3NJFA

Y26f mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIFTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 18
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njfA00
1CC3A 2DY2A 1GW0A 2HX8A 2Y1AA 2TSAA 2DWSA 1TKWA 2FQGA 3AY2A 1F56A 1PZBA 1VLXA 3FU7A 3UGEA 4HAKA 2BHFA 4A67A 2HLEB 2I85A 2IDQA 3X1GA 4YSRA 2PPDA 3H4HA 4KNUA 3EH4B 1GY2A 2CBPA 1AS8A 1ETJA 4YSDA 2LLNA 1MG2C 4EF3A 4KNTA 3ABKB 3JT2A 1ILUA 1SFHA 4F2FA 3ERXA 2IDTA 4A2FA 4QLWA 1QLEB 3S3CB 4BK5C 2FQEA 2FJSA 2BW5A 2ZOOA 5F7AA 1RZPA 5PAZA 2W88A 1GSKA 2N0MA 4WKXA 3TA4D 1GR7A 1FA4A 1BXUA 1E30A 2IDSA 5LDUA 1AACA 4GXFA 4E9SA 1NWPA 1RKRA 5ANHA 4E9QA 2MTAA 3PAZA 4HALA 1JZIA 2EIKB 3SBQA 2I7SA 3S3DB 4YSAA 1J9QA 3H56A 2BO0A 1SNRA 1NICA 2AZUA 1PCSA 3T6VA 4DP5X 1BAWA 4AI7A 3T9WA 4A2DA 2GI0A 4G72B 3WG7B 4BXVA 2YXWA 5I6PA 3CVBA 3QJQB 5B1JC 3UACA 1X9UA 2EIMB 1OCZB 3WKQA 4HCIA 2PP8A 1NDTA 1IUZA 1PZAA 4QKTA 3MBWB 3IN0A 2BW4A 2Q5BA 1KDJA 2UX7A 3X1NA 2OV0A 2NRDA 2JXMA 1NPJA 2QPEB 2BP8B 4M3HA 7PAZA 1WA0X 2ZWNA 2YAMA 3V9EA 1AANA 3QJRB 1IKOP 2J56A 3DIVA 3NJMA 4UAHA 1OE1A 4K9JA 4E9XA 1JZFA 4YSCA 4DP9X 2B3IA 3OMAB 4A2HA 1WA2X 4KOCA 1NIDA 1AOZA 3NJNA 1PLBA 1UATA 1NZRA 2I7OA 4YVUA 3ZDWA 1ET5A 2Y69B 3IE9A 2EINB 2BZ7A 2J55A 4YSUA 2XLLA 3IBOA 1JXDA 1AR1B 1ZIBA 3ZX1A 3UAEA 1TEGA 2PPEA 3GYRA 3X1FA 1J9SA 2P80D 4HZ1A 3T6XA 3FQ1A 4DPBX 4BXSV 3NT0A 2FT8A 5B1KA 2XXGA 1M57B 3AW5A 3PAUA 4AX3A 3UAAA 3FSAA 1DYZA 4HCGA 3NJJA 5B7EA 2UXFA 1HAUA 1NIBA 5B1BB 2UXVA 1GYCA 3RYMA 1ZIAA 1E65A 4A2GA 4DP1X 1GS8A 2IDFA 1WS7A 1T5KA 3C75A 1BYPA 4PAZA 1JZGA 1PZCA 1B3IA 5I6OA 3AG3B 3MX0B 3WNJA 2IH9A 1TEFA 3CVCA 2XWZA 3AG1B 4GP8B 4ENZA 4FAAB 1JVOA 2E86A 2PP9A 2XX1A 3NYKA 3HB3B 2RACA 1L9TA 4CSPA 3UABA 1BXVA 1QHQA 2CUAA 4UF7C 1A3ZA 1KBWA 2FTAA 4BWTA 2CAKA 1OOWA 2UXTA 1NIEA 2GSMB 2JFCA 5E9NA 3T6WA 1SFDA 1KGYE 3HEIB 2JKWA 3ZBMA 4YL4A 4N4YB 1JZJA 2CJ3A 3DKHA 1CURA 3CDZA 1A4CA 2HZHA 1AS7A 1PLCA 2OJ1A 2XX0A 2XU9A 1NPNA 4KO6A 3X2QB 2GBAA 2IWEA 3TBBA 1AG6A 1PNCA 4BDVA 2QT6A 3FSZA 1IBYA 1OCRB 3QQXA 2AZAA 3S8GB 2GIMA 4L0PB 5AFAA 2FNWA 5I5IA 3CZUB 3EH3B 2HX7A 3AG2B 3NJLA 2BP0A 1SDDB 2CALA 3CDZB 5PCYA 1J9RA 5B7FA 2YAEA 1AG0A 2Q9OA 2HXAA 2QPDB 4HIPA 1A8ZA 3PLYA 4HCFA 1ASOA 3WKPA 2UX6A 1J5DA 2YQBA 1JVLA 4PCYA 2GC7C 3NSDA 1OF0A 4W9ZA 1BQ5A 3FS9A 5I6MA 2DYSB 4A2EA 5AZUA 4F7KA 4AKOA 3JTBA 1W8EA 1W6LA 1N68A 3CG8A 1XB8A 5D4HA 3FSVA 3QJTB 1ID2A 2EILB 3FYIB 1SDDA 1TU2A 2VN3A 4G71B 3AZUA 1SF5A 3NJIA 4MFHA 2R7EA 4W1TA 1KBVA 2ZXWB 5I26A 2VW6A 4NB7A 5I5MA 1L9SA 1MZZA 2VW4A 4DP8X 4GYBA 3CVDA 5B1JA 4Q8BA 2XV2A 4E9RA 1PAZA 2BWDA 2EIJB 2AFNA 6PCYA 1X9RA 2FWLB 1RCYA 2AVFA 1JZHA 4HHWA 1IC0A 3QPKA 4AZUA 1V55B 2IAAC 1GS7A 1OCOB 3GXUB 4DP0X 1ZPUA 4G7QB 1GY1A 3X1BA 5A7EA 3OMNB 3NSYA 4G7RB 1ET8A 5D4JA 1SHXA 4AKPA 4TXVB 1PF3A 3UADA 2DYRB 3TBCA 4YSTA 1PNDA 2VM4A 2BP8A 4N8UA 2FQDA 3OQRA 4A66A 1SJMA 2XUWA 4JKNA 2R7EB 3H4FA 1AZRA 5I28A 1E5YA 1PY0A 1GS6X 1MG3C 4BWWA 2WSDA 4E9TA 2AANA 5TK4A 3NSCA 1ASPA 1ZDSA 1URIA 2YAFA 1BQKA 4GP4B 1AAJA 4A68A 1AZBA 3FT0A 1XB6A 1N70A 1MDAA 2DWTA 5B1AB 2VMJA 3QJUB 1SHWA 4YSEA 4KO5A 3PXLA 1EZLA 2W8CA 2GC4C 1R1CA 1JXGA 2ZONA 3BVDB 1FWXA 4ZK8A 4G7SB 1SF3A 2WO3B 4WTQA 3EH5B 2XVBA 3ABMB 3L45A 2BZCA 4HHGA 2MRYA 2GHZA 3X1EA 1AZNA 3FQ2A 4P5SA 2OCCB 3QJVB 4BDVB 2PPAA 4DPCX 3N2JA 1AZUA 2YXVA 3SBPA 1OCCB 3OM3B 1EHKB 4GY4A 4JHVA 1HAWA 1L9RA 3OMIB 4RH4A 1AQ8A 4YVNA 3T71A 3KW8A 2J5WA 3PAVA 4M4RB 2CCWA 4DP7X 1AIZA 1QNIA 4Q89A 5EHFA 4AKQA 2IDUA 2UXGA 2X87A 4DP4X 3AG4B 5I6LA 2FT7A 3V9CA 5I6KA 3SBRA 7PCYA 1JOIA 1OE3A 3FU7B 4F2EA 2B08A 1DZ0A 3FPXA 4GP5B 2J57A 4KNSA 4JHUA 8PAZA 5B3SB 1V54B 1KYAA 5AKRA 2XXFA 3PPSA 1WA1X 1YLBB 1XB3A 1I53A 1BXAA 2IWKA 1ASQA 2DV6A 3FU8A 1RZQA 2PCYA 2PPCA 2QDVA 3TU6A 4YSOA 1KCWA 1ZV2A 1JERA 2YARA 2HX9A 4DPAX 1BYOA 4CSZA 1NINA 1BEXA 3TASA 3ZIYA 1OE2A 3NSFA 1WS8A 1ADWA 3T6ZA 3NJGA 3EF4A 1AS6A 1L9PA 1NWOA 1KCBA 4G70B 3WNIA 2YAPA 2PPFA 2BWIA 2YAOA 2VSMB 3D12B 3ABGA 1ILSA 3IN2A 2BP0B 3NJHA 4KOBA 2HRGA 1E67A 5D4IA 1CYWA 2TSBA 4YSSA 3S3BB 4FA7B 1PLAA 3PCYA 2P80A 4P5RA 1NTDA 2VM3A 1CUOA 1W6WA 2H5UA 2XV3A 9PCYA 3SQRA 1A4AA 1ET7A 3ASOB 2FQFA 3G5WA 3NP4A 6PAZA 4DP6X 2A3TA 5TK2A 1HFUA 2IH8A 1V10A 1BQRA 1NIFA 3DTUB 5B7MA 1CYXA 2PCFA 2YAHA 2H3XC 2YAQA 3ASNB 3NJKA 2PLTA 2XV0A 2VW7A 4X4KA 2VSKB 3FU9A 3QJSB 2IWFA 1WAEA 2FT6A 4DP2X 4UANA 3EHBB 3BQVA 1A65A 3FSWA 3U25A 5F7BA 1M56B 2WO2B 3FYEB 4E9WA 1ZDQA 3OD3A 1PMYA 5IY5B 1JZEA 3N55A 4E9VA 1E5ZA 3KW7A 2GB2A 4E9YA 1IBZA 1JXFA 1MZYA 2H47C 1A4BA 4YSPA 2QDWA 3FQYA 1M9WA 1KV7A 3S8FB 4KO9A 1J5CA 4NERA 3ABLB 2X88A 1J9TA 5FC9A 3NJFA 3WIAA 3WI9A 2HRHA 3GDCA 2PP7A 1AZCA 5I5JA 3FPYA 1L9OA 1FFTB 4YSQA 3IEAA 3NP3A 4NAJA 5I6NA 1L9QA 1XMEB 4KO7A 4BWUA 1KDIA 1OV8A 2XYBA 1NIAA
chains in the Genus database with same CATH superfamily
1NPUA 2CBMA 1T7XA 3PIQB 2D73A 3T65A 3GRWL 5DJ2B 4Y8AA 3O6KH 3P4LA 1U58B 3FU7A 2FD6H 1KCUL 5FA3B 4WWID 5JW4N 2NSQA 4PREA 1W72L 1FNEA 4MNHB 5FFGA 4N20A 1TQVA 4TUUA 3LRKA 4B7LA 2FUQA 5LAXB 1ZLEA 5TE7L 1KJ2B 3O3AA 5AUMB 3V4PH 4LDLB 2D7MA 4KFZC 2R4SH 3CLEL 3BZFB 1SFHA 5KUMA 3RVWC 4KZEL 3TCLB 5LGJA 1T1XA 4Y5VA 1G7PB 2J4WH 1H3PH 2K4AA 4OLYH 3VE0B 1VERA 4U3SB 2IAMA 5E99L 3T6QC 1UM5L 3D51A 4C54A 1AXIB 1RZPA 5A2IH 3QJXA 1U36A 2YEVB 3ARBC 4NQCB 3SPHA 5EO1A 3U7YL 1IQDA 2UVFA 4U1JA 3HG1B 3NFSH 2AJVH 5E8DL 1I8MA 2G5BA 1JGUL 4JPKH 4NN7C 4WJ5A 4E9SA 3WHXA 1T0MA 3DHJA 1CXFA 2K8QA 1FDLH 2LVCA 3NIFF 2OP4L 5FUOH 4GRWB 1G7IA 4MCYA 4NUJB 2JKTM 3TWCL 2EYTB 4L1DA 3HG4A 1A0QH 2XN1A 3D50A 5I1AB 3V6OA 1GIGL 5DJ0B 3Q2WA 1WF5A 1HSBB 3LXCA 1OARH 4J4PD 4PHXA 2Q5BA 3PDOA 4JPIB 1UWGL 1C8PA 3IRCA 2WN2A 5F7KC 1PZ5B 1TETH 4F33A 2ITCA 3QUXD 2ALAA 5IQ9B 4IIQC 5F3BB 4AIOA 3OB0K 1NDGA 4YUEH 2CBTA 3JZ7A 5D7LB 3QXUA 3WD5H 1K4DB 3SN6N 1T5WB 2VC2L 5G2NA 3VFOA 4WK4B 3K4ZA 4KDTC 3UZQB 1KCRL 1LP9E 4K3GA 4QRQA 1PEWA 2DMHA 3H54A 3S3SA 3EG9A 4S11A 4PY8J 3QXAB 5ABDE 3GMPA 4IMLB 1Z6JT 3PP3K 2TRYA 3LIZL 2BOLA 1I3RA 2AGJH 3D25B 4HIQA 4PTUB 3UH8A 4U1JB 3NH7H 3EJUA 2IANA 3CC1A 3T77A 1UYWL 2QVFB 4PCSA 4KQ0A 5A40E 2FT8A 4QOKE 1T1WA 1R3KA 4BQ9A 5I1IL 4LARL 4RGNC 5IMOA 1JRHH 4PB9L 4FHKA 1BWWA 1UXSA 1X5MA 2VL4A 1BLIA 4QXVA 1EK3A 4A63A 4OLZH 3A6CH 3P73B 5F89B 5HYJA 4YBLB 4IOIA 4DP1X 1JPGB 2NY0C 1P5UA 5DSCB 4JPQA 1AGDB 2YZ1A 3SBWC 1DVFA 1BYPA 1KTLA 2QKIA 5FHBL 5LUMA 1FVEB 3GJFK 4YR6A 1LYQA 4J1UA 5C0IB 4PUBH 3DUUA 4KZDL 4ELDA 1JVOA 2E86A 4H1LB 3S36H 2W1NA 3BW9A 3ZHNA 4FOMA 4QYOB 1S7TA 4EI5C 2R1YB 3CDYA 4NKDB 3WE6A 4P06A 4Y2NA 4F20A 5B22A 5BRZB 4H2AA 1CT8B 1P6WA 3FFDB 4NQDB 5JIQA 2LHAA 2WNXA 2ZX8A 4XWOC 2FIKA 5JHDA 3O4LD 3FQXA 4LASL 2N7BA 4GQZA 4K15A 3CZFB 3QI9C 3RWIA 3CUPB 3F12A 3V0WL 1N2RB 2WNGA 2VN7A 4EAEA 1QR1B 3EDFA 1E40A 1EV2E 1I1RA 4PTTA 3T08A 5LLIC 1CURA 1FVDA 4P9HC 2F58H 1V7NH 5EZIH 3QCTL 4XRCB 1MAML 4I8DA 3RB7A 3FBQA 5CIPB 2CIKA 2QSVA 1MH5A 1WO2A 1IC7H 4U0QB 4ZFQA 4JL1A 4JRYB 1G1CA 4O51B 4BDVA 3O9WD 2VERN 4TRPL 1YMME 3MNZA 2R83A 4GW5B 4F7EA 3UTTD 1T1ZB 1U3HD 4ADGA 3GNML 3QAZC 2WLHA 4NZRH 3EJPA 5E56A 3AY4A 3BDXA 1TG8A 1IZJA 2OMXB 4PJ6A 2WIIA 5I1HH 1QSEA 3W5NA 1I3VA 1A64A 3FTWA 3NSDA 1GGCL 3HS0C 3H3PL 4Z7VA 3KPRD 3VG9C 5HGBA 3ARFA 2EEAA 5AZUA 4GUQA 4W6WB 4Z3HA 4GQQA 1P4LA 4ICXA 4N6RB 3CFBB 1FP5A 3D3VE 3KH4A 5EF0A 2I27N 5DJ6B 5I18H 3G6DH 5SX5K 2WIMA 3OR6B 3WY2A 3V4PB 1UH4A 4TUOB 4O5LL 1A1NA 5MEOB 4HIHA 3NIDE 1QAWA 2ICWJ 3PNWA 3L1EA 5ID0A 4GG6F 1JIBA 4MCYB 1V27A 5I8KH 5I1HL 5HGAA 3W11C 2F1EA 4BHUA 4U1MA 5B1JA 5C8JA 5DUPL 5GRJH 2Y25A 3VRJB 1MCJA 5T5FA 5CZXD 2D2CC 1IAOA 2AFNA 4HUXA 4ABVA 4AYFB 2NYYC 5LVEA 3MJ6A 4JK0D 2D7TH 2C26A 1K5NA 1G1YA 4HMDA 1IEBA 1R9FA 1PEZA 2DDQL 3GBEA 4P4RB 5FFLA 5BUAA 2FJHB 3U9PL 2G30A 5CMAA 3X1BA 4KJQC 2EDKA 4WKZB 3TN0C 4MJ6B 1O9VA 3VE0A 3WOVA 3WFEL 2WXKA 1H3GA 2DIEA 4AKPA 2CIKB 2R2BB 3A4FA 2ESVA 4RBPH 5L4IA 4ZUWB 5JXEC 1TNMA 1KT2B 1GAFH 4DN4H 1OAZH 4RDQF 3ZQWA 1JZ6A 3DYPA 4PGEA 4PYGA 2XUWA 5EN2B 1XAKA 4XOBA 4TULH 5CZRA 4AOFA 5EBGA 2GIYA 2WQXA 4Z7NE 1DZBA 1EHAA 3PQYE 1JNNL 5DLLA 3RWIB 3W2DL 2WLZA 2YBRB 5SX4I 1GVIA 2IANE 3WSQH 4RAHA 5EZOH 1XGZA 1RULH 1XWVA 3D85D 1YUHA 3IPEA 1QATA 3BJLA 3PL6D 5B1AB 4X7FC 5ICYB 4QD2E 2JJSA 2UUDH 4KVCH 1M71B 5IJBC 2ICWI 4DW2L 5I66B 5IT2L 4HK0B 1OAZL 1CJYA 4RMWA 1K5WA 4QKXB 2HJLA 3GNMH 4BE6A 1CN4A 2VRAA 4MQTB 2DQCL 4TULL 5H35A 1L9NA 4JFEB 3CLFL 3NRFA 1DVFC 5BCAA 3QIUA 2QKIC 2X0VA 5DCCA 1VZIA 1TLMA 3TA3D 5JNYA 2YMOA 4BK4A 5AEAA 2XWJB 3OF6D 3NEOA 2YLHA 1IGIH 1I9JH 2BSSA 2W07B 1ACCA 3SGEH 1F5WA 1EJFA 1I8IA 1ZWIB 1CTMA 2PPAA 3FO9A 5KOVC 2I5YH 4HUVB 2DEYX 2YXVA 4O02H 4PJ8A 1RSYA 3SBPA 3QHFL 1JDAA 2DLGA 3DX9A 4IOFD 5EU6A 1VIWA 4Y5YB 4WF7A 5IJCC 1XF4A 1AI1L 3EJTA 4Q9CA 3UBFA 4AVHA 2VXTH 2JKSA 5GISL 3PP4L 2XDHA 3RWGB 4UNUA 1AGFA 1E4WH 2OTUA 2P5EA 4FRWA 4MJIA 5D7IA 4HIIB 2VE6A 2ZKMX 3AG4B 3S96B 4JFZL 5J1TC 4QHKI 1JOIA 1OE3A 4X6BB 2X4TA 1G43A 3IS0X 3MYJA 1OM9A 4J3VA 1GZPB 3E6HA 3N1PC 4Z3EA 1PU0A 2APWA 2GK0A 5AKRA 1RZGB 2GT9B 2XXFA 5H94A 1YLBB 5L2KD 2ATAA 4DJMA 4NQXB 1AC6A 4JM4H 4TUKL 4CSSA 2H2PC 4KRPC 1RIHL 2CO7B 1U3HC 1N6QH 3HI6H 2QDVA 3VFUA 5E51A 3MRJA 1JZ7A 1AGFB 4BZ2H 4X6CF 3QQ9D 4IBQA 4HS6A 4N2GA 5EN3A 3NIDF 4JS7A 4MS8C 5KSAA 3O4OB 1UUSA 5GJTL 3BE1H 1WBYA 4G3YL 3LKRA 1K8IA 3R4RA 1A7QH 1JPFB 4NZUL 4TUJB 3BKYL 3CZKA 3NSFA 3Q06A 1S9VB 4YAQB 2OMVB 4XNQB 3JXAA 5D70H 5JHLA 4OZGE 4MTMA 1B0GB 2VSMB 5D9SB 4QTHA 2WZAA 4G8GA 1ILSA 4J3OD 4BYHA 5DT1L 5EOCJ 5D4IA 1WAAE 1RIVL 1GH7A 4CN4A 4FXGC 3INUH 4GKOA 1Q9WB 3QJZA 3ESNA 4XP4H 4QXTB 3MJ8B 4HH9B 2BNRA 2UZYA 3P9LA 4KRPB 4HEMA 3VTMA 1MFBH 1E2VA 5TE6L 3LZQA 5CEZD 4ZT1A 1SDAB 2GY5A 1H3VA 4E0RA 1GA2A 4M56A 4D9QE 5GZND 5CZXC 2DWXA 3L3GB 4NXKA 4DQOH 2G0LA 6PAZA 3EO9H 3HC0B 2VZOA 3DOIA 4N2FA 4NQEE 2BS9A 5JOFA 2G75A 3DTUB 1JTOA 5B7MA 1NANH 3R8QA 5JO5B 2G9HB 1ZTXE 2CHZA 3BSZA 4LCYB 2RFXA 1BM3L 3L4XA 3QJSB 4HUCA 4WWNA 4I87A 4PP2B 1A65A 2DJMA 3TT1L 3ZKXB 4C56D 5AWNH 3VD1A 3HE6D 5AW5B 4ABWA 5JXED 3BAXA 3IGAB 4Y2DC 3HNSH 5CJ8A 4J8RB 2IADA 4ZFZB 5JOEA 2XTJE 5KBKA 2AJ3A 1PKQE 4M5SA 3DMMA 5I17B 1DQLH 1AOHA 3ILQD 4JFFA 3A24A 4P59H 1JRHL 4XNMB 3PWJA 1JUFA 1DBML 4PRHA 1E2WA 2HG0A 4CU7A 1AZCA 1E9PA 4JKKA 5H37A 3SGDH 32C2A 4HS8H 5H4YA 3NDZE 3T8XB 5IF0A 2UWEA 5BUPA 2RQEA 4PJIE 1L9QA 3OKKB 4MRCA 4PJ7F 5IUSA 1E5UI 2WTOA 4PJCF 1GZQB 5AW9B 4JN2A 3SYCA 1MIML 4BFOA 1RP8A 1CVSC 1EEYB 1V7ML 3RVWD 4XCNB 2IFFL 4GMTL 2WZ5A 4HCRA 1YEGL 5DK2A 5SV3A 1P84K 2TSAA 1F02I 2FJFB 5DVOA 3ULAB 3T4YB 3X14A 4AQ8C 2O6CA 4H5SA 5H2BB 3QIUC 2Z9TA 3T0EA 5ACLA 4YDIL 2C9QA 2Y07H 2GABA 5EORH 1KTDB 2IDQA 1BEYH 3QUZD 4PMFA 4XPTH 4X50A 1WTLA 2N3JA 2QR0B 5C0CB 4AG4L 3W82A 3MUGA 3P3UA 2JIXB 2CBPA 1AS8A 4IOFC 2JKJA 4KV5E 1P6FA 2D03H 3F7YA 3U7YH 1SEBB 3LNHA 1CU4L 1FBIL 1ZV5A 4BK5C 5IHZB 1KWKA 3FHAA 3L3DB 5FCUL 2FJSA 3HUJF 5D71H 2SODB 2HT4C 4NDMB 3OPUA 5F7AA 3ZZ1A 3RFRA 4L8SA 2NQ3A 1AIFA 4X80L 1BWMA 1LO5A 1OM3L 1UG9A 1KPRA 1NUFA 1OIOA 4LSVH 3VI3E 5GGTL 2ZOUA 4EI0A 5TDPA 2KMWA 4O9HL 4BFGA 1AACA 2AAAA 4FQLL 4XP1H 2OCJA 3MRMA 4FJZA 2ZAGA 4JHWH 3QEQE 2H3NB 2KDGA 3PAZA 5CLXA 4M1DL 5HYSG 5J11B 2IGLA 5EIIG 1HL4A 1KXQA 3QB7C 4Z7OF 4TV3A 2C9AA 3TT3H 3IRPX 5D1XA 4ZO7A 1NAMA 3UACA 2PYFA 4KQ4L 5ESVA 5TPWL 5I5RA 3R1GL 2UWEB 3TIDA 5KSBE 2HAZA 3ZKMC 3BUDA 1Z7JA 3IN0A 1W9XA 4LFHG 1A9VA 4HGMA 2JXMA 4UQ2A 1KFGA 1BQHA 3U6XS 4HT1L 3WEXB 3AWGA 1WQVT 1I4FB 1XGTB 4UQ3A 2NY1B 2WXGA 3QULA 4HPHA 2A0LC 3ET9F 5FGCE 4XWGH 5T1MA 2V7NA 4RAVB 1JTPA 3V55A 2ZXQA 5A6MA 1DQIA 1XD0A 3S2AA 3GSRA 4EI6A 3GMOA 1IGIL 1WCBA 1KIUB 3L7EA 3HKZA 1QRKA 2W80C 3DURB 3F5WB 1KTJA 25C8L 4N8CH 3U2JA 3W57A 3EUUA 3VRLF 3D06A 3KJ4C 5MEPB 1BVKA 5TGBA 4PB9H 3CJJA 1BD2A 2KDYA 4I9WE 4XX1E 2N1TE 5FV1L 3GD1C 5EEXA 4OZIF 4G8AC 4KDVA 1LMIA 2E7CA 2YPVA 1IGMH 2XQYG 3M46A 3UAJD 4RESB 4XPAH 1Y7VA 3WFBH 3PAUA 3NCJH 5I0VA 5A1AA 1OPOA 4M6ML 5EIIB 3UIZA 3AQZA 4JPSA 3MTXA 2R29L 2W0FA 4O2CB 3UBGA 2NT1A 2WYIA 3OAYK 4OM1L 3BX7C 1CLZL 4OZHA 3X17A 4ZUSA 4Y2DD 3BAEL 3L95B 3MJGX 4N90E 4Y16C 4U6TA 4NT6B 1KFAL 1T4WA 4XP5H 5FUCE 1JSYA 1NGZB 4G9DA 4AENA 4Y2DA 4AQ1A 4TN9A 3ULVD 3LZOA 1CLOL 3RVUC 4OSUH 1ES0B 4LBEA 1A1OB 2XTJC 1WBZB 3KXFD 2NR6C 4YIQB 5FO7A 4GQRA 5FECA 4WTXA 2XWZA 4BKSC 4LIQE 4MMXC 1T89C 4PRAB 1OD9A 4GS7C 1WFJA 2V5TA 5FV2A 5FYJD 2RACA 4BZ2L 2X0UA 1V3JA 1A02N 4QJ4B 3CN0A 3AAZA 2EDBA 2IFGA 1MELA 1BGXH 1YVLA 2ZCLH 3CFCL 4PGEB 2Z31C 3KLQA 3BEWB 4KAQL 5FO9A 3T4AB 1A3QA 4H8PA 4HJIA 3SDCB 4NKQB 2C1OB 2WKOF 1FZOB 3BD3A 4AUYA 2K8MA 1BFSA 1WEJL 5LXVA 1UT1A 2CDGB 3EOBA 2F5AH 1X44A 2R2EA 5TDPB 5L2JB 1D6VL 3FH5A 3LZFL 5F7FA 4Y9BA 3T1FB 4YL4A 3UBXG 3QUYD 3BKCH 2B4CC 5K9OA 1A4CA 3QCUH 2VSDA 5E4IA 3PWUB 1UJ3A 1OF2B 3GHBL 3QPQD 3JWDC 5HHOA 4WJ5B 2MKLC 4UIKH 4WZ9A 3LNDA 5EIVA 1I3GL 4NFDA 3WCYA 3FSZA 3TEXA 4HZLB 3BP5B 2ZD0A 2HT2D 5CCGE 1AGBA 3CZUB 2VDQH 1XF4B 3BWAA 3APNA 4CW1B 5C0RH 3VTAA 4X0KB 2TRHA 4F8LA 5B7FA 4F57H 2IEPA 3N44F 3BO8A 2XWBB 1JK9A 4KI5E 1BJ8A 1QRNE 1TQCB 2NCMA 1W2KT 1G0XA 1HK6A 1MLBB 4MNQD 2PYED 3QUZA 1E27B 4RMVA 3TEYA 2NYYD 4PMEA 1EHLH 3P4MA 4QRRA 4GMSL 1W8EA 1W8OA 3CG8A 3LEVH 4PI2A 1FNEB 3CZSA 3QJTB 1Y18B 4IOSA 4Q7DA 2XQYK 2VLJE 4K7PY 5I1GL 3NACH 3AZUA 1SF5A 5HHVH 4FQHB 4K7FA 5CGBA 4A1RA 1SDYA 1G6RA 3H9HA 3IWUA 2A9AA 4W1TA 3DARA 1KBVA 2ZXWB 4BH8A 3SE9H 5B8CB 4XPBL 3FZUD 4NQEB 4Z7QF 1BJMA 3EJYD 5DZNA 4JFFB 4PRPB 4HS3A 5IOPB 4HIJB 3RKDD 1BZ8A 5I1CL 2D3VA 4YLQT 3MFFB 5HGHB 2VN6A 1H6EA 4P0DA 2V7HB 3FQUB 3MGOB 3PV6B 2IFFH 3BUYB 4GMTH 1ORSB 2EACA 4PWHA 2ZKYA 4F15B 4IQHA 4XVUD 3LKOA 1WAPA 5EZPA 1QPPA 4NLHA 4ADJA 5J7CC 1P2CA 3PL6C 1B2WH 2NT0A 1U8QA 4JVWA 2VMFA 3H55A 1F97A 4OVVA 3VFMB 4F27A 1SLXA 2F08A 5I1LA 5IB4A 2D9CA 1PD1A 3OQRA 3Q8CA 4PGDB 3ZTDC 1DVFD 4PVBA 5EUKB 4JMXA 1KIRA 3KLAB 3PWVB 3QIBA 4O4YL 3BH8B 3DX1A 3AU1A 3WMQA 3IAPA 1DEEA 3VJ6B 4E0RB 4LP8A 1Y18A 1O6SB 3NGBC 4PJ5A 1WZ1H 4FS0A 1MHEA 4QRBA 2VGLM 1NM9A 4LSUL 4A68A 3V4UH 2XYCA 3HC4H 4MA1B 3PPEA 5DRNB 2AF2A 2ARJQ 5ES4B 4LSVL 4PJDA 2XVKA 1HHIA 1P4UA 4LSQL 1EAPB 3RJQB 3LXAA 4IRJA 3GUTB 4MDIA 3HI1A 2ZONA 1SXSA 3QJOA 1RXLA 4R0LB 1WWBX 3K2KA 3F01A 1AH1A 3L45A 1H6FA 3VACA 3KPOA 1AZNA 3UERA 2V5YA 4PGJA 3EZJB 5HGBB 1DVTA 3MCG1 4JKWA 3UC0L 3LQMA 3BGMA 5DK2B 1H0DB 3BYYA 1KLUB 3HJ0A 5C7ZA 2HRPL 2VR5A 3H9SE 4XCEA 3H9SA 3NGBB 5D8JL 4TRPH 1U91A 3RWHA 3O3BA 3E38A 2V2XB 3IDJA 2E8ZA 1XSKA 1ZSHA 3BDYL 4XXCC 4IHOB 1YEIL 2XZAL 1E8YA 2ADGB 1WSST 3DTDA 4JG0H 4HWZB 3VXQA 5IESH 3ARDB 5KS9A 1QNZH 1QNIA 4UM8A 3QORC 4H8WC 4TVPL 2EIDA 5IJKC 3IB4A 1DVYA 3ZDYB 2AXFB 3DMMB 2JVUA 4KVPA 1CK0H 4AEIH 4FN0A 3D85B 5HI5C 3H0TB 4JHUA 3FO1B 3NCCB 3P11L 4L4VA 4RISH 3A67L 4X6DF 4ACTA 5B3SB 5CP3A 4AITA 2O1AA 2XNAA 3HUJB 4KTEL 3N6YA 2P8PB 3T8VA 1A8JH 2R69H 1JWMB 1KLFA 2NTFB 1T3FA 1TVBB 4XNZB 3RX7A 4XZUA 4NUJA 4GUPB 5JW5A 4U1IB 3M7FB 3IKCA 3AUVA 2Y72A 3DOSA 4YSOA 1D3CA 2YARA 5DUPH 1TITA 4LHJB 4B60A 3B2MA 1VHPA 1NA8A 1IJ9A 4WW2F 3DHMA 3FB8B 4LFHD 2A6JB 5J57B 3INUL 4KJYB 3OPZH 3FTVA 3SKJL 4Z8FL 4I77L 3GM8A 5C0IA 3DETD 1AHKA 4JG5A 4OJFH 3O6KL 2UZYB 3P9LB 4WCYL 4MJHA 2DDQH 4KOBA 4NPYA 4Z3GA 4ISVB 3WKNA 2NYZA 3MV7E 1P9MA 1FZKB 4MA7L 3SPGA 4IKNA 1PZUB 4FX5A 4JB9L 1MF2H 4BK8A 3TJEL 3OAUL 3A6BL 4I18A 2V5MA 1EFXB 3BRDA 4H8QA 1QSZA 3WDHA 4I88A 2DYPD 3UP1A 1U33A 3G5WA 4X0KA 4Y5XC 5EN2A 4E5XA 4AGNA 2BWQA 4PRPE 3NZUA 5IW3A 4EXKA 1HYSD 4LCYA 4U1GB 1BCIA 4EOWH 5KSAB 2YAHA 5HGHA 4NZJA 3QXWA 4A7TA 1OAYL 3Q9QA 1C12A 2W38A 2XZZA 4RAUA 4QRTB 1EAQA 3NJKA 4X8CA 1JPTL 1N6UA 2ED8A 1FNGB 4LIQL 1D7BA 3WUWG 3ZDXF 1OPGH 2VLRA 2J6EL 4B9ZA 2R2HB 3B7RL 2GEEA 3FU3A 4U33A 4K5PA 4FNUA 5C6TH 3N55A 3ZTNL 3K4AA 4GH7B 4AMWA 2OMNA 4BFIA 1AY1H 4MS6A 4I9WD 2NW3A 4WEEA 2A9NH 1A4BA 2Y6SD 1ZRUA 3F05A 5M95B 2R2EB 4KO9A 1GMIA 4YH6A 5E9DB 4AEIL 1A0QL 1T6BX 4N8VA 4LCWA 1RFDH 3OF6A 3KGTA 2P48B 2ZUUA 3CGTA 2Z7UA 15C8H 5KBMA 1FL5A 4HWBA 1JS4A 4MNQB 5INCA 1J12A 3AU0A 2ICEB 5AVSB 3BIBX 2D2OA 4KVNL 3SD5A 3U9PH 3EYOB 4F9LA 5E8NB 3WMSA 5C0EB 3ZE1B 1NIAA 3NTCH 1PAMA 5EU6D 4E68A 3VSUA 5IVOA 3WEMA 3S7GA 2B4CL 3CFMA 5CCHE 1QFWL 4WEMB 1YEHH 1JHTA 3O4LB 1EMTH 4ZDHB 3L95A 3GSWB 4OJCA 3CVIL 5FGBC 2XCMC 1F2QA 4YXLH 1MVUA 4TQPA 4WI2A 3N9GL 4R3SB 1KIRB 3KLAA 3KNBA 5CJBA 5BRZD 1FNFA 1G0YR 1J86A 2XKNA 2XHNA 1U4EA 1ZHNB 4OZFA 1GY2A 1U8IA 5F0JB 4Z77A 3JV5A 1J8SA 2ZG1A 3MNZB 1ETJA 3U9WA 3OKDB 1K72A 4U2YA 5LAPA 1OTSD 2WN3A 3VI4B 3VXSD 2PTVA 3QORD 2PABA 4NC0B 4TNVK 4GRWE 1IL1B 2O5XL 1CDYA 2CIIA 4M9PA 2RB8A 4EVNA 1NCCL 1SOKA 4WI9A 3N1FC 1OGPA 4XXWC 4UZUA 1QUNA 2EYRB 2DJ4A 3GZPA 3BUYA 2JJTC 4NQUA 4EQ3A 2ALWA 4PRAA 1DFBH 1HCFX 2AJYL 3HW7A 3LS5H 1G4RA 1NJ9B 5ISZE 4FDWA 4HAFA 1PQZB 4K55A 3S5ZA 2WK2A 4K7PL 3VXTB 1WLHA 4B3EA 1NFDE 3HR5A 3LQAH 4M1GL 1P7KB 1Z1WA 3CDGA 4RCAA 4MJ6A 1XH3A 4QHLA 4S1QH 2EICA 5J6GA 3FDWA 3UG5A 2BVPA 1HOEA 3WFCH 3L4WA 2OTWA 4ZS7L 1IBFA 3EYQD 4MASA 2Z4QA 2LAGB 1YSOA 3WG7B 1I1YB 5C0FA 2FWSA 4XO3A 3ULUE 1YYLH 4OGXL 4PR5A 4RFEA 5I15L 4WEBH 5I66A 4G5AA 5IMKB 4GAJL 4Y19A 3MGAA 3DUSA 5B38A 2V17L 3MRNB 2Z0BA 2X0WA 3AWEA 5D2LF 3LN9A 2JTDA 3NPSC 3X1NA 2IPTL 3MHZA 4CMHC 2YGNA 1PFOA 2CGRH 2JB6A 2ICWA 2XWTB 5CBEA 2CJUH 4K8RL 3HZMB 4K07A 5C70A 4GUPA 2VJ0A 4JFQB 1SN2A 3GI8H 3IETB 5I19L 5DQJB 2EVHA 3SE9L 5AVZB 4GG6E 3WJLC 1HESA 2J12B 3BPCA 4KK8C 2P8PA 3IDIB 1E5AA 1RHHB 3OMAB 4Z18A 4EJ1C 1QQDB 3J7HA 1PLBA 3NIGB 2NCEA 5I1CH 2AABH 4HKBB 1EJOH 2W5PA 4U1LB 1OB1A 1L7TH 3RG1C 1TTUA 4X7DC 4LVNC 1E4JA 1V3KA 4YSUA 2XLLA 3L3OA 1ZVYA 1GGTA 1ZIBA 2FH8A 2XTJD 3DECA 1TEGA 3ETBJ 4P57A 4FQQB 2MPAH 1UKTA 3SDDA 4PG9B 4ANWA 5SWSB 4AXWA 1PY9A 2FGWH 2R4SL 2PCPA 1M7IA 4IMKC 1G9MH 3FSAA 1T7YA 5F6HJ 1W0WB 3PWNA 5DC2A 2ADFL 1MFVA 2FX7L 3HNVL 3VGHA 4N3TA 1ZS8A 1A6UH 1YEFL 4OF5A 1P5VA 1GGYA 2X4UB 1BZ9B 2VQUA 4Y9GA 3E80A 1EANA 2PXYD 1L7IL 2BFGA 1YAIA 3BAYA 4KAQH 1H9VA 3RIAK 5BO0D 4LRIA 4XP9L 5DJ8B 5AYUH 3RI5K 2VZTA 1N0LB 2ARWA 3AG1B 2XX1A 4EDXB 3EO9L 4P99A 4NI3A 1INQA 5FUOL 1S7QA 5FECB 1HQRB 4LOVA 5A2JH 4PJGA 2FTAA 3C6LC 3E6HB 4KKBC 4ONGL 1R5VA 2VLRD 4ZQTA 3MA9L 2J2ZB 1NIEA 2GSMB 4YFEA 2MOQA 4KV5F 4P2OA 4P5TC 4OAWB 1D5ZB 1T66C 4G8FA 4UQEA 3UJJL 2FCBA 3QAZB 1OSPH 2COVD 3QDGD 2F8VA 3OR7B 5FB8A 2WC7A 4YHPB 4YK4B 4X80H 1T80A 4YUEL 2FR4B 1RJCA 4J4PC 3HUJE 3ZKXC 1IAKA 4JANB 5H37G 4Y89A 3WD5L 2P5WE 4TL5A 4B50A 2GBAA 3ARTA 1JFQL 5CEZE 1ECZA 3I75B 2ADYA 2V9RA 4D9LL 5MEQA 4KKLD 1KPUB 3OAZK 2LQRA 4NLAA 4GQ9L 3S8GB 1ZLUH 4JEGB 2FNWA 5AB2A 4G8EB 2OAAA 3NJVA 3EYUL 4U7SA 5I6XB 3IDYB 1TU2B 1SN0A 2NY1D 3GS4A 3MMEB 4PB0H 2ISDA 3U4KA 4Z7QE 5D55A 3L3GA 4L4JA 1FGNL 5C6WH 4G6FD 1XGRB 2M2DA 4DAGH 4DGIH 4FGMA 2WPGA 5F7WC 1T89A 1Q0EA 2QQLH 4ELMB 5JW4M 1K3IA 2DQDH 1P53A 5E6UB 4X4YA 1M6OB 5AW3B 1P7QA 5F9DC 4HQQH 1T4KA 3ZZQA 3UZEC 2YD4A 3VXTA 2VO8A 1O6VA 1KIQB 1T21A 1TU2A 5IHUL 5ADOL 4B9FA 1QI4A 1M1XB 2VL5B 1HXMA 3GS7A 1WZAA 2NY0D 3OZLA 3RY4A 1J0IA 3DGDA 3K1KC 4DP8X 3RLSA 2X38A 4U6HB 3MI6A 2COQA 4GAGL 2ESVB 3RIKA 1DVSA 3NJXA 5DJ0A 4IBSA 5LGHL 4W9EC 1FH5H 2CDEB 1MNUL 3MV8E 1KGXA 1F13A 1XXFC 4FTVB 2AVFA 5CJOH 1IM3B 4PJ7A 3U30C 3V6OE 4YHYB 3PGFH 4JFDD 4CC4A 3JWNG 4M6MH 1OCOB 5JYMA 5I23A 3T0DA 5DO2D 1TQTA 4A6YA 5CKGA 4WRLA 4JREB 4YZWA 5HJ3B 4ZBJA 4XWOD 4ZFFA 1A7NL 5HHQA 4UBDC 1SHXA 3VMNA 4UU9A 4Z3IA 4GW1B 3F7YB 3PXHA 2PN5A 2VUOA 2X6UA 3WTYA 1CIUA 4WHYG 1MJ8L 3Q3GA 5E23A 3MRGB 5JHLL 5F9OH 3VVWA 1MHCB 3QFGA 4HSCX 3ZMEA 1GKOA 3SDDC 4L29A 3TWYA 4IDJL 3EOBB 4BWWA 1XTLA 2APBA 2E9GA 1NCCH 5D96C 1CL7H 1FL6A 4N8VB 2E27H 5D93B 4B9KC 1J10A 4XCNA 1FV1A 1DDHA 1OCWL 3H42L 1GC1H 3CHQA 5D4QA 3V8OA 1HSAB 3DX7A 3RVTC 2WCGA 3ZO9A 2YD8A 3RI5F 5IG7A 2YA1A 4OF0A 1SF3A 3RWEA 2CXGA 4WTQA 3IJYB 2DQ6A 2ZPKL 2W59A 3GO1L 3MBEC 2R2HA 1CVRA 5IQ7H 3D3VB 5DHVB 3CN2A 4W4OC 1K4CB 1MHHA 1RZ7H 1A7BA 3TIEB 2QVIA 2I32A 3GXTA 1R4XA 3UO8B 2JIXD 1L4IA 3C2SA 4HKZB 5C0CD 1AZUA 1PFCA 2AJ3B 4GBXD 4D8OA 1TZGL 1Q0YL 2MCPL 3MXWH 3OM3B 2APTA 3BVWA 3OMIB 4HOMA 1T66D 3RWCB 4FXGA 3VX0A 1CDJA 4M4RB 5DS8B 1RUKH 4RWHA 1DVQA 4ODXB 1D6EA 4AJYV 1NMAH 4RRPA 4X9GA 1KUMA 5EULV 1JWUB 1R3HA 5HVGB 1NCWH 1E9OA 3K91A 4GSUA 1I8KB 2ZJSH 4KXDA 5I6LA 3HTLX 3QDHA 4TSBH 5I71B 3VI4A 3M8OL 4LQ1A 4ICWA 3TO2A 1BVNP 5INDA 1ZOXA 4C4BA 4DGVL 5AW7B 2DM4A 3L9EA 1T1YB 1DANU 4APQB 5JW3H 1UTDA 2LE9A 1S7TB 4DKFL 4GI8A 3V4PL 1YEJH 1ZVSB 2O6FA 1PDKA 4RA3A 4KH9A 4U4BA 1ADQH 2CXKA 5I74C 1XGQA 5C0NC 1KIPA 4K5OA 1XH3B 4QHLB 5AB9A 4KK9C 3HPLA 5DA0B 4R7DB 4CSZA 4WV1B 4AMKL 4EIGB 2K4WA 1F1GA 3HE6B 1NKOA 2X1PA 1QBBA 4NZDA 3DV6B 3FT2B 2VDKH 3AS3A 2C7FA 3NN8A 3OQ3B 4OZHF 3LRSB 3IJ7A 3VFGH 1XZWA 3N43B 3QIWD 1YY8B 4HULB 4OLZL 1D9KD 3F7VA 3UZEA 1JNHB 4ZTEA 3VXRB 2NY3D 3QR0A 3AXLB 4NRXB 5ETUB 1KXTA 4K94L 1S78C 4H26A 5T3XL 4Z7WF 1JFHA 3SQBB 1XFPA 2BJML 4XHJD 2NY2C 3GRWA 1RU9L 3B2UD 1TSHA 3QWRA 4HEME 4AM0A 4JVPA 4ZMTA 1OZUA 4MX7A 1DTUA 4B27A 1AQDB 5D2LE 4GSDH 1WG3A 2MFNA 1G7HA 3NP4A 1Y0LA 1MRDL 1TCRB 3OSVA 4XCYB 4AQ8A 1LWJA 1V10A 4ZODA 5DWUH 2GK0B 4G7YL 4DVRH 3PU7A 1TLKA 1U8KB 2AQ2A 2WHVA 3CFDA 3BRGC 3T0EC 5D71L 3FC8A 1FYTA 3KE0A 3PNRB 2IQ9L 2H3XC 4XCEB 2VO5A 2HYMA 2AJZB 3N5AA 2XV0A 4YX2L 3S96A 3D2UA 2AABL 3SZKC 3B37A 3UEQA 5DZPA 2DJUA 5EWIH 4BFRA 3FUMA 2ZOTA 2NMSA 1BSIA 1I8LA 3KPOB 5T3ZH 1M56B 1D2OA 1NAML 1MCIA 1XF3A 4DTGH 1KB3A 5I75C 1SJEB 2XG4A 1G9NH 3WTSA 1GPOL 4Q74A 1KEGH 3ESVF 1H8OA 1M9WA 1LQSR 3EUDA 4PJEE 3ABLB 3BQUA 1BG9A 3EHBC 1L9MA 4GW4A 2PO6B 4I48B 4XH2B 4CAGA 4Q9QL 2VUYA 1AQMA 1KIPB 1E90A 2V0AA 3ZKNC 4FMVA 4JX0A 2EH7H 1NCGA 5JORB 2Z1KA 4JFXB 3D6GA 1U6AH 4P5MB 4RNRB 3O9WA 3CSBA 1OHZA 2DLIA 4PD4J 5HGDA 4KWUA 2QHRL 3QI9A 1BMZA 1R6VA 3AXHA 1G9NL 1OTSC 3BKYH 1W72B 4H40A 2GUOA 2H2SD 1NFAA 1GOHA 2PTTB 3MCYA 5L4FA 4F15C 3PFUA 2X70B 3AADB 4Y1AA 4PJFF 1R5WB 3ZTEA 2YPVL 1BBJB 2P5WD 1CK0L 2ZXCA 5HYJB 2BHFA 3MBEA 4OF8A 5T5NF 4A67A 1QUPA 4FF9A 2X1QA 3L16A 4XZUB 3X1GA 3HG1E 4O58L 3ZGIA 3SDAD 2X2IA 3JWDH 4YPGA 1WFUA 1R3KB 1HE8A 2WZPD 2DWEA 1RVFL 2H7WA 3TV3H 3T0AA 4KNTA 4YDJB 5KSVB 2RJMA 4LDCA 4QLWA 1T4KB 2G9HA 2VLRE 5EEZA 3EJCA 2HTKC 4FMKA 4G80A 4JFUA 5LCVA 5EMYA 3FFDA 4N5ED 4N0YH 4YQXH 2Z91B 5J1SC 1P6AB 3OB8A 5HHNB 4Q6YA 5CLZA 2W88A 1GSKA 1TQBB 2A77L 2DBJA 2BRRH 4DKEL 3VXNB 1ZXKA 3TA4D 2DWDB 1T20A 4D0CB 5JORA 5DD0H 3T3MB 3H3BC 4WI6A 3VRJA 5LN8A 1XGUA 2EJ1A 3UTQA 4E9QA 2IBZY 4QRSB 4WTWA 3HG2A 2EDDA 4HXAL 3GLZA 3QP3A 3C6SB 1ACXA 1ZTMA 4JGJA 4DGYH 4D9RE 5DMYA 3GIZH 4PBWD 4ZTOL 4NEHB 35C8L 1JK8A 1K6QH 2HFFB 3UYPA 1C16A 4MQXD 1OAXH 3TBYA 4M7KL 4KK9D 4XGZB 1OP4A 2WP3T 1JGUH 2BVEA 2EO7A 2Z8SA 3QJQB 4MAZA 4M9OA 4U1NB 3AB0B 5B1JC 3OR6A 1EO7A 2ENSA 4JM2B 1UEYA 5JOPD 5LXGH 4NC1C 1RURH 3K5SA 5DMKB 5ICXA 5ABZA 1LO3L 4NN6B 2DI8A 1UB5A 3WN5C 3Q1SL 3WUWA 5E2UH 1TVHB 4Z7VB 4J3XA 5DJ8A 3VMPA 1ETA1 4C57C 5T3XE 2FBOJ 2TAAA 2WIIB 1IKOP 1BDYA 3CSFA 1HWWA 1JNLL 4ZJ9A 3ZT6A 3CHRA 4AYMC 3B2UC 1DLFL 4D8PA 4FQPA 3IDNA 3QFDB 4ZS6C 4MDJB 4AIZA 1ET5A 2PO6D 1X7SA 3MROB 2MSPA 4UCFA 5IB4B 5D1ZB 1YNKH 4J3UA 4N2MA 3HC3L 2MOGA 2YPVH 4AT6B 3PS6A 3BGMB 3ARQA 4X99B 2X4RA 2CSPA 2N7AA 3FQ1A 5ITFA 4L9DA 2X4OB 3VXRA 5B1KA 1JPSH 3Q13A 3EO1A 3AW5A 3UBHA 3OJ2C 5IFAL 1JYWA 2WWMC 4AQEA 3O3AB 3ARFD 3DX9B 4XMTA 4FXTA 4R5VA 2H32B 2WINB 2Z8WC 5FCUH 1MW2A 3VG0L 4AL8C 2LLGA 1OK8A 3VWJD 1LE5A 1QABA 3RYMA 1XH2A 3NDYE 4X5XB 1GMEA 2WTPA 4N2OA 2IDFA 4H1LH 4P5TD 2C4XA 3MJ9L 3ARUA 1CQYA 2EIZA 4X6DA 4B95C 1BMWA 4TNEA 4BV1A 1S46A 1IAIH 3PGCB 4UI2A 1G9HA 2PP9A 4HCRH 3RPIB 4FQHA 1A6VL 2YSSB 2AMUA 2HJLB 4QY8A 3STBA 1SMOA 3LKSB 4L0ZA 3GI9H 3FULA 4PRNB 2KERA 1P1ZA 4IJ3C 4P2YA 2Z91A 2CCLA 1ETZB 4OFVA 4UF7C 5HYFA 2NX5A 1XR9B 4HF5H 4EKXA 5BQ7A 4ZPTB 1FAKT 5KS9E 5DHYA 3Q1EA 4IRSC 4XCFH 5A2KH 1T7ZA 2UWEE 4MB3A 4WW2A 1KGYE 4M7JL 5T5FL 5TGBB 5MEPA 5D7SH 4ZXBB 3MRHA 1RZIA 4WIQA 5EU3B 2P42B 3MNWB 1DO5A 1S8DA 4FYQA 3L3OC 4Y4KC 3SPVB 1MREL 1OP5K 2WGXA 3QO0A 4OFQA 5I30H 2EIEA 2AEOA 3V7AG 4NKOA 4M4RA 3ZT7A 3I9PA 3K6FA 2RAMA 2OJ1A 5CR8A 1TZGH 4QT5B 1F41A 4KO6A 5JUEH 4QHKJ 3UTPE 3MLXL 3SJVA 1O75A 4HF5L 3CXHJ 4QNPF 1I1FB 4K8RC 5I1EH 1CL7I 5DZAA 3EZ8A 3NFPB 5KN5A 1ZHLB 1XF5B 4CUCA 3AGWA 4MNGE 2HTKD 1ZA3A 3K71B 1R19A 4APQD 3AG2B 5C92A 3L1OH 1S9XA 4IBLT 5GISH 2DJSA 2E46A 2ITDB 4FI7A 2BP3A 3MV7A 1SOQA 1LK3H 1ODAA 1RZFL 4Y4KB 1J5DA 1BAFH 2B8OT 4N0RA 1CFQB 1C7TA 4ZO9A 4N86A 1G9EA 4CBPA 1A9BB 1TNNA 1OTTC 4A2EA 5LG1A 3ATAA 4NAMA 3TBVA 3HA0A 4AV4A 1GPOH 5EU6E 4HLZH 2VRQA 1ZS8B 4OLUH 1JPEA 3KVPA 1CLOH 3GZKA 5LBSA 5FYLD 1ZLSH 4P2OC 1PZDA 4P5TA 3O6ML 3REWA 4PGCA 4OIIL 2I60L 4L3EB 2VW6A 5I5MA 3QUKA 4XPFH 1JD7A 2PCPB 2WVSA 3T2NH 1E42A 3HE7C 3L3DA 3HG1D 2WXOA 4X5WB 2ZCLL 3CFCH 3BLBA 1G7QA 3QO1A 4OCSL 2YK1H 2BXZA 4Y7OC 5EO1B 4NPKA 1WEJH 3B9VA 1NMBH 2F5BL 5K5YA 4J12A 3DIFA 3FFOA 3MRBA 3QUXB 5CSBA 2YC1A 4H88H 5CZKA 4N2NA 4PY7B 3P11H 5CD5D 5IHBA 4XP4L 4JQVC 4XPFL 4R84A 2FVNA 4MNQA 3FUFA 3MCLL 2LU3A 4KBPA 4N2IA 3PHSA 4ZOAA 2ADIA 5G4MA 1NCBL 1RJLB 1T0NA 1HWGB 3MA7B 4G8GE 3UADA 2AQRA 4JFEE 4CBZA 3BEWA 2DMKA 2VL5A 3H4FA 2YUZA 2VOTA 3W56A 2VDKB 5GGUA 3SOBL 3DX6A 3GMMA 5D7JC 1ERNA 1UASA 1CXEA 1OL0A 4F3FB 1SJHB 1ZAGA 3E8UH 4ODSL 4KJPD 4L2LA 4S2SB 4UQCA 1SBSH 1DBJH 4G43B 2Q8AH 1TYEB 3HRZC 3T1WA 2KLSA 1HXYB 5EO0A 3CXDH 2VXVL 3OKYA 4PD4K 1KYOJ 2FHBA 5B8CA 1QLEL 2AKRB 4KO5A 4R8WL 1JF5A 4KUCF 3CDGB 3GZOA 2W8CA 4XPHL 1MOEA 2GC4C 2KZ1B 5F1NA 4XAKD 3UJJH 4I1NB 4X5XA 5T3XD 3FB5B 6TAAA 3GSXA 2XVBA 1MAKA 1YEEL 4OIFA 3HPJB 4O02B 1C5DB 4FJ6A 5DLMH 5TFSL 3F00A 1FFNB 1GYVA 2FJGB 2O4EA 3R8BB 5T1LA 4JDVB 5GSRA 2XFXA 3O4OC 1GCYA 1JFQH 4EUPB 2YGVA 4DPCX 3CLFH 4F7PA 1IKFL 2WQAA 4EDWH 3BO8B 4GKSA 5EOQL 2I9LB 1IFHL 1T0OA 4TVSa 1KIUA 1L9RA 1XR9A 3GM0A 3HFFA 1JDCA 1XCTB 2BMKB 4WUUD 1A3LL 4PLNC 1P9MC 2HKAA 2VC2B 4Y4HB 3VMOA 2W91A 5IEHA 4XTRC 1NFDA 2WVTA 5J89A 1PLGH 4NP9A 1TQCC 4B9JA 3KLHD 1RPUA 4QY8B 4NCC2 2LV4A 1I9IL 1ZHKA 2X1OA 1MCKA 1VEPA 2DB8A 3V9CA 1Q94B 1I4FA 4JFSA 4PJAB 3NESA 2J57A 3BSZL 3OMZA 4JO2H 4LCIH 4OZGB 5IMMB 2YHGA 2QVMA 4HWBL 4UOQA 1MW3A 3H7BB 1ZK9A 2BIIA 3P3RA 5AZ2H 4DFHA 2H6PA 5EH1A 1BXAA 2VMDA 3MOAL 3P30L 1YCSA 1D9KC 5IHUH 2CA3A 1ETB1 3UPCA 4X5RA 1FZMA 4MNGB 4XHJC 1TENA 4WW1A 4CN6A 5CN3A 2YKLL 4Q6IB 5IKCA 1OEZW 2OM5A 4JHZA 1KB5H 4U31A 3UROR 2PXYA 3H3KA 1NCOA 2FLBT 3ISYA 5KYXB 3O3EB 4MB5A 3SOBH 4ZAKD 3LXUX 2EVFA 1GOFA 1IGTA 3MROA 5KVGL 4GOSA 1G84A 3E8UL 4D0CA 2WKLA 1W0WA 3DSFH 4PJBA 5HI3D 5E00A 5FKPA 1QG3A 4KMTL 5CN1A 4Y7MA 1E67A 2XQYA 3IDJB 4OUUA 3SD2A 5EEYA 3ZYJA 4LPWA 3MYJB 5HD8D 3I84A 1NDMB 4FA7B 1NGZA 4G9DB 5G5DA 1NM4A 3NFPA 4CGUB 5DURB 1L3NA 2VNCA 2Y6TE 5JIDA 5KN5B 3UBXI 3LVEA 1JN6B 1MFDH 3QZNA 2AERT 2GFBB 5AB0A 4Z7NB 3MX0A 1U8JA 1TZHA 1MCPH 1DBBH 2H5UA 2VR9A 3IDMA 4LCCA 1U3JA 4KROD 4O2CA 4PBVC 2CPUA 1UA6H 1HCZA 3MMEA 1B4TA 2XN9A 2Z7WA 3CU1A 5ICXB 3I9AA 1FLTX 1IAII 3CMOH 3IYLW 4PJGF 4X6FB 5EG6C 1ACZA 3S5LB 4FG2A 5BOJA 4ZMZA 3FJTA 1CE6B 4YDMA 5HYQB 2ATPA 2WO4A 3DV4B 2Y24A 5HHMB 4JE4B 3FO9B 4HX1A 2J1XA 4HU2A 4HFUL 1WAAF 5E5RB 3BCDA 2FE0A 3BQVA 4N1HB 1C5DA 4FABH 4YXKL 4Y16A 4YHIB 3FYEB 2N4IA 5A3IC 2AJUH 2V4LA 3DRQB 5JIIA 1E5ZA 3KW7A 5H35B 3ZE1E 5M7QA 4GKNB 2ZOKB 5F7UA 5AVRB 5KVFE 5BXFA 9CGTA 5I0DA 5GGQL 4JW3A 3RX8A 3VH8B 3WIAA 1KACB 4HUNB 2ZXDA 4ELMA 3ZMRA 1DE4A 5MI0C 4YSQA 2Z35B 1YHPA 4CVZA 3JV6A 1E9QA 1MHPH 5C07D 2ILLA 2GCYB 1F90H 4K5MA 5AD0A 2W9EH 1LE5B 2XTLA 3BEVB 3ENEA 5DWPA 3CC5A 2YPLB 1IARB 2A6DB 5T1KA 1PD0A 1TJHH 2IOOA 3DBXB 4WU7B 3QA3A 5I19H 4L8DA 3OKLB 1A9EA 5GXBB 2IPKA 3ZVVA 2ADIB 4JPVH 3UJIH 4PGBA 4NS0A 4X9YA 4X4MA 2A1WL 4LLYA 4XMKL 1LMKA 5ESQB 2CMRL 3IDXH 1XAUA 1UOKA 4KRNA 5ID1B 1JV2B 2H32H 2IH3A 3MOQA 4YHOL 1Z5HA 2WNKA 3PABA 1RZKC 1UENA 1TQSA 3BZEB 4BA0A 3VGEA 3TZVA 2JJWA 2A77H 2EQDA 1QEWA 3O3BB 3EJRA 3ARBD 3DROA 1UOWA 4NUGH 4C55A 2YQ3A 1ZPLA 4P2QB 5GZNA 3K2MC 4KKCC 4X5WA 1IKNA 4R4FH 1LEIA 2BX5A 4AG4H 1PYWB 3NCXA 5DD6B 5KSBF 1BZEA 1UURA 3EFDL 3TH4T 3BKCL 2IVFC 4U1LA 4AW7A 3D18B 3QJHB 4BD4A 5F0MB 1YA5A 4TSAL 4LIQH 1B0RA 3HI5H 4UT6L 5F1IA 3EDEA 4ZTOH 3LKNA 4JQIL 3DO7A 3GSVB 1DBAH 1A5FH 1CF8H 1F3DH 1QHOA 2AXWA 4GXFA 1L6PA 5ANHA 3TBYB 3TH3T 2DQTL 4GXVL 3HKFA 1JZIA 5CILL 1URLA 3VFNB 4WV1A 3H56A 2L7JA 1SGKA 3AQDA 3N3EA 3QWOB 4FQ2H 2FEDC 2VDQL 4W9DC 3UTQB 4A2DA 2VC2H 3UFIA 4PV9B 5KYUA 4L4VE 1MY5A 4TF4A 2XG5A 1NDTA 2WXNA 3LSOA 5SWZD 3CHSA 4XCYA 1GGBH 2HVJB 4H7VA 1ZA3B 3RU8H 2YWZA 3MLSL 1JUFB 1P7QD 1C1EH 2BP8B 1TTAA 3NH7L 4X7TB 2VDRL 4G8IA 3Q6FA 2NXZC 2YJLA 3NTCL 5ESAB 4G6JL 1VEOA 2GW5A 5TF0A 5I71C 4RMUA 4UAHA 5D96B 1BZOA 4K9JA 5EA0H 1WA2X 1MJ7L 3NAAL 4Y5VC 3DJRA 1NBQA 2Q6WA 3ZDZE 3PGDA 4P9HH 4LL9A 3O2WH 1EGJH 3C09C 3KYOB 3SO3B 3NN8B 1USQA 2QVTA 2A99A 3N9GH 2BFVL 3V0DA 1KCLA 3MV01 2YK1L 1N2RA 2FWOB 3IBOA 2GTZA 3X3FL 1D5MB 1UXMA 3MO1B 2JB6B 2C3XA 1WIUA 5CBEB 4NN6C 3X1FA 2DI9A 5EB9A 1J9SA 5FYJE 4R7DA 4J4PA 2GTWB 1XCXA 3TBWA 1YN7A 2AEQH 4GJTB 1M57B 5BV7L 4AUJA 5FYLH 2EDWA 4IK6A 5TF1H 1MCNA 5FAAA 3X3GL 4I4WB 5E94A 4B9PA 4JCLA 1A3RL 2MH4A 2I07A 4P4KA 1EGJL 3EYSL 2WLNA 3P9MB 3OKMA 3CH1A 4HWBH 4CILA 4MAUH 1SMAA 2P5PA 3B34A 1UH2A 3IF1A 4PAZA 4JO5A 1P7KA 3ZR5A 3PFQA 4OD1L 1RU9H 2QMJA 2BSRB 4KRLB 4FFWC 4HIEA 2OK0H 4MD0A 4XNDA 3NYKA 3QR1A 1HZHH 1UC6A 4HU8A 7FABL 4PWEA 4FLHA 3C5ZA 3KPQB 2NTFA 4ADIA 2BCKB 1MCCA 3WDJA 3VXRD 4BRVA 5JW4R 4FL4B 3I2CL 3VGDA 4UTAH 1G6RL 4EVNB 4I89A 1KEMH 1KBWA 2PMZA 2VQ1B 4LU5L 3QJHA 1BIIA 1IAIM 1EO8H 1UKQA 3NFNA 3WBDA 1ZGLM 1H3XA 3PUUA 3DX4A 4LCCB 4MMZA 3EJSA 1IVTA 5EWIL 5JDJA 4H20H 4POUB 4L4TE 1I3RB 5CP3H 2CO7A 2XICA 3N42F 3ILPA 5IJKA 4A7GA 3TS8A 4P2RB 4H8WH 1MQKL 4IHOA 4N2DA 4S10A 3KYNA 1S9WA 5E00B 5E2JA 5FKPB 1IZKA 4GI9A 1EQWA 3SO5A 1MFDL 4FXKB 2RHEA 4GRLD 1MPAH 3X2QB 1S2EA 1XF5A 3QG7H 1KEML 5GQBA 2HRPH 1XSJA 1N3NA 1PNCA 4FTVA 4FADA 2OMYB 2ZSVB 4DEPB 1CR9H 5JHMA 1Z9SB 2CA4A 4RSYA 2GIMA 4GFTB 4N2BA 1WVZA 3D33A 2VABB 3N1GC 4AEHH 4P9HL 5EBMB 2ZQKA 2Y2WA 3ETBF 3OJDB 5D5MB 2J3SA 4G11A 4E41E 3IGUA 1KJ3L 5GZOC 4DNLA 3WKPA 1KBPA 3MOAH 3P30H 3O11A 1BQ5A 3NCBB 5GS1C 1XIWC 5JPMA 4F7KA 4UDTA 1PX4A 1LHZA 3IF1B 2PW2A 5FLUA 3UTPD 1B6DA 1BAGA 3U0TA 1JHLH 3DROB 3FQRB 1Q94A 3OX8A 2VDLH 1ID2A 1SJVA 3QG6A 3W11D 5IOKA 3MR9A 4W6YB 3FU0A 4ZUSB 4ONFL 3BZEA 1SM3L 3WXWL 1RV6X 4I18C 5J56B 5I6XC 1B90A 2XIBA 3MUJA 4QCIB 1EHNA 4APQA 1EVUA 1MZZA 4LLAA 3R7QA 3P4OB 1NCDL 2CO6A 1G7PA 3VDBA 2XV2A 2OJZL 4KI5F 2L7EA 1A1MA 5HHPB 4N1EA 2YOAA 4Q9BA 3T4YA 1X9RA 3I75A 2CO4A 3RJOA 1RLWA 4E5XB 2R0KL 2R0WH 3EF7A 4H0HB 1MCLA 1WGOA 4G42A 3CC5B 4KY1H 1ZPUA 2DM2A 3VSTA 3K6DA 3C6LD 3RGHA 3BZ4B 3ZHLA 3FQUA 5A7EA 3FB5A 1E6OH 2QV2A 5FX3A 4BFKA 2P26A 3ZJAA 2V5RA 4PJFA 5IF0B 3CSGA 1NEPA 2NNCA 1BFOA 2HT3D 3T8XA 3A6BH 4WI4A 4JZNB 4XI5C 4X98B 1JRHI 5HDWA 2ITEA 4JZOA 2NNAA 3JWOH 4I1PA 2Y7OA 3ZDZB 2BP8A 4ZOCA 5GRUL 4A04A 2FQDA 2P47B 4V1DA 4CDGC 3S98A 5C3LD 5IV2B 3BAIA 2OKMA 1K8DB 3HZKA 1IGFH 3DHPA 1I7RA 2FL5B 3DVGB 4HOWA 4HUMB 2OLDA 3OC5A 5DC9B 3CK0H 4EKJA 5B39A 1I1AD 4C83A 1CDUA 4JFDB 3BSGA 4QOKA 4UIMB 4LESA 4AQAB 2AK4B 1SHWA 3L4ZA 4F9LC 3TA3C 3RFZC 2K6ZA 1WZMA 2QQLL 3BFQG 4LLUA 5DJXA 4AIXA 1RMFH 5K9JL 3JUYA 5L8JB 3MAWA 4NNPH 1R1CA 3VXSA 4L3FA 3B5TA 1VCAA 4JGNA 1FWXA 1OKEA 5FDWB 2H9GA 2E76C 2WO3B 2JKXA 2YD0A 4YHZH 5F1IB 4XMVA 3EH5B 4BZ1H 2R8SH 4JBSA 2X6AA 3GBMH 3MLYL 4IRJB 2NY0B 2G3ZA 4OBRA 3OXRA 2H6PB 4PFEA 5AKSA 3X1EA 3ZHFA 5IEKA 4PRPD 2DQMA 2BVYA 1VAHA 4EXPX 3T77B 4H13C 4NQED 5T1DH 1NOFA 4NZTH 3MLXH 3RTQA 2DLHA 3KS0J 5E08H 2V33A 3G08B 4RGNB 2IGFH 4NUPA 4PBXA 4B0MB 2FO8A 4QRPB 5HHQB 2H6UA 1QACA 1TR7A 1RD6A 1Z9PA 1DEEB 1HAWA 3QDJA 4ONFH 5F9WC 2X4SB 4HXBH 3VJ6A 1O9ZA 2J5WA 4PV8A 4WGVB 5T1JA 5CSZA 4MMZC 3FUEA 4JO2L 4LCIL 2VR8A 3BXNB 2DBLL 2OMUB 4J2XA 3RWHB 1AIZA 2YMTA 1BBDL 3MUUA 1IGTB 5EHFA 3INOA 2B4CH 3X11A 5D8JH 1AMXA 5LGJB 3OXSA 4B41A 3FCGA 4KNSA 1TPXC 4ZAKC 3F04A 3AVEA 1YYMH 3B7YA 3THMH 1NC4B 5E1HB 3LRSA 2DI7A 5ILTH 1X3DA 5DQ9B 2KPNA 2OS7A 4PRDB 3MV7B 2PWFA 2YD3A 3FTZA 3I6GA 4M7LT 5E1AB 4B5EA 5EZJA 2VXQH 3LEVL 4Y0GA 5IJVA 4OI9A 3FQXB 3GT6A 3U4AA 1DUZB 2JJVA 5GRZA 5GZOD 1SOSA 3SDDB 4JFTA 2OTWB 1AP2B 2DLFL 2ZUWA 3CE1A 2CDFB 2VXUH 5TDOB 4IM8A 4N2HA 2VAAB 4PWJA 1FFOB 3AITA 1A6WL 3BH8A 3KS0H 3QI9B 1BFOB 2DQEH 1E50A 5HTSA 3JWNH 5F8QC 1NJ9A 2D7QA 5GS1A 4UAOC 3VDAA 3DVFA 4FERA 1CFTA 5D72H 2H41A 4LL1A 2CRMA 2GUYA 1G87A 3Q5TA 1CYWA 3DUHA 4NN7B 1IT9H 5D1QA 3UIYA 1PLAA 1SOXA 3CMOL 1U8QB 2Q7YA 2RFXB 4FI8A 2NX5D 5LCVL 3CZNA 3RURA 3D52A 5MHSD 5D1QD 4PJDE 3LNIA 1AZZC 5HHXH 3IXTA 1A4AA 1CE6A 4A7QA 4N2AA 5D2LA 1U8LA 3MRKB 2HKFH 4UOW1 2Z7ZA 3GBML 3MLYH 4QTIH 3WNMA 1XGYH 4FXGB 4BSVB 1CFTB 1LILA 3JT0A 4PRBB 3ROLA 3V2AR 1AJ7H 4FQLH 4XP1L 3MRIA 1KCRH 2DQFB 4WGKA 4FXLA 5F1NB 5BJTB 1BOGB 4JDTL 4QRFA 4U6YA 5ABAA 4HH9A 3SB3A 5E2WL 4PJ7E 4XT1C 5DK0A 1UCTA 3E7JA 5F7BA 3QCTH 1NMCC 3NOIA 5D2NE 4E9WA 3ZKQD 2CJSA 3WU1A 4GT0A 5EEUA 4N85A 3HS8A 1PKOA 3REWB 1JXFA 1CD8A 4Y5YC 5E8EA 2JK5A 2AEQL 4H2CA 4RGOH 2BVOA 2EXYD 3ZQ9A 1UXLA 3GZQA 3OKOB 4L4VD 5INCB 3RIAF 5IJDC 1CTNA 3MV7D 5FS5A 4YGAB 3DOHA 3KVDD 3WDIA 1MUJB 1QYGH 3GKWH 1T7VA 2DIAA 1FE8H 5DO8A 2BY3A 1B4JH 4L3CA 5E9DA 5ITBL 4G82A 2A9NL 3MJWA 3FCSB 2X4QB 3ULUL 1KBGL 3REVA 1J05A 3BWAB 4NQVA 1YUKB 2Q3XA 3N42B 5J3HD 4X8XA 3QPXL 1OXYA 4YBQD 3E1F1 4XVJH 5CP7A 5CEYA 1QX1A 4H25B 2EDRA 5JQHC 4LKXB 2HLFC 1PSKL 1CFVH 2XY1A 2FATL 3Q05A 2ADJA 4DO4A 3BSZH 1J9CT 4ZFOL 5IB2A 4M5YH 1YN6B 2J7LA 5E70A 3FN9A 3WUWB 2FEEI 4KNUA 2Q7NA 1NFDB 1EWHA 4J3OF 4MVBC 4XBEH 5C9JA 4TNGA 4H0GA 43C9A 1CD1B 2H1LM 1BVLB 1NH6A 1F18A 3JTTA 4WJG3 2VT0A 1I85A 3CFEB 4IRJD 1LO0L 4M1DH 2VMCA 3CFBA 3WY4A 4ZW3A 5DJCA 5E6ID 1YYCA 1AO7A 3L54A 3PF2A 3EOYG 3WEOA 2AW2A 2ZOOA 4OV6F 3KPMA 4PVNA 1N4XL 2QLYA 4P23C 1WFTA 1LM8V 1WGVA 3KPRE 3ARDC 3MJ9H 1E30A 3PQYB 4HFWA 4GFXA 2XPZA 5DUJA 3QHZL 3DSFL 5T3ZL 2YD2A 2B59A 2JE8A 4HALA 1FBIH 3GIVA 3SBQA 2P49B 3N85H 3WLWC 2E6PA 2KZWA 2BO0A 3FQTB 2NNAB 4M7ZB 3LD8C 2VMEA 2PWGA 3PHAA 4XNXL 3WENA 4BXVA 4PB0L 1QLFB 4TOYH 2BSED 2DH3A 2IXQA 2F53E 5EZOL 3VFVA 3S35H 1QBLL 3F7KA 1K85A 2YQGA 3HVDA 3U36B 2O5YL 3O3DB 3MBWB 2BSEA 3RUGA 2AV7B 2ZICA 1JCKA 2VDLL 5FFOA 3B3IA 12E8H 2DQUH 2ZWNA 2R9HD 2RIKA 4WEBL 2Q7AA 4FKKA 5E1QA 3LPPA 4NIKB 5L0QC 3MRFB 3CNKA 4OKVA 3JV0A 5D1QC 2OXHB 2X05A 4JPWH 1U8MA 1UYWH 4N8VG 2W65B 1OP3H 4OY9A 4G9FD 2ZKHL 3II3A 3P77A 4MXQD 3ZKSD 1UD8A 1THCA 3SKUD 5KVFH 1TYRA 2NYKA 4PP1C 2EINB 2VWEC 5IQ7L 3BHBA 4YDVB 3BP4B 3OGOE 1AR1B 4WI0B 1HX0A 1Q9OA 3BGAA 5F72S 2QPUA 2ZWSA 1ZGLB 1HWHB 1FH2A 3CZJA 2H0EA 5EORL 4DPBX 4QHUB 2VITB 4JKMA 1EHLL 4PJHB 3WFDL 2A74B 5AVWB 4H25A 2EC9T 3ULVE 4AX3A 1FAIL 4G8GB 3ZZSA 1E2ZA 3OXRB 4UNVA 3ULVC 1BQLL 2UXFA 1F4XL 2UXVA 4PUBL 1JHKH 3FFCB 2ZF9A 2XT1B 2ZOLA 1LO0H 3CXFA 4PLKC 2PWDA 3SE3A 3KYKH 1XF3B 4FLSA 4P46B 2W9LA 3N41F 4GQPH 3GQFA 3M8OH 1X5FA 2X4RB 4R7XA 3K74B 3NCYS 5GHWH 4IBUA 3WSQL 1BZ9A 2VITA 4GKZA 2OMYA 2Y9RT 2ZSVA 3ARZA 4MA7H 4ZUVB 3W39B 4DK6A 4ENZA 3GJEA 4ZI8A 2W92A 1OTUD 5DFAA 1JG9A 2ZP9A 3GIZL 1YEHL 1OSEA 4Z78A 3ORJA 4KRPD 3DLQR 4PJEA 4AZ8A 1OAQL 3HZKB 1OOWA 4FZ8H 3HOGA 2W65A 4OLEA 4LLQA 1GCFA 5EZLA 3FH8A 5E9NA 5C6PB 2K7PA 3T6WA 3IU3A 3RZCB 1S9YB 3MLRH 1BECA 3GB7A 1ZEAH 2QTVA 3TEZA 1Z9MA 4J23A 3QXTA 1XH1A 1IC7L 2IG2L 2RBLA 3NFNB 5LWYL 2LT9A 4PJBF 2UYLA 3HFML 3BUTA 3MNVA 3MZTA 3FNKA 2M83A 1T04B 4Z0BH 2IGFL 2FSDA 2OCFD 1BGXL 2KH2B 2V9UA 3GLEA 4AEHL 4D0DB 4HPYH 3IBEA 2BNUB 5GJSH 3ZL4L 5BZZA 1VPOL 3UBXA 2V7HA 1AI1H 1ZWIA 2QT6A 2F7QA 3MRPB 4PVMA 1AY1L 3MDJA 4XMWA 1FYHB 1WHPA 3MNDA 4P4KC 4NJAL 2C3VA 1DN0B 5JMOC 3K0YA 3MRNA 1XTMA 3EH3B 5C0JB 2EE0A 5BRZA 3HC0A 4HLEA 1J9RA 1MRDH 1OSZB 3HG1A 4LEEA 3H9HB 4JDTH 4ODUA 1BP3B 4BGDA 5CXPA 1RK7A 4X4XA 1Q0XL 3OKEB 3ATEA 1GYUA 5E0QA 4EIBA 4PG2C 2XIIA 3GUTA 1ODUA 1ZT7B 2G2NA 4Q56A 3VG0H 4FFYL 5I6MA 1G1KA 4ZMOA 2E8YA 2Y1YA 3O81A 4L05A 4L37B 3RQ3A 1CGSH 2VYRE 4WU5B 1FC2D 3HRZA 2ORBH 3EJYC 2VJXA 3EDKA 4YGVA 1VCBC 4KTGA 5I1JL 3KZ8A 1JHKL 4G71B 4PW9A 5C0RL 4DQAA 4M6NH 5C07A 3PGDB 2JI1A 1IKFH 3GSOB 3KXFE 3OGCB 5F7NC 4YMPA 1F00I 1PD6A 3T0VA 1T1WB 2ZT9C 3NZ8A 2BFVH 4KNQA 1CE1H 4RDBA 1I1CA 2ZWZA 3Q9PA 4N90D 5IB3B 3BIAX 5D72L 3QEQA 2UZIL 1FFPB 3EFDH 5I2IB 1JZ8A 3TM6A 5CJQL 3UMNA 1JZHA 4HHWA 3G5ZB 4PJCA 2HP4A 2IAAC 5HPOA 5FYLL 3VXQB 2BHZA 5FUZL 3VFRA 5KS9B 4P2RD 3ZRFC 1RZGA 1X5GA 4K7FB 2ATKA 1NCIA 1IBHA 1UQSA 4R3SA 2DMGA 2CK2A 3ARBB 2Q0ZX 2ZCKL 1BZ7B 2FECL 1MJUH 3HZVB 4PY8I 1IGFL 2FBJH 5I30L 4QXTA 2EVGA 3TZVD 3ZGHA 4PP1D 2NY4D 4XPTL 2K45A 3W81A 3S34H 4X7SH 2WYHA 4JO1L 5FYKD 3QIUD 5C0AE 2VIRA 2P44B 1VKXA 1TVHA 3TWCH 4A66A 4JKNA 2XRAL 1YY9C 5H4ZA 1BF8A 4L9LA 2DD8H 2P43B 3FTGA 4KI1A 2J44A 3OPZL 3SKJH 4Z8FH 1PY0A 2XA3A 2OMVA 2MPVA 1D7CA 1SJEA 2BCKA 3BDBA 4F8OA 5KJRL 4DVBA 4LEXL 1YYLL 2JKIS 1GTFA 4PJ8D 5DJXB 5GS0H 1JK8B 2M8XA 3UYPB 3FOLA 2XWTA 2YPLD 5KSBA 3Q8BA 4FQXB 1D9KA 5LNDA 3A6OA 5DK0B 1LK3L 4BCZA 3RIFF 4DEPC 1SYSB 3QH3B 2WBWB 1UFGA 3STZA 1Q9OB 4F2MB 1JXGA 3BVDB 2XRAH 3VUAA 2KLRA 3C5XA 4K2UH 2DWDA 5KVEH 5ALCL 3BISA 4I0PC 1NCNA 3T3PF 3MLWH 2XA8H 1Q9KA 2V3EA 4RQQB 4LCUA 3GXPA 2CO1A 5DF0A 3QG7L 1B4RA 3LH8A 2R29A 1MXDA 2XY2A 3MV8A 2VDML 4M61B 3TO4C 3U9UB 1MH5B 4BDVB 2J8UF 2GTWA 4P46D 4BUGA 1Q38A 2I60H 5KJ4A 3RJDA 2XPYA 3WO4B 3MU3A 5DHVH 1AQKH 2LGNA 1FORH 2VDNL 4GSRA 4F58L 3UCRA 1OPGL 2VUKA 2QQQA 3FFCD 4LP4A 1O6TA 2OFQA 3KW8A 1FVDB 3GSQA 3C2AL 1HOCA 2ENYA 2JB5L 3WUZA 5F7EL 1WT5A 3KPTA 3QRGL 2XA8L 4DESA 5FW7A 2AEPH 1Y07A 1EEZB 4MCZB 4YGVB 4YHLH 1KB5B 2Q2LA 2ZXAA 1ZTXH 4F9PA 3ARGB 2IBBA 3FPXA 3QR2A 2OW6A 3L7FB 2H0JA 3D9AH 4PW3A 4HPOL 1LO2H 1PJ9A 3FCTA 2VXQL 3B2DC 2D9QB 2X70A 2K78A 1R5IB 5DXWA 4F58H 1F58H 1JHLL 3UTTB 3K46A 5GGQH 4ESKA 1XGRA 5AYUL 3O9WB 4HFWB 1B2WL 1IAOB 3BOVA 4HKJA 1I8MB 4ETQA 3ULUD 3C5JB 3SGJA 3NA9L 5HHOE 3MRQA 1O0VA 3VXSE 1AXTL 1LNUA 2IV9A 4MDRA 4X0NA 1JPGA 2R29H 2QTEA 4JHWL 1GYAA 5EOTB 3SQOH 3MRPA 4YWGH 4L4TD 4LEOA 1B4LA 4KTEH 5MEOA 4PG2A 3F5WA 2YKKA 3M45A 3WNIA 2YAPA 4CNIB 5DD0L 2UY6A 5IMOB 2IDCA 4FHJA 5HHXL 4XNXH 4ZFGL 1YDPB 1KT2A 3JWOC 3MVSA 4IDLA 4WFGD 4BQCA 4KDTA 1IIIA 4RRPM 2PW1A 1OZTG 2Y22A 4XBPB 5IVZA 3RVUD 1HYSC 1A7OL 5E6YA 3MACL 1QLRB 2VISA 2GJPA 2RALA 5BS0B 3ASOB 3BLKA 5KUKA 3VFSB 1REIA 1IEBB 1ND0A 1A6VH 2XN9E 2CR6A 3UXFA 4C56E 2VZ3A 4JY6B 2WKOA 2PCFA 4J2QA 2X2JA 1FZJB 1NAMB 2I9TA 4YFLI 4NQVB 5DJAB 3NRPA 3AUWB 4XOEA 3JTSB 1IGJA 2R23A 4GKZB 1ZT4A 1WWCA 1LP9F 2ZUQB 4UQIM 1OK0A 3L9YA 1WAEA 1XEDA 1AXSB 3EHBB 4O00A 1OAUH 3D07A 3TZVC 4J3OG 3U25A 2OJEA 1WBXA 1FGVH 2K6WA 4FFZH 1I7TB 4NBYB 3SBWA 3UAFA 2EXTA 2VJ8A 4WTZA 1ZA6A 5C07B 4K23L 5AOMA 2A6DA 3L5HA 4OV5A 2F7IA 4OZ4B 1EDHA 3F12B 2OXGB 1CZ8H 3QPQC 3S8FB 2NUTB 3UTSD 4N22A 2AC0A 4LBAA 4EZJA 3V5KB 4MB4A 5ACZB 3D9AL 3CCHA 3WI9A 5I16A 2VZ1A 5ERWA 3BMWA 4C47A 5CD3B 5CCKL 1FC1A 4ISVA 4BSWB 1XCQB 1ZHLA 4PHZA 1CT8A 4NQDA 3QYMA 3RZCC 4F57L 2HT2C 1YMMB 1KFAH 4OCRH 2WQVA 3IEAA 4XP5L 1INDL 1II4E 3E3QC 1EJ6A 1C1EL 4IRSA 4BKTC 1ONQA 5J13C 3IVKA 4WW2C 3V4VL 1KDIA 2D4DA 3PABB 3GPEA 4GAAA 2CWRA 1J5OH 4MXVE 3L4YA 3RBSA 2XYBA 3RWDA 4N0UE 3CX2A 4M5YL 1T03H 2WLLA 1CC3A 1T1YA 1KTDA 1NBZB 3A5VA 1UM6H 4K3DH 1HHGB 2HFTA 5HHMD 1RUKL 3L1GA 4R2GB 1AKJB 4TMPA 3UGEA 4XPGH 2NZIA 1TTBA 5JW5B 3ZXAC 4Z7UB 4G6MH 3DX3A 4ZD3L 2WZPA 4HJ0D 5D1XD 3JWNE 2PR4L 2IC2A 2ZJSL 3IPBA 4XVSH 1E3ZA 4R7NB 5BZWB 2E9IA 2X2YA 3HZYB 5IROD 2GJJA 4YSDA 5A16A 4HUWA 4OTXH 3RWDB 5HD8C 3B9KB 1MLCA 1BPVA 2OR9L 1XVSA 3VWJA 4WDIB 4HIJA 5IK3A 1S9YA 4ZMVA 5LBVA 3RKDC 5C0BA 1OLZA 3RHWF 4BH7B 2F8IA 1J1XL 5TD4A 4UV4L 2AJXH 3LVTA 4NQCD 4IMLA 1ITBB 4OGXH 4X98A 1KTBA 3GTNA 4NFBA 1I1AA 2R8SL 4KK6D 3AACA 1N5AB 3HNTH 4GG8A 5EZJB 1FLRH 3MV9E 4QMEA 2H0FA 4HUWB 3FSOA 1KC5H 3KLLA 4AGOA 3B5GA 4OZ4A 5F6HI 5GRXG 1N64L 4EN2A 2G60H 1R0AL 3BC9A 4KTDH 3ME0A 3UTTE 3X13B 2MQ0A 3QUZB 2G3XA 4I13B 1J9QA 4LVOB 5BNXD 1SNRA 2AZUA 5DZ9A 3RDTB 3MA7A 4YHKH 1NGYB 2YBGA 2WXRA 3GRBA 4N25A 2OA9A 1UD6A 1FZMB 5JO5A 5IWLC 2PF6A 3SGJC 1VFBA 1W0VA 3Q0HA 1HH9B 5HVWA 3HC4L 4QKTA 5KYWA 4R2GD 3QZBA 3PP4H 3HNTL 3HHMA 5EU4A 4Y1TA 5JQ6L 2BSTA 2QPEB 1F90L 2Y7QB 1TQBC 4M3HA 4NDMA 3BN9C 2IANB 2EDMA 2E7LA 4AL8L 4MKMA 5IMMA 2VB5A 3ZL2A 4PG9A 2IMMA 1VADB 1CGYA 3QJRB 4NP4H 3DIVA 1YYML 4E9XA 2BNQB 4AY0A 5C0AB 3NEXA 5BZDA 2EE6A 4YDVA 4MD4A 5ACZA 3QEHA 1NBVH 2I7OA 4DZ8B 3S37X 5LQBH 1NC4D 3HJEA 1NUGA 1E7VA 4XXWA 2V17H 2GY7B 1CFSB 3QUMH 2F54D 4XC1H 3ZYZA 1EA9C 4ECNA 3QQDB 4XOAA 3ZX1A 2VDPL 5DJDB 1ED3B 2YEZB 5EOTA 4YXHL 2EUVA 4JO8A 2KYIA 3NT0A 3OJMB 4HIEB 1VKXB 1NMBL 2F5BH 3A47A 3X13A 5E9AA 3RNQB 1DYZA 1GGCH 1M53A 1F86A 3JTSA 4CVUA 2YUXA 3NJJA 1N8ZB 2V2WA 5K1VA 4F2ME 4X5LA 3C5JA 2FLMA 3UGUA 1D5IL 3VXOA 1GYCA 3GHPA 3P0VL 5KW9H 2WLMA 4JY4A 4R83A 3RDJA 4XNYL 1EUUA 1PG7L 1FHGA 1CD9B 4KKCD 5B38G 3QNXA 2VXSH 5HHNA 4Y4FA 2X4TB 4DHLA 3NZHL 4FFVC 1X7QB 2ZX6A 2RTTA 4NSKA 4FAAB 5GZOA 2Y07L 4WWPA 2EO1A 4JDZB 1HDMB 3VXPA 1SJHA 2YRZA 4WHCA 3SPIA 2LW3A 5ICUA 5LBSL 3J2PA 4OI8A 3IGAA 4GRMA 1E5BA 2J6EA 3P0VH 1RK1B 2OMBA 1WIPA 1XL6A 4Z9KB 3TCXA 2QGBA 1BD2D 1EDYA 2QQNL 3KPMB 4O58H 2IWGA 3L4VA 2A9MH 3P3SA 4L1BA 2L0DA