3NJFA

Y26f mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
112
Chain Sequence
b'QGLAQFIKVNVTLENGEPVFIFTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 18
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njfA00
1MDAA 2DY2A 3T6WA 2FQGA 3V9EA 4ENZA 5I5MA 3NJIA 1V55B 1PLAA 4DP8X 1AZCA 1AACA 4N4YB 1KYAA 5I5IA 1J9RA 2A3TA 1EHKB 5I6MA 2CBPA 2PCFA 1OCCB 2RACA 1AZRA 1IUZA 3EH4B 1SF5A 2DWTA 1NWPA 3H4HA 4AKPA 2XYBA 1RZPA 3H56A 4Q8BA 1OE1A 2VSMB 2J55A 1KBWA 1TKWA 2XX1A 1IC0A 2XLLA 1XB6A 1XB3A 4EF3A 3PAVA 2R7EA 4UANA 1NZRA 2E86A 9PCYA 3FU8A 1JZHA 1TU2A 3L45A 2I7OA 3OQRA 3PPSA 4HHGA 1NWOA 1E65A 4HHWA 3HEIB 3IE9A 4JKNA 4YSAA 3NJNA 1PF3A 3SBRA 1AOZA 1DZ0A 3KW8A 4A2DA 3AW5A 1PNDA 2UX7A 1V10A 3TU6A 1KCBA 4HCGA 1IBYA 2FJSA 4WKXA 2FQFA 4F2EA 5B1KA 3TBBA 3ASNB 4AKQA 2EIKB 3S3CB 2I85A 3FYIB 2VW7A 4QLWA 3FSWA 1YLBB 1VLXA 3DTUB 2IDUA 1AG0A 2WO3B 3NP4A 3X1GA 2Q9OA 2BP8A 1NIBA 3EH3B 4AI7A 1OE3A 1R1CA 2HX8A 2N0MA 1GS7A 4JHVA 2XU9A 2PPAA 2CAKA 5AKRA 4YSCA 5B7FA 1KBVA 4P5RA 5B7MA 1A4AA 2IH9A 4DP6X 4DP2X 1J5CA 3AG4B 3FQ2A 2IH8A 1L9QA 2PP7A 4BXSV 1F56A 1ASPA 1SFDA 1JZEA 4KNTA 2QPDB 2Y69B 1J5DA 4L0PB 2CALA 2HRGA 2YAQA 2AVFA 2PP8A 4GP8B 1SF3A 2ZOOA 1HAUA 1QLEB 1L9TA 3AZUA 1MG2C 1J9TA 4G7RB 2ZWNA 1ADWA 1AG6A 3UABA 2OV0A 3CDZB 1FFTB 1AANA 2AZAA 3S3BB 2BP0A 2UXVA 1NIDA 1CYWA 3FS9A 2BW4A 1BAWA 1E5ZA 2FWLB 2I7SA 5IY5B 1J9SA 2XX0A 1KV7A 4E9WA 3ABGA 1ASQA 1N70A 2CJ3A 2NRDA 2QDVA 3PCYA 1ET5A 2ZONA 2GC4C 5B1BB 4BWTA 2EIJB 3S3DB 4DP4X 1BXVA 1SFHA 2IDQA 4PCYA 3PAUA 3AG1B 1X9UA 3NSYA 4E9SA 3TASA 1SJMA 1JXDA 2JKWA 1ILUA 2W8CA 4HIPA 4BWWA 1PLCA 5I6KA 1BEXA 2XWZA 1ILSA 3G5WA 2PPEA 4F7KA 1RCYA 3T6ZA 3QPKA 3MX0B 1WA2X 1PLBA 5I5JA 3DKHA 4YL4A 2WO2B 1FWXA 3QJQB 4Q89A 2YAMA 2BW5A 3IBOA 4KO7A 5I6NA 1PY0A 3NYKA 3UAEA 4UAHA 1E67A 3OM3B 4X4KA 5LDUA 1RZQA 3S8GB 3X1BA 1A65A 2XXGA 1BQKA 2H5UA 1PZAA 2FQDA 3WIAA 1M9WA 2UX6A 1GYCA 1AS6A 1AQ8A 4BDVA 3RYMA 3WNJA 2HX9A 1QNIA 2HZHA 3X2QB 2IDFA 2GHZA 4F2FA 3TA4D 1ZPUA 1SHXA 1URIA 4KNUA 1PAZA 2TSAA 1ID2A 2J56A 4GP4B 2QPEB 3CVDA 2DWSA 1A4CA 4KO5A 1CC3A 3TBCA 3OMIB 5I26A 3ABMB 2BZCA 3QJUB 4ZK8A 4KOCA 2EIMB 3ZDWA 3GXUB 1L9SA 3PLYA 4UF7C 4HCIA 3U25A 5I28A 3FQYA 4E9VA 4G71B 3GYRA 5E9NA 2X88A 1IKOP 3T71A 3UAAA 2FQEA 4FAAB 3QJSB 1T5KA 2TSBA 4BXVA 1HAWA 2IWFA 1AIZA 1PNCA 1BQRA 3JT2A 4G72B 1OCZB 5B1JA 4HAKA 1A3ZA 1SHWA 3WKQA 3CVBA 4KO6A 1OV8A 1JVLA 2DYSB 1I53A 3H4FA 4N8UA 4DPBX 2EILB 2BO0A 3FPYA 3EHBB 4KNSA 3X1FA 3NP3A 4AX3A 1WS7A 4YSUA 1W8EA 2GBAA 1AR1B 1V54B 2IAAC 2B08A 2IWKA 2J57A 2ZXWB 4G70B 4KOBA 3X1NA 1PZBA 3N55A 4E9XA 3QJTB 5B1JC 2EINB 4W1TA 2YAOA 5I6LA 2UXGA 3OD3A 4DPCX 2GB2A 2PCYA 8PAZA 2P80D 4BDVB 1HFUA 2XXFA 3S8FB 3NJHA 3NSDA 3FSZA 4CSZA 1JVOA 4HALA 1XMEB 1DYZA 5TK4A 2YQBA 3WNIA 2OJ1A 4E9YA 1ZIBA 2R7EB 1GY2A 2W88A 4YVNA 2VN3A 2VW6A 4TXVB 2IWEA 3NJJA 2AFNA 3FU9A 2BWIA 3GDCA 4DPAX 1NPJA 2P80A 4BK5C 1MG3C 1KDIA 1BYPA 1L9OA 5B7EA 2BHFA 1OOWA 4E9RA 3T6VA 3ZX1A 1M56B 1QHQA 1OF0A 2PPDA 1NPNA 3NJKA 2HX7A 5I6OA 3ABLB 3ERXA 1SDDA 1B3IA 1ZDQA 4P5SA 2BP8B 3CZUB 4QKTA 4DP1X 2J5WA 1JZIA 3C75A 4DP7X 2YAHA 3PAZA 4G7QB 1EZLA 1KGYE 3FQ1A 1WA1X 4E9TA 1AAJA 2PP9A 3EH5B 3WKPA 2FT8A 2AZUA 1W6LA 4A68A 5AFAA 1N68A 1GS6X 2BWDA 1GY1A 1NICA 3QJVB 2XUWA 3WG7B 3IEAA 4YSRA 1NDTA 4A2HA 3CG8A 1RKRA 1A4BA 3IN0A 2QT6A 4DP5X 5A7EA 4K9JA 3FU7A 3ABKB 1A8ZA 5F7AA 2H47C 2VW4A 4JHUA 1TEGA 1OCRB 2BP0B 3WI9A 3NT0A 5ANHA 3UADA 2DYRB 3ZIYA 2XV3A 4A2FA 7PCYA 1IBZA 2HRHA 4GYBA 2WSDA 1BQ5A 1NTDA 1BXUA 4YSTA 5PAZA 1AZUA 4YSDA 1XB8A 1ET8A 1JOIA 1JZFA 2FNWA 2MRYA 3AY2A 5D4HA 6PAZA 5PCYA 3CDZA 2JFCA 4DP9X 1SNRA 3OMAB 4DP0X 6PCYA 2YAEA 1CYXA 2JXMA 1PMYA 1MZZA 1TEFA 1WA0X 1SDDB 1M57B 1NINA 3ASOB 1NIFA 5I6PA 2DV6A 3EF4A 1NIAA 3UACA 1AS7A 4WTQA 5D4IA 3NJMA 3OMNB 3QJRB 1AS8A 2GC7C 4NB7A 4GP5B 3N2JA 4G7SB 3PXLA 3BQVA 2HXAA 5TK2A 7PAZA 2FT6A 1GS8A 2CCWA 2FT7A 1GSKA 4AZUA 2UXFA 3DIVA 1OE2A 4M3HA 5F7BA 1ZIAA 2CUAA 2QDWA 5EHFA 2YXVA 2MTAA 2PPCA 2YXWA 1ZV2A 1AZBA 2VMJA 1W6WA 2XV0A 2Y1AA 1E5YA 4W9ZA 3AG2B 3D12B 4CSPA 1BYOA 4A2EA 2YARA 4PAZA 3FU7B 4RH4A 4A67A 1ASOA 2GIMA 2PPFA 5AZUA 4YSSA 3CVCA 5B3SB 3T9WA 1JZGA 1GW0A 4HZ1A 2OCCB 3HB3B 3T6XA 4NERA 3FPXA 4HCFA 3SBQA 4YSEA 1KCWA 2HLEB 5D4JA 3FYEB 4FA7B 1GR7A 1PZCA 1JZJA 3NSFA 1KDJA 3KW7A 4YSPA 1OCOB 4YSQA 1PCSA 1WS8A 4BWUA 2FTAA 3UGEA 1MZYA 2VSKB 1L9PA 2B3IA 2GSMB 4KO9A 3MBWB 1JERA 2XV2A 2GI0A 1JXFA 2Q5BA 2BZ7A 2YAFA 3AG3B 1FA4A 1CURA 3JTBA 4AKOA 1L9RA 4E9QA 3NJFA 3FSVA 3IN2A 5B1AB 2VM3A 2XVBA 1CUOA 1WAEA 1BXAA 1ETJA 2X87A 2PLTA 4A66A 2VM4A 3NSCA 4M4RB 4MFHA 4YSOA 4YVUA 4GXFA 1NIEA 1ZDSA 4GY4A 1E30A 3NJLA 5FC9A 3NJGA 1UATA 2YAPA 3FT0A 3V9CA 1ET7A 1J9QA 2H3XC 2IDSA 1X9RA 3SQRA 3X1EA 3ZBMA 4NAJA 2IDTA 3FSAA 3QQXA 2UXTA 1AZNA 2AANA 4A2GA 3BVDB 3SBPA 1JXGA 2LLNA
chains in the Genus database with same CATH superfamily
3LQAH 3H9HA 5B21A 1YC8A 4GKNB 4X8GA 1LK3L 3PDGA 3ULVL 5I6MA 3DX2A 2B9AA 2ZF8A 4BH7A 4R7NA 5E08H 1Q9KA 5CEZH 4E0RB 2A7BA 4PGBA 3DUUA 3FB8B 2FR4A 3UXFA 2ITCB 3H85A 4FQJL 5H4ZA 3LRSA 1FZMA 1MRFL 3JUZA 4NP4L 2WWMC 2E7LC 4R5VA 4KKBC 4Z9KB 5DFVC 2NNXA 1FFPA 4AYGA 43C9B 5IKCB 2X4RA 2CLRA 4UBDC 2SEBA 4PP1C 3LHAA 1JZHA 3MRFB 4YXHH 2YK1L 4RNRA 1NCTA 2AXFA 2V8LA 1KTCA 2AP2A 3DVFA 4GJTB 1TZHB 3M88A 4GRWB 4GB9A 4LLYA 2X6VA 1QI4A 1K85A 5T5FA 3SBRA 5FGRA 2EIZA 1CWVA 2Z92A 2NY7H 3WJJA 5HI5D 5BXFA 3UEQA 2NZ9D 2C7UA 3FQRB 4WKZA 2FQFA 2VMDA 4L37A 4F2EA 5MHSE 1FN4B 1O9ZA 1ZT4A 4XP4H 3LN5A 2F5BL 1OTUC 3B2VL 4BH8A 3T77A 4GUQA 1G43A 3IKKA 4GIPD 3GXIA 5E6YA 2WV3A 3F6JA 3OSKA 1G1KA 1KJ2A 2GITA 3DOIA 1SN2A 5T1LB 2V9TA 4F8PA 2FBJH 3LZPA 1YYML 1CLOL 2VJ0A 3MNZB 4KJPC 5AVQB 4JANB 4LLMA 1P7HL 1Z9PA 2EXYC 3PIQB 2VCOA 3QWOA 4L48A 5ICYA 2XN9B 3VFWA 4BD4A 4QGTA 1F6AA 1FG2B 2YRLA 4R4ND 1OP5H 4AVJA 3N1QC 1ZGLB 4P48A 3WOVA 2WLIA 1RUAH 1DUZB 4KKCC 5TDOB 1ZT1A 2XVLA 3LKPB 4N5ED 4JRXE 1ED3B 1KN2L 5L4JA 3VI4B 3TO2B 1BBDL 4ZS7H 4FZEH 3GUTB 2RR3A 2WBKA 3RWDB 1WFTA 4CBZA 1J5DA 2D3LA 2J5LC 5TE7H 1WK0A 2EEFA 3RY5A 5E70A 2E7HA 1SEBB 2QV4A 4LOEA 4EAEA 4B5ZA 5DS8A 4I5BB 1YEEL 1BZ9A 5I1CL 1MG2C 1SHMA 3BPCB 4M1DH 1MJ7L 2OV0A 3VFMA 4HJJL 1A21A 1RIVL 1RIHL 2AZAA 4P23A 4FOMA 4TNWK 3S3BB 3T0EA 5BZXA 2N7BA 3TIDA 1RK0A 4ZTEA 1TIUA 5J11C 2KKQA 2QGEA 5ICUA 5D9SB 4AZ8A 5GGQH 4JO3H 3IDGA 4OKVA 3PV6B 1ZVNA 2WZ0A 3UJTL 4W81A 1BF8A 3CFNA 3FQTB 1CD8A 4EIUA 1AGBA 3KXFE 1G7MB 2EIJB 1T3FB 3IGAA 4X5PA 1RJLB 3S36X 1MNUH 3MACH 3N0PB 4XMKL 2VL5A 1N3NA 4XBEL 4Z3EA 4GT0A 2HFEB 2XWBB 4D0CA 2GTWB 3RIAF 3CXHK 1ZE3H 2B1HH 4H5SB 3ARVA 3ZYZA 2X6UA 1SJHA 2OX5A 3LAFA 2W0FB 1O7VA 3FTXA 1F2QA 1NJ9A 2J5LB 3D1MC 1H8SA 3B4NA 4V1DA 1FGNH 1CS6A 3CUPA 3LJ3A 2OJEA 4CC4A 4V2BA 4FTDA 1KF9B 2HFGH 2WXFA 4LASH 4Q89A 1CVRA 1FH5H 3QXDA 2WIMA 3ZJAA 3GMRB 5FXCH 4M8UA 4NHUB 4O9HL 3VJ6B 1GOGA 4HF5H 1XGYH 5KVDL 1MI5E 3MTRA 1OLZA 5J11B 1A65A 1T1ZB 1CF8L 5HPMA 5GZOC 2H41A 1I4FB 4OZHF 1KSRA 5BQ7A 2FEDD 1ND0A 4H44C 4PGEA 5CP3A 3OPZH 1QNIA 2BS9A 2QADD 5FV2A 2A74A 1Z2KA 2JJWA 4DEPC 1VFAB 4F2FA 3A6BH 3B8SA 5D2LA 3BWUC 1QX1A 1NDMA 5INDA 2JF1A 2AJVH 2LHAA 3ALXA 1KOAA 2J56A 3BVVA 5DJ2B 2QPEB 2DWSA 3OMIB 4KK6D 1BWMA 2V2XB 4LNRA 5IHUL 5A16A 3O0LA 2E74C 1DBKH 1TLMA 4FFVC 5AL0A 5F1NB 4OI8A 4NI3A 3U4EB 4JFTA 4EDXB 5GGRB 3L7EB 1TZ8A 3G7TA 1T1WA 3APFA 4PGCA 4F58H 1PG7H 1YJDH 3BW9B 3UAAA 5JR1H 3QYMA 1KBPA 1RJYA 5EU4A 3A3YB 1RLBA 1JWMB 2IAMD 2IPKA 4G72B 1KJVB 4M62L 4LVEA 4CKQA 1MF2H 3NN8A 1IB5A 1AKJB 4KY1H 2AQNA 2VZ1A 5GGTA 4C56B 2LU4A 2PO6A 4GEJA 5ID0A 1CFTA 5JNYA 3TV8A 3RU8H 1SVZA 5ACLA 4MXVF 5F7WC 4AIZB 4PJIE 3WXWL 4M43H 3PWUA 5DO2C 3STLA 2ZKWA 1KLGA 3ELQA 3X1NA 5LBSH 4A6YA 5F7HA 1DFXA 4X6CF 1LMIA 2BLFA 3NZHL 1D2PA 2BNRB 4E9XA 4J3OC 3IJEA 1FHGA 1OP9A 1VADA 4KZEH 1OARL 2CO4A 2DMKA 2B0SL 5AZEL 1S2EA 2CGZA 2VAAB 4JM2C 3PJSA 3DUUB 5DVNA 4DZ8A 2Z4QA 2FR4B 1RPUA 1A3RH 2X4PA 4XX5A 1FZMB 2CM5A 3CZNA 2ADFL 1J5OL 1IAIL 4JHWL 1JVOA 2LOEA 2W07A 1FFPB 1CGTA 2X4RB 3DGGA 2CLRB 4PHXA 3X12A 3HR6A 3U1SH 4ZMYA 4WW1A 2VW6A 4O02L 1RVFL 2E9JA 4RNRB 1W0VA 4ZFOB 1WAAF 2AXFB 3MUUA 5DFAA 2M8XA 4JG1L 4OM0H 4RMVA 4BK5C 2OKMA 2JKTM 5ISZA 1JPTL 1TQWA 1F3JB 1LDSA 2E76C 4KRPB 3FTUA 4Q4EA 3IM1A 1OOWA 4BZ1H 4ACPA 2TAAA 2JE8A 2A73A 4L37B 4ZMTA 3EFOB 3RNQA 2VE6A 1ZT4B 2G2NA 2R56H 4NKQB 2X6AA 2P5EE 5DD6B 3D5OF 3GLEA 4QNPE 4CU7A 4BFIB 4OV5A 2OL3B 2ZOKA 5EF3A 2QQNH 1GJUA 2GITB 4RZCA 5GS0C 2ZNWA 1YEKH 4S1RH 2VDOH 1G7PB 3HIZA 5CJ8A 3FT4B 3BC9A 2ZIDA 2NSMA 1YY8B 4EN3A 3BIBX 4LLMB 3BFQG 1EAJA 3UC0H 4TYUA 1FIEA 4G7QB 2ZXGA 4UYPA 5ICYB 4GW5A 1MLBA 3VFWB 1F6AB 2DD8H 5CD3A 1A25A 1TETL 2A4ZA 5H2BA 5B1CA 2ORBL 4PRNA 2HKAA 1ZT1B 5JUEH 4A68A 1A6WL 4H1LA 2D3NA 5KUKA 1NICA 3Q6GL 2NYYD 4Z0BL 1Y18A 2JTDA 2ADYA 3MRCB 5DK3A 1CICA 1CR9L 2Y23A 1FRGH 2VDQL 1I7TB 1BZ9B 2AK4D 5JA8B 3QFDA 3UZQA 3LKSB 5SWZD 1UA3A 3HI5H 4H26A 4UZGA 3J7HA 3I3DA 1HHKA 1DDHB 2OTUA 4FG2A 3VFMB 3IT8D 1M9SA 1EEYA 3KR3L 4P23B 3T0EB 3B2MA 1MJJB 3GSWA 3TIDB 1IGIH 2DYRB 4JCMA 3BRDA 2M26A 2PW2A 1NTDA 5EBGA 5FO9B 1FHNA 4AZ8B 3UH8A 5J12B 1L0YA 4I3SL 1PZSA 4IRSD 1EDHA 4NQEA 4XNQA 4NIKB 3E9TA 3BHBB 4Y9CA 5F8RC 4XCFH 4Q74A 3D2UD 1SNRA 1I1AA 3F01A 4G2AA 1JHLL 1BX2B 4JKKA 1CYXA 1NKGA 3HS0A 3WNNA 4D0CB 3QIWC 1KGXA 5B38B 3BKJH 3UCRA 5BVPH 4JAMB 5D7JD 3QC6X 2R0WL 4JRWA 2E6QA 2QKIC 2YWYA 3JWOC 4V1DB 4UV4H 3OMNB 1QNZL 2NW2B 4JQXC 4HT1L 2OJEB 1O6SA 5IF0B 3ULVD 3BDYL 5E8NA 3TCTA 4GAGL 4K5NA 4N2FA 1X5LA 3P0YL 1QFWL 2DQFA 4AYFA 1WFNA 1DJYA 5DRWB 2N56A 3FQXA 2R4RL 1RZKH 4EI6A 4HOMA 1FFOA 4MVBD 5C3IA 1A5FH 3UO1H 1DQLL 3O11A 5EOCH 2Y06L 3WXVH 3WEOA 2YEZA 4E9LA 1NCHA 2G4EA 5J9PA 4UB0L 1BZ7B 1ND0B 2X1WL 4FJ6A 1N0LA 2ROXA 5D7SH 5AVYB 4KI5C 2DMGA 4CL7A 4U1IA 1FAIH 5JDJA 3JWNE 5D7LB 4M29A 1NDMB 4PRPE 4PUBL 3DXAB 4YDIL 2IOMA 1YA5A 4Z6AT 5DSCB 2DLTA 4L1HA 1NGZA 3CFUA 2HT4C 3CMOH 4FNPA 4HUUB 3RKDC 3VU2A 3QIWB 5B3NA 4LNRB 5A16B 3MRHA 4HZ1A 2Y7LA 3C5JA 2QKIB 3D08A 1WFOA 4HIIA 4KK8C 4XNYH 3DI3B 4PJXE 3FYEB 3ZKNC 4X5XA 3H55A 4UOZA 1L6PA 5IUSA 4PGCB 3LKRB 1OCOB 4UILH 4YSPA 4YHOH 3QUYD 3FN3A 3PABA 3F2LA 4M7JH 4O5LL 1L9PA 1AXIB 1ZKAA 2VRKA 2VXVH 3MI6A 4GSUA 4PWKA 2XA8L 2VR3A 4M1GL 1CDIA 4PG9B 4XAKE 2Q5BA 3QYCA 2BZ7A 1Q9LB 2F7RA 4ZAKA 1OM3L 5DQDH 5FA4B 1JGVL 2FO4B 3A4DA 3JTBA 1TZGL 4QRPD 2AAVA 4KJYA 4NGHH 4PS7A 2VM3A 1D5XB 2PO6B 4RISH 2JKIS 3KL3A 1CFTB 3PY9A 2FYYA 5EA0L 5FWRA 2BFVH 2APSA 2Q86A 3K6NA 1CFVL 1ZK5A 5F1SA 3U7YH 3OMZA 1JWSA 2VZUA 4YQXH 2HG0A 1IIIA 4QRSA 4DH2A 1KLGB 4G9FA 4A6YB 3WTTA 3A4FA 4ABUA 4XWGH 3RZCA 2MHAB 5F96H 3SN6N 5E1IA 3BAYA 2XWTB 1IKFH 1ET7A 1VADB 1L7IH 5C0AB 4MAUH 5AB1A 1MAKA 4Z7VA 2Z4QB 2EE6A 4O4YL 1CXLA 2VDKB 4GSRA 3SBPA 5FFLA 2H8PA 1BJ1J 1HIMH 3L17A 2CDFB 1PLAA 3GK8H 2W07B 5DJCA 2DYPA 3MCKA 4JO2H 5A40E 2A3TA 3X12B 1HILB 1GYAA 1T0MA 1AZRA 3G6JB 3SGKC 4WV1A 1MXDA 2OMUA 1NWPA 2DM7A 1CGUA 2CJUL 1U8NA 1Z9SB 3TYGL 3FTVA 3MJWA 3UZVB 2XKNB 4QJ3B 4TVSa 4YGVB 1KBWA 4QRBA 1IL1B 2QGCA 5AVXB 4JFVA 1AOHA 4NLHA 4X6DA 3IJSA 4NO0B 1DVFA 4KK9C 2VE6B 2A9NL 3FO0L 4OSUH 5JZ7C 3WFZA 3PPSA 2XZCH 4BQCA 1WC7A 3EDEA 4OV5B 5MEPA 2ZOKB 4HA1A 4U1NB 1U42A 4JY6B 5HYJB 4IU3A 2AQSA 4W4OA 3GMOB 15C8H 1DZ0A 3UTZA 3ATFA 4XBPB 4YR6A 3BGFC 3OKNB 4K8RH 2YKKA 4MRBA 4ONHB 5EZLA 4CJ0A 1U6AL 3CHOA 3TFKD 4EN3B 1GW6A 5DJ8B 3BOVA 3TBBA 3VD5A 4LQ1A 5I1AA 4GW5B 5H94A 1MLBB 3V0JA 1S9WA 4ZMPA 1BQLH 1PIFA 1YLBB 5CD3B 2IDUA 4G7YL 3P1VA 5DURB 4PRNB 4AT6A 3E3QE 5E03A 1NGPL 3QZLA 3NTCL 4H1LB 4YC2B 3EGDB 3H7LA 2N0MA 3ZGHA 2A38A 1A7NH 4XMTA 3T1WA 1INQB 4N28A 1OAXH 1CICB 1TDQA 3B9EA 4NP9A 3WYRA 2GY5A 3KNBA 3PL6A 4UAOB 3ASWA 1A4AA 5J1AB 1MRCL 2C26A 3AG4B 3CFEA 5CJBA 3BEVA 2NY2D 3OWRA 5AWNH 1HHKB 5DQJB 4PV8A 4DVRL 3GSNL 1CL7L 4LGRB 3TCXA 2NY1D 4LCWA 3KAAA 2N01B 5GRUL 4LPCA 1EO8L 3L4VA 5F7DB 5IFAL 2H0FA 5CMAB 4LEXH 1OP4A 4P5TC 3B2DC 2Z9TA 1RULL 2AI0H 3AXLA 5J4MA 4BSWA 4FHBD 3H54A 5BRZA 2H1XA 4PBWD 4LEEA 3SJVB 2WN2A 3OXRB 2X4NB 1USZA 3WKMH 4OJEH 4NDMA 3HRZC 4X6EA 5DUPH 5C07E 1KTLB 3VI3F 3W2DL 5B3JF 2ADGA 3HS0B 4X7EC 2V5SA 1L5GA 3STZB 4LHUD 5TGBB 2DLFH 2O5YH 2XX0A 2ZJSH 4IIZA 5EEXA 4XCCL 1A3LL 2EH7H 3DOSB 4Q9QH 1KTDA 1N70A 4GS7C 4Q6YA 2ZONA 4CNIA 2F54E 5KYXB 4GQQA 2IDQA 1SFHA 1O6SB 2F53D 4PWGA 3VE0B 5E8NB 1A6TB 1S9YA 2CMRL 1B9KA 2FRGP 2HFFB 2XZZA 4XNAA 4DGVL 4YLBA 3RWEB 2DQFB 3QR0A 2CHNA 4V33A 5ABAA 4TNWF 3FQXB 1CZ8L 2Q7YB 5AW0B 3IS1X 3HPJB 3KLQA 3MRGB 2DTSA 4WUKH 2ZCZA 3UEZA 4B6ZA 1ZV9A 3C2SA 4MCMA 1ZTXL 5KSBA 4U7KA 2WQSA 1EAOA 3QBTB 4ODWA 1BLNB 1K8DA 2CDEB 1XH1A 1KGWA 3DKHA 4YL4A 1A7OL 3VFNA 4JQIH 3B9DA 4U1IB 4HD5A 4UQBA 1R4XA 1QACA 2VR4A 4Z18A 5DYOA 2XC8A 4XBMA 2JCCA 4N0UA 5AKTA 3WIHH 1U8MB 1W0WB 3LXAA 4TSBH 2HYMA 3HRZB 2A6KA 5B4MC 1OPOA 1N8OE 1IFRA 1UWFA 3B6SA 4WK4B 3KPSB 4AW7A 3T04D 1E4WH 3ZDZB 5AL8A 5IB2A 1JXJA 4LESA 1A6AA 4Z78B 4D8OA 5LQBH 2RBLA 3E6FB 3EHBC 1RMFL 4XNXL 4Y19A 3SQBB 3P9MA 1I31A 1ZSDA 4H20H 1KXQA 3GBNL 1PG7X 3NH7H 4HWBA 2QHLA 4OTXH 4WI7A 1KJ3H 3AGWA 3VWJA 1UXWA 5C0CD 3VD0A 4PJ5D 4CU6A 4FP8L 3BH9B 2GKIA 4LCYA 1BM7A 2NXYB 4UNUA 3TO4C 1JRHI 2BHUA 4XMWA 2QGDA 1FVDA 3RHWF 1ZT7A 1VA9A 4MKTA 4ZAKB 2ATKB 2ADIB 1YEJH 4OCMC 3MBXH 4ONFL 2Z8RA 5HI4D 2HRPH 4WFHD 5HHQA 5JHDD 1NCUA 1KV3A 2L7UA 3FUHA 3ME0A 5EEZA 1M05B 1JGDB 2VM9A 3FQYA 1EZUA 1CDCA 3FO1A 2QPSA 2Q86B 4JL2A 1EX0A 4QRUA 3HPLA 2WLLA 4K23L 1JWSB 2F74B 3QDGD 1AR2A 3M07A 3BT2L 3FSOA 1AIZA 1HSBB 3QGVA 5E6IC 1J0KA 3UYPB 5E8DL 2F8OA 1MIEH 5LBSA 1Z9MA 4CUCA 3QDJE 3ZQXA 1II4E 5KN5B 2VNCA 3FTYA 1UB5B 4HKJA 2B8OT 5JOEA 3RWGA 1FVEB 1LO5B 2ZQKA 3FFOA 4GI8A 4WFFE 2FCBA 1RUKH 3EHBB 3GI9L 1X7TA 3PDDA 2WXKA 4AMKL 4DTGL 5HYQB 1QR1B 2D0GA 3EJRA 2X44D 3EDKA 2XKUA 4K7PY 5JQ6H 5D93B 3KWWA 3RNKB 2UWEF 1A6ZB 3QCVH 4WJG3 2DQIH 3B7YA 5AOKA 3GXPA 2Q87A 2EDFA 3K8LA 4OLZH 4FNLH 2GUOA 3APNA 3W38A 3NFSL 5EU3A 3EUDA 5EC1A 1T66D 4ZPVA 3NSDA 3FK3A 4ODVH 5C09E 2CUHA 3JVGC 1LO4L 4L3FA 3IJSB 3L3GA 2LU5A 2R4SL 4X6DB 1SLWA 1MWAH 2N4IA 2GCYB 4BZ1A 3BUPA 1WZ1H 2XTLA 3S97C 3PDOB 3LVTA 3ARUA 3SE3A 2XPYA 4IU3B 1D9KA 1VFBA 2V7HA 4L29B 1NCBH 1ROWA 1B4JH 3II2A 4M5ZH 3C5XA 2MMXA 2VISB 1QFWM 2FX9L 2VSCA 4ICXA 5I8KL 3U7WH 5DJYB 2G9HA 2ADJA 3MOBL 5IJDC 4POZD 1M56B 3GSRA 4B9CA 1JV5B 1OALA 1AJ7H 1NPNA 1S9WB 1H15A 1IFHL 1TTAA 1UT2A 2C9SA 4ANXA 4PJ7E 4XVJL 2VDML 4FA6A 1J8HE 2YUVA 3GJFK 5AUMA 5C8JA 3IMBA 4Z7IA 5MI0C 1A6UH 3CZKA 1TENA 3P4LA 4UDUA 2BY0A 2EDYA 2YEVB 4YH6A 4JNXA 5IJKA 3IFNH 4MA3B 1G1YA 3ZMNA 3VFUA 5I18H 1WEJH 4Q56A 1H6TA 1KCVH 5BV7H 1FI8C 4F20A 4X4YA 2FT8A 4D94A 2J2ZB 4W70A 3BEVB 1U58B 5C70A 1ORSA 2BM3A 2IADA 1N68A 2DQMA 3VQMA 3FCTB 2PYEB 2HTLD 4RA3A 1CTOA 4LCWB 3ZE1F 4DT2A 3TBYB 4K5OA 4OZ4A 3CH1B 4L9DA 4Y5VC 5L8LB 1H8OA 4ZZKA 4M93C 1WTLA 4WAFA 5IP4A 2YPLD 1DTUA 3EG9A 4M7KH 4YFDB 3FU7A 4X5WA 5BRZB 1NBVL 5KJRL 3COOA 3IDNB 4Z5RB 4B41A 3ZTJH 4KY2A 4UQAA 2AVGA 3BVWA 5DT1L 1OCRB 3B9KD 4NDMB 3BIAX 3K6OA 3NT0A 4X6EB 3LQZB 1PKQA 4QTHA 1L5GB 1RZ7H 5JQHC 1AHWC 2EDRA 1U3JA 5JDSB 1TMCB 5MI0B 4HQQH 1N64H 4APXB 1JGIA 5HHOA 4M56A 4G5ZH 5EB9A 5JOPE 1CDHA 2AJSL 1KTDB 1PDKA 3EO0B 1QBLL 4GAJL 4QMEA 4RMUA 4C83B 4OVVA 3TGXA 2C7FA 4CNIB 3BFOA 1DQJA 1DUYA 1JUFB 4U49A 1JN6A 2IBBA 1P0SE 3JYBA 2YAEA 2H26A 4YHLL 1UWGH 3FN9A 2CHWA 1MLCB 2DQHL 1SDDB 1M57B 4PJFA 1IAII 4KK5D 3FH5A 4PJIF 3IAGC 3SE9L 4P59H 2YPVL 1Z5YD 2AJXL 4Y5VB 2GC7C 1K8DB 3N43F 4M93B 5BRPA 1G9HA 4LCCC 1TTGA 3PXLA 1DSFH 1DQMH 4GSQA 3QPQD 3AS1A 4KHTH 3VFNB 5C6WH 4PJGE 1QRKA 3V6ZB 1GIGH 3T8VA 3I6KB 4IDJH 3JV0A 3GXNA 1T2QH 4UTBH 5BJTA 3O45A 1IC1A 5I8CA 1MJ8H 1TTBA 3WTVA 1TQCB 4N0UB 3MV8A 3D0LA 3QIUA 2CUAA 5FM8A 5B8CA 1RIUH 1C16A 2DWEB 3B6SB 4NWUL 2YXWA 2BVYA 1KEGH 1LO0H 1AHWB 1SJVA 3VGBA 2VDRH 4RMWA 5I0YA 5SWSB 4IRJA 3Q6FA 1A6AB 1LTXA 1ECZA 2J1WA 2YARA 4Y19B 3B56A 4AENB 3EJZC 4QHUB 1ZSDB 5IK3B 4HKXA 4QT5A 5IG7B 1UXWB 3BKML 1IT9L 5H37G 3HOGA 2BVPA 1I8KB 3WSQL 4QPEA 3ZSSA 3T6XA 4N2KA 5T33L 1HWGB 1FVDB 3H42H 4IDLA 3QR1A 4QNPF 4OCWH 2VXSL 3FQUA 2P1YA 3O4LB 3P3UA 4R8WL 5K9JL 4ZUSA 1JZ4A 2EUXA 3QI9A 3SYPA 1CXHA 3ME0B 1WS8A 3RY6A 6FABH 2FTAA 3FO1B 1HN1A 1KEML 1CD1B 1M3IA 4K71B 4LCIH 4WI2A 5FYLH 3RFRA 2RFXA 2VLMD 5LXVA 4N8VG 1U2YA 2NR6C 1UB6A 4N2NA 3QJOA 1X5YA 4WI4A 1ERNA 4L3EB 4WFEE 5DQ9B 3Q48A 3Q5YA 4TSCL 4PJ9D 4R97C 1QUPA 3RWGB 5I1IL 4AQZA 1KACB 2VN7A 3F00A 2IQAB 3AREA 1EFXA 1ZA6A 1FNLA 5DFTA 1CE6A 4YVUA 3GRGA 1ZDSA 2VLKA 1F3DH 1NBZB 3FTGA 4HZAA 1E30A 1NL0L 1GPOL 2D7TH 3RI5F 2OMWB 3FO9A 4XPFH 4P57B 1ZWIA 4KJWD 1S5HA 4FI6A 2IDSA 3AGVA 1BPVA 3L1GA 3A23A 2GUOB 4JDZA 4PR5A 5LG1A 4A7SA 2A9AA 5EC1B 4ZPVB 1OGPA 2C1PB 3FQNA 2CPCA 4JFWA 2Y2YA 1BM3L 3DGDA 3AWGA 4G8GE 3L3GB 5DA4A 3DGCR 1Z5LA 4AOFA 1J9RA 3QARA 5DJAA 3EOTL 5E8PB 1NEPA 2PCFA 4OD3H 3MXVH 2J6EH 3FDWA 3HNVL 2CUMA 3H4HA 1UM5L 5KAQG 2YGQA 5KYYB 3D25B 4IKNA 3U2IA 3AMLA 1VFBB 2AV7A 1SY6H 3CVHH 5E9DD 3MBED 5FPIA 4G8FA 5D1XA 4R97B 4H2CA 2ADJB 1RURH 1YPZF 4P2CG 4ZFGH 4NQCD 4XI5C 3GSVA 4KDTC 1TU2A 3JWOH 3L45A 3B2UC 4JQVA 5CZKA 1R5WA 3BUYB 1MI5D 4H0LC 1JL8A 3U1PA 4GRLC 3U6XS 4PRHD 1BVKA 5AUMB 1J1PL 1U91A 1KBKA 4PWFA 2EUVA 4OCLC 4RLDA 3L3DB 2NLJA 5LAXB 1KUMA 2KDGA 4XHJD 4N86A 4ZO6A 5F93C 5F44A 1F1GA 1H3UA 3RL2A 4R4FH 2VO8A 3Q1EA 5IHLB 2Y3AA 1RUPH 4WCYL 5JLZB 2UZYB 5ICZB 4X4YB 2DKUA 2E75C 3MRPB 2ZXAA 2WTRB 3U9WA 1OE3A 4LKCB 3KLHD 2AXHA 3RJDA 2C1OB 4FLSA 4HKBB 5I73C 3E38A 3NPSC 2CAKA 3CHXA 4ODHL 5GRXG 4HBCH 1YNLH 3EG9B 5D1QE 4KFMA 5KAQF 4ISVB 4BFNA 1HDMA 4OKDA 1H3WM 4UQDA 3L2MA 5EUOA 5J8OA 4JDVA 4PJXF 3DC0A 3CDCA 3NMEA 3HKZA 5I0XA 4YBQD 3SGJA 1MCOH 4C55A 2ZG1A 2CWRA 4GRLB 2I27N 3M6DA 3S5YA 4K55A 4HEMA 1R17A 4MWFB 2BC4B 2BIIA 5HHOB 1TPXC 3OKYA 2ZOLA 4OGQC 3AQDA 1AZZC 2J8UE 3SOBH 1OWWA 1J9TA 3ROLB 3P9LB 5I1HH 1D5MA 2QSQA 1DQJB 2NNFA 4UQ9A 1TR7A 2H26B 4PJDE 3MLYH 3MLWL 2FWLB 2RH0A 1J9SA 4KAQL 2C3HA 1FE8L 1YNTB 4OCNC 2VRAA 5SV3A 1QSFA 2VQTA 4NN5C 3VXUD 35C8L 4JRYA 3VMPA 3VWKD 4APQC 3NPSB 2QDVA 1XSKA 3KLDA 3OAUL 5AYUH 4U2ZA 2H32B 3UBGA 2I5YL 5BJTB 3H2PA 4JQIA 3E8VA 4EOWH 4BWWA 1AR1D 3SDAD 1D2OA 3O2WL 3QIUB 3D4GA 3WN5C 5B8CB 4Y2DC 4JB9H 3CLWA 4OIBA 4UT9L 3FXIC 1DLFL 2OJZL 1E3ZA 1PFOA 3J8F7 4MNQB 4FTVA 5DHYA 2E7LA 1OAQH 1TPXB 1XBRA 4D7BA 3VXQB 4D9QD 3Q13A 4QUOA 3T0VA 2Z8WC 1OK0A 4OQ1A 3CPUA 1RSYA 5LAPA 4BA0A 2IF7A 3SDDA 4XNDA 5I66B 4WFGD 4Y8AA 3N9GH 4FKKA 4HKXB 5I9QC 3ARYA 2E8ZA 4RGNC 3DO4A 2ICCA 4QT5B 2Q8AL 4NKMA 4FQCH 4GKLA 3VXRA 2GW5A 4AIXA 3KYMA 4PLNC 1M9WA 5KBLA 1W9XA 1U8QB 3S9DB 1HL5A 2A4CA 5D4QA 3IRPX 2ICWI 1HNGA 1NGYA 4APQB 4GQ9H 5L9DH 5CLZA 3W0WD 1M71B 1XH3A 3MRJA 2W81C 2FHBA 3GI8L 4G42A 2R23A 1HHGA 4UNIA 5HHPA 4YHYC 1Q72H 4H8WC 3NQIA 4HK3N 1H3GA 4CC1A 3FCSA 4F5CE 1BVLA 5ITBH 4DO6A 3FHQA 3GXTA 2PWDA 1OANA 1TO4A 3PP3H 1EPFA 1S7WB 2RFXB 3M1BB 4TUKL 4YUEH 5KOMC 1UB6B 4M4PA 3GXUB 1L9SA 3QHZL 3K91A 5AOMA 1ESOA 2GHWB 2L04A 1JFQH 2GYSA 4XRCA 3F04A 1PW3A 4XPGH 5KVEL 1WWCA 4ZUWA 1ZA6B 1S9KC 3VD2A 4MS6A 2OZ4H 5F0LB 4JPSA 3RIFK 4ZMOA 4GKZB 1JGLL 5I9QB 1F4WH 1NSNL 4RGNB 4X4XB 1ROCA 4XPHL 3SHSA 3M17B 5A43C 1H3TA 1ZWIB 2F58L 3MO1A 5MEOA 1E3XA 1MH5B 2LFEA 3U79A 5HHXH 3ALPA 4M48L 1A1NA 1U8IA 3ECWA 4QHPA 2IQ9H 4KQ3L 1HQRA 3NP3A 2FJUB 4OH2A 1I3RB 3FQNB 7FABH 1J0IA 4P2QD 5BMFL 1S5IL 3C5ZD 4YHYB 2OMZA 3HMXH 3QUML 3GSQB 3BLKA 1T5XB 3GNML 1MWAA 3L1FA 4HIEA 4O2CA 2EINB 2WAQA 1NANI 4WO4C 2PCYA 5AG9A 5G4MA 2AV7B 1F6LL 1BIHA 4Y5XC 5T1MB 2W1NA 2YXFA 1PX8A 1WFUA 4C47A 5EPMB 1OSEA 3WNMA 4UIKL 1MVUB 3GSVB 2GIYA 2AFNA 1KPUA 2P8LA 4NNXA 2XPGA 3CVIH 1QBML 2VLJD 5I5RA 4FJYA 4MA1C 2F8IA 4PMFA 4ZMZA 1BVKB 1YAIA 5TE6L 2ZUUA 3QUZA 5CLXA 2KI6A 1HSAA 4MMYA 3MREB 2MSPA 4HPOH 2FECL 4PRIA 4JPKH 3ARSA 4Z76A 1AIFA 5E8OB 3VO0A 5LO7A 4H88L 3L81A 3ERXA 4TVPL 1RZJH 1E4JA 1RK1B 3PXHA 2EVIA 1P7QB 4NUJA 5GGSY 3WKYA 2F8XC 1EANA 3BN9D 3BP6B 3KGRA 3VFVA 1PCXA 2VLRA 3RBSA 4YDJB 4WO4B 4DP7X 5CBEA 5LGYA 4KKRA 4NQDA 4LSVH 1HNYA 1O9VA 1EZLA 1MCWM 4OFYD 1LEIB 5I8OH 1UASA 3PJLA 5FYJL 5DRZB 3O0RL 2X1PA 1NA8A 5EUOB 2AZUA 3OAZK 4QYOA 3IETA 3D9AH 2BIQA 1EGJH 4LARL 4N85A 4RIRA 2Z3FA 4NO5A 2XFXA 1QFUL 4Y16C 4YSRA 4MA1B 4RSYA 1IZKA 3TJHD 4YBHA 2F08A 1AP2A 5C08A 3EJPA 3K4DA 2OSYA 1RD6A 4KZ0A 1JK8A 5D8JL 3FOMA 3LDBC 2X5PA 4XCYA 1D5MB 4GAAA 1DVZA 4K07A 2NQCA 1J1XL 2MNUA 2NQDA 3NFNA 4NQVB 4PS4H 4W4NA 4GYBA 3TH3T 5ADOH 4G6KH 1Q9WB 1QSFB 3OLIA 1AO7B 1BOGB 2AGJL 3QXAA 3PHOB 4LL4A 1HXMA 2QMJA 3QPXH 4JRYB 4R0LA 3WD5L 4MNGB 5DD5L 4GIAA 1K4CB 2JFCA 4OVUA 4L5FE 2G30A 1E4KC 4ONGL 3V4UH 2HLAB 2MCPL 5FYKE 5IW1B 4C4KT 1RERA 4UTBA 1QLEH 3AABA 3AY4C 3DPBA 5HJ3A 2JLPA 1NCOA 3HN8A 2IPUG 4Y16B 1DN0A 1WBXA 3RIKA 5D4IA 4RAUA 4DOHE 2WZPD 1P53A 2Y72A 3L13A 1G7LA 5K9QG 1L4IA 2R29L 3G9AB 3MUY1 3DETC 2X09A 4LLVA 4RDQG 1EJ8A 4G1EA 4ZFFA 4DEUA 3LDBB 3SDDB 2BNUA 4FYRA 3EGSA 3N42B 1AD0B 4Q4IA 3KM1A 4QRFA 4XOEA 4M3HA 3S35X 2QDWA 4M5YL 1IVLA 5JOFB 4ZW8A 3MRDB 3LX9A 3PGFL 2OSLA 2VT0A 4QDGA 1F86A 4NKDB 2CQVA 3EDFA 4Z8FL 3WTSA 1IBHA 1VACA 2R2EA 5ESVA 3WU1A 1EHXA 4CSPA 1R0AL 2Z8SA 3FU5A 4J4PC 1KIUB 3UBHA 2O5ZH 4W9DC 5L7XH 2XHNA 3BZEB 3I9GL 4TLTA 2OR7A 4TTGA 2R39A 5AZUA 2ZUYA 4JY4A 4AQ1A 3HE6A 3HW7A 1BVLB 2OULB 4Y1AA 5HI5C 3BJLA 1EZVY 4QHLA 4I87A 2QJDA 2Y36H 3OKLA 2BJMH 2HLEB 4FZ8H 1PZUB 5GISL 1ZS8B 4R4BB 1R24A 4PJ7F 2P9RA 3ZE0B 5FUCC 4PRDA 1LM8V 5CJQL 4LIQE 1HOEA 4XRCB 5D2LE 5EC2B 1XH0A 2V2WA 5TDPA 4BWUA 5D5MF 1Q38A 1WBZA 2D2OA 3PWVA 1U8PA 2JB6A 1E2VA 4NCDA 1X6NA 2GSMB 2P8PA 3TPUA 3T3PB 3LQMA 3FUEA 1A4JA 1G87A 4RDQF 2GI0A 1K5NA 3LEXB 2WXLA 5LGHL 5MEOB 4KJQD 1IC5L 3TF4A 4AUUA 2AQ1A 4HXBL 1A1NB 1FJ1B 4DGWC 1BXAA 4J3VA 2X87A 3DMMA 1DBML 4LL9A 4N5EC 3ZHKA 2QHRL 2W38A 1EJOL 1HJCA 2FSDA 1HZKA 3HBZA 3O2DL 1E9OB 3NJLA 5HGGS 4HOZA 3QNYA 3X17A 3NJGA 4DGIH 1NBYA 3DVNA 4HIEB 4OFIA 5T3XL 2ZAIA 3QQNA 1CGWA 4O2CB 3QNXA 1I9IH 4LKXA 4KBPA 4B27A 2IDTA 2J6EA 5T3ZL 4A2GA 3T6VA 4XC3H 4DEWA 4ZO7A 1SY6A 3CVHA 3RL1A 2Y1VA 2D7OA 1KYAA 1KENL 4Y4HD 1I9JL 4MJ5B 2ZP0T 5CO1A 4DSYA 4QLRA 1ZHLB 4XCNA 3S3SA 4U7SA 5DMGC 5F3HA 1IM9A 1NCCL 2P8LB 4LVHC 4PS8A 4GMTH 2O30A 2QVTA 4Q8BA 2P8MB 2XDHA 3AU1A 1F18A 1TKWA 3QUZB 2JVUA 4OIAA 4DKAA 1MCJA 4JFSA 4PRIB 4ZMWA 3KVPA 1RUMH 2V5TA 3TWCL 1XF2B 4BQ9A 1XF3A 1AY1H 4PQXA 1YO4A 3NIFB 1U95A 2O6EA 3RZWA 3RTQA 5JW4R 2Z7YA 3EFDL 4NCC1 4PJGF 2EO9A 1BFVH 1JPSL 4NUJB 4E41B 4R7VA 4HUCA 2CHXA 1GZQA 1QEXA 2QSCL 3AW5A 5DJZA 3VFVB 4A2LA 5ISZE 3QA3A 1ZVHA 5I1KL 3MCLL 5CBEB 2CLZA 1IEHA 1WSST 2WMPA 1R5IA 4PJ8D 2WLJA 3WJLC 5D70H 1XQ4A 4PCTA 3FSWA 5KUMA 1R34A 3L5HA 1GYVA 4M1CD 2FEDC 2H6PB 3E6HA 4QYOB 4AI7A 2QADC 2VN6A 1TQUA 3JTSB 3KWXA 4FQLH 1NUDA 4UDTA 2HJFA 4HV8A 4LVHB 2R0ZL 4XPBH 1QQDA 4Y4FD 2YUZA 3MOAL 5FX3A 1AP2B 3I50L 2OTWA 5B7MA 5JXED 3O3AA 4JZOA 4TRPH 2ALWA 3GIVB 3ESVF 2GABA 1JNJA 4JFZH 5IMLB 2J8OA 3KEHA 3NIGE 1BF5A 3L3KA 3MV7A 3WMQA 5DMYA 3GB7A 1HESA 1V7NL 3O3DA 5KSAD 2AVFA 2DM3A 3U82B 1BEYL 2FE0A 4P0DA 1U3HC 4XP9L 2K6ZA 1TYEB 1HXMB 1T0OA 2CBQA 1DCEA 1FZJA 4OZHA 5CS7A 3RAJH 1ADWA 3GMQA 3IAQA 5ILTH 1KIQA 1QSEB 5IESL 4P4RA 3LEVL 3SGDI 3T2NL 1WICA 4PI0A 2NX5A 3WV0A 4MQ7A 3WY2A 5I2IA 5L2KA 4NSKB 3PRZA 5I0ZA 5IFJA 4DKFL 4JO1L 4KDWA 1EZSA 3MPCA 3PWLA 2R0KH 3DPBB 1SOSA 2WLYA 1S8DA 2W60A 5EZJA 4G6MH 4BFBD 3BAEH 4HWNA 1ASQA 2CJ3A 4K3GA 1I1FA 2WXMA 4DF9A 1GGYA 4R90H 4NQEE 1X9UA 2WXOA 2RTTA 3GEWB 1A22B 1ILUA 4G1EB 2BNUB 5IBTH 3N41B 4XE0A 4JGJA 3MRIA 4R26H 5HVHC 2Z35A 3TCLA 1TJHL 5IJCC 5I6KA 4LHUG 3VQ1C 3DRTA 3BE1H 5DWUL 2O61B 3LS5H 3KYAA 1CK0L 2OSLB 3BPLC 2O93L 1JZ6A 5FF6A 5CFAA 3PHSA 3C5SB 3X3GH 4X8JA 1U3HB 3HE7C 3P30L 2VQ4A 2IANB 3L8QA 3SDCD 2AJYL 2NNAA 2WJ5A 3MV9D 5KBMA 2X3BA 1QRNB 5JIQA 3VCLA 4AYMC 1EVUA 4UINL 3QG6B 1KB5B 1ZS2A 2PR4H 1RQ5A 3ULAB 3VU1A 1I7ZB 3NCBB 1J8HD 2CRZA 5C6TH 1MREH 2WXRA 3CLEH 4L4TB 1N6VA 2IALB 1VHPA 5EOCJ 3T2OA 4QHLB 3C9NA 2FJHA 5EZIH 1DVQA 3OKLB 4IBSA 2BSEA 3X2QB 2G3NA 1DEEB 5DJ6B 3BVNA 1R24B 5DXWA 1KYFA 4D7PA 5DZAA 4Z0XA 3QEUA 4LZKA 1PSKL 2VQ1A 3VW3H 1GZHA 3GZKA 3VXSA 4MZ2A 3LKNB 5TDPB 5D7IF 2QSVA 3PWVB 3F8UB 2VAJA 5A2AA 3TN0A 5IBUB 43CAA 2P8PB 3EJQA 4OCSH 1INEH 2OZ4A 2JCWA 5HSFA 3B37A 1VGEH 3BPLB 2Y7MA 25C8L 3V7AG 5FYJD 4UZUA 3FMGH 3VNZA 1T7XA 3FRUB 3HE7B 5G5DA 5I28A 2WXHA 3DX8B 4NHCL 2A9DA 2GK0B 3TJEL 4C59B 3T0WA 2NYYC 1T5KA 3P3TA 4BXVA 2ZCKH 1H5BA 2Y3NA 2NSXA 4MS8D 3HB3C 1A4KA 3WS6C 1N6UA 1FSKC 1SHWA 2YC1B 5ESQB 1TJIH 5IROD 3HMXA 1O9WA 3H4FA 4LKXB 4N0CD 5CD5D 3FF7A 2PYFA 5JOPD 1CGVA 4IRZH 4XZ4A 1SOXA 1XIWD 3B2PA 4FFWC 3VSVA 2X7LA 3BPNC 2Y22A 4CMMA 2GBAA 4LLDB 3RDTA 3Q44A 4Y0GA 4R7DA 1ZD6A 3ARBC 4G70B 1FYTE 4L9LA 2YHGA 2NDGA 1JZDC 2ESVA 4P2RB 3RIFF 4X6BB 3H9SA 5EU6D 4PIBA 5GGVL 5F3HB 4G9FE 4S0SD 5FHBL 1OTTD 4PJEF 5CR8A 2H9GB 5E1AA 2K9UA 1W91A 1VPOH 2GJ6D 2Y6TE 1JHTA 2F5AL 3LRMA 4IGBD 3QEGH 2QSTA 2Y7QA 1NC4A 3FUDA 4JFDE 4Z7VE 5EDXA 5T1KD 5CEZE 1IBBA 2G3XA 5ERWB 3WNIA 2RCSL 1EEZB 3HNSL 4MJIE 5I16B 2YZ8A 3C6LC 3HVDA 3S8WA 1XF3B 4QGYA 3HG1B 1IIKA 1U95B 3BKYH 2B4CH 3QFJA 1URLA 1FSKB 5DI8B 4ORZC 3ULVC 3QQ4A 4ODUA 1GZQB 3L6FB 1RU9L 2UUDK 3H9YA 1FFRA 1F41A 3QA3B 5HYSG 4OM1L 4ZFOL 2CLZB 2JJTC 1DL7H 4MVBC 1R5IB 5E99H 5TDNB 1NCDL 5L4IA 3GHPA 4IJ3C 4YXKL 4OGAD 4X6DE 4L3CA 4GNKB 3ARBB 2EXSA 1FVCA 3LV3B 4U1KB 5E2TH 1S7TA 3E7JA 4JG0H 4HJEA 3E6HB 3ECBA 5DEGA 1NLDH 2XWEA 2VKXA 3EYQD 3HCVA 1U8HA 3KPRD 2EDDA 3QRLA 4NN7B 4JFED 4QKTA 4UDTB 1G6RA 3C60A 1G0XA 4HV8B 4ERSH 1EGJA 2JKXA 3UTTA 3WNKA 2XY2A 5I17A 5H8DA 1BXXA 2OL3L 2Z34A 2XWDA 1KGYE 1JD7A 2OTWB 4RAHA 1BFOA 4E9TA 2X4QA 1JPGA 1AAJA 3PWNB 3C6LB 5C9JA 1QEWB 4ODTH 4P46D 4B0MM 4L8SA 1IJ9A 5J06A 3N3EA 3OHXC 4GINA 4HVBA 2D8KA 1ADQH 1CI3M 3LHPH 3L3KB 3MV7B 4RQQA 4X9FA 3WFEL 3T2LA 4JKPL 3UJJL 2RD0A 4QY8B 3GB7B 4GQRA 1FNGA 3D85A 4YNYA 1NEUA 2WNGA 4OZHB 4H8WH 1FL3B 5EZOL 3GMQB 4EDWL 1L0PA 3MN8A 4FQIH 4HFUH 2VW4A 1NC2D 2YMXL 2H2SC 3QEQA 1TSRA 1KYDA 5I2IB 2NX5B 4YHPB 2DMCA 1NOFA 3ARFD 2JTYA 4P2OD 2HH0L 1N5AA 1BXUA 2AJ3A 1AFVL 5C0DA 4LDCA 2GJZA 4Z7WE 2RGSA 3Q2LA 4H40A 1DN2A 1S8DB 5KANI 1SYSB 3BD3A 1WHPA 4WJKB 2FNWA 2EO1A 1OW0A 4KHXH 5HDQL 3W39B 2ZD0A 5BRZE 3A6OA 1OQOA 5T3XD 5GS0L 5I24A 3F7VA 3DX9B 2IDCA 2IWGA 2Z35B 3TCLB 3OHXB 4LLQA 5GIRA 1NIFA 5T3ZD 2DV6A 4IOIB 4FFYL 4RBPH 1NIAA 2NTSP 4NN6C 5FECB 2YD0A 3S36L 3TZVA 2GSIB 1M7IB 3MLUL 3BQVA 2WQUA 1NCWH 2ZXCA 4OGYH 4UZSA 1ZLSL 3CSTA 2MNJB 2MPAH 3QULB 3V0HA 3ZPDA 3ZL4H 5AOJA 1JYVA 3HFML 4QRRB 3MUGA 3TP4A 5KSVA 4FQQB 3CXDL 2O5XH 1WT5C 5F7BA 4MAYC 1ZIAA 4ALAC 32C2A 1KELL 2BNQA 2BSSA 4X9YA 5EBLA 4X6CB 2DI7A 2GTZB 1XSIA 3TT3H 3UTSB 5AKSA 3SY6A 5KSBE 3J07A 3C9NB 5ACZA 1Q94B 3F65A 4BIKA 4JPVL 5IT2L 1QA9B 4S11A 2F9BT 5DMIH 3PP4H 5CCJA 2XI9A 1U8OB 2VQ1B 1KWGA 3QUKA 4LPUA 5D6CB 4LU5L 1YZZA 2JCCE 4N0UE 4GEIA 3AROA 1UXSA 1HH9A 1ZA3B 3D3VB 3EJCA 1URZA 3GHBH 4JBSA 3MA9L 3LZQA 2ZUTA 5MERB 4L4VA 1T20B 3TN0B 4JPWH 3WL9B 3TFKC 3V0WH 2E7CA 1NLBL 3SBQA 5GJSL 3SCMA 1J1OL 2DQGH 5ADPH 3ATBA 3DJRA 2AEOA 3MRBA 5K1VA 1AGEA 4Q52A 2X6MA 4R9HA 1SMDA 1WZAA 2ATPA 3JV5A 1OP5K 5H37H 4OJYA 4YSQA 5DLML 3ES6B 3MLPA 3IMTA 5I82A 5CZVL 5TF1L 1KXQE 3O8XC 2XZQL 3IU4H 2JQAA 2L7JA 4MAYB 3IYLW 5CXPA 1H5BB 3ECUA 3GSOA 5FAAA 5CZXC 2IEPA 5T1LD 3CFDA 2XBZA 3NJFA 4N2AA 4HJUA 4K9EL 1CUOA 2RB8A 5MENA 2PYFB 1ETJA 5FOBA 2P48B 1EJFA 1U30A 1DFBL 2WWMD 2X7LB 2WQAA 2XN9D 3GLDA 1MUJA 3EGXB 4JKMA 4KKBD 4M4RB 3P11L 4U0RC 2NY1C 2W91A 4ZOBA 4N26A 3SGEH 1A7QL 4PP1D 3KYOA 2ESVB 1ZGLM 4FCAA 4LSUL 1LNUA 3L4WA 2JLLA 1MCFA 1RZ8A 3D39B 2BRRL 4AGQA 2E4TA 3SQRA 2UYLB 3P9WB 3RVWC 3BUIA 1ZPLA 3GRWL 3JTTB 4F15C 5E1AB 3V8OA 3T3MF 4D0DA 3ULUL 1JDCA 5F7EL 4NPKA 1TTRA 1I7RA 5K33A 2Y7QB 3P4OB 3VXTB 1J05B 4ZSOA 1NGQL 4QKXB 3Q8AA 3B7UX 3N85L 3TVMC 2K6WA 4HCRH 5DJXB 3O8XB 1YN6A 3V4PH 2VDKL 2TRHA 1M2VB 1ZHKB 3NACH 3D7PA 5C0FB 2VH5H 4PH8A 2ZAGA 3QFJB 4H0HB 3DA0A 3AWEA 5BW7C 1ZJAA 3R4RA 1RH8A 3QQ4B 4NQTA 4LCCA 1N5YH 2HAZA 4KJPD 5EOQL 4DIXA 1XB6A 5ALCH 2XG4B 1EXHA 1RFDH 4K3DL 4PPTA 2EXYD 3MMEA 1J10A 2VERA 1YQVH 4CDHA 3PNRB 3U1QA 1PZ3A 1EUTA 2OPCA 4U0RB 1H6UA 3MLZL 4L3CB 1X5AA 4P3WA 3SEPA 2OW7A 4FXLA 4HHWA 1KGCE 3ZE2F 3U4BL 1TYJA 4OR1A 1CGSL 1JK9B 1B0GA 4JFYB 4ZUTA 1U8HB 1MCPH 3LMJL 2CLVA 1G6RB 3C60B 4F15B 3NUKA 2P52A 5HXMA 2VDNH 5I17B 2QZ5A 1XCWA 3KCWA 5B1KA 3NGBC 4NWTH 2DJMA 2VWEE 1KJMB 4JJOA 1IAOA 1OGAE 5C3LD 5EUKB 1JHKH 2VW7A 1BFOB 5TPWH 3VFGH 4GSXA 3IFPA 5CWSB 3EF7A 5HYIA 1NKRA 5E2JA 3TVMB 2Q9OA 2WIIA 4IM8A 3E80A 1IC4H 1C1EH 1OSPH 4BE6A 1F58H 4HX1A 4OJFH 1MXGA 4UI2A 1KPRA 3L5XL 2D03H 5CINH 2HKHH 4FYSA 3GT6A 4R2GC 3D85B 4MZIA 4YNYB 2MKLC 5I75C 4P5RA 3OJMB 2J25A 1J5CA 2KS0A 3WAJA 4MB4A 5LCVH 1SQMA 5AW8B 1YRKA 3GUFA 1F56A 4JG5A 4JLRA 4QTIL 4G6JH 3RWCA 2AV1A 4FQXA 5EU5A 2QPDB 2W9DL 2NR6A 2OLDA 2F19L 1SOQA 5HI4C 1KBGH 2IH3A 5D2LF 1KZYA 4LQFH 2PP8A 4GP8B 1G9NH 1UM6L 4YXLH 1FO0H 4AQ8A 1HQ4A 1QLEB 1CLVA 4XXDA 5JXAL 3SOTA 3CZSA 3PV7A 2CGRL 3BMVA 5BUPA 4Z77B 4J2QA 3NGBB 3PQYB 1VZGA 3KGSA 4N90D 3LVEA 4K5PA 1FF5A 2RIKA 1X5XA 1GGCH 3F7VB 1KNOA 1FZKA 3F5WA 3OGCA 2EDXA 2QVIA 2AITA 5D1ZA 3DUSB 1J0HA 5C0BA 1PKQE 3GPEA 3UCQA 1N4XH 4ZS6D 5HI3C 5GZOD 4KTGA 4R7LA 1AMXA 2OFQA 3HZMB 2A9CA 4ZG1A 5HTSA 3UC2A 4DP4X 1NAKL 1RHHA 4C56D 4R2GB 3V7MA 2X2HA 5F89A 5I75B 1I1CA 4LSPL 4TQPA 3NCMA 4URKA 3MUZ1 4MJ2A 4A39A 3L3IB 4HIPA 4KXBA 5KSVB 3S98A 2XQYG 1YYLH 3QQ9D 3VXMA 2Q3XA 3VDAA 4AWJC 4IEFA 4YHKH 3FUIA 2CG9X 1XF4B 2APWA 2BNRD 4W9HC 4PJFE 4PB9L 3G6DH 5HY9A 1U93A 4XMUA 5EBLB 2VR7A 4KROB 1G1OA 5G4OA 5IWLC 5ACZB 2MCMA 2ZP9A 4KO7A 5ABZA 1U3NA 3DRQB 3QIBC 4LPTA 2B59B 2VXTL 2AQRA 3LZFL 4YHIA 3S8GB 2R1WB 1D7CA 4U1JB 1OPGH 3QUKB 4PW4A 4WDIA 1JTPA 5D71H 3M8OH 1C9SA 3MV8E 3WHE0 3BIKA 1J48A 4WHTB 5DVPA 4XVSH 1I3GH 2PMZA 4BDVA 1JFHA 2UWEA 3CQPA 3HAEB 3HN5A 3I2CL 2Y1ZA 3MYJA 1NFDB 1P7KA 1T1YB 4FKEA 4KRPD 1AGEB 3ZO9A 2VRQA 5CKAA 5KBPA 1P4IH 1MHPL 3V6OA 1QSZA 2EVHA 2ZE0A 5FKPB 4IBUA 4PGDB 1LILA 5DO2D 1AQDA 2FX8L 1OAYH 4YHZL 4XPAL 1X3DA 4FRWA 4BKTC 3UBFA 4TM9A 4J3OD 3GSOB 3FN0L 3KXFA 4K3JL 3PLYA 4PJBF 3CFDB 4JZNB 1EEUA 1IV8A 3HR5A 3CFIC 1YEIL 4OFPA 4RFOH 5MENB 4MJJA 2WYZA 5FOBB 2QV2A 4NI6A 3QIBB 4IRZA 2HTLC 2P45B 5I30H 4GKSB 3EXLA 4YIQB 3LZOA 2AXWA 1MHEA 2BSTA 2FAUA 5J13B 3V6FA 4XNMA 3ZHNA 5C7ZA 4QOKA 1GH7A 1KB9J 3OJDA 4ZW7A 1EEQA 2BO0A 2OMBA 4LF3A 2I60H 5DEFB 3NFPA 2G9KA 2LE9A 4UIMA 1W72H 4NOBA 3ELAT 2OXGA 4ZSOB 4KX7A 3TA3A 3CSPA 5DVMA 4CVWA 4EJ1C 4JFUA 3QDMA 5I1JL 5F1IA 4P23D 2VLKE 2VXQH 3DX3A 3T0ED 4BFKA 3T5WA 3TBTA 3Q5OA 4X4MA 4OIIH 1JDAA 3WJMA 4OF5A 3G04B 1HFUA 5GS0D 4XO4A 2A83B 2D0HA 1H0DA 4CSZA 3S37L 1KY7A 1DYZA 3AACA 4M8RA 4UV7H 1ZGLP 3V95A 3QH3B 4WLCA 1DP0A 1TJGL 2JI3A 1P5UA 4WWPA 4D8PA 2Z7ZA 3WN5A 4YAQA 1XCTA 4YHMH 4Y2DA 3GJFH 3BZFA 3LRLA 5M94B 4GXVL 4KGLA 1QKZH 1U21A 2CBMA 4ZUTB 2ZPKH 1KT2B 1OCWH 2P44B 1LO3H 2XYCA 3C09C 4OQTL 4V1DD 5IMKA 3ZLQC 4X50A 1U8KA 4DN4H 1J0ZA 3MLRL 4PSPA 4I0KA 4OT1L 4WU7A 4FQ1H 1N8ZA 2AK1L 5D1XE 1IAOB 3KBPA 3NJKA 4PG2A 4N1HB 3ZU8A 3K6SA 4Q0XH 1T04A 4N6RA 5SWQB 3BYYA 1U9KA 1KCKA 2WIIB 2X9ZA 4DESA 1OT1A 4UYQA 5AVVB 3VFRA 4ZPTA 1FYHB 1KPRB 3UPRA 1MFCL 2GT9A 3B3IA 4LRIA 4PW9A 3O6FA 4K7PX 3ARGA 2ZUQB 4XBGB 4M9PA 4NC1E 2JB5L 3W9EB 5IVXA 1TOXA 5D7LD 4B9FA 4ES9A 2DQCL 3ZRCC 3DXAD 2QQKH 4JLRB 1Q1PA 4B7IA 1HEJC 3THML 4ZD3L 4FQXB 1E4HA 5J1TC 3QIWD 1TSHA 1MDTA 1LP9F 2CE6A 3FUFA 2IH3B 3CXFA 4AG4L 3C09B 1AGFB 1VERA 2IO5A 2F7QA 2QT6A 1SMOA 2QVKA 2OXHB 3IRCA 1A8ZA 1TQTA 2DOCA 2VR6A 4KVNL 3WIFA 2DQDH 5E4OA 1YUHA 5IJVA 1FNFA 1EERB 3HZYA 5ANHA 4OLUH 2Q3AA 1KNOB 1AXSA 3BVUA 4M6ML 4MCZA 3OGCB 3IDIA 1BQ5A 5D1ZB 1UOVA 1D6VL 1MPAH 3X14B 4JN1H 1G9MC 4X6FB 4FDWA 5C0BB 5F0JB 4A04A 1AE6L 3NIDE 2E47A 4HEME 4U3SA 4UT7L 3E1F1 5I74C 3D30A 3N40F 2C3VB 2EDNA 4PCSA 2Q6WA 4KI5D 5F9OL 5F89B 1JNLH 3BP5B 4U7MA 1AGCA 2ZYIA 3CLFH 4HU8A 4I4WA 4WNQA 2Y5EA 3BGAA 4KJWC 2EVGA 2NY5C 1HINH 1UACL 5AG8A 4MYPA 5I6PA 5IVNA 3HI1A 3ULUD 4RZKA 3RKDD 2HT4D 2YS4A 1ID5I 1S46A 3MKGA 3UACA 3L16A 3AQYA 2A6IA 1QSFE 2ICWB 4BK8A 5C0AD 5HY9B 4N9GB 4NZTH 3QVAA 4KK8D 1CLYH 4NM8H 3AS3A 1MCKA 4JRYE 2W9EH 3UYRH 7PAZA 1SGKA 3ZKND 1BAFL 1QWNA 1A9BA 5F88A 2DJUA 3HLKA 3SDYH 4JRXB 1JE6A 2UXFA 3CFCH 4X5LA 5DZ9A 4LDEB 3JWDC 1MCRA 3K7UA 1IAKA 1MHHA 4WWKC 2MTAA 2EECA 4PD4J 4UM9A 2C9VA 1DVUA 4GW1B 5IGXH 3CPLB 4X98A 2JIXB 2UWEB 4W9ZA 4DK6A 3TT1H 4PJCF 2ZWKA 4K94L 5I74B 1YMME 4DW2H 4ODXB 4FTVE 5GRJH 4NENA 3P77A 4PREB 4L0YA 1G7HA 2EEBA 4RVBA 5IR1B 1LK3H 4NO0D 3VTTA 2YRZA 3OBAA 2R2HB 5H37A 3J2PA 3D34A 2HPTA 4XXCA 3ULVH 2WBWB 1Q9OA 3IVKB 2VDLH 5B3SB 4LDLB 1WFJA 3O3BA 3PHQA 3QUXC 5HYJD 3ZTNL 4YSEA 3VXRE 3KXFB 4FQJH 1QZNA 3DX6A 4FA7B 1MRFH 4HWBL 1PAMA 1ETZA 4NP4H 4YWGL 1KDJA 3HHMA 1HOCA 1SXNA 3T4AA 4EN3D 3SKMB 4FLHA 4OD1L 2NY3B 4MZRA 3FFCA 3MCYA 3MGOB 2ZKHL 3KLHC 4N8VA 5F2FA 4K5MA 1BD2A 4FEIA 1YPZA 2YK1H 5I1LB 4HOWA 2XV2A 4WWKB 2BSTB 4OGZA 3SBWA 3LB6C 4HUWB 2K4AA 4XNMB 1L9RA 2XVBA 1CICD 3OJDB 1MAML 2DLIA 2DTML 3IXTB 1DQTA 2XTJE 3WFBL 3BGMA 3K4AA 2F5BH 3NFPB 3B2VH 5BS0A 4UIMB 1HHHA 4YBQC 2Z7UA 4B95C 1CFNB 1Z3GL 4KK9D 2WAHA 5I6XB 2V17L 5JZ7D 3LNDA 1TCRA 5D7HA 2VZSA 3NCJL 1IGYA 2WVUA 4HCRA 4WVRA 1YYMH 1CLOH 1IGFL 3QUXB 4NT6A 1EXUB 3TBTB 4HIJA 3KPQA 1K6QL 3ZE1B 3NJXA 2G5BA 3S7GA 4JFQB 3SJVD 4F8NA 1E4KA 4PLKD 1L0QA 4Z7WF 2W0KA 2O5NA 8FABA 3RGVA 1I8UA 1KN2H 3EH4B 5EEYA 5FW7A 1P5UB 4DGYL 4NCC2 1BBDH 4D8PB 3VWKC 3GMNB 5IUCA 1JVKA 4Z7UF 1VAHA 2Y07L 3QZOA 4HWZA 3P0VL 4TQHA 1XL6A 1YEEH 3F84A 1VIWA 5I1CH 4OZFG 5LUMA 4EF3A 3QISA 2R15A 1U8KB 1UJ3C 1AR1C 1MJ7H 3SDAC 4WU7B 2E46A 1O5PA 4Q9RL 4HJJH 1RIVH 1RIHH 4HJ0D 2I9LB 4HHGA 4GIOA 1SBSL 1E7UA 3IDXL 3U9UB 2E9IA 3K6SB 4N6RB 5J1SC 1UHVA 2GPZA 4R3SB 3UFIA 2P5WA 3MLSL 1KCBA 1K2DB 3UJTH 3HMWL 3DHMA 1QLRB 1NAML 1PD0A 3IJYA 1BZOA 3S5LG 1W0YT 4PJIB 3ASNB 3O6FB 4YN3A 4AV5A 2HTKD 5IIEA 1X7QA 2GBVA 2R51A 3BPOB 4RGOL 4MCYA 3N43B 4PRIE 4XMKH 4BV1A 2CM6A 1TMQA 4NQXA 5KSBF 3V79C 4XBEH 2BMKA 5K39B 3F7YB 4W9IC 3HZVA 1TFPA 1PZDA 5LCVA 5CIPB 3MXWL 3W5NA 5A3IC 3KPSD 1KWKA 1HKLL 2FD6L 4IBYA 4M7LL 3FCUB 3ILPB 4WY7L 2JCCF 1O7SA 2E6JA 2P7TB 2VLRE 3Q7JA 3V52L 4N3UA 4P4KA 3HUJA 4W9LC 4NQDE 1UOKA 2IH9A 2X41A 5JPNA 3US9A 1FO0A 2ZKXA 1UJ3B 3APCA 2IH8A 4Q9CA 2UZXB 4O9HH 1VFUA 4YZWA 1YUHB 1EO7A 5IJVB 5KVDH 4I2XA 2DIAA 2OMNA 3HZYB 4H8PA 4KNTA 4KH2A 3SKUD 1AXSB 1CF8H 1H3PL 2VITA 4XOCA 1MW3A 2DBJA 1B0IA 3LXBA 3VG9C 2FSEA 4NRYA 4ZAKD 5CR1A 4AYSA 1AG6A 5C08E 2H3NA 3RGBA 1AANA 2P5EB 4HWEL 1I82A 4HWUA 2Q6WB 3W3BA 4AYEC 1AGCB 2UXVA 3L08A 3MRMA 3NRQA 5EIVA 1NFIA 2C9PA 4I4WB 3BKCL 3FFDA 2HVBA 4F7CB 4Y7OC 5IHUH 4UOW1 4F33A 3HI1B 3V0FA 1CJYA 4YZFE 4FG6C 5E5MA 3VGGA 4HU2A 4AEEA 4EI5A 3DO7A 1BXVA 3N1PC 4BCXA 3PAUA 3C5ZC 3NSYA 4TS6A 3O2VL 3EHBD 3SO3C 1BMWA 2Z91A 3ZUNC 3CWGA 3U9PL 5F88B 5IM7A 2WUBL 1E5BA 3CCHA 2ZWLT 2YJLA 1XEDA 3G5WA 4C4UA 3QUGA 3RUGA 1YDPB 3SZ6A 4M62H 3EYOA 3MX0B 1Y0LA 5CILL 1T89A 1RZGB 3IMVA 1H19A 2ZWSA 3LH9A 5BNXD 3VG9B 2Q1EA 1UWYA 2V6HA 4G1MA 2FZ3B 3UBXG 4I3RL 4UAHA 1U4EA 3WXWH 2XQBL 3P77B 4XMLL 1G7HB 5C6PB 1RZQA 1OSZA 4JJHA 3EAKA 4UCFA 4AXWA 1JMXA 4IMLB 1BVOA 3NZHH 2K8QA 4M6NL 2VQUA 4LNVA 4JDEA 1BVZA 4CJ1A 1OARH 1S78D 2CBTA 2B0SH 1GYCA 4NAMA 4PW3A 4YO0A 3KHQA 5AZEH 3RWFB 3PHQB 2HX9A 3MV01 1KFAL 3JWNC 4HS6B 2FGWL 3T8XA 3I74A 3DX6B 1SHXA 1URIA 2UZIL 5DD3L 2ADFH 1J5OH 1E27A 1ETZB 1IAIH 1LEGB 4JHWH 1EAQA 1ID2A 3T4AB 2D2CC 2PWEA 4U2YA 1JCKA 3C2AL 5AAMC 3BN9C 2N1TE 3FFCB 2E7MA 4CVUA 4ZJ9A 4O02H 3IGKA 1RVFH 3IJHB 1P9MA 4JG1H 1YECL 1PD1A 3EO1A 3BEWB 4F7MA 2L7QA 3BUQA 2JELL 1QZ1A 1JPTH 2ZOTA 4Y1AE 4JL1A 2F54A 2I24N 4JPIA 3ZDYF 1VEPA 3OKDA 3R1GL 3BWAB 5EEVA 3L3OC 5FYLE 1R6VA 5DMJB 2WB7A 3U36A 5C7XL 4FXGC 2BOCB 3ZN6A 4CVXA 3NBNA 3MUJA 2CO7A 1HHHB 2IIJA 3NVQA 1W72A 3TONA 5K69A 3TJHC 5B1JA 1TCRB 4F93B 2PYED 3LKOA 1OV8A 2K78A 3QRGL 4LCWD 4KC3B 2VXQA 1U92A 2C4FU 2D7MA 1FORL 3MROB 4FXKC 3EYFA 4PTUB 4HIJB 1FIGL 4FMKA 5HGBA 1E90A 4PRPB 5BRZD 2IAMA 4DK5A 1TETH 3L1OL 1F6FB 1UCBL 4PB0L 4AL8L 2ORBH 1CO1A 4XO8A 4CADA 5DLLA 2YD5A 3MODL 4XC1L 1A6WH 5I1DB 5CFHA 4PSRA 3Q6GH 4ZYKB 2YAOA 2FIRT 4Z0BH 3TBSA 3P4NB 2VMEA 4PJXB 4OUUA 5CU5A 1CR9H 4IJTA 3ZZLA 1UEYA 3OAYK 3GJFA 5FIEA 2VDQH 2G5RA 4IMKC 3L3OB 3MA7B 2YQBA 2VUYA 4K7FA 2GBTA 3TJPA 4FXGB 1QUNA 4B9GA 3JV4B 4XXWA 3KR3H 2IWEA 2DS4A 4WEBL 1K4DA 4LSDA 1UWEL 1JYXA 1KYUA 2EEDA 4WF7A 3DJ9A 1L9OA 2P5WB 4U1GC 4ORGA 4I3SH 3U6RA 3NCYS 3G9VA 2AJUL 2ZX9A 4FXKB 3IJYB 4FHKA 3ZKXB 1QPKA 4WTWA 1IGTB 5EEUA 5C3TA 3TEUA 3GZPA 1X7QB 3MJ6A 1T1XA 1S7XA 1JHLH 1W2KT 4NQXB 4BZYA 2J12B 4XO5A 3T08A 1IEBB 1PFCA 2EJ1A 1K3IA 1NUFA 3HC3L 2R0WH 2DBLL 3U46B 2J5WA 3WGVB 3LD8C 5KW9L 1QNZH 4HT1H 4JO4L 2F7IA 5SWSD 4ODSL 2HWZL 1JF1A 3BDYH 1KCSL 4GAGH 4P4KB 3P0YH 1K9TA 3BSGA 1QFWH 3WUWB 5JPNB 1FO0B 5ICXA 2DJSA 4Y19D 2QTEA 3E3QC 2R4RH 3RPIA 5BZDB 3FAWA 3L4YA 3K71B 1DQLH 3CJJA 2Y06H 3MSPA 1MVYA 5T5NG 4BJLA 4GT7A 4ZXBC 5CCKL 3X3FL 4UB0H 1G7QA 4EUPB 4OF3A 1KTBA 2MOVA 4GG8A 4ZMXA 1A4BA 1XO8A 4X9HA 5A7EA 2FSEB 5AZ2L 1XGTA 4U05A 3O4LD 4KX9A 2MQ0A 4PUBH 2MPVA 4YDIH 2HJLA 3BSZL 3D2TA 3R06B 2VOTA 5ENWB 1BCIA 1NFIB 3CFKB 3FFDB 1Z66A 3FO2A 3MV7E 4N0RA 1XGRA 4F33B 4HDIB 2AK4A 3SPJA 5DHDA 5DRNA 1UZ6E 1U8CA 3AXIA 5SWZA 1VKXA 3DSNA 3I6GA 3D8MA 6PAZA 4L3ED 5E5MB 5FO8B 1X6LA 1I3UA 1A9EA 4EI5B 5A2FA 1GL4B 4GBXC 1B4TA 4TUOA 2HFTA 1SLVA 2IV9A 1JI2A 3U2JA 3IFOB 1BQHB 2Y6SC 2JXMA 4N2BA 5C0RL 3EJZD 4O5LH 2NX5E 4IRSA 3UGUA 5L2KE 3LIZL 4WQOA 2XA8H 5D5MA 4J3TA 4M1GH 2ISDA 1CQYA 3VD3A 2V3FA 5E6SB 4X7DC 3CXHJ 3EYOB 1OM3H 4ZXBB 1Y0LB 1JGVH 1ZHBA 3IMSA 3AM8C 1TZGH 2E9WA 4KKNA 3PWPA 2VO5A 5FOJA 2V37A 5AVWB 2R83A 5EA0H 4G1MB 1B3JA 2YRBA 1RL1A 3L5JA 1CFVH 3BP7B 5D7JA 1UH2A 4XN7A 3FC8A 4AXWB 3US0A 4QF1B 4KTDL 5DUML 3NZ8A 5DEZA 4ZX4A 4FYTA 2Y1AA 1CXKA 3O3EB 4O4YH 3T8XB 4YE4L 5IB5A 2ODIA 2J21A 1P4LA 1DLHB 4KDVA 1UYWL 4DQOL 4F2ME 4GBXB 4MMXC 4CAGA 4QRQB 3DLQR 2CCLA 2Q76B 3ROOA 1NUNB 2CNYA 4YHNA 1K8IB 2AXGA 2HN7B 1KTKE 4OW6A 1M6OA 2OS7A 1YSOA 4KUCD 3KPOB 3FPXA 4NERA 5K9OB 2CJUH 1UD3A 3BISA 3TYGH 3MRNA 4PJ8C 3EADA 2F54B 2ENYA 3B7TA 5DMKA 2Q10A 1TT6A 1EH9A 2YGOA 1P1ZA 5J3HC 2E27L 4MMZA 4QRTA 3PUCA 4M1CC 1I8LC 2A9NH 3A4AA 3FO0H 3FT9A 3GIZL 3QNFA 1A2YB 3VXSE 4MJ4A 3DROA 4XMZA 1W72B 4Z7QE 2ED7A 1E5AA 4A7UA 3BQUC 4CN4A 5CJXC 3QUYA 2X89D 3MJ7A 4JCLA 4XGZA 1IQDB 1WAEA 5M7QA 1U6AH 2KERA 2NXZC 2OCFD 5D72L 2NPLX 2CPUA 1D7BA 3C6SA 4XN4A 4AQAB 4ETQA 3KZ8A 5C1MB 4FLOA 2IAMB 1KLFA 1COBA 4G7YH 4TPRL 4XI5D 2CD0A 3FQWB 1CE1L 4CW1A 2OYLA 3UG5A 2Z65C 3ARDC 4QRPA 1U0QA 1UATA 3O6KL 1NGPH 3NTCH 1FL6A 4HG4K 3QORB 4GRLD 1KXVA 1GHFL 4OUUB 3BFWA 2Y25A 3KYNA 2LLNA 5D6DC 5HHOD 5C9KA 5FM5M 3QAZC 4NUPA 5J6HB 1MRCH 3DVGA 5GS1B 1KULA 4G8IB 5FGCE 5F6IB 2H45A 5DO8A 3P2BA 4B9ZA 3LNFA 3DPDA 1B4LA 2RACA 1R5VA 3GSNH 3NIDF 1CL7H 4DVRH 2X12A 4WJ5A 3GMMB 4OF8A 4G6AD 1J5IA 1XHHA 5GRUH 1EO8H 3H9SE 3LCYA 4JMNA 5IFAH 4Z3FA 1QPPA 1RULH 1JMZA 3JYCA 3BQUB 4NRZA 1NCAL 5J6GA 2XLLA 5ANMA 4HH9A 2NXZB 1NZRA 3PS6A 5DWPA 3FOLA 4XPTL 5DS1A 4Y4KC 2WYIA 3W2DH 1Z0NA 2WBJA 3IXAA 1JPEA 1X7SA 5KZCB 3GSXA 3ARDB 3QDJB 4YSAA 4I89A 4XCCH 1A3LH 3GF8A 3EBIA 3QFJE 3D4CA 4HCGA 4ZUVA 1N26A 1IBYA 3GJEA 1OAUL 3CN1A 2WUCL 3DOHA 3NCCB 4DCQA 3LS4L 4MNQD 2VDPL 4EN2A 3HJ0A 12E8L 2CMRH 3QAZB 3H6JA 4DGVH 1QHPA 4YK4C 4A7GA 2OCJA 4G82A 4P8QA 1R3KA 3WCYA 1CZ8H 3RPIB 1UQSB 1NM9A 1N9PA 3TEXA 1OB1A 2BP8A 3PP3K 2ZSWB 1WCBA 3M7OA 1ZTXH 3DX7A 5BCAA 3H0TA 5KG9B 4OU3A 1QYGL 5HGDA 4DPRA 5C09B 1CT8A 4PJ6A 3UTTE 1A7OH 1KBVA 3KBEA 4HYTB 3GINA 4APQD 1MCHA 2BS71 2G0KA 3VA6A 1E8YA 5DR5L 4LPWA 4BXSV 5AW2B 5GZNC 2AQ2A 3MV11 4Y4KB 1GAFL 1DJGA 2FJFA 1TZIA 4ZRGA 2PXYB 4P99A 2QFRA 1KIPA 3NCFB 4Y8DC 1F02I 5E4AA 1XD0A 4H0IA 5DRNB 4NJAL 1VKXB 1U8CB 1QABA 3WEAA 5EO9A 2FWOA 2P26A 4YDKL 4N3TA 1RMFH 1HYSC 4L18A 4XNXH 1CGYA 5IVZA 3MNWA 3W9DA 3JVFC 4HKZB 1WWAX 3WN6A 2VKWA 2DEYX 4JKWA 3GBNH 1BPLB 1NIDA 4MS8C 4PJ7B 4HIHB 5L0QB 3D4ZA 5GXBB 3QEQE 1T5WB 4FADA 4FP8H 4N0CC 1N59A 4RGND 5D7IA 5D5MB 4JFXA 4HPHA 1GGBL 1MCDA 2Y7OA 3F05A 3FB6A 2NW3A 3X11B 5C0JA 2BIPA 4ONFH 5B1BB 4TLSA 3UTOA 1F13A 2DL9A 2FEEI 3PWPB 4PCYA 2Y5TA 1NMCB 2CR3A 4FG4A 2IG2L 5F21B 4LHUA 4LSRL 3REVB 1WD8A 5KVGL 3DVIA 3T65A 4LPXA 1BG1A 3MOQA 4K23H 5JIPA 1BEXA 1OTTC 3BT2H 2DWDA 3CK0L 4PRBB 1A8JH 1AQMA 1GRWA 3T6ZA 5E8DH 3F7RA 1WA2X 2NT1A 3Q06A 2F53A 1HL9A 3DTXA 2OA9A 5HHMB 4AYBA 2VDLB 1H3VA 3G6AA 5AD0B 4F9LC 4PRAA 3NYKA 3QQDA 3UAEA 1P4LB 1UD5A 3TFBA 3GI9H 3T2PA 3S35L 3ZHDA 1MFVA 4AMKH 4DTGH 4YFEA 3LH2L 1DJSA 2RQEA 3NA9L 1KTRL 5F97E 1R3HA 3VACA 2FUTA 1AI1L 1BQKA 3WIAA 1PZAA 2A77L 1DQKA 1FCGA 2AXGB 5K1NA 2UX6A 1WO2A 5INCA 4POYA 3NZSA 2X2JA 3N50A 4O02A 2FHCA 3NFSH 2BNQE 3M45A 3DIFA 3MRNB 2AERT 1ZPUA 4PJEA 1KB5L 4OGAC 2CRMA 3HLAB 1DDTA 2XETA 3L3JA 3BH8A 1P1ZB 1LO4H 3NEEA 4M00A 2R4SH 3A24A 3D0VA 2BH0A 2CKBB 3EYQC 3ABMB 1KY6A 4U4BA 1MY7A 1P7QD 4PWEA 3CZFA 4JZJC 3S4SB 5I8EA 1NBCA 2EIMB 4K15A 5KJ4A 3V5HA 4L4VE 4JFFE 2VLLB 3U25A 1OGTA 4PJGB 5AW7B 3PNWB 3MDJA 4WO4D 2FX9H 5I8KH 4XGZB 5IEKB 3KDMA 3VD1A 3MOBH 2V8MA 3ZGIA 2X88A 2ITEA 1NEZG 3C6SB 5DK0A 4YX2L 4ETQB 5J89A 1AH1A 2TSBA 1IFHH 1DSWA 2YA0A 3LRKA 1Z9NA 4XVJ