3NJFA

Y26f mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIFTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 18
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njfA00
4HZ1A 4YVUA 2OV0A 2VM4A 1JXGA 1XB3A 2PPEA 1J9TA 1MDAA 3OMAB 2IDTA 1ID2A 2LLNA 1B3IA 3JTBA 1AANA 4BWWA 2UX7A 4F7KA 1KCBA 4DPBX 4TXVB 1NICA 2BWIA 3CDZA 4HCIA 1OCOB 4YVNA 4CSZA 1XMEB 4BWUA 2VSKB 1NIDA 1L9PA 3T6ZA 1KGYE 1OCZB 2FWLB 1NZRA 4BWTA 3WKPA 4BDVA 1A3ZA 1V10A 4E9XA 3AY2A 3EH3B 3N2JA 2DV6A 4E9WA 1ET8A 2CALA 4YSPA 4DP0X 2IWFA 3DKHA 3WNIA 3EH4B 1PLBA 2VSMB 1A4BA 3PXLA 3WG7B 2IDQA 3ZDWA 1L9SA 3MBWB 1RKRA 7PCYA 1ZDQA 5EHFA 1KDIA 4GP5B 4X4KA 5B1BB 3DTUB 2R7EB 2HZHA 1HAUA 3NJHA 4ZK8A 2HX8A 3SBRA 2OJ1A 4A2HA 1SNRA 1IBYA 3T6VA 5A7EA 4BXVA 5I6MA 3NSYA 3X1GA 2DWTA 2N0MA 1BQ5A 4YSTA 2W88A 1CUOA 2GC4C 4G70B 1GS8A 3NT0A 4G7QB 4KO6A 2QPDB 4HHWA 1GS7A 3CVBA 3UAEA 4E9SA 4YSQA 1CYWA 3NJGA 3UABA 2CUAA 3FSZA 1GR7A 2H5UA 3N55A 3X2QB 1T5KA 4DP5X 1CC3A 3FYIB 5F7AA 4YSAA 2P80A 3RYMA 2JFCA 3PAVA 2PPDA 5B1KA 1OOWA 1BQKA 2MTAA 2H3XC 1YLBB 2GBAA 1SJMA 1JZGA 1N68A 2HLEB 2BP8A 3AW5A 4E9YA 1DZ0A 1J9RA 2CCWA 3HEIB 4KNTA 4UANA 2RACA 4M4RB 4E9RA 2JXMA 4KNSA 3X1BA 4E9VA 2J56A 4P5RA 4YSSA 1AZUA 2YAMA 2J57A 3CDZB 4G72B 2UXTA 8PAZA 3S8FB 2PP8A 3OMNB 4N8UA 1WS7A 2XUWA 3FQYA 3T6WA 1BYPA 1ETJA 5I6OA 3UADA 2EILB 4YL4A 4JHVA 3AZUA 1I53A 3AG1B 3U25A 4WTQA 4K9JA 4BK5C 3ABGA 3BVDB 3T71A 1PZAA 1NIAA 1SHXA 1TKWA 4HHGA 4F2EA 2XV3A 3KW7A 3OD3A 2BO0A 2P80D 2Y69B 1PY0A 2IDSA 3QJSB 3H4HA 1N70A 2UXGA 3QJVB 4PCYA 1JOIA 3FYEB 2ZWNA 1JVLA 4PAZA 2FTAA 1TEGA 3FU9A 4GY4A 4UF7C 1ET5A 3QJUB 3OM3B 1JZEA 2R7EA 4UAHA 1XB6A 1V55B 2B08A 2YAQA 1ILUA 4Q89A 1PNCA 3QJTB 1SF3A 2FQGA 2XV2A 4Q8BA 1PLCA 3ZX1A 1EZLA 2AZAA 1BEXA 3QJQB 4G71B 4DP1X 1J9QA 1GS6X 5FC9A 1JXFA 3NJFA 3X1NA 2HRHA 3DIVA 4GYBA 2X88A 7PAZA 1IUZA 3TASA 1NPJA 1L9QA 2XX1A 1XB8A 2VW6A 2FQFA 5D4JA 3NSDA 3L45A 4HAKA 2VMJA 3FU7B 5PAZA 2FNWA 2HXAA 3CVCA 4A2GA 4DP2X 3FPYA 2H47C 1NIFA 2YQBA 2BW4A 2UXVA 2PPFA 2B3IA 3ZIYA 3NJMA 5B1JA 1OE2A 1GSKA 4YSEA 2WO2B 4EF3A 1E67A 2Q5BA 1X9RA 2Y1AA 2BP8B 2BZ7A 2IDFA 3TA4D 6PAZA 1BQRA 2J5WA 3TU6A 4WKXA 4KO9A 3PAUA 1AS8A 4AKPA 3T9WA 2JKWA 5AZUA 5B7MA 4KO7A 3ZBMA 1PZBA 2XVBA 2VW4A 1J9SA 1OF0A 3IBOA 3X1EA 5I26A 4E9QA 3S8GB 3V9CA 1PMYA 3ABKB 4HIPA 1URIA 2YAPA 2ZXWB 2XXGA 1TEFA 2ZOOA 1OCRB 2IWKA 3GDCA 4HCFA 1BXAA 1KV7A 2EIMB 2XWZA 3IEAA 1ASOA 1PF3A 2AVFA 3FS9A 2XV0A 1W6WA 3PCYA 1ASPA 1M56B 1ZIAA 4FAAB 1FA4A 5I6NA 1PLAA 2IWEA 2QDWA 4DP9X 4KOCA 1IBZA 2VN3A 2YARA 1JXDA 3G5WA 2IH8A 2TSBA 4A66A 6PCYA 3FSWA 1AZNA 3EHBB 1OV8A 2PPCA 4AX3A 2AFNA 2XX0A 3FQ2A 1QNIA 2I85A 2PP7A 3FT0A 2FT8A 3QJRB 1J5DA 2YAEA 2QDVA 4DPCX 3NJNA 2TSAA 2GC7C 3EF4A 3OMIB 1ILSA 2IDUA 1GW0A 3EH5B 1AZCA 3HB3B 2XXFA 2CBPA 4KOBA 5I6LA 1TU2A 3SQRA 1DYZA 2HX7A 1BAWA 1HFUA 1E30A 3CVDA 3GXUB 5I5JA 1AAJA 4AZUA 1R1CA 1WA0X 3WI9A 1AG6A 1RCYA 3WNJA 1E5ZA 4W1TA 5B3SB 4JHUA 3FU7A 1EHKB 2J55A 4M3HA 4DP4X 1NIEA 2EIKB 1UATA 3X1FA 4QLWA 3AG2B 1ZDSA 2IH9A 1HAWA 1NIBA 4DPAX 2I7SA 3D12B 4DP6X 3S3BB 4NAJA 2QT6A 1E65A 3ASOB 4AKQA 4YSDA 4F2FA 2HRGA 3NJJA 2OCCB 4AKOA 1JZHA 1AG0A 1SDDA 1AACA 2EIJB 2I7OA 3WIAA 1GY2A 4A2FA 1M57B 4A67A 1A4CA 1IKOP 1PZCA 2WSDA 1OE1A 3FSVA 9PCYA 3S3CB 2YAHA 1BYOA 4A68A 2BHFA 3NP4A 1SDDB 2FQDA 3IE9A 4DP8X 5AFAA 1ET7A 1AS7A 1NWOA 2CAKA 1QLEB 1AQ8A 4ENZA 2UXFA 1ZV2A 4NERA 4G7SB 1SFDA 1AIZA 3NYKA 5B1JC 1RZPA 1MG3C 3GYRA 1A8ZA 2EINB 1W8EA 3UGEA 4BXSV 1WS8A 2GSMB 2XU9A 3NP3A 3QQXA 1MZYA 5B7FA 3V9EA 4HALA 3CZUB 4CSPA 1L9OA 2DYRB 4L0PB 2Q9OA 2W8CA 1A65A 2MRYA 3QPKA 3NJLA 2GB2A 2WO3B 3KW8A 1PCSA 2DY2A 1WA1X 2DYSB 1E5YA 4YSRA 2NRDA 2HX9A 3BQVA 5I5MA 1JERA 1L9TA 1KBVA 1PNDA 4RH4A 3ABMB 4QKTA 2XYBA 2AANA 2PPAA 2BZCA 5IY5B 5I28A 1ADWA 2PP9A 1SFHA 1KYAA 2PCFA 1SF5A 1AS6A 1GYCA 1KCWA 1IC0A 2FT7A 4A2DA 3UACA 4DP7X 1NTDA 1A4AA 3IN2A 2BW5A 5LDUA 1MZZA 2BWDA 1FWXA 3NJKA 2A3TA 1OE3A 1W6LA 5F7BA 2GI0A 2E86A 2VW7A 4BDVB 3H4FA 2UX6A 2DWSA 5I5IA 2QPEB 3NJIA 1SHWA 1MG2C 1J5CA 2CJ3A 5I6KA 4HCGA 3ABLB 5D4HA 3TBCA 4FA7B 4NB7A 3NSFA 2VM3A 1V54B 4YSCA 3MX0B 2FQEA 4E9TA 2ZONA 1AZRA 1ZPUA 3FPXA 3H56A 2GIMA 4MFHA 5D4IA 2YAFA 4W9ZA 5B7EA 2FJSA 3SBQA 2BP0B 3SBPA 4YSUA 2FT6A 1JVOA 2YAOA 2PLTA 2PCYA 1RZQA 5PCYA 2XLLA 3T6XA 3AG4B 3AG3B 3CG8A 3ASNB 1BXUA 2X87A 1PAZA 1JZIA 5I6PA 1GY1A 4AI7A 1CURA 2BP0A 5AKRA 1WAEA 1QHQA 1AR1B 5E9NA 3JT2A 2GHZA 2YXVA 1X9UA 1WA2X 3NSCA 1NINA 3PLYA 4P5SA 4YSOA 3UAAA 2AZUA 1M9WA 5TK2A 3WKQA 1VLXA 1KDJA 3C75A 3IN0A 2YXWA 4G7RB 4JKNA 1BXVA 1NWPA 1KBWA 1OCCB 1FFTB 3FSAA 4GXFA 4KNUA 1L9RA 5TK4A 1F56A 3PPSA 1AZBA 1NDTA 1JZJA 1AOZA 3S3DB 4KO5A 2IAAC 3OQRA 3FU8A 5ANHA 4GP4B 1CYXA 1NPNA 1JZFA 4GP8B 3TBBA 3ERXA 3PAZA 4N4YB 1ZIBA 3FQ1A 4A2EA 1ASQA 5B1AB
chains in the Genus database with same CATH superfamily
4IJ3B 2YPVA 4XCYB 1KCVL 3B2UD 4B97A 3APFA 1U42A 2F5AL 1U8HB 2X0WA 3L6FA 1UVQA 3VU2A 4CC0A 5JPNB 4BWWA 2EDYA 2WIMA 3BSGA 4I2XE 3WENA 2VDPL 3HUJE 1T20A 2H0JA 4LLMA 4YVNA 5F7DA 5EF1A 4MJ6A 4PBWD 1QLFA 4JRYE 3MV8A 4XO8A 4FQXB 1H8SA 5E2UL 1CDIA 3C60D 3LNDA 2R0ZH 5I0WA 2Q3XA 3P2DA 3P9LB 4E9XA 2P52A 3RL1A 3OB8A 3DETD 2AJYL 4GMSH 1IU1A 3D05A 4RFEB 5T1KA 1XQ4A 4BZ2L 3IJHB 1MJ8H 2L7QA 4JW3A 5AW8B 4FI6A 4FZEH 1ITBB 1RURH 1NKRA 1HQRA 1Z9SA 2F18A 2QGBA 1NCCH 3PPEA 4UYPA 2VDLL 1X7TA 5AALA 5D7LE 5JNYA 1E6JH 1D7FA 2DKSA 5KW9H 2B0SH 7PCYA 5J6GB 4JE4B 4F5CE 1XGRB 4JFPA 4H1LH 2R56L 3BHBB 3JWDL 4G8FB 4UBDC 4X4KA 2NLJB 3GHBL 4N0FA 5MEOB 3FQRB 4KUZH 4PTUB 1RZKC 5D1ZA 4OZGE 5HHXL 5EBMA 3I9IA 5E6IC 2O93L 3F64A 3N1FC 5J9PB 3SPVA 3GSVA 4LLAA 4JHZA 5C09E 3F7YA 1MIML 4UQAA 3LZNA 4A2HA 3FTGA 1WFJA 1N59A 3F6JA 4BXVA 2IADB 3VMOA 1AGCB 5T3ZD 2D73A 1E27A 2HVKB 4Q6KA 3LEYH 5BJTB 3FFOA 3CN1A 1HC1A 2IPTL 3K6NA 3UEQA 2ED8A 5FAAA 4X5WA 1M6UA 2C7UB 1GS7A 5HDWA 2PCXA 4XPAH 4JMNA 4FQLH 1ZS2A 2H45A 4KH2A 2Z31D 2XZZA 5IOKA 4MDJA 3VXMB 5IV2B 3L5XH 2BSSB 2X70B 4P59H 2JVUA 2VLMD 3VA6A 3U0WL 1FI8C 4ONHA 4F2ME 3MJ9A 1I8UA 5F44A 4Y19D 4GSUA 2IH3A 1A21A 5DJ8B 4Q9BA 1U9KA 2EKJA 3GK8H 3GMMA 3S96B 2CO1A 1RUPL 4FQJL 4J1UA 4UQ3A 4Y9EA 3BGAA 3VFSA 1R5IA 5LGJA 3QXAA 1JMZA 4M1DL 3ULUD 5GGTA 3QHFL 3BRDA 4G72B 1A2YB 3AREA 3LH2L 5GRUL 1XGPB 3S8FB 3NN8A 4R0LB 3E6HB 3PV6B 1LEKA 2A9NL 1LMKA 4BKTC 2NY7H 3MJ7B 4IRZL 1R33A 4X5XB 1B0IA 3TWCL 3BQUA 1U8NB 2OMVB 3FMGH 3SPIA 1RZ7H 3U25A 1HILB 2AI0H 3QSKB 2EACA 1SEBA 5EU7C 3T71A 2Z1KA 4NQEE 1QBMH 4AC4A 4MMZB 12E8H 2VXTL 2UVEA 2ZXQA 1D5BA 1XD0A 5C2UB 4KGJA 2XV3A 2D7QA 1J88A 3KW7A 2X6BA 3GSNL 4KMLB 4LOEA 3T09A 2XWTA 5C0FA 2WQSA 1AXSB 4MA8L 5KSAA 3RWJA 2WXMA 4O2EA 1TVHA 5ELIA 2APXA 3UO8B 5SWZE 4AJVA 1MXDA 4G8GB 1JPEA 2BJML 2XV6B 3IPFA 4LZKA 3KPQA 2WTOA 4WUUD 2ZYHA 3RWHA 4B7IA 3GUTA 3O4OC 3T1FA 4QXUH 1PKQB 2R7EA 3PF2A 3RWGB 4OIAA 4XNBA 4QTIH 2Z34A 1BLIA 4UTCA 3WUZA 3VRIA 3P73B 5IM7A 2Q86A 5FYJE 4HJ0D 3DBXB 5EZJA 4G71B 5DO2D 3UZEA 3IDMB 1IM9B 1JXFA 3ENEA 4GW4A 3IPEA 3DOIA 4ZUTA 3BQUC 5LDSA 1UTDA 2DI9A 3HBZA 4POZC 2X3BA 2KDGA 3FOMB 1H3PL 1YN7B 3WCYA 5K1JA 4AK2A 5GIRA 5IG7B 4GAJL 5IJKC 2QGEA 4YEFA 3HG4A 4Y5YB 3OAZK 4OB5H 3BMWA 3HS0B 5E2WL 3FPYA 5IR1B 4P2OA 1QR4A 4Z7UB 5K39B 4LRNL 4NN5B 4AYGA 4YC2B 2V2TA 1B88A 5AW9B 3VVWA 1GSKA 5K69A 4JN1L 3S37H 3CUPB 3QQ4A 4O9HH 2Q5BA 1ZT7B 4WW1B 3DX9A 4PCTA 2YPLE 2YBRA 2OXGA 4DEPB 3PAUA 1IILE 5B7MA 4P48A 2DM3A 3G7TA 4RGND 4C54A 1U8JA 1GGIL 2K9FB 1ECZA 2WM0A 1FNAA 4YNYA 3TVMB 3ZUCA 4G8AC 3QVAA 1DJWA 3V9CA 4WHTA 2SEBB 2WVUA 2G5BA 2X6CA 3BKYL 4GS7C 2ESVE 4UQDA 5D96B 1KPUB 4K8RD 4ODHH 4Y19B 1R0AH 1OCRB 4R8WL 1KPVA 5CN2A 3VDBA 2X4PB 3QUGA 3VFVB 1IKFH 2DLGA 2DEYX 4ZTPH 1G9EA 1OLLA 3U30C 3RGBA 5ESVA 2K8MA 2FNBA 4L8SA 4LLWB 1CF8L 2AAAA 5FHAH 2E9WA 2PYFB 4FAAB 4HD9A 4S1DC 4K55A 3BZ5A 3QIUD 5MI0C 4JPKH 3QC6X 2X4TA 2FX9H 2VLKE 4OZFB 1K5NA 4ZXBB 1JHKL 1OV8A 1LLAA 2AK1L 1VFBB 2UWEA 5HGGS 1EO7A 3BW9A 4OLYH 4UM8A 3SCMC 4O5LL 1CT8A 2XFGB 4NQUA 5IIEB 2I85A 2F7PA 5I76A 1DFXA 5DQJB 3VE0B 3BWAA 5GSVB 3L4XA 1ZSDA 1PZ5B 2GC7C 3BP6A 4AENB 3CWGA 4ZOEA 1RZ8A 3OAUH 1ITCA 1A0QH 3CZLA 3FW6A 2YEZA 1DVFB 5LCVH 1XZ0A 3P4LA 1BVLB 1A7RH 2ADJA 3VW3L 2R69H 3NABL 3VXOA 3ZR5A 2HJLA 2OR8A 1UGNA 4ZAKB 1F18A 3VD0A 1QFWM 3W9DA 5DRZB 1AYOA 2ESVA 4LVEA 1QO3B 3OJDA 4R7NA 4Y7MA 5KAQG 2NTFB 1IAOA 4M8QA 5F88A 3UBXG 3CD4A 5AYUL 4TQIA 3TBWA 1ZDSA 1H3WM 1E4JA 2E7CA 1P2CB 4JZJB 5CUSL 4OCRL 2VLME 2NUTB 1E4WH 2Q10A 5DJ0B 1YMMD 1EMTL 2V9RA 5CIPA 3VTMA 1E65A 4RESB 4YDJB 2G4GA 4AQOA 1IFHL 3BUPA 2ZX5A 2E8YA 3MZGB 1NUFA 3MLRH 1TZGL 2EIJB 5E2JA 4GAFB 2ZCKH 2W9DH 3QEHA 3ILPB 3G08B 5JOPD 1IGMH 1M7DA 9PCYA 5HPMB 4LPCA 5IVNA 4NZFA 4XO5A 2JKJA 5CEZE 3RTLA 3V79C 2BNQB 1HDMB 2W0KA 5IB3B 4PS3A 3MLZL 1BWWA 4RMBA 1HXKA 2CGZA 4NDMB 1MFNA 5DS8B 3GMPB 3SY6A 4AK1A 2BSEA 3KWVA 4N6QA 4Y9CA 2UXFA 1MI5E 2NMSA 4ZNEE 2BS71 4PLOB 4D2NA 2Q7NA 4GKSA 3RX9A 4WIQA 3OKMB 3WFDH 3FU0A 1RZPA 5K33A 3RY6A 4KUCD 3G6DH 4NUGL 3K4AA 3QXWA 1A6UL 1UD6A 2BC4B 2C1PA 3DRQA 4IRSA 5B7FA 3GSXA 1FN4B 4YMPA 5FYJL 3WUWB 1T03L 3DTXB 4OM0L 4XZUB 4Y4KB 2P45B 1XH1A 2XZQL 4YPGB 3SDAC 3O2DL 2F74B 2CRZA 2HWZH 3TWYA 3IMSA 1KCRL 5FOBB 2Z8RA 5KANG 2ZQKA 5EUKB 2BVPA 1KJ3H 2VAJA 4UB0L 3VI3A 5DA0B 2X4NB 4BZ2A 4J3TA 5F96H 3ZN6A 2AJXL 4P0DA 3TA3D 1KBVA 2QLYA 5HGAB 1AR1D 3CX5K 1SEQL 5EO9A 2FR4A 4NHUA 3GIVB 5HHQB 1J1XH 3QIUC 1KWKA 2VLJA 4MJ5A 1OALA 3HPLA 5L2KE 1ZE3C 1HL4A 5DJDB 2KUTA 4OKDA 4NO0A 3QULA 1IC0A 3HBGA 1BV8A 4HJTA 4LSRL 1MW1A 3MNVB 3NDYE 1ZVYA 2DBLL 3V9FA 1NC4A 5LGHL 1G9HA 1OE3A 5F7BA 2E56A 5C6TL 5CCKL 4M7LT 4PJGB 1F4XH 3S48A 1NL0L 4OJAA 3WTTA 1FDLL 3K6IA 2UX6A 2MCPL 2DWSA 5G2NA 4DO5A 2G4EA 4H7VA 2KZBA 5EBLA 3ZTNL 5KYXA 1QPPA 2JCCA 3IKCB 1K6QH 5DEJA 5CGBA 4Y4FD 1XBRA 4DO6A 1XR8B 2VM3A 1HCYA 3HZKB 3M17B 1HJCA 32C2A 4LSUH 4AIZB 5I1HL 2YPKA 2FLRT 4NZUH 2OYMA 3H85A 3FF8A 5A2JH 5D2LB 5ANME 3M1OA 1WITA 3QUML 5HI3D 2JTDA 2Z64C 5C0CB 4ZYKB 3DUUA 4QKXB 1L7TH 4UT7H 4Y8DC 1TITA 3T6QC 3KWWB 5AKVA 5H37G 2VR9A 1QHQA 4O02L 4TUJB 4WU5B 2GY7B 4N2IA 5JR1H 4U1LB 5FM4A 4AL8H 4C83A 1ZANL 3TJHC 4UILH 4NQEB 3VXQA 1H6FA 3ZTJH 2YXWA 2XQ0A 4U49A 1OPGL 3WY2A 5JA9A 2APTA 4XH2A 4JFFD 4NQDD 7TAAA 2K8QA 1G9MC 3QAQA 3DMMD 1DO6A 2F8VA 4LCVA 2VUYA 1WSST 3O3AA 4CADB 5T33L 1RVFH 3NCFB 5ANHA 3BZFB 3NQIA 4KKLD 5DJZB 5TGBA 5DQ9B 3QG6A 3BSZH 4G8GE 4WI7A 4AQ1C 2DH2A 3L6FB 3RZCB 2R0WL 2AQNA 4X8GA 1JPSH 4CVZB 1ZIBA 4RZCA 4PRHE 5GS2H 4QXTB 4CDHA 1KGJA 4FQXA 4BD4A 4I1PA 3NEEA 2GYSA 3BAIA 4P3DA 1E4XI 2H0PA 4UDUB 1FFRA 4DPBX 5KSBB 2DDQH 4HOZA 4BGDA 4HDIB 4K3DH 3NZUA 4XXDB 3MV7D 2P8PB 2VN4A 5F9OH 2UWEE 4AEEA 4XPAL 4A38A 2WBJC 4G9FB 3ZL4H 2IFFH 4I5BB 2NXZC 2Q8AH 3IGFA 4XN1A 3AY2A 2ADIA 1HWWA 3OPZL 4X7EC 4NJ9H 3VGAB 3AQZA 1U0QA 1QVOB 3LEXB 4UQBA 1GC1L 2IFFL 5BS0B 1AC6A 1H3XA 1HL8A 4ZMXA 1BBDL 1S3KL 2X4QB 1EJFA 3FQRA 5D1ZB 2YKLH 1PY4A 4XAWL 2Q6WB 3V6FA 4K71B 2H0EA 3FUKA 4X7FC 5J9PA 3GXTA 4ZFQA 5TQ2L 5IMMA 5DJXA 1R5WB 2M83A 2X9XA 5FKAA 3TZVA 3AXIA 3FUJA 3K91A 1BZ7B 5DMGD 1QAWA 4NQCA 2CJTA 5C7ZA 2VQ4A 3ZKMC 4JFZL 3G6JE 4PIRF 4KK8C 4ACTA 8CGTA 3MBWA 2GBUA 2WK2A 4JMXA 1B2WH 1KT2B 1F2XK 5GZOD 3Q2CA 2GI7A 3U6RB 4GG6E 3GC3A 4OM1L 3HNTL 1ZJBA 2WBJA 1F6AB 2Y07H 2WYTA 3CJJA 3O41A 3FRPB 5F6HI 1R3KB 5E5UB 4MJ2A 4YDIL 2QMJA 3A6CH 1M2OA 2H32B 4HHWA 2EUVA 1CQYA 1I31A 2GCYA 3OXRA 3MGTA 3UABA 2ZAHA 3CHXA 1KXVA 3ULVF 3UJIH 1GR7A 1QYGL 1EEYA 4LCCA 3PS6A 4OI9A 3QFGA 1E6OL 4BRJA 5HHOB 4JFOA 1F0LA 2VQTA 4X98A 5E5RB 1A14L 3MV7A 5CFAA 3W37A 1D5IH 3GZKA 3U0TA 1SJMA 1OHQA 1NMAL 2MFNA 3PWLB 4KJQC 3MNDA 1OP3K 4E9YA 3LD8B 1OSEA 4M1GH 2WBXA 3FOLA 4KXDA 4I89A 4MKTA 2XBDA 1NCWH 2ZKXA 3MOQA 3HRZC 4N24A 4X5XA 1TQWA 5AENA 4ZMYA 5JYMA 2EUZA 3BQUB 3A4EA 3RIFF 1OF2A 4AV5A 1ZLVH 4CMMA 3UZVB 1SXZA 5HDLA 1XBDA 2OJZH 2PP8A 3O11A 2LR4A 4FKKA 3VXUE 3S35H 4P5TD 1H0DB 2C9AA 2XTLA 2WNWA 2WZ5A 1JHLL 1BYPA 1D7CA 2WLKA 3LXAA 3P0VH 2A77L 4M6NH 4WQOA 3DX6B 4NNXA 5I2IA 3A4AA 1XZWA 2PO6B 4KI1A 2IALA 2FD6H 4PJGE 2FH6A 3RWJB 1BBJA 1XO8A 4K5LA 2ORBH 3SEPA 3GSQB 3VYPA 3MLWH 4BK5C 1TKWA 4F20A 3FT9A 4UILL 5F0LB 3RY5A 2IV9A 3RGVD 5I1JL 4KJWD 3O8XD 3T1FB 4GSRA 4U0QB 2XWJA 3RWGA 4UWQB 4FKHA 3ETBF 4OLVL 3CQPA 4KMTH 5ALCH 3O8XA 1KXTB 4W4NA 1YNLH 5F7EH 3AROA 1NGWA 2J6EA 4AIOA 3UAJD 3DBXA 3FU9A 1NCIA 5AOMA 4OZ4B 4S1SH 5DEGA 3D0LA 5EZJB 3SE4C 5BS0E 3X17A 2PETA 3RWDA 2WLLB 2BY3A 1V55B 1NCBL 2HT3C 3FBQA 1K4CB 4B3EA 1MNNA 3BAKA 3H8NA 3GKWH 5DHYA 5ID1A 2VABA 1IGCH 4BSVA 3NFNB 4KQ4L 1CGTA 4P5TA 4TSCL 1SXBA 2QVTA 1MY5A 3C5ZD 3LNHA 4K3GA 3VQ1C 3DIVA 1SOKA 5BQDA 4XN8A 2I5YH 1HSBB 3TESA 3NSDA 4ES9A 4FP8L 3HR5B 4HLZG 3AS2A 5PAZA 2YQ3A 4LF3A 4UTBL 3IS0X 3QCTH 3QNXA 5IMOA 1NIFA 4WW1A 3ZE2B 2PPFA 2QSTA 2XA8H 4NS0A 3JTSA 2J72A 3MQIA 1S9XB 5B1JA 3FB8B 4YSEA 1U8JB 4ODBD 5F0JB 1FL5A 1ZSHA 3K3QA 4OGYH 3MOAH 5BVPL 4PJ9D 2G5BB 3TURA 5IT2H 3HZ3A 2Y6SD 1YNTA 2G2PA 2VIRA 1KPUA 3C60A 2PXYA 1GW6A 2OZNA 3J27A 4O02B 2JV6A 3ME0B 1IKFL 3KJ4B 3O3BB 2X9ZA 4K2UL 5I6XB 1WV7T 1QUNA 3V4UH 4B50A 1TJGH 3NDZE 5DJCA 1URIA 4JRYA 3B1UA 2A6IA 4X4MA 4Q6YA 4RFNB 4Y89A 4LCIL 1DBJL 4G8EA 2IO5A 2W9EH 3F58H 3OKKA 2MHAA 2A7BA 2BIOA 3ISYA 1I3GL 4XC1H 1K5NB 3S35X 1CDGA 1OY3B 3WY4A 4XNAA 2YR3A 3NFSL 5IQLA 1J8RA 1MCKA 4M8VA 1NC2A 3LEYL 5KOVC 1HINH 4JJOA 4I3GA 1CT8B 4PJIA 4MMXC 3J7HA 5HJ3A 3AGVA 4R7DB 1QQDB 4U3XA 2IWEA 4G6JH 3AXHA 3HE7C 3ZQWA 4MDIA 3LNFA 3DOHA 1M71B 1PX8A 3FSWA 2MNJB 3N6YA 4QRBA 4BFJA 3IBEA 1V3LA 3X14B 1DFBL 1U8KB 3SDCC 1KJMA 3LDBC 4JDTL 3C2AL 4WTWA 3P40A 1DVFA 3SE9L 2N4IA 4DGVL 5A7BA 3EYFA 5EB9A 1XZ0B 4UIMA 1A6VH 3QJRB 1UM4L 5FW8A 1TTAA 4U33A 5DFAA 1OARL 2OPCA 5C9JB 3NCJH 5FLVA 4G5ZH 5EH1A 1ILSA 35C8L 1UQSB 1MN4A 1MCLA 2GUOB 1F3JB 4NWUL 4GO6B 4UM9A 4ADJA 2O61A 1ZE3H 5JDJA 4EZJA 2HG5B 2CBPA 2NTFA 4X6EB 1A6WH 3F83A 1RURL 2ARWA 2DWYA 1MFCL 1U8QA 5I30L 2JIXD 5E8NB 1BAWA 4NCC1 1NCDH 3PWNA 2YKKA 1IEHA 1RK0A 2GHWB 4HEPA 1ODUA 4QTIL 2EDQA 3SN6N 4XPBH 2YD7A 4FQXD 5E51A 1NIEA 2CO6B 2FGZA 5DYFA 5G5DA 4GG8B 2IH9A 1HAWA 3AQDA 4NQVB 3DOSA 1S9KC 1T6VN 3ZOAA 1UT1A 4QHNA 4MNQB 4UB0H 5F89A 4FQCL 3BAXA 3RVWC 3BVTA 3I6KB 1LO2H 3E9TA 5DURB 3S5LB 3CN3A 3HMXH 4LAQH 1A1MB 1W9XA 3P0YH 4PJCF 3GMPA 1SN0A 2PXYC 1IKOP 2ZP0T 3N85L 4JB9H 2VSDA 3QDMD 2VZSA 3G5VA 5DA4A 3SDDC 3NIFE 3IMRA 3FQXA 2DYPA 3EJCA 1I8KA 4MJJA 3ZMRA 4FYTA 1OQOA 2BHFA 3STZB 2AV7A 3LRSA 3VFRA 3WFDL 4AT6A 5KSVA 1VEMA 2AK4A 1IAKB 2V7NB 3II1A 4NZTL 1FN4A 1HX0A 5LHDA 3K6OA 3C6SA 3ELAT 3CFJB 4Y4KA 5F21B 5D1XE 3UGUA 1ZT4B 3NYKA 4A2LA 1MQKL 1P6FA 4H88L 4M3KB 3VYNA 3OHMB 1Z9MA 1W8EA 3O9WC 3AT9A 3D3VB 3KJ6L 1E9OB 1LK2B 1BGXL 1YYLL 3EFFA 4Q74A 3C5ZA 3IRPX 4XBGA 3IM1A 1I4FA 4JG0L 1FE8L 5HGAA 3CVHH 3Q8AA 4IKIA 1Z9PA 1D9KD 3CC1A 3O0RH 3GO1H 1A5FH 2NRDA 2L7JA 4GAAA 5KVGH 2CDGA 5CINL 4BM7A 4JO3H 3DMMA 3VG9C 4WI0B 2ZX8A 3HHSA 1ZHNA 3F85A 2WAHA 1BPLB 4R90L 1GZHA 3IU4H 4JFWA 4OBSA 2ZUQB 4HT1L 3JXAA 5L9DL 1IGYB 3ZDZE 2AEWA 5F93C 4R4ND 5JLZA 5FXCH 2FATH 5FGSA 3VQMA 3FTUA 4A6YH 1U91B 2NPLX 1C7TA 1TTGA 4TLSA 4JM4L 3US9A 1AS6A 3B7UX 5JHMA 1KFAH 4N8CL 4TVSa 1K8DB 5SWQA 2L4OA 1YJDC 5EBLB 1WVZA 2VMEA 4U0RB 1UJTA 1NFDA 4RIRA 3DV6B 1CDJA 1UM6L 3BZ4A 2O5XL 4J3WA 3IDJB 2RD0A 3VFTA 4NZUL 4PJ6A 1QUPA 5JZ7C 5KOMC 3KYNA 2AV1B 1MCBA 4PJCA 4PWHA 1O0VA 4FA6A 3WXWH 1Q72L 3B9EA 3Q8CA 4Y4FA 5FS5A 5I16A 2X2IA 1HHJB 2V3DA 3MX0B 4KTEL 4O2FB 2AVGA 3HTLX 5DUBB 3QORD 1ZPUA 3GJFH 1UWGL 4GAYA 1T5WB 4HWUA 1WFIA 4FQ2L 2VDNL 1A66A 2FJSA 4LIQE 4NXSA 4Q6IA 2ZJSL 3T4AA 2BP0B 2H2SC 3K2UL 2W38A 4XBPA 2Y7SA 2GTWA 4AGLA 2ZSWA 1CCZA 2BIIA 4AG4H 1YJDL 2NOYA 3APNA 2WP3T 4HKBA 1MLBA 3K71B 3VXQB 5I6PA 4HJEA 1RZFL 5MENB 5DO2C 1QSVA 1SLVA 3C8KB 3VWKB 1T5XB 3SDDD 4EQ3A 3WEBA 4XH2B 5BO1L 2MPAL 4ZT1A 3VQ2C 1WA2X 1DVFD 3DGDA 1AGFB 3K81A 4POZD 1N3NB 5IVOA 1FZKA 1HJBC 3C75A 3QQDB 5DQ9A 3IDXL 4WWKC 1BXVA 3SQBB 1KBWA 2ARJA 4BFBD 2D3LA 2O26U 4KZ0A 1LEIB 4ZXBC 3BUBA 5D1XD 1O5DT 1BX2B 1JV5A 3S3DB 4J27A 4KO5A 1AJ7H 3QORA 1OAXL 4LSTH 3RJQB 1CD8A 4QRTA 2V8LA 5FK9B 3MRJB 5DJ6A 5HGHA 1NGPL 2OTUA 4H44C 4X4ME 5I1AA 5CZVH 1LE5A 1JGUL 1I9JH 2FBJH 3HG1B 3PAZA 2BLFA 2JQAA 4NKDA 3QEQD 5I0DA 4L4VE 2DJUA 3INOA 4XNXL 1A7NL 2OV0A 2VM4A 1WAAF 1E5BA 2DQGL 3NJXA 3L3IB 2F7OA 3FT3B 5DD5H 2X89A 5GGUA 1MDAA 2OLDA 1CL7L 1OTTD 4NO5A 3H3KA 5A16B 3OXSB 1CE1L 2E27L 4KK8D 4ZSOE 4F7KA 1XGUA 3TN0D 1YCSA 5JIIA 2EP6A 1U3HA 3T77A 2HA1A 4ZMTA 1RHHB 3NFPB 1QVOA 5KBKA 3OR6B 1OCZB 4YHYC 1CB4A 1TJIH 4LU5L 1BZOA 1HCVA 3ARPA 5E6ZA 3HZMB 3RWFB 4RWYH 1NJ9A 2BXZA 4F8NA 5JORB 2VE6B 1QW9A 4HC1L 5CIPH 4AIEA 3IK2A 2DIAA 4MJ6B 5C09A 3GXPA 3MV8B 3TA3B 5CCKH 1D7BA 3NRPA 4FERA 3WNIA 3VWJA 4JJ5B 2O5ZH 1QTPA 1WZKA 4Z76B 1F45A 3N44B 3HI5L 2ENJA 4JHAL 4BGLA 1E3XA 1MHCA 3CFKA 1QLRA 4B9YA 2M8XA 4L4TD 5DCCA 1KT2A 3C09C 4L9LB 3KPPA 4J6RL 3D85A 1XGQB 5E24E 1P5VB 3MCYA 4NBYB 2B39A 4XP6H 5CJ8A 5ICYA 5C07B 3D3VD 1ZT1A 1KG0A 5JPMC 1P5UA 2HX8A 5JHLH 5J6GA 4BFEA 1LNUB 1YEHH 2GCYB 1DE4B 5ACLA 3T6VA 5A7EA 1YEJH 3BIAX 1G6RB 4LVHB 3GS0A 4Y4KD 3V52L 5IMKB 1XXFC 4TMPA 2CGRH 2MCG1 2FX8L 4YL9A 4A04A 4I48B 4KTYA 1KTKE 3F7YB 3V4PA 4XPHH 1WBZA 2ILLA 4L3EB 1A14H 3FN9A 2UZYB 5F9JB 1AGCA 4N3TA 5IQ9B 3PWLA 1AVAA 4MXWL 2G5UA 1IM3B 2H1PH 1BW8A 1CVRA 3FOLB 3UGXA 2CDEB 3O0LA 1FVCB 1KTBA 4MTMA 3MRPA 2MTAA 4IMKC 3I9AA 3ALPA 3MRRA 2DIJA 2AF2A 3ARGC 4JG1L 1EGJH 3L4CA 4CAGA 2R15A 5IV2A 2B16A 1TNMA 2CCWA 5AW1B 3UZVA 3FXIC 3VFNA 2YGQA 3V6OC 3X3FL 2GBTA 1WEJH 2JXMA 3OC8A 4E9VA 1RJLA 3MFFA 1JGDB 3MV9E 5IB1A 1S7TA 4OD3L 1KIRB 3ZDXE 3TO2B 3CPLA 1G7QB 2WYZA 3CDZB 4XPGL 1KYUA 4XOBA 3ZTEA 3BDXA 3SGDI 3DPDA 1J0JA 5MHSE 3KBEA 1SGKA 4U1SB 3TXAA 1S7XA 2V9QA 4MDRA 2WXGA 4PLJC 1RH8A 2WHVA 3WL9B 4EN3A 2F1AA 4TQHA 1KBKA 3GJFB 4OIBA 3ABGA 4XBMA 3PV6A 3QDJD 4HHGA 3PDOA 1N67A 4ANVA 4GRLA 4PBVC 1CFQA 2NNFA 2XVKA 2GFBA 5DZ9A 1JHTA 4M7JL 4NO0D 4QR7A 4JS7A 2CCLA 3KCWA 1MXGA 1BJ8A 3NCMA 2KH2B 1SEBB 1A7RL 4OI7A 3O6MH 2E9BA 4KVCL 1HEHC 3SPCA 1UWFA 4IRZA 5JMRA 5EU3B 5FYJU 3TVMC 1JZEA 5C0FB 1O7DC 3FHAA 1XB6A 2P8MB 5LAXA 4YBLB 5JOFB 2NY0B 3ULUL 1V7MH 3TJEH 1KELH 3QJTB 3ARRA 3R19A 3B1TA 3D18A 4HKZA 5DR5H 1BD2D 3QJQB 4E0RA 2JB6B 5AVYB 1VIWA 3WEAA 3QHTC 1IGIL 1HZLA 4NKMB 3R4RA 2QHLA 3FH7A 4JGUA 1HH9B 2VW6A 3TFKD 5E94A 1S9XA 3L45A 3UTTA 3MJ6A 1ZGLM 4RMRA 3TYFB 1QRKA 1KYFA 3SBWA 1IMHC 1U30A 2XHNA 2YSSA 1O9WA 1L5GA 2NX5B 5DQDL 3ZE1F 4YGVB 1IM9A 4YHLH 4A2GA 5C6PB 4V1DD 1KLUA 1PGRB 1PSKH 4ZUTB 3E38A 2UXVA 1Q8MA 4Z7NB 1FIGH 1QTYT 1C5BH 2XIIA 5IT2L 3FOMA 1AKJD 3LRKA 3C60B 4EUPG 1GPOL 1OE2A 1PJWA 3LN4A 3ME0A 4GKNB 2H3NA 1DDHA 3QCVH 4KKPA 3TBSA 4Y5YA 2Y1ZA 5IJCC 1RUKL 4L0ZA 5L8JB 2IPKA 3QWRD 1N6QH 1QBAA 2PTTA 3GIZL 4AL8L 2YD5A 4NYLA 2J5WA 3SYPA 4AW7A 3RTQC 1LILA 4LCWA 3L4ZA 4JFXA 2V2TB 5INDB 3TT3L 4P59L 1C08B 2MHAB 3ZYZA 1ZXKA 2NNCA 3QT2A 4LXFA 2WQWA 4QHMB 2DB8A 3Q6FA 5MERB 2BPBA 4M9PA 2YA2A 3LXCA 4PJXF 3B9DA 1FNSH 3FRUB 4M1GL 1L3NA 3VH8G 4GRWF 1I3RB 5L7XH 4ILDA 4KQ4H 4TSCH 4MD0B 3VQLA 4BK8A 5TH2B 3TPUB 4Y5VB 5E1AB 4GKLA 4XMWA 1RK7A 2GJ6E 2NYYC 1NDGA 4KXAA 1FA4A 4Y19A 1KTCA 1OKEA 5JUEL 1FP5A 3BJ91 4OF3A 2OK0L 3FSOA 2VJ0A 3GMOB 4LSDA 6PCYA 4J6IA 1TMCB 3I3DA 4P8QA 3DXAD 3U82B 3UG3A 5HHXH 4JRXD 1LD9A 2DMHA 1MCIA 4N2LA 4Q4EA 1T83A 1BFTA 2EZ0D 2DM7A 2E5EA 2EIZA 4AGQA 2F53D 5ANMA 3VXPA 4ZXBA 2UWEB 4KRPC 1J12A 3ABZA 3A3YB 3ULVC 2VLRD 5EU7E 2XZAL 4XN5A 4ZMWA 1CG9A 3QPQC 2YQ2A 4XPTL 5KUMA 1ZA3B 4GMTH 3TTSA 3CVDA 1IFGA 1SY6A 1ADQL 4NQVA 2P5EB 4G3YH 5JIMA 1IT9L 4IDJL 1RFDH 3WI9A 1RZ8B 4F24A 1HQ4B 2UY6A 4ZFGH 2IFGA 3PP3H 2YEZB 3BKCH 5KG9B 1E5ZA 4QHNB 2ISDA 3Q6GL 3VXUD 3DPBA 3MZTA 1KYOJ 2CHNA 3BN9C 3JWDH 1IT9H 2XFXA 3S5LA 1UEMA 1E50A 2WUBL 2WKLA 3ZKXB 1KJ2B 2IANB 4PJHB 5D1QE 1I8AA 3W5MA 3QZNA 3L3DA 3NJJA 4JPWL 4D9QD 2DQ6A 3K74B 5JXED 1PG7L 3TBWB 4BRVA 2AV7B 2PR4L 1AACA 1WCBB 1P2CA 3LRLA 2DQEH 4JZJA 2AK4B 2V7NA 4GBXC 3VXMD 1J1PL 3QUXC 5F1SA 2CJSA 3ISWA 1O9VA 1H8OA 4HIIA 4JO1L 3GSRB 3UJIL 2FQDA 4WRLA 4X5RA 2P8LA 4L8DA 4R4FL 5AFAA 3RFZA 1AS7A 2LVEA 1VGEL 4JPVL 4R0LC 2J5LC 4FFWC 3F8UB 4JUTA 2GTZB 3C5ZB 4JY6A 2DMBA 1M05A 5E8EA 2IAMD 4MYPA 4JFHE 5KVEL 2DTML 1A8ZA 3QQ9C 5AZEL 3D08A 1WS8A 4OLWH 1DJHA 2XU9A 5IKCA 5D6DC 1H3GA 2CDGB 4KDWA 4LSSH 4JEGB 5AKSA 1EV2E 3LD8C 3BGFC 3HHSB 2R2EB 5FO7B 4AMWA 3NJLA 4EN2A 1H6EA 2BVEA 4GKSB 3GINA 3FQ4A 5AVUB 1U93B 2OI9B 3H6JA 5CAYB 4LASH 3FONB 1EMTH 1NPUA 3DRQB 4UTBH 1YMHB 4OCRH 4K23L 3WUWA 5CZXD 5KSBF 3QUYD 1KUMA 5AG9A 4PJAB 2R27A 4GT0A 3SZKC 1CFVL 2JQMA 1X6LA 5F9DC 4GNKB 3HS0C 1V3JA 2PPAA 4AYID 3JBG7 5FOBA 4X4YB 1GCYA 1RUKH 2BSED 1INQA 3BMVA 1JPGA 1KCKA 3DTDA 3WHE0 2X4NA 4WFHD 1BMWA 1NFDB 3ZL4L 4WKZB 1ZLSL 2YBGA 5EO9B 1CGXA 2FR4B 3GIVA 2DJSA 4GAJH 4MJ5B 3U1QA 1A4AA 4X7SL 1U3ZA 3KWUA 5TF1L 2AV1A 1K9TA 1A4KA 2BIHA 3EYUL 1JK9B 1SZNA 4W4OC 5L2KD 4KRPD 2B8OT 2WN3A 5J0BA 3RI5F 4NKIL 1DVFC 3UPAA 3QULB 5L88H 2UZXB 4KKAD 4ACPA 1W8OA 3THMH 1I8MA 4NI3A 3O2VH 3U2JA 5D2NB 1FG9C 1JGEA 1YVLA 3QUKB 4OFKA 3WEXB 1TCRA 1T21A 4GAYB 1NCDL 4ZUWB 5IEHA 3HNSL 3W38A 3G5ZA 1F90L 5CMAA 5L88L 2BVOA 2Q0ZX 3DURB 3HRZB 1Q9LA 2BNRA 4PTTB 1DTUA 2XZCL 1EX0A 2GABA 4LDOB 3GO1L 1CLZL 3A23A 1SQMA 3PWPA 3IKCA 3RVVC 3VFOA 4JKMA 4N2MA 1QEWA 3HZKA 4XXWA 5CJQL 5PCYA 1NM4A 3KYAA 3WUWG 4ELKA 1WFTA 4KITB 3P9WB 4X6CB 2HT2D 2BS9A 2E0PA 5F9OL 5FCUL 3S3PA 3QQDA 3BIBX 3U1SH 4AI7A 1MNUH 2IBZY 3LCYA 4JN2A 1Q4NX 2K0RA 5J13B 5D6DA 1DL7L 4ZYKA 1B4JL 2AITA 2WJ5A 4KROC 3IN0A 2W5PA 4QRTB 2R83A 3M1CA 5GISL 1NWPA 3CVHB 4Y88A 5EU4A 2EYSA 3CBRA 1MREL 3HG1A 4L29A 4JRXA 4U6HB 3SDXB 3NSJA 4LHUG 5IVXA 1MF2L 3DDFA 3SSGA 1I8LC 4WF7A 2V3FA 2ED6A 3VWJC 3MRKB 1JZFA 3UTQA 1MFAH 3H1ZA 4GUCA 4CU7A 4PRDA 2CDFB 3L1GA 5FYKH 3Q7JA 4I9XA 3L9EA 5B1AB 1TJHH 3QRGH 1ES0A 1YO4A 1O5PA 4J3OD 4NRZB 3O6FD 3QAZB 4XP9L 3OR6A 5B39G 3GM8A 4KK9D 1GA2A 2D9QB 2Y06H 2JQZA 3SPHA 4O51A 5HYIA 1MLCA 5BMFH 5I1EH 2Y07L 1B90A 2VDMB 5IHZA 5D7IA 5MEQB 5KBLA 4NUMA 1FFQA 2DPKA 3EDFA 3ZHDA 2F0CA 4PJ8A 4GKZB 4NNYA 2OM5A 4LCUB 4JJ5A 3GJEB 4P3DB 2YKLL 1TZGH 4UDUA 1MQKH 4YZWA 35C8H 5DJAA 1QLRB 1ET8A 1B2YA 4ISVA 4AQ8C 2P8PA 3IJYA 4G42A 4N90E 1JFHA 1P5VA 4OUUB 2VN7A 1LE9B 4FMVA 3ZDZF 2HKHL 1KG0B 4NZJA 1P5UB 1A6TA 1L9SA 2ZIDA 4F1SA 2HN7B 4XP4H 2E7MA 5F7WC 1MRDL 3K0WA 5LB1A 2VDKL 4QF1A 5KTEL 3O2WH 1L6XA 1NCCL 3RLSA 1X4ZA 4ZPVB 4WFEE 2K9UA 1EEUA 2AXJA 3PL6C 4RX4A 3BGMB 2AC0A 1JIBA 1THCA 1CTMA 3DO3A 5DJXB 5KANI 1X5YA 1SNRA 5GS0D 2EVFA 4XB7A 1TZOA 4KZCA 1TENA 4DKAA 3NSYA 2BX5A 1T1WA 4KK5C 4Z7NF 5D96C 3JYCA 1IEAA 2CLVA 3UX9B 3ETSA 5FYLE 4IW4C 4ZBJA 2XVGA 1KEGH 2BDNH 2CJUL 1KEMH 4KVNH 3ZSSA 2IAMB 3S97C 2X4UA 3BZDA 3LTVA 2YD9A 4IIQC 5B8CA 3HNTH 1I9RH 1GYUA 4PRNB 3EGDA 5LGYA 3GRBA 1NKGA 1R3KA 2HJKB 4TNVK 5J1TC 4OJYA 2AJ3A 4LGSB 4UT6A 3MRBB 3VFNB 4CN1A 3LPPA 4LOUC 3QDJA 1QFUH 3MGTB 4OQTA 3AFLA 3QWQB 3TO2A 5L4JA 2RB8A 1D5ZA 3C9NB 4KDTC 4Y16A 4PJCE 1N12A 1KACB 4X98B 2ZKMX 4OM0H 3TVMD 3KPNB 4NIKB 3KPSB 3MA9H 4LLVB 4YO0A 4P5RA 3MJGX 2F54E 3PNWA 2ATKA 4FNLL 1CK0L 4LKXA 1BOYA 3P77A 3UBHA 3GZQA 4JE0A 3LY6A 2J57A 3IGKA 3WL9A 4XRCA 4IKNA 2FBRA 3RPKA 3MNZA 5FB8B 2YPVH 3HG3A 4PVLA 3TYGH 1CFNB 4H26B 4J3OC 4GRLB 1ETJA 3UADA 2ZX9A 4NUPA 3C6EA 4HEME 2BY1A 1U92B 4J2QA 5A6IA 3H0TA 3QWOA 4WTXA 4YHLL 2ZD0A 4RNRA 2CKBL 5DMKB 5GGQL 1Z9OA 3QXDA 1PZAA 4FQ1L 3OD3A 3DX6A 4NNXB 4ZRGA 1TT6A 3WJLC 3QZWG 3X11B 4DGUA 1C1EL 4JPQA 4QY8A 1FV1B 2A9MH 2W60B 4PV8B 5GGQH 4MSWB 2A83A 4AXWB 5HHME 5I17A 1ZGLB 3IB4A 4S1QL 1RXLA 5DR5L 5C6TH 3MRNA 5E6YA 2ICEA 1NOFA 1RIUL 1YY8B 5GRXG 5JIHA 4ANWA 4X5QA 2V3EA 4RSVA 2JB6A 4BZ1H 1I82A 4Q58C 2ZPKH 1WFMA 2YUXA 2ZCHL 3DIFA 1EZLA 1MRCH 4OZ4A 5DEGB 2VDQL 2YSSB 2KMWA 4IBZA 3KLAA 5ETUB 3ROOB 3T3PB 3K0YA 3WLWC 4NFBA 4OD2B 1FNGA 5DHYB 4HAKA 2VMJA 3S37X 5CEYB 1FNEA 2CK0L 5J6HB 1MCWM 4TQPA 3NFNA 4HPYH 4P5TB 2B4CC 2HFEB 4ECNA 2J8OA 2IPKB 5FKPA 1E0OB 3B56A 3QZLA 4KK5D 1NLDL 1MFEH 4NYLB 5E9DB 2ITCB 3IS1X 4JDTH 2J1KA 5BO1H 1Q9OA 2AXGB 3N5AA 4P2RA 3WDJA 2WO2B 3UJTH 4YZFE 4MZ2A 3MJ8B 1JDDA 1HH6B 4JQIA 3FZUD 4M1CD 3QB7C 3QNZA 1MCQA 4QHMA 3D06A 3P4NA 4AM0Q 4LEOB 4N1CA 3VFUA 4ZX6A 3PGDA 4TOYL 2XPYA 5ICUA 1FL5B 5E8DH 4MD0A 2Q3AA 5E1AA 2CKBB 5C97A 4HIPA 3TV8A 2ZXWB 1S7WB 3QGVA 3ZKSD 2K6WA 1FE8H 3GD1C 4ZMPA 1VAHA 4HCFA 1CDUA 3GMOA 3NOIA 1CLYL 5DTFA 5E5MA 5DHVH 5GRJH 4BZYA 2CH8A 1R3HA 1LD9B 3MUY1 4JRYB 4MRBA 1CO1A 1ASPA 1KENH 3RWEA 3DHPA 1GZQB 3KXFB 4EDXB 4G8EB 3ULUE 4ALAC 4YHMH 1NFAA 1IBZA 3ES6B 2B5IB 2I07B 4LPVA 5ANMB 3C8DA 3PREA 4I0CC 2W59A 1BM3L 2TRYA 4HX1B 4KK6D 2AFNA 3AS1A 2QADC 3E3QC 3GZOA 3T0ED 6FABH 1FUNA 2H6PB 2NT0A 4HWBH 5C0BE 4N0CD 3WHE1 5FR3A 3AM8A 4Q0XL 1J5DA 3SPJA 1BIHA 1LO0H 3E8UH 4Y5XA 3KR3L 4RRPG 1ZA3A 5E8OB 2J5LB 3OPZH 4MCYA 4EI0A 1FBIH 4W9GC 3GTTA 4FQPA 5DHEA 3E6FA 1DFBH 1U8LB 1GW0A 3JWOH 1AZCA 3L3JB 4Y1AB 3HB3B 4Y4FC 4RISH 2GK0A 4RAVA 4NQTA 1K8IB 2BWQA 5FWQA 5C9JA 5I66A 3KH3A 1E4KC 1DLHA 4JHAH 1NCJA 5AOJA 5TQ2H 4AQZA 1F3JA 3AITA 1KJ2A 2IANA 2OP4L 2IAMC 4G80A 3ZY7A 4XB3A 4W9HC 2JCWA 1U8QB 3OF6A 4JKLA 1MFCH 1WCBA 4DP6X 1J7VR 4NAQA 4QXGH 1ORSA 4IGBD 4C56B 2DD8H 4AM0B 2QT6A 3Q3GA 2CUMA 4PJ9C 3DNKA 3VI3F 4F2FA 5SV3A 4JM2D 2ZXDA 3D09A 3NCBB 3KPSD 2VC2H 3T5WA 1JNJA 1HXYA 2IG2L 2E47A 3WELA 2UZIL 3QEQB 1HTYA 3HVNA 1YEFL 1PZCA 2WSDA 4MBOA 2DKMA 3KHQA 4XGZB 4EKXA 5F89B 3SE9H 4DGVH 1M05B 3GBMH 3NEXA 3NPZB 1SDDB 4WNSA 4HC1A 1ZHKA 5DT1H 2BSDA 3SO3C 5GS1C 4U1GC 3MBXL 3EYVA 5CN3A 4OZIA 3UFIA 5FGBA 3VFWA 4NERA 1DLFL 1SXSA 2XPGA 3G5VB 3MROA 3OLDA 4G7SB 1FAKT 4RRPA 2P3YA 5HGDB 3W0WD 4G11A 1I8KB 1MIEH 1XSIA 3STZA 3EO1B 4NKOA 3V7AG 3FONA 4AT6B 3OZ9L 4Y5YC 3AADB 1RVFL 4CSPA 1YC7A 4FNSA 4NPKA 4JFFB 5FGCB 3RX5A 1INEL 2ATPA 2VLJE 1QFPA 2K6YA 4JDVB 3PE9A 4JANB 4LCWE 3BPNC 4Q9QL 1LK2A 1AHKA 5J3HD 1NCBH 3CZEA 5EU6A 4HOWA 3TV3H 2CJUH 3RB5A 4PBDA 4YHPA 3T08A 3FUDA 3RGVB 1OK0A 1BZQK 2H8PA 5JOEA 1RZIB 4HVBA 1IGML 1RJYA 2EE3A 2EXWC 5IY5B 3EYUH 4QGYA 1C5DB 1L0XA 4D3CL 3CH8A 5DJYA 2X4RA 2WXPA 2G30A 1GHFH 2X2UA 1H3PH 2PCFA 4DKDC 4PMEA 1GTFA 4KKNA 3NACL 5C0DA 3D4ZA 1Y07A 1W15A 5D2NA 3QCTL 2CO7B 5HYJB 1TCRB 3DX1A 5IEHB 5JLZB 2XKNB 5E2TH 4FQHB 1F97A 2DYPD 5CMAB 3H55A 1BZ9A 4PTTA 1JNHB 2OL3L 4FNLH 4K9EC 4LEBA 4YHZL 2NY2D 1XVSA 5AB9A 2EO1A 5SWQB 2WTRA 1ZV5A 2C3XA 2VH5L 3HFMH 2XC8A 4PH8A 3WMPA 3WOVA 3B83A 1T0NB 1PYWB 4ZFGL 1K4DA 2AKRB 1D6VL 4OR1A 5KBPA 2Y5TA 3OKLA 2BNRD 3FCTA 1VSCA 3MODH 3KYKH 3SKNA 1B0RB 3VFTB 4B0MM 4F7TB 3K8LA 4P3CH 2F58H 1ANUA 1VDGA 4UU9A 2J6EL 4KQ0A 1CDBA 1AIFB 3HMWL 4L5FL 5JHLA 2LV4A 5SWSB 3MXWL 4PJDF 3GSNB 4OZIE 3CQQA 3HB3D 5I16B 4PGDA 1MJUH 5L9DH 4WGKA 5EZLA 2VOTA 4HZLA 5JMOC 4HZAA 1ZEAL 4YHIA 5IB2A 2BP0A 3U9UB 5EU4B 3CSGA 3CFIC 4YC2C 5E9NA 2IOOA 1QZNA 2NSMA 2VLRB 2AABH 3F7LA 4L29B 2A5UA 5DZVA 2BRRH 5HVHC 4XP5H 3CHPA 1KDJA 1UXLA 5CZVL 4FTDA 5MENA 4OJFL 1UZ8A 3MRKA 3UTQB 3GNMH 3PY9A 4X80L 1Q9WA 5DZOA 3SE8H 3PABA 3P9MA 5GGRB 5TK4A 4BSJA 2ZCLH 2IQ9H 4CVWA 1EUUA 4XO4A 3U4EA 3MV9D 2CR0A 1UG9A 1FNSL 3PUCA 1LP9F 4YX2L 1DVUA 3GEFA 3BD4A 1HHHA 2NCMA 4H0LC 1M1XA 4ZO8A 1QFHA 5H2BA 3KGUA 4FG0A 2JI3A 3MC0A 4MNHA 1MLCB 1NLDH 4A2EA 4KX8A 3D12B 1T6WA 3HC2A 2R8SH 5MEQA 3QORB 4YVUA 1RULL 2IBZX 5D7JA 4D94A 4FHBD 1KYDA 5I1AB 4DCQB 1YECH 5LGKA 1BQLH 2BNUB 2CM6A 5C0ND 1C7SA 2J25A 4O2CA 2F19H 4TF4A 1QASA 2VL5B 4WJ5B 1TQCC 1HHKB 4CSZA 4N90D 4ISVB 4J3SA 1URLA 4R96A 4P2QB 5I23A 3LKQA 1MHPH 1NZRA 2LLGA 1DQJB 4NO5B 4HLJA 4OUUA 3PNRB 3SE3A 4BDVA 2KLTA 2OTWB 3CSTA 4Z0BH 3MPCA 3VUAA 4L05A 4OUOA 4X6FA 4F37F 4HUUB 2E74C 2J8UE 2FO8A 2FYVA 3FN3A 3QORC 3M8OH 5I1CH 2ZP8A 1DJZA 4MD5B 3WTSA 2VDKH 3LNGA 4JCLA 4QRQA 4FMKA 3BH8B 3RDJA 3C08H 5IW3A 2F8XC 4GMSL 1S78D 2XACC 3JWNE 5BOJA 5C0AE 2COQA 4R2GB 5JORA 2I24N 2UV3A 3US1A 1I7RB 3VFMB 3QIWD 1C8PA 4AEIH 2HKFH 1GJUA 3VWJB 4X6BA 4Z76A 1NDMB 2PYEE 1G9ML 1BBDH 1S3KH 3L95B 4RQQA 1NMBL 3LJ3A 2XQYA 6FABL 4QO1B 4ZUSA 1KIUB 1AOHA 5HD8D 2JKTM 4RBPH 3TH4T 3EBIA 4BHUA 3A67L 4LBEB 3O9WB 4GUPA 5INCA 4JCWA 2F8IA 3QZPA 4LL4A 3DX7B 1M2VB 3NG5A 2PWDA 2X9WA 5FA4A 5L6YL 2YD6A 5K9JH 1RQ5A 1FGVH 1YHPA 2XWRA 5I1EL 3L16A 3L7FB 4ZXBD 4IEFA 1UCBL 1HNGA 4HK3J 1Y6MR 3MKGA 2CUAA 4NUQA 4G6AC 4O58L 3X2QB 5LVEA 3QUZB 2B4CH 3C9NA 3CFEB 3PWPE 3R0MA 5IMKA 3A6CL 4Y16B 3IFPA 2K3TA 3PAVA 4KHXL 3JWNG 3L9RA 4QRPD 1EERB 5B1KA 3KPSA 3V4PL 5BUAA 2B4CL 3L3HB 3KD4A 2UZYA 5F9JA 5IQ9A 4FABH 3BCDA 2ZXBA 4LKXB 1RIHL 1KV3A 5C0CE 3MKKA 1IM3A 3ARFD 4QRRD 4ODWA 4L18A 4WTZA 1J9CT 3MNZB 5FB8A 3IF1B 3BE1L 4MA3B 2MKLC 1FVCA 4NN5C 1CFNA 2WP3O 4M4RB 5ICZB 5HYQA 3EDEA 3HJEA 1VKXB 3WTWA 3FQWA 4K7PY 4KAQL 3G5YA 3LRGA 3ILDA 3I2CH 2ZOLB 2D2CC 5TDOA 5E70A 4XNXH 4TLUA 5HHVH 3LKNB 4C57C 4L9DA 1UH3A 4YL4A 1U8CA 4JREC 1KIRA 5EZIL 3FKUS 5FUOH 2VN5A 2Y6SC 4TPRL 4NBXB 5D71H 4B9JA 4HMEA 1HIML 2A83B 2JIXA 4D0CA 2WKGA 1S46A 1SJEA 5HVWA 2V5YA 3LKRB 5AD0B 4E41A 4MMXA 4BCYA 3IJ9A 3QUMA 2BVTA 1QSEB 3QXTA 4M43L 5BV7C 3V0WL 4GQ9L 3Q43A 3SODB 4Z7QB 5I1DA 4GO8A 1D6EA 2V9UA 4PR5A 4R5XA 3QUYC 3K6SA 1KFAL 4N8CH 1ZHLB 2KZ1B 3PV7A 3S36L 4ZO6A 2VRKA 3L08A 1JI1A 3KS0H 3CC5A 5FYLL 1H19A 1TEGA 3PDOB 4M93B 3FZUC 2EDEA 4M1CC 3SDAA 8FABB 1IVTA 4LASL 1KN4H 4B41A 1IGIH 3UTTD 4EN3D 3KLKA 1OP9A 3MMEA 1BF2A 3GRWH 4FG4A 3ULVH 2OR9H 3D48R 3ROOA 1FIEA 2GKIA 4PM1A 3PJSA 2HFGH 3VA2C 2G60H 3PWVB 4YR6B 2L0DA 3KBPA 3PFQA 3GEWB 5EU3A 3G6AA 4OVVA 4JRWA 3SOBL 4HXAH 1BQLL 4HETA 3QI9C 4JLRA 4GYBA 2YMOA 2D03H 1IAIM 5LAXB 2FX7H 2CNZA 2XX1A 1FHGA 5FO9B 2OS7A 3EIFA 1ZJAA 3CVHL 5IHWA 1XL6A 2AXGA 4P2RB 2WV3A 3LKPB 3EOAB 1J05B 5IBUG 2A1WH 5E1IA 1IO4C 4GXVH 5D1ZC 4NO2A 4OFYD 1Z5HA 2QQKH 4K15A 5AW3B 2DWEB 2X6VA 1PZUB 1OVZA 1OP3H 2V7HA 3PGDB 4WW2C 5HY9B 4PJ7A 3WS6C 1MVYA 5FWRA 1T7WA 4OQ1A 4JO2H 1CGWA 5KVFH 1OB0A 2W9LA 1DQTA 3KE0A 1AS8A 4NN7B 4LDEB 4OCSL 4Z3JA 1EWHA 3ZKNC 1KGIA 4XOCA 3UTSB 5H37H 3VCLB 4P3WA 4RFNC 4PVNA 1OSZA 1CGSH 2ZE0A 1LVEA 1NBYB 3KPMA 4LCWB 2L04A 3KNBA 2ZOOA 1UA3A 1C08A 3B7SA 3BSZA 4MMYB 3TNNA 5TE7L 4WY7L 3L5WB 1L7IL 4Z5RA 3EZ8A 1YQVL 5DYOA 4KROD 4OD3H 3QJXA 3A5VA 3S6CA 5AB1A 3S7GA 3HG1D 2GT9A 5I6NA 2VR3A 3RZCD 4P46C 1B9KA 5FUZL 1JYVA 1JXDA 4Y5XB 5JHBA 4A66A 4FN0A 5LUMA 4FTVB 2OXHB 3NMEA 1DN2A 4HCRH 3N43F 4K71C 4Q4IA 2BOLA 3PXJA 4FQ2H 2WXFA 4I3RH 5DD1H 1LDSA 5EC2A 3ZJAA 1W72L 2A4EA 2NNAA 4TL5A 4Y1AA 1I1AD 2ALAA 1KJ2L 5DUPH 2YAEA 1PD6A 3O9WD 4N8PA 5F97E 2M1KA 3BPLB 1T22A 3B9KC 3J2PA 4AC2A 1P4IL 2QQLL 3O81A 1EHNA 2NQ3A 5EF2A 4FNPA 3X13B 3R0NA 1HCFX 1UENA 4KK9C 1MI5A 1HSAA 4RETB 5KS9E 5D70H 1U8PB 1DYZA 1CXIA 4FKEA 1UH4A 4PCSA 4KUCF 3VXPB 2I32A 4KRNA 1JF5A 2Y7QB 3AWEA 4NN6C 1FSKB 1ORQB 4J6RH 2OULB 2ZAIA 4JHUA 4LEXL 4W9IC 5KBMA 5BZWA 4Z77A 1VESA 1BVNT 1CG9B 1TU2B 1UATA 3VD3A 4EI5C 2DL9A 2I7SA 4XVSL 4XP6L 3QEQA 1FZJA 1OAXH 3CFQA 4LSTL 1YPZB 2C1OA 1RZ7L 3BAEL 5DJ2B 1T0PB 5E1QA 1C16B 1A3QA 1ZLDA 1FO0A 1SDDA 3MJ9H 4NQCE 3W39A 3S4SA 5B39B 5GJTL 1M57B 1O7VA 3LPFA 5AL8A 1U3YA 1O6TA 4PJHA 1G0DA 4GXUM 1X9QA 5C0RL 1JCVA 5T1LA 2NY1D 5GXBB 1OL0A 4N8VG 2W0FB 2DM2A 4HUWB 5ADOL 1MIEL 3DHUA 1GIGL 2PWGA 1Z6JT 1IL1B 2KBGA 1BVKA 1QLEB 2DQHH 3INUL 4PJBB 3T3ME 4PS4H 4HIIB 4LP8A 3IGUA 3RX8A 1JPTH 3OTTA 3ZDYE 5B3JE 3U7YH 2NNRA 1E4XH 3WJLA 1MG3C 3O3DB 2X89D 2P8LB 4L8DB 3UGEA 4Z6AT 3FT2B 1IFRA 4JPVH 4OLZH 5BPPA 4RX4D 4XCFL 3MUHL 1NGPH 1OGAA 1YA5A 2Q9OA 3HFML 3RVTD 5IW1A 3R18A 3AC0A 2NZ9C 2PW2B 4J3BA 1CK0H 3GDBA 4MLIA 3U9PH 5C8JB 1C5DA 5I1IH 2FJHA 3FFCB 4LOUD 4GXVL 2EDHA 4BFFA 2X3CA 2FCBA 1CI3M 1L9TA 1PG7H 1U8OB 5FO7A 1EZVX 1QWNA 2OW7A 4RH4A 4PGEA 1QSZA 2QSQA 3BH9A 1EHXA 4JRYD 2UY7A 1AMXA 2BZCA 4CC4A 5IBLD 4MMZC 4IQHA 1R6VA 3PGFL 4NM8H 4CN4A 1RZFH 4PJHE 1JFQL 4EEEA 4UV7H 4WSGA 1SF5A 1JNHA 4B0MB 1RIHH 2J2ZA 3IDIA 4J2XA 4G6KL 1XH3A 1NTDA 1WGOA 2LLLA 3RB7A 2FATL 3HNSH 2CA4A 2WTRB 1INQB 3CV5A 3ZQXA 1UD2A 4QJ5B 1CFTB 5C92A 2AJVH 2XG5A 1GCFA 1T0NA 3VYOA 3H2QA 2F7IA 4N8VA 1ND0B 3TF4A 5EO1B 1N6VA 5E6IA 3SKNB 2B1AL 2QPEB 2ZOWA 1ZVNA 4L5FH 4UU9B 5EF3A 3VFPA 3W1ZA 4X7SH 5EOCL 5TF1H 4QTHA 1PCXA 5F6HJ 3H3PH 3QUXD 3L4UA 4BH8B 3WBDA 4OF7A 3OLGA 2B1OA 4FA7B 1XV8A 1MW2A 4JG1H 1D2PA 3VRLE 1OAKL 4DK5A 3QDJE 1YMMA 2C9XA 1XEDA 2LHAA 2P5ED 3K6DA 5E6SB 3D39E 3U6XA 3G9VA 2HTKC 5L2JB 1MJJB 3QPXH 5KVFE 3AMLA 2B20A 3TV3L 1KNOB 4FXKC 3WXWL 2K4WA 4H20L 4HWBL 4ABWA 5KSBE 1RLWA 2GUYA 3QIBD 1S7SB 4HSAC 3V5DA 5D7KE 4J8RB 3WN5C 4XVTH 3MRCA 1F6LL 1R3JB 2VGLM 5EULV 5HHMB 4PP1C 5FM5M 5E2VH 3ZTJG 2ZWKA 3KL3A 4Z7WA 2VO8A 3UAJA 5C0NC 3DLQR 4HKXA 3LQAC 1UM5L 4PJEE 3Q2NA 3BRFA 2WINB 4MVBC 1X9UA 4N2NA 5EEZA 2Y22A 1NINA 1U8MA 2D4FA 3V0FA 5FM8A 4OF6A 3IETB 4RVBA 2R29L 3AM8C 3KLLA 2VERA 3TT3H 3ILQC 2LGNA 3F7KA 5H4ZA 2LU4A 3FO1B 3FTWA 5IQ7H 1QSFE 1T04B 4PRAA 5HHMD 2D4DA 43C9A 1CD0A 4EKJA 3FNKA 5EZPA 3FT4B 4JFYB 3CVHA 3QISA 4DCQA 4FCHA 4AYSA 4KKLC 1KJVA 3ZMNA 3KPSE 2NY3B 2I60H 4YJZL 4MJID 4PHZA 4Y2OB 3B2DC 3FQ1A 4L4TA 2VL5A 4UZSA 3TBVA 3I84A 1HHKA 1PTZA 3ARDC 1TJMA 1XB3A 3SO5A 5JTWA 4P2QA 1J9TA 4ORZC 4BSWA 4QEGA 2Z0BA 2A9DA 1A22B 4PRDB 3ZRFC 5C0GB 4AGOA 2EEXA 3K1KC 5CCHE 4O4YH 1E8XA 2Q3ZA 4GLRI 4LRIA 1M6OA 4FFZA 2GQHA 3REWB 2O5YL 4HUUA 1ES0B 4A7TA 4HIEB 3Q06A 4NRZA 4MD5A 3IJ8A 2PWFA 2LFEA 3UP6A 4O51B 1WGVA 3BDYL 1YNTF 3HMXL 4K94H 1LQBC 2DV6A 2OX5A 1TNNA 4PJ9B 3HAEG 2IXQA 1IGJB 4BUQA 3FQNA 4EXPX 1P0SE 4GKZA 3CPUA 3ZGHA 3EJRA 1DCLA 1BM7A 4KFMA 3VH8A 3GXDA 2BZDA 2ZPKL 3FO2A 4DWHA 1MCDA 1Z3GL 2IPUG 3LN5B 1YEEL 4IHBA 5EN2B 1S7QB 4LLUA 1YEIH 2AQRA 4FXKA 5GJSH 1H6UA 5JW3L 1QLEL 3IPBA 3RWCA 4KKZA 3D87B 4PFEA 3CHSA 1MVUA 2GJPA 1WBXB 2HT2C 2YFNA 5FF6B 1BD2A 3UMNA 2DQCL 1SN5A 3IMWA 4X0KA 5D7LA 1DBAH 5FA4B 4OM1H 3WMSA 4EQ2A 5I15H 2XZCH 1F1AA 1U6AH 2R9HD 1HHIA 4PS7A 5KYYB 1T3FB 1TJHL 4N86A 1ACXA 2HN7A 1LO5A 3MLPA 1QRNE 5GZOC 1S5HA 1JTTA 3OSKA 2N0MA 3QUZA 3CFDB 3STLA 4OZGA 3BGMA 4YXKH 3T0EB 3D51A 5LBSA 5CP7A 3KZ8A 3EHBD 2QPDB 4KJPD 1TOXA 1UXSB 1ZKAA 3RWIB 3HI6L 2BHUA 1IEAB 3V0WH 2KZKA 2P80A 5JZ7D 3O6ML 3IF1A 1UM4H 2CM5A 4BA0A 5IROD 4M4RA 4E41D 5ICZA 5T1JA 5HYQB 2E59A 4GSDL 3ZE1E 3O6FC 3QYMA 1MCEA 3BFQG 5B8CB 3BP7B 5JHAA 2BMKA 2HLEB 5KEZA 3HAEA 2BP8A 1GGBL 4JL1A 1XF5B 1JGVH 3RVUD 3S3JA 5DD0H 4FI8A 3NIFF 4XCYA 1TFHA 1ZY9A 1T66C 2AJSL 2V33A 4ABUA 5FV2A 3I6LD 4YSSA 3JSSA 2DIEA 3MRIA 4I0PC 4JQVA 2EC9T 1HHGB 1IKNC 1CXKA 5CP3A 2JIXB 4D0CB 4MNGE 3CN0A 3OMNB 3WIFA 3SY0A 4GOSA 3FQYA 4E41B 4AW4A 2J20A 4MMXB 5ESAA 2Y7MA 2MNWA 1KGCD 4UIKH 3WN5B 2ATKB 3P9LA 2CLZA 2DQHL 2ZUXA 3I6SA 2F54D 4RFEA 3WO4C 5D5MF 4HOMA 3D0AA 3MLXL 3LKSB 1YPZE 2VDKB 3X3GH 3RBGA 3D25B 4I18C 2X1QA 5HHNA 3RQ3A 4BQ6A 3V4VA 2BO0A 1TQTA 5GZNA 1ERNA 1HEZA 2IDSA 3GTNA 5HJBA 2GAZB 3H4HA 2D3VA 1MSPA 5DMKA 3CN4A 1RV6X 1QA9A 3PWVA 4RA3A 3RIAF 2JB5L 4J28A 2FIKA 4OD1L 3VMNA 3CXHJ 4JLRB 3AQXA 2KQNA 5ITBL 2FEEI 3WE1A 3BXNA 4YHNB 4XP1L 2NY0C 1SEQH 2YO3A 3MRNB 2GBVA 1D7DA 4PJFB 1G7JA 3LKPA 1J9QA 4J4PC 4WWPA 3EOAA 3C87A 2HRHA 1HZKA 5BJTA 4KTDL 2DZEA 1IUZA 3IJ7A 1G9MH 4KNQA 1TVBB 4P23B 3PP4H 4DTGL 1YEGH 2WXJA 4UOQA 4UQCA 3V5KA 1OGTB 2LU3A 5K9QG 3B7RL 4YDNA 3SB3A 5HY9A 3ARSA 2ODIA 3S2AA 5GS1A 2WB1A 25C8H 4ELDA 1TJXA 1CVSC 1XH2A 1JN6B 3DX8B 2BXYA 3GMRA 4N0RA 4YHKH 5M94B 3E1ZA 3AB0B 4W9LC 5E6ID 1FNGB 4P9HH 1BZDA 2K70A 1JF1B 4XCNB 5HBBA 1X5FA 3HLAB 2B9AA 2HFEA 2DTSA 2KLSA 4GFXA 4LFHD 2IH3B 3QDMA 2A6JB 3ARFB 3IDYC 3QJOA 4ZODA 2HLFC 3U46B 4XP5L 4H5SB 3KPMB 2Z91A 3HB3C 1FQ9C 5AVXB 1KY7A 4DGIL 2Q8BH 1Q9OB 2AXFB 1V7NH 4ZX3A 3P3TA 2EDWA 3PWJB 1WTGT 2DWDB 1Q38A 4TNWF 1XGPA 2XXGA 3D4YA 5D9SA 4NIYE 3VFUB 2IDCA 2N56A 5F70A 1RP8A 3BLKA 2MSPA 3AUVA 4RGNE 3GSOA 1H3TA 1UB5B 5CLTA 1A9EB 2P1YA 2VISB 4HPOL 2XV0A 3V0JA 1CU4L 1QWUA 4JY4A 5CUSH 4XMPH 4DN4L 1E2ZA 2L3BA 4TULH 3CNKA 1PLAA 1D5BB 3FAWA 2ALWA 4KOCA 1E7VA 1IFHH 1JCKA 2F1BA 2TSBA 1N8ZA 4FFWD 4XR8C 1WE5A 4GQQA 1QYGH 4KV5F 5CEZL 4K3EH 2V5SA 1PZ2A 3QDGE 3X13A 1AE6H 4G1MA 2XX0A 1D5MB 3CZJA 4H8VA 2NUPB 5FHBL 1A6ZA 6CGTA 4DKTA 1IE5A 4FL4B 3ES6A 3PUUA 3GUTB 2I07A 5C9KA 1VGEH 1TQSA 3NH7L 1A9BB 3NSXA 1CYGA 5E2TL 4I87A 1WD8A 2DQMA 4JDEB 4XVUD 1KWGA 3FHQA 3P73A 2XXFA 4F7EA 4YOKA 5T1LD 4HXBH 1TU2A 1EZSA 1KTJA 4WEBL 1A7OH 2EC8A 3EXLA 3GXUB 1E30A 4GW4B 2OW6A 1Z9LA 4FFZH 4QHKI 2WQRA 4JFDE 4FFVD 1E6JL 4EDWL 1FLRH 3P3SA 4YEEA 3DDGA 2C1OB 1DVYA 3SBWC 5EU5A 5B3SB 1YPZF 1EHKB 3BVNB 4P2QD 2VDRH 4H1LA 1C16A 4XP4L 3AG2B 1K8IA 3W39B 5B39A 5IR1A 3SKOA 1G7HB 3FQUB 3LQZA 4I0PB 3QJFB 3PXHA 3HI1B 2FJFB 3MCG1 3OPUA 2BK8A 5EEXA 2MCMA 1E40A 4G80B 5ADPH 2R2BA 4ETYA 4HUVA 1Q0XL 1ZVHA 1AGBA 1KTDA 3MLWL 3OB0K 1M9SA 2P49B 4HV8B 4JJHA 2I7OA 3QQ4B 4RZKA 4N6RA 2X4SA 2MTPA 4DOHB 2E7LC 3UP1A 4Y2DD 3HG2A 3MA7A 3G3LA 1JZ2A 3RDTC 4U1IA 4YIQA 4V1DE 2YAHA 4A68A 1WD9A 1NFDF 2EXYD 4ZMQA 5D8JH 3POHA 3MXVL 1DBKL 3NACH 2CAKA 5LWYH 4PGJA 1HL5A 3OJMB 4QRSB 5D93C 4BK5A 3I3BA 4OV6F 3PJLA 1PKQE 1T7XA 4JFUA 3H6AA 2W65B 4WU7B 1WT5A 4QOKE 4N2BA 5IW1B 3VFVA 1KCRH 3ULSB 1ZS8A 4BXSV 2K7PA 2PW2A 5ESVB 3NP3A 4FXGB 3CBKB 3EYVB 1RPKA 2FJHB 3FFCA 3CZUB 3LS4L 4CUCA 1UADC 2XN9A 5FYKU 4L0PB 4K5NA 3V0VB 4ZNCD 2E76C 1JDAA 5HGDA 1OAJA 3TBYA 2VMFA 1MH5B 2YLHA 4OZFA 4RGNC 5EBWB 1NMCC 1U3HC 3LIUA 1E5YA 5KYWA 3L13A 1VFBA 3Q5YA 4X9IA 3WNPA 1U8IA 4IK7A 2ZUVA 3AWGA 1MY7A 4JFFA 4YWGL 4C55A 1G9NL 5DQJA 1SLXA 3VE0A 2YUWA 1J1PH 3QI9A 4F57H 1DANT 4H25B 3O4LE 2HTKD 4KJYA 3MOAL 1CFBA 3UYPA 3IU3B 3FF7A 4R4NC 4UT7L 3QQNA 2MJWA 4RGOH 4NAMA 5EO1A 2H8PB 4ZW8A 2PYEB 4AUYA 5K59F 3CSYA 4A2DA 4A7VA 4EIZC 1MFBH 5C3TA 4PHXA 5CSZA 3BVUA 2YJLA 4HK0B 4IU3B 4Y2DA 3W9DB 1FBIL 1JI2A 2C34A 4G9FD 3S36H 3QH3A 5E00B 4NP9A 4Z7OF 2CO7A 1OIOA 4MQTB 2ZCHH 2ZWSA 4KY1L 4BQCA 4N2DA 3C60C 4M5ZH 4YDJA 3Q8BA 4QRPE 4UDTA 2XN9E 4JHWL 4E9LA 3WFEH 4YSCA 2BY2A 1AZZC 4UQIM 3PIQA 1AZRA 3UBGA 4GI9A 3RDTA 5A1AA 1R3JA 4B9IA 4OCXL 3DJRA 1MFDL 2F6AA 1CFVH 2BIMA 2V5MA 1K4DB 2AKRA 6TAAA 4HKXB 1MRFL 4DK3A 4Z78A 1BMGA 1YY9D 1B0RA 3T6XA 4LE8A 4OLVH 2DQUH 4NDMA 5ALCL 3QZWA 1AIFA 2EECA 5FFGA 1SMOA 5CBEB 4Y2DC 3KWTA 3DI3B 4DKEH 5E7BA 1H3VA 4JGJA 3VXME 4TTDD 5D7IF 3ET9F 3C5JB 2GHZA 1VF5C 3JUZA 5D7SH 4TYUA 1SVCP 2P44B 3COOA 3BDBA 5D72H 2V6HA 3WSQL 4YSOA 4FDWA 5CGYC 3VG9B 1C12A 2N59A 4GBXA 4JAMB 4K7PL 1AHMA 1WC7B 1A25A 3RGVC 1QFWI 4W6YB 2ERJC 3U9UA 1FFTB 2WVVB 2BP3A 2ZXCA 3EBAA 3PL6D 4XWGH 3QG7L 3PPSA 3MLYH 5K1NA 2OYLA 2R8SL 4L4TB 1AOZA 3CGTA 5T5NG 4HIHB 2A4CA 2EXWD 4ODHL 1CGSL 1E4WL 3QDGA 2A6DB 3FU8A 3UMTA 1CFSA 2UYLA 3APCA 4BSWB 3D8MA 1NAKH 5KJRH 4N85A 2JCCF 4NHUB 3EGXB 3PABB 4QUOA 2A9CA 4X9FA 5K9OB 1F3DH 4DAGL 2WWMC 3REWA 3MREA 2BSTA 4HZ1A 5AVTB 4HIEA 5DK2A 2YPLD 1KGWA 4PY7A 3GI9L 1PW3A 1M1XB 4XO3A 1UWYA 2VO5A 3PQYB 1G4MA 4UCFA 3OGOE 1NC4B 4PJ9A 5D55A 2FAUA 1ECYA 4M6MH 2IXQB 1NIDA 3WU1A 4OT1H 1U58B 3KH4A 4N5ED 2IJ0C 2BNUA 4G6MH 5DFVC 3RPIB 1Y18B 1AD0A 1X5GA 1KB5A 3GXMA 2O5ZL 1SHSA 1MWAB 3U2SA 1OAQL 3FCSA 1A0QL 5IESH 3BH4A 3WLBB 3UPRA 3HUJB 3J8F7 4FA8A 3LKQB 1JWMA 1GZPA 2EO9A 5IVZA 3FJTA 2EVHA 3FB5A 4Y1AD 5K1VA 4NQXA 4B9PA 5I15L 4JQIL 2EDFA 3ZE2E 4OV5A 2IDQA 2YPKB 2BIPA 4M8UA 2AJYH 1RKRA 1ZDQA 1BFVH 2DQDH 5C3LD 3V0DA 5EOCH 5IFHH 5I8CA 1FGNL 4LSVL 3BH8A 4X7CC 1T1YA 5C0EB 4K7FB 1XMWA 2OQJB 3EKCA 3CFDA 5E4EC 1HAUA 1WZAA 3DUUB 1Q94B 1RERA 2DLFL 3C2AH 1MWAL 2A38A 3MGAA 5CP7B 5EIIB 1HZHL 2F53B 3KWWA 4NI6A 4WHYH 3TWCH 5I6MA 3KYMA 1SXAA 4TUJA 4WU5A 3M86A 2NY4D 3EOBB 2DRUA 4RQQB 3Q13A 3UZEC 4GW1B 2GC4C 4QO1A 1R9FA 4G7QB 2YXMA 4YSQA 4QNPF 1ZAGA 1TFPA 1M2VA 4Y4HB 1T5KA 4L37B 4NUJB 4UUJA 3FYIB 4P5MB 2Z6FA 4MQSB 3CCHA 1SHMA 4P4RA 4YGAB 1XGYL 3EOTH 5D6CB 4DZ8A 3BKMH 4C4BA 4HHAB 3DX3A 2H3XC 2GBAA 3EDKA 3JT0A 2ZOTA 3WS3B 4AOFA 4G7YH 4TLTA 1OM3L 1AQMA 3WTYA 1N2RA 2ZF8A 4XNQA 4W9KC 4XCFH 3KPRE 2RACA 2JLPA 4W6XB 3AXLA 1RUAH 4MAZA 3X12A 4DHLA 4EI5B 4MXQC 1YUHB 4G7YL 3V5HA 5L4IA 5IF0B 3K2UH 5KSBA 4JBSA 3RIKA 2YAMA 3U9WA 4NC1E 1TEYA 4KX9A 1UACL 1SYVA 5CD5D 4L8BA 5DLLA 3IXAB 3PFUA 5KVGE 1FYTA 3DROB 5T5NF 5ADOH 4AQEB 2CBMA 4WWID 1B4RA 1DUZA 1UCBH 4WTQA 1OGSA 3GBEA 4LVNC 4KMQA 5FDYA 5KYUA 2VLLA 2ADYA 3K2IA 3WDIA 5D1QB 3QIWC 1ETZB 1FC2D 4UV7L 3HOGA 4GINA 4MCZA 2UWEF 2WY3B 2X6UA 3ZHLA 3BISA 3MV7E 3KEHA 1N70A 4YZFF 5TE6H 5IEKA 5I1LB 2ADGB 4CMHB 1UB6B 3H7BB 4DF9A 4IRJC 5IMMB 4MWFA 1OAZH 4UMGA 1CICD 4PAZA 5CEXB 5FKAB 3TZVB 3OC5A 3OG4B 2OMZB 1G7JB 2FH8A 3IWUA 3QUMB 4WVRA 4NPYA 3OM3B 4WI2A 5TF0A 1KIQA 4UAHA 2DQTH 2ZUSA 3QCUL 1QHOA 4K73A 3SYAA 5IBTH 3C6LB 1ZHLA 4P23A 1JXJA 2X4OB 3VRLF 1HI6A 1R47A 2XBTA 1PLCA 2CO2A 4X9YA 4GI6A 1JZ8A 3SDAB 1R3IH 4KK6C 3VG0H 3TP4A 3TFKC 3O41B 3MMEB 4KJQD 5C0BB 3MOBL 4CL7A 1UOKA 5CLXA 1JF1A 1UWEH 3FU7B 4XCNA 1VEPA 4XMLL 5D5MB 4TUOB 3CVCA 2SODB 3SOTA 1MFAL 4DP2X 3QDMB 5DMGC 2WLYA 4G6ML 4HS3B 5EA0H 4XMVA 4KWUA 2ZYRA 3BDYH 1HIMH 4HISA 3REVB 4K3EL 2KC0A 2Z91B 5DD6B 4F9LC 1LDPL 2Q8BL 1QBML 1LO0L 3E8UL 4R83A 5DURD 5B3NA 4PD4J 3UOAB 4PLKD 2ZNXA 4RGNB 5FYLD 4U2YA 2WQXA 3B8YA 2J21A 5EF0A 3EW3B 3W2DH 2R0KL 2AQ2A 3SJVD 5JDSB 3P02A 3QRFM 1QRNA 4DO4A 5BRZB 4WWKB 4YHOL 3T8XB 3EFDL 3PHOB 4TS6A 1EHAA 1EJOH 3VSTA 3TIEB 1Y0LB 4HJSA 2WXOA 1DQDH 4KRMB 1F3RB 2E9JA 3Q8FA 2C5DC 5I26A 3X1EA 2VISA 4CNIA 4EBQL 4P57A 4H0IA 1OB1B 4MJIB 4IIQA 2WBWB