4R1G A;  1CI8 A;  5DFY A;  4D2O A;  2X71 A;  3W4Q A;  1OK3 A;  3G2Z A;  1DJA A;  3KSI A;  3BQ8 A;  4I38 A;  5TR7 A;  3T4K A;  3EJH A;  3LIA A;  1LSW A;  1OTB A;  2QKP A;  4R70 A;  2V1A A;  4UQI M;  2KOI A;  5AVE A;  2BG1 A;  3BEC A;  1T18 A;  3A0V A;  3BFG A;  3CLO A;  3NDG A;  3T4O A;  1QO6 A;  3A0S A;  1IYP A;  3KX0 X;  1E3U A;  3IHA A;  4HNB A;  3IX8 A;  3ICY A;  1OK1 A;  1ACF A;  1FOF A;  4WZ5 A;  4EBL A;  2EA9 A;  4WEJ A;  1MKI A;  2QJ7 A;  3FKV A;  1DP6 A;  3F1O A;  4AYM A;  1ALQ A;  5FA7 A;  4H8R A;  4B2R A;  4DDS A;  5LBR A;  1LY2 A;  1MXO A;  1K0K A;  2BLS A;  5CEB A;  1ZJK A;  5HWT A;  3SS4 A;  3NOP C;  3C7V A;  2W80 A;  1XA1 A;  4JGO A;  1OTI A;  1LT0 A;  1YMS A;  3T4S A;  1BLP A;  2W0N A;  3FKW A;  5IHV A;  1FQG A;  3B47 A;  1K25 A;  1ZTU A;  2XRN A;  3R4K A;  3OXU D;  4F4O C;  3OC2 A;  5CGW A;  4JF4 A;  3VP3 A;  3ZFZ A;  1YPR A;  5CHJ A;  4BMW A;  4EV4 A;  3HLB A;  3DW0 A;  4LRZ E;  5DVA A;  1UWP X;  1KE0 A;  5FAO A;  4BEN A;  3LYX A;  4ZRR A;  2QWS A;  4R23 A;  4RA7 A;  5A90 A;  1H0M A;  4NG2 A;  1O7E A;  2Y8S A;  3KZJ A;  2I2L A;  4OOL A;  3VOL A;  3A3J A;  1K55 C;  1YQS A;  2HPB A;  1S67 L;  2W1T A;  3GVB A;  3WRZ A;  1D7E A;  3TOI A;  2YKH A;  2XRO A;  1HZO A;  5IT5 A;  4MSL A;  1SKO A;  4FCF A;  1LI0 A;  5CX7 A;  3F6K A;  3LEQ A;  5EOO A;  2ZQ9 A;  3VFH A;  4HI4 A;  3LFV A;  3ITA A;  4Q0H A;  1XFQ A;  4X25 A;  3Q81 A;  2WUQ A;  1XJ3 A;  2HP6 A;  2XH9 A;  4GKU A;  3IBJ A;  1TPM A;  5AQA A;  3MBZ A;  2FFY A;  2UWN A;  4KG2 A;  1RP5 A;  2RKZ A;  3F1P B;  1TDG A;  5CHM A;  5DJT A;  2C6W B;  3CG5 A;  3BLS A;  1OPX A;  5DTK A;  2K31 A;  3ZG0 A;  3NC8 A;  5EFW A;  1ERM A;  4WMC A;  3LEZ A;  3G30 A;  1KVM A;  4OP5 A;  5EOE A;  5CGX A;  3ZCZ A;  3IH9 A;  2JCH A;  1BLH A;  3SH8 A;  3BLM A;  1YT4 A;  2RCX A;  4DE3 A;  1IEM A;  1DY6 A;  2W81 A;  1NYY A;  3L89 M;  1XA7 A;  4GHI A;  3KXV A;  2W27 A;  3A3D A;  4DXB A;  1NRJ A;  1MWU A;  3D9Y A;  3RXX A;  4E3L A;  3ULF A;  2X2Z A;  3M2K A;  1JNU A;  4G3V A;  3MS6 A;  3LIE A;  5HYU B;  1EI5 A;  2CKU A;  4HP9 A;  4LCM A;  5FAT A;  1OTD A;  3ZQ5 A;  1C3B A;  3DAV A;  1YLY A;  5GLD A;  2V8F A;  2XFS A;  3ZYT A;  2XSS A;  5GLA A;  2GX5 A;  2FFF B;  2PHY A;  3IX3 A;  5HAR A;  2ZC3 B;  4PPR A;  4DJ2 A;  1OK2 A;  1XKZ A;  3ZVW A;  2AVX A;  1ES4 A;  3P7N A;  4AYE A;  3L7H A;  4ETZ A;  4MEZ A;  1J3W A;  3MQO A;  1PWG A;  3O86 A;  3C4O A;  5DTT A;  5FEG A;  1W63 Q;  3NOT C;  2WII C;  1SHV A;  2W1R A;  3OED C;  1WA9 A;  4JXW A;  1SCW A;  5CTM A;  2PR5 A;  1OK9 A;  3NIA A;  3PBQ A;  3VE3 A;  1CK3 A;  4UA6 A;  3T1R A;  2JN7 A;  4KZ7 A;  4KZ6 A;  3WWX A;  2JRA A;  1K4E A;  2OAP 1;  4DE1 A;  3V3R A;  4QD4 A;  1Y28 A;  1PW1 A;  1ZKJ A;  4UA7 A;  3IF5 A;  2BZM A;  2IZ4 A;  2VEA A;  4LV2 A;  4ME4 A;  4HES A;  3UPN A;  4HH2 A;  4ARZ B;  3GEC A;  3Q7V B;  3T1X A;  2G7U A;  2ZMF A;  4KZ8 A;  4PM5 A;  1O07 A;  4UEY A;  5EPH A;  3IXG A;  3IXD A;  3ZG7 B;  3S1Y A;  4JHS A;  4HY8 A;  1RLH A;  2J7V A;  2J9P A;  4N92 A;  5G18 A;  2ZMA A;  3EQV A;  5I0Q B;  4Q0I A;  4BJP A;  3ZG8 B;  4JF6 A;  1TVF A;  3LIB A;  3KSG A;  3FZC A;  3LR3 A;  4HQA A;  3N4I A;  4NK3 A;  1K6S A;  3P09 A;  5FDH A;  4U0X A;  4EQI A;  4Y5F A;  2W3G A;  2ACG A;  4Y0U A;  3IF6 B;  2OAQ 1;  1QMF A;  1K55 A;  4IBX A;  1GSV A;  4KQO A;  2JBF A;  2VZW A;  4MMN A;  3C4P A;  1YLP A;  1L2S A;  5L07 A;  4QU3 A;  2BAS A;  3TJZ C;  3LIF A;  3EQU A;  1TDL A;  3UPP A;  3OPH A;  3CAL A;  5EEC A;  3HCY A;  3IHB A;  3FC7 A;  2A49 A;  1SDE A;  3LUQ A;  1MC0 A;  4R4S A;  5A92 A;  4PO7 A;  2MCZ A;  4RX3 A;  3BEB A;  5F83 A;  1IYO A;  3IX4 A;  3IF6 C;  1XFN A;  1W5D A;  5G4Z A;  4F94 A;  2P9V B;  2PRF A;  4EQ1 A;  4MBF A;  3MXR A;  2ZBB A;  2EC3 A;  1S1Y A;  1CEG A;  1YM1 A;  1PPQ A;  2J80 A;  2IA2 A;  1ES5 A;  3I7J A;  2I9V A;  2ZM8 A;  3O87 A;  3T4J A;  3S7Q A;  3EEA A;  3PBS A;  3T5O A;  4WJG 2;  3HJK A;  4IUH A;  4UHU A;  2JKG A;  4YNR A;  1OJY A;  4N1X A;  4BD0 A;  2HF6 A;  5JPM G;  3PYP A;  2H28 A;  3BM6 A;  5A8B A;  4E3J A;  2OSU A;  3E4P A;  4KG6 A;  2PBD P;  3BJN A;  3F1P A;  3FYZ A;  4DJ3 A;  2L0W A;  4LOS A;  2XEP A;  4AYI A;  2WGI A;  1YSP A;  1N9O A;  3M2J A;  1ODV A;  1IFQ A;  4XUZ A;  2WZX A;  1MD8 A;  1QME A;  1CKL A;  4L9G A;  4H6J B;  4XUX A;  1ESU A;  2M7U A;  4B2S A;  2ZC7 A;  1YLZ A;  3UE3 A;  3R7W B;  3C38 A;  3D4F A;  4KZ5 A;  5HYT B;  1JWZ A;  3HLE A;  5KSH A;  4YIZ A;  2HZ5 A;  4DRT A;  4YFM A;  4QY5 A;  3IX0 A;  4R3B A;  1X0O A;  3PBO A;  3V5M A;  2PD7 A;  5JYP A;  3SS5 A;  1PWD A;  4D60 A;  3BFE A;  1W8Q A;  2QY0 A;  1PIO A;  3L9K A;  4U3T A;  1OTE A;  3T12 B;  4Z9Q A;  4OQG A;  1BSG A;  4M4X A;  4CLC E;  2DCF A;  2O99 A;  2V1B A;  5TFQ A;  2NUP C;  4P6B A;  3NUL A;  2M1C A;  3HUO A;  1YSQ A;  3C7U A;  4MBK A;  3DTI A;  2Z2M B;  1DP8 A;  4QJG A;  4ZDX A;  3UB8 A;  5FQQ A;  4QY6 A;  4N1H A;  1TEM A;  4ZTK A;  4PM8 A;  5L09 A;  4IVI A;  4WUJ A;  1G5U A;  1GKN A;  3M7P A;  2Y91 A;  3LIC A;  5HDS A;  4Q8I A;  4WM9 A;  1KE4 A;  4KZ3 A;  2EHF A;  1GA9 A;  3BYD A;  2WAF A;  4S2J A;  3ZG9 B;  2Y8T A;  3ERB A;  2XRD A;  5GL9 A;  1NJ4 A;  3O3V A;  2Y2P A;  3S7N A;  1E8B A;  3BFD A;  2Z6D A;  4ARZ A;  3MQQ A;  3Q7V A;  1Q2Q A;  4MN7 A;  2RLP A;  3UDI A;  3NY4 A;  4M3K A;  1BZA A;  3FWL A;  4E3O A;  2EFX A;  2XQW C;  3JPU A;  4E6X A;  5IU1 A;  2JKR M;  4KZ4 A;  3OCN A;  3AGF A;  2HJE A;  1XXM A;  3IQA A;  2WZZ A;  4YWZ A;  5HD3 A;  5M19 A;  2ZQA A;  2H10 A;  4KUK A;  3E2L A;  1Z6F A;  5DF7 A;  4FUW A;  1G28 A;  1DRM A;  1XJ2 A;  3IF6 A;  4ID4 A;  4EES A;  4Y13 A;  5EM0 A;  4F3L B;  1TD5 A;  5GLC A;  4GJ4 A;  1DJC A;  5CXW A;  3OLO A;  1MBL A;  3TE8 A;  4YNX A;  2XLN A;  4NEE D;  5E2G A;  1I2S A;  2XK1 A;  4K0X A;  4Y0O A;  4AYD A;  3N8L A;  5FQK A;  3UB5 P;  1PI4 A;  3MF0 A;  3UDF A;  5HDC A;  1IEL A;  1S0W A;  2I72 A;  1KVL A;  2HDQ A;  3NBL A;  1GPZ A;  1YMX A;  1SKF A;  4QWO A;  4MCW A;  1FIK A;  3UNW A;  1PWC A;  2DRW A;  5FL3 A;  1XJ6 A;  3E2K A;  5J3W A;  3RFB A;  1CJF A;  1Y54 A;  2XD1 A;  4GDN A;  3ZG5 A;  3RJU A;  3ZNY A;  2YKF A;  2B18 A;  2IZ3 A;  2P9V A;  3OP8 A;  2XGN A;  3WSX A;  1L0E A;  5DFX A;  4NXE A;  1OJ5 A;  5F6A A;  1IKG A;  3C30 A;  2VK3 A;  1H8M A;  2Y2G A;  3ZD1 A;  4OLG A;  2W3H A;  3HUM A;  2B5I D;  3TVJ A;  3KSH A;  5F5Y A;  4KQD A;  4DMZ A;  1HVB A;  2KRI A;  2KLI A;  4BQM A;  1ZG4 A;  2OOL A;  2JE5 A;  3EGX C;  1LL9 A;  4JLF A;  1FR6 A;  1GHM A;  1SDN A;  4HIA A;  4MN6 A;  1ZC2 A;  3RTY A;  1ERO A;  3WSY A;  4S2O A;  3PAG A;  4N9L A;  1GA0 A;  2PYR A;  4I3A A;  5CED A;  1W7F A;  4E3I A;  3WS4 A;  4OOY A;  4EBN A;  1E25 A;  4HJ4 A;  4GD8 A;  4H6J A;  2A2L A;  1DP9 A;  2XDM A;  1V9Y A;  3R7W A;  1D1J A;  3VWO A;  1JTG A;  2DNS A;  2EX6 A;  3QHY A;  3GQZ A;  5FAP A;  3IWO A;  2X02 A;  3NOU C;  1LSV A;  3E4Q A;  4LOT A;  3NFP I;  1VHM A;  4Q0J A;  3MR0 A;  5HL6 A;  3D3O A;  4LCL A;  2P74 A;  5K5B A;  4IUK A;  3MKE A;  4B93 A;  1UOT P;  4ETX A;  1N4O A;  2ZQD A;  3DTK A;  4GLQ A;  1E5G A;  1T1C A;  1NWV A;  5E2E A;  3D72 A;  4ZJ3 A;  3F1N B;  5J7E A;  2ZQC A;  3S7P A;  3QNB A;  1I2W A;  3LR5 A;  3NDE A;  1RGZ A;  4HEF A;  1FSW A;  2A3U A;  3UMD A;  5GLB A;  2WKE A;  5I5L A;  5DF9 A;  1G6O A;  1GSW A;  1Z09 A;  2Y55 A;  3HL9 A;  2ZQ8 A;  3QNC A;  3K3T A;  1OME A;  2EX2 A;  4BD1 A;  3U4L P;  5HD5 A;  1K54 C;  2VA0 A;  5HAP A;  4NKP A;  1HD8 A;  4RVA A;  1ELV A;  1GKG A;  2EWW A;  2ZL1 B;  2Y8H A;  4PMA A;  1BUL A;  5GHX A;  2WKR A;  4X53 A;  1FSY A;  2L4R A;  3WS0 A;  2OV5 A;  5HDD A;  2H0Y A;  4N7E A;  4KQR A;  1YAX A;  1RGY A;  4L0L A;  3VSL A;  5MC7 A;  1XPB A;  5KZH A;  2Y2L A;  5M18 A;  1SS2 A;  2J3W A;  3BY9 A;  4HP4 A;  1W79 A;  4OQ0 A;  2GZA A;  3IH8 A;  3KSF A;  4HBU A;  3MXS A;  4II7 A;  2Z2L B;  2VX8 A;  5E2H A;  1YLT A;  4A5R A;  4EBP A;  1MY8 A;  2JKF A;  3MXQ A;  4F3L A;  1ERQ A;  2XFT A;  1VVD A;  4RX2 A;  1FCN A;  3HLG A;  4QPR A;  1OT6 A;  3VMA A;  5FAQ A;  3NJA A;  4A5W B;  3T4T A;  4C6Y A;  3MZD A;  3UB6 A;  3VSK A;  1PI5 A;  1EWZ A;  1AXB A;  2Y2K A;  3H82 B;  2LB5 A;  3N7W A;  1KGF A;  4X6T A;  3G4P A;  2VV8 A;  4ZJ1 A;  3BQA A;  3JYI A;  3GTC A;  5HSQ A;  4X1L A;  1K4F A;  1D06 A;  4KKD A;  5JYO A;  1BYW A;  2G2W A;  4LGW A;  3WS5 A;  5EVE A;  4HJ6 A;  2V8C A;  3NI9 A;  2GJ3 A;  5AQ7 A;  4OPR A;  3MJQ A;  5HZP B;  4IJG A;  4C3Q A;  3ISG A;  4K12 A;  5KIZ A;  5HAQ A;  1PYY A;  2O9C A;  1STZ A;  5CER A;  5FAS A;  2R78 A;  4ZAM A;  4PAU A;  2J9O A;  4HJ3 A;  2WKI A;  4LFU A;  3HLF A;  1BTL A;  4OPZ A;  3S7O A;  1NZU A;  4X68 A;  5FI2 A;  4LLO B;  1P97 A;  4R3J A;  5D3O A;  4EU0 A;  2EX8 A;  4LPZ A;  1XGI A;  2ERJ A;  3LY4 A;  3CPT B;  2VV6 A;  2V2F F;  3ZDJ A;  4XXR A;  2JKR I;  2JGX A;  4S2I A;  1FR1 A;  1NY0 A;  2EXB A;  5FQ9 A;  1H5X A;  1Q2P A;  1S4S A;  1LSX A;  2Q9N A;  4FH4 A;  2K7S A;  3TG9 A;  4MLL A;  1WE4 A;  4NXG A;  2PBY A;  4EUV A;  1LL5 A;  3FG8 A;  3ZVT A;  3HRE A;  3PBT A;  2UV0 E;  4DKI A;  3H9W A;  3HLD A;  4HHD A;  2Y59 A;  1FIL A;  1K56 D;  3RXW A;  3ZLD A;  3FV7 A;  3INB C;  2Y79 A;  4MN5 A;  3N8S A;  5AQ9 A;  1OJW A;  4OON A;  2B5R A;  2RL3 A;  2O0Y A;  3P01 A;  3G6O A;  3V3S A;  3SS3 A;  1IKI A;  1H3Q A;  4QHC A;  3TRC A;  3GR2 A;  2Y2J A;  4O0P A;  3IWI A;  4B88 A;  5TBM B;  3LR4 A;  4XT2 B;  3CJM A;  3SW1 A;  3NEC A;  2E8I A;  4GCZ A;  1HTZ A;  1K38 A;  3O5Y A;  3CZD A;  3VOY A;  3CHW P;  1BT5 A;  4C75 A;  3NHQ A;  1P9R A;  3A3E A;  3VP1 A;  1UWN X;  1K54 A;  3FGT A;  4P0M A;  4NET A;  2Y2O A;  1RCJ A;  2WAD A;  3F1N A;  3DWZ A;  2BTF P;  4IVK A;  4EWF A;  2ZQ7 A;  3Q7Z A;  1J9M A;  3UE6 A;  4PM9 A;  2HV1 A;  2P7J A;  2O9A A;  2IWB A;  1VET B;  5E43 A;  5F69 A;  1W63 M;  4DJZ A;  4WEL A;  1XJ4 A;  2WAE A;  1PW8 A;  4P85 A;  4EXO A;  3VV4 A;  4CJN A;  4I5S A;  3SZT A;  1DJB A;  3A0R A;  3CI0 J;  3VP2 A;  4CLC B;  4WZ4 A;  4QB8 A;  2ZOH A;  2Y2Q A;  2V8E A;  2KMS A;  3CMZ A;  3O8E B;  1VM1 A;  3C5A A;  4G3K A;  4HOI A;  4JXS A;  5DN4 A;  2HDR A;  3A3F A;  3OZH A;  4NXB A;  4WL9 A;  3M6B A;  4WLA A;  1C1Z A;  3GSG A;  1L3L A;  2CC1 A;  3GXE A;  1N9L A;  4BL3 A;  1BLC A;  5F1G A;  4S2P A;  4BBT A;  2ZL1 A;  5FI6 A;  1MPL A;  3ZNT A;  3KYE A;  3VP4 A;  2RL0 A;  3LI8 A;  4K0W A;  1FCO A;  2WGW B;  3SH9 A;  4EET B;  1OJV A;  4GD6 A;  2HDU A;  5FEF A;  1O9A A;  5TGF A;  1GSX A;  4PKY A;  2ZMV A;  1W8Y A;  3UB7 A;  4X56 A;  4GS9 B;  4E3M A;  3MQ0 A;  3E98 A;  4EUZ A;  1PFL A;  2JC7 A;  5AJG A;  2XRB A;  4PM7 A;  2LB9 A;  4RQ9 A;  3BFC A;  4CLC C;  3S22 A;  4R4R A;  2P04 A;  3C2W A;  4OPY A;  2EXA A;  5A91 A;  1LI9 A;  5HX9 A;  3LR0 A;  1G4G A;  3IU3 I;  3MZF A;  3T1S A;  2WYX A;  3JVU A;  1MWS A;  2J8Y A;  2Q9M A;  4CLC D;  4EEU A;  3CAX A;  5M1A A;  2V1Z A;  3EOI A;  3BW6 A;  5EV0 A;  3W4O A;  4KEN B;  4HBT A;  2VGJ A;  2ZD8 A;  2JKT M;  1ONG A;  2H5S A;  3HVF A;  1YKD A;  2O39 C;  2DMW A;  2EFU A;  2OLU A;  4NXF A;  3K3C A;  4OKP A;  4LV1 A;  3DTE A;  2MJ6 A;  5HWV A;  5KSC A;  2J3T C;  2XR0 A;  4FH2 A;  1L0F A;  3H82 A;  5A93 A;  5FDS A;  2PU2 A;  5FQJ A;  3IWQ A;  2W3E A;  2B02 A;  4FD8 A;  2ZOI A;  2HJ9 C;  2J3T D;  4B4Z A;  4S2L A;  3T4L A;  1GHI A;  1K56 A;  4P6Z S;  4O7D A;  2JGW A;  1MKM A;  1VQQ A;  1TS6 A;  2EWV A;  4O01 A;  1ES2 A;  3W8K A;  3N8R A;  4ZBE A;  5U47 A;  3UPO A;  3OOV A;  3GDI A;  1H03 P;  4DN0 A;  5J8X A;  4ZJ2 A;  3OCL A;  2VLG A;  5DJU A;  2OWJ A;  2IWD A;  1MD7 A;  1SZV A;  4LEN A;  5HWW A;  1JTD A;  3IS2 B;  1JWP A;  3LCE A;  2X01 A;  3T50 A;  2HP5 A;  4P87 A;  5TJJ A;  5CGS A;  4I39 A;  4N9K A;  1Q3X A;  2A55 A;  3CPT A;  3VE4 A;  5HYP A;  4IGD A;  1H2P P;  4ESP A;  3LI9 A;  3V39 A;  3CUE C;  1HFI A;  3BRM A;  2RLQ A;  4OQI A;  2FZ0 A;  1GCE A;  4WEK A;  5F68 A;  3CWF A;  2G2U A;  1HFH A;  2E8J A;  4PZ5 A;  3FPW A;  2KDK A;  4FTX A;  1JWV A;  1L0D A;  4OQH A;  2XD5 A;  3OBF A;  2V0W A;  3PAE A;  5EVL A;  1I5Q A;  4BL2 A;  3MSH A;  1SRZ A;  4DXC A;  2Y4A A;  5L2F A;  1S66 L;  2A24 B;  1CF0 A;  2PT7 A;  5EUA A;  4FSF A;  4E3K A;  1CQA A;  1FCM A;  2PYP A;  5TBM A;  2Y8R A;  4XT2 A;  2VGL S;  3KO6 A;  3A3I A;  4OVD A;  4AFI A;  4Y0T A;  2XA7 S;  4GNU A;  2CG6 A;  4GW9 A;  4JXV A;  2PU4 A;  4MUC A;  3ZGA B;  4BBV A;  1VEU B;  1E88 A;  4LRY C;  3VOZ A;  1TS8 A;  2ZC6 B;  3IXB A;  1YLJ A;  4KZ9 A;  5C5K A;  1MZU A;  4S2N A;  1PNE A;  5EVI B;  4WN5 A;  1NWZ A;  2H0T A;  4E3N A;  2R9W A;  1VET A;  5HZH A;  3BY8 A;  1G68 A;  3GRJ A;  3UDX A;  1BUE A;  4R3A A;  3ZD2 A;  2P08 A;  4WF0 A;  2ZM2 A;  3G35 A;  3AGE A;  4CLC A;  4P6Z M;  2YRA A;  4JPM A;  4IHQ A;  3V50 A;  5FQI A;  3GV9 A;  2QYB A;  3V67 A;  1F98 A;  2K2N A;  3LID A;  1ESI A;  3G31 A;  1LL8 A;  3M6H A;  3RH8 B;  1LLB A;  3MZE A;  4PHT A;  3ITB A;  4IED A;  5EVI C;  2MCY A;  1TPN A;  3WS2 A;  1UGU A;  2QPN A;  1QUB A;  3P98 A;  3BWL A;  3VFF A;  2WGW A;  2GNX A;  4MDZ A;  5KMW A;  1VB6 A;  1OJG A;  3SH7 A;  5EVI D;  4R38 A;  2ZC5 B;  4GS9 A;  3UE0 A;  3GOV A;  1T1B A;  3T1Q B;  3CI6 A;  4WYY A;  3UN7 A;  2Z6C A;  4S2M A;  1S6R A;  2QHK A;  1H8Z A;  2PDR A;  2ZJ9 A;  1MWR A;  4EEP A;  1TPG A;  1ONH A;  3R62 A;  1A0K A;  4GDB A;  3MKF A;  4KQQ A;  5CRF A;  4L9E A;  3GMW A;  3DBA A;  3PXP A;  1K57 C;  1G6A A;  5EM1 A;  2WKP A;  1N9N A;  1VVC A;  4OH0 A;  3IT9 A;  4JKT A;  4CPK A;  4DE2 A;  4U0T A;  3G2Y A;  2Q0O A;  5IS1 A;  3C8C A;  3MFX A;  4B4X A;  5HW3 A;  3W4P A;  3QP2 A;  2YBY A;  3DTM A;  3HLW A;  4X69 A;  4OP8 A;  5HPF A;  4BBU A;  2ZYC A;  3K2N A;  4DE0 A;  5CTN A;  4UA9 A;  3B42 A;  4HH3 A;  2KX6 A;  5G4Y A;  1EW0 A;  1BLS A;  4R0Q A;  2OWH A;  3Q82 A;  4S2K A;  3UO9 A;  3FGR A;  2VGL M;  4PKY G;  5HFO A;  1ZG6 A;  4YIN A;  1U60 A;  2XA7 M;  3WS1 A; 
#chains in the Genus database with same CATH homology
 1XJ3 A;  4YWZ A;  4GCZ A;  3CUE A;  5HD3 A;  3MMH A;  3IBJ A;  3O5Y A;  3H7W B;  4KUK A;  3NHQ A;  1NLZ A;  1P9R A;  3F1P B;  1IOU A;  1UWN X;  1G28 A;  1DRM A;  1XJ2 A;  5DJT A;  1OPX A;  4EES A;  3FGT A;  2PR6 A;  2K31 A;  5DKK A;  5EFW A;  4F3L B;  1TD5 A;  4GJ4 A;  3UB9 A;  3F1N A;  3OLO A;  3IS2 A;  4Y3I A;  1ZHH B;  4O8G A;  2QJ5 A;  3TE8 A;  3E4O A;  3UE6 A;  4NEE D;  4KUO A;  2HV1 A;  2P7J A;  1P0Z A;  2O9A A;  5F69 A;  3PBR A;  1W63 M;  4WEL A;  1XJ4 A;  3MF0 A;  4EXO A;  5HDC A;  4GHI A;  2VKS A;  3VV4 A;  2W27 A;  4I5S A;  4BWC A;  2PD8 A;  1NRJ A;  3W2Z A;  3A0R A;  4MCW A;  3ULF A;  5AVF A;  5FL3 A;  4CLC B;  2X2Z A;  1XJ6 A;  1JNU A;  4G3V A;  2ZOH A;  3HJI A;  1NLY A;  5J3W A;  3RFB A;  3LIE A;  4HP9 A;  1OTD A;  2V9A A;  3ZQ5 A;  4G3K A;  4HOI A;  2YKF A;  4NXB A;  4K08 A;  2B18 A;  4WL9 A;  4WLA A;  3T4Q A;  3ZYT A;  2XSS A;  1P9W A;  3WSX A;  2GX5 A;  2PHY A;  1N9L A;  2JKT I;  3EEH A;  5DFX A;  4NXE A;  1OJ5 A;  5F6A A;  4BBT A;  4DJ2 A;  3C30 A;  3F1O B;  1H8M A;  1F9I A;  3LI8 A;  1KOU A;  3P7N A;  4ETZ A;  4EET B;  2W3H A;  2A24 A;  3MQO A;  3IBR A;  1GSX A;  4PKY A;  2ZMV A;  3JVV A;  3KSH A;  4APL A;  4OOM A;  5F5Y A;  1W63 Q;  3UB7 A;  4KQD A;  3NOT C;  4GS9 B;  4I3I A;  4DMZ A;  3MQ0 A;  2W1R A;  1WA9 A;  3E98 A;  1TF1 A;  1TS0 A;  2PR5 A;  2KLI A;  5AJG A;  2LB9 A;  4RQ9 A;  3PBQ A;  3VE3 A;  2OOL A;  2NUT C;  4CLC C;  1S1Z A;  5J4E A;  3EGX C;  2JN7 A;  2P04 A;  3C2W A;  4HIA A;  2OAP 1;  3LR0 A;  2INW A;  4MN6 A;  3RTY A;  3EGD C;  2D01 A;  1Y28 A;  3JVU A;  3WSY A;  1T1A A;  4CLC D;  4EEU A;  3CAX A;  3PHY A;  3EOI A;  2VEA A;  2PYR A;  3BW6 A;  4I3A A;  4ME4 A;  5HPI A;  4HH2 A;  4ARZ B;  2JKT M;  3GEC A;  2W1T B;  4CQH A;  1V9Z A;  2G7U A;  2ZMF A;  4HJ4 A;  1YKD A;  2DMW A;  3B33 A;  4NXF A;  4UEY A;  4H6J A;  2A2L A;  3K3C A;  1DP9 A;  3FPV A;  2MJ6 A;  5HWV A;  3R7W A;  1V9Y A;  2J3T C;  4HY8 A;  5L8M A;  3EQV A;  3H82 A;  4Q0I A;  2W3E A;  2B02 A;  4BJP A;  3LIB A;  2ZOI A;  3KSG A;  2HJ9 C;  4UQI S;  2J3T D;  1S4R A;  3LR3 A;  4FOF A;  4HQA A;  3T4L A;  3CIT A;  3NOU C;  1LSV A;  3E4Q A;  4I3J A;  3UME A;  2W3D A;  1VHM A;  4Q0J A;  4P6Z S;  1MKM A;  1TS6 A;  3MR0 A;  5HL6 A;  4EW7 A;  3D3O A;  2EWV A;  4O01 A;  5K5B A;  2L1M A;  4IUK A;  3PBN A;  4B93 A;  4Y5F A;  2W3G A;  3EWK A;  1OTA A;  3OOV A;  3GDI A;  4ETX A;  4GLQ A;  2OAQ 1;  4DN0 A;  3OCL A;  4B9O A;  1T1C A;  2VLG A;  2JHE A;  5DJU A;  3D72 A;  1GSV A;  2OWJ A;  4JGP A;  4KQO A;  3F1N B;  5HWW A;  5J7E A;  2FH5 A;  3IS2 B;  3S7P A;  3T50 A;  2VZW A;  4MMN A;  3LR5 A;  5TJJ A;  5DKL A;  4I39 A;  3VE4 A;  2BAS A;  1T19 A;  3TJZ C;  3LIF A;  3EQU A;  2WKQ A;  3UMD A;  4Y2F A;  5I5L A;  3TW8 A;  5DF9 A;  4YOF A;  4GHI B;  1G6O A;  3PR6 A;  3LI9 A;  3HCY A;  2VJW A;  3CUE C;  3FC7 A;  1OT9 A;  3U2A A;  1GSW A;  1MC0 A;  3LUQ A;  4PO7 A;  1F5M A;  4G3W A;  2FZ0 A;  2VV7 A;  4WEK A;  5F68 A;  3CWF A;  4EER A;  4BWI A;  3FPW A;  5HD5 A;  2KDK A;  1XFN A;  4JGQ A;  5G4Z A;  2VA0 A;  2W3F A;  3OBF A;  2V0W A;  3K3D A;  4NKP A;  4EQ1 A;  4Z1W A;  4JGR A;  2EWW A;  2CMN A;  2ZBB A;  1TS7 A;  1S1Y A;  2HGV A;  2Y8H A;  1S66 L;  2A24 B;  2WKR A;  2J80 A;  2IA2 A;  4R6L A;  2I9V A;  4E04 A;  2PT7 A;  3T4J A;  2L4R A;  4L9F A;  3KYQ A;  4FSF A;  3EEA A;  3PBS A;  3S7Q A;  2PYP A;  3HJK A;  4IUH A;  5HDD A;  5TBM A;  2Y8R A;  4XT2 A;  4N7E A;  4YNR A;  2VGL S;  3KO6 A;  3KYZ A;  2HF6 A;  4AFI A;  1YAX A;  2XA7 S;  5MC7 A;  4L0L A;  3PYP A;  2H28 A;  4LRX C;  4GW9 A;  2J3W A;  3BY9 A;  2M7V A;  3H7W A;  5A8B A;  3E4P A;  4HP4 A;  4BBV A;  3BJN A;  2GZA A;  2D02 A;  3KSF A;  3F1P A;  4DJ3 A;  4II7 A;  2L0W A;  2VX8 A;  4LRY C;  1TS8 A;  2V0U A;  3E0Y A;  3ZLE A;  4F3L A;  3MXQ A;  5C5K A;  1YSP A;  1N9O A;  2O9B A;  1MZU A;  1ODV A;  1IFQ A;  4WN5 A;  5DFY A;  4QPR A;  1OT6 A;  1NWZ A;  4L9G A;  3NJA A;  3T4T A;  4H6J B;  2M7U A;  3KSI A;  3BQ8 A;  4I38 A;  3UB6 A;  3T4K A;  3UE3 A;  3R7W B;  3C38 A;  5HZH A;  3LIA A;  1LSW A;  3BY8 A;  1OTB A;  2QKP A;  4R70 A;  2V1A A;  3H82 B;  2LB5 A;  2VV8 A;  4R3A A;  4UQI M;  3BQA A;  5HSQ A;  2KOI A;  5AVE A;  5KSH A;  4YIZ A;  1T18 A;  3A0V A;  2P08 A;  1D06 A;  3CLO A;  4WF0 A;  1BYW A;  1X0O A;  3PBO A;  3T4O A;  3A0S A;  4CLC A;  4P6Z M;  3KX0 X;  2PD7 A;  4IHQ A;  4HJ6 A;  4HNB A;  3V67 A;  2QYB A;  1F98 A;  3ICY A;  2GJ3 A;  2K2N A;  3LID A;  3MJQ A;  1LL8 A;  4IJG A;  3RH8 B;  4PHT A;  5KIZ A;  2EA9 A;  2O9C A;  1OTE A;  4WEJ A;  1STZ A;  2QJ7 A;  2R78 A;  1UGU A;  4PAU A;  1DP6 A;  4HJ3 A;  3F1O A;  4CLC E;  4M4X A;  3BWL A;  2GNX A;  4MDZ A;  3S7O A;  5LBR A;  1VB6 A;  2O99 A;  1P97 A;  4LLO B;  1OJG A;  2V1B A;  5HWT A;  2NUP C;  3NOP C;  4EU0 A;  4R38 A;  4GS9 A;  4LPZ A;  2M1C A;  1T1B A;  1YSQ A;  4JGO A;  1OTI A;  1LT0 A;  2VV6 A;  3CI6 A;  1DP8 A;  2Z6C A;  3T4S A;  2W0N A;  2QHK A;  2PDR A;  3UB8 A;  4EEP A;  2JKR I;  3B47 A;  1ZTU A;  2XRN A;  1S4S A;  3R4K A;  4L9E A;  1LSX A;  4WUJ A;  2K7S A;  3DBA A;  3OC2 A;  3LIC A;  3PXP A;  5HDS A;  4NXG A;  4BMW A;  4EUV A;  4LRZ E;  1UWP X;  3FG8 A;  3LYX A;  3PBT A;  2WKP A;  4ZRR A;  2QWS A;  1N9N A;  3H9W A;  2Y8T A;  4HHD A;  5IS1 A;  2Y8S A;  3S7N A;  2I2L A;  4OOL A;  3C8C A;  3VOL A;  2Z6D A;  4ARZ A;  3ZLD A;  3MFX A;  3MQQ A;  1S67 L;  2W1T A;  2Y79 A;  4MN5 A;  4MN7 A;  1D7E A;  2YKH A;  2XRO A;  5HPF A;  4BBU A;  3K2N A;  2O0Y A;  3B42 A;  5IT5 A;  3P01 A;  3G6O A;  4HH3 A;  2KX6 A;  1H3Q A;  4MSL A;  5G4Y A;  1EW0 A;  3TRC A;  2OWH A;  5CX7 A;  3F6K A;  4O0P A;  3FGR A;  2VGL M;  4HI4 A;  4PKY G;  5IU1 A;  5TBM B;  3LFV A;  2JKR M;  3LR4 A;  4Q0H A;  2XA7 M;  4XT2 B;  1XFQ A;  3OCN A;  3SW1 A;  2HJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...