3NJFA

Y26f mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
112
Chain Sequence
QGLAQFIKVNVTLENGEPVFIFTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 18
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njfA00
4E9XA 2FT8A 2J5WA 2WO2B 3WG7B 3G5WA 3WNIA 4AKOA 2BZ7A 2XXGA 1A4BA 1BYOA 3ASOB 4F2EA 3ABKB 1A3ZA 3FSVA 4YSSA 2CJ3A 2BW4A 2XUWA 1SFHA 1SJMA 1WA0X 3OM3B 2EINB 4W9ZA 4YVNA 2YAMA 1ET7A 3EH5B 4NERA 1AS6A 2XV2A 2R7EA 3PLYA 1QLEB 2Q9OA 3N2JA 4KNUA 2XVBA 3OMNB 2HLEB 1DZ0A 1AZCA 2YAPA 1GSKA 1KDIA 3CVBA 3MX0B 3NJHA 1X9RA 3TBBA 1AZRA 4BWTA 2BWDA 4TXVB 5I6MA 1AZNA 4RH4A 5I5MA 4A2EA 1QHQA 2P80D 4GXFA 1PLAA 1NPJA 2EIJB 3TASA 1PNDA 3X2QB 3GXUB 1ET8A 1BEXA 1J9QA 4DP8X 3EH4B 1IKOP 3ASNB 3QJUB 2CCWA 5B1KA 1KCWA 3FU7A 3D12B 3WIAA 1UATA 2WSDA 2UXVA 4QLWA 2R7EB 2Y1AA 2VSKB 2E86A 1JZHA 3ZDWA 3TBCA 2PPCA 2IWEA 4MFHA 2FT7A 3IN2A 1QNIA 1URIA 3NYKA 1MZYA 2PP7A 1B3IA 3AY2A 3QJSB 1NIDA 2EIKB 2PPDA 1NIFA 1JZEA 2J55A 3FPYA 3FQ1A 4M3HA 5F7BA 3NSYA 5PAZA 5B1JC 2YXWA 1AACA 4YSOA 2CAKA 1PZBA 1ET5A 2ZXWB 4WKXA 1BXUA 3ZBMA 4Q89A 3OQRA 2FQFA 2ZWNA 3L45A 4FAAB 2FWLB 3T6XA 1ILSA 1A8ZA 3OMAB 4DPBX 2GSMB 2I7OA 4NB7A 3CVCA 1BQRA 1IBYA 1GW0A 1M57B 1MG3C 1N68A 3T9WA 4E9WA 3C75A 3NJGA 2BP0A 2N0MA 2XX1A 5I6NA 3FSWA 1ASQA 3AG4B 1E5YA 2W8CA 2VMJA 1WS8A 3BVDB 1NIAA 2DYRB 2HRHA 3PAZA 3UGEA 2IWKA 4BWUA 2GC7C 4PAZA 4ENZA 1BQKA 2YARA 2RACA 3N55A 2PLTA 2YAEA 2QDVA 1PAZA 1BQ5A 4HZ1A 4KO9A 3SBPA 2WO3B 2XV3A 1R1CA 3KW7A 4DP7X 4YSDA 4CSPA 5D4HA 1NIEA 2AFNA 3CZUB 2H5UA 5B1JA 1AZUA 4BDVB 2PPEA 5F7AA 4AZUA 4HCFA 1GY1A 3X1NA 4KO5A 3TA4D 1SF5A 2BP0B 3EHBB 4W1TA 4M4RB 1KBWA 2BWIA 3PCYA 1OCCB 2HRGA 1RCYA 4E9RA 2UXFA 1E5ZA 1WA2X 3UACA 3GYRA 1BYPA 1J9TA 1L9QA 1XB3A 1NINA 3NJJA 3X1FA 4JKNA 1NPNA 1L9SA 2H47C 4X4KA 5AKRA 1ASOA 4K9JA 4HAKA 2OCCB 4DP9X 2HZHA 3S3BB 3X1BA 2IWFA 1RKRA 2IDQA 1A4CA 4FA7B 5D4JA 3U25A 5AZUA 2FNWA 3NSDA 1NICA 2IH8A 2GB2A 3T71A 3IN0A 3V9EA 5I6OA 3SBQA 4GP8B 2B3IA 4KNSA 1GY2A 1AOZA 2FQEA 4UAHA 2GI0A 4E9YA 5E9NA 2FQDA 1W6WA 1WA1X 1GS6X 2XWZA 1CUOA 3TU6A 4BXVA 3ZX1A 1ZDQA 5I28A 1PLCA 2XU9A 3FU8A 2PP9A 1IC0A 2ZONA 5I26A 2BP8B 2A3TA 1L9PA 2VSMB 2VM3A 3FU9A 2YAFA 5TK2A 4ZK8A 1PCSA 4A68A 4YSPA 3V9CA 1M56B 1F56A 2XV0A 3QJTB 3HB3B 2AZAA 1OCOB 2W88A 3FQYA 2GC4C 1NZRA 2BHFA 1FWXA 2UXTA 4DP4X 4E9QA 1E65A 2J56A 2Q5BA 4DP0X 1PY0A 3ABLB 2QDWA 3S3CB 3WNJA 2TSBA 1JERA 1EHKB 3AG1B 3FS9A 1RZQA 3UAEA 4N8UA 3NP3A 1NDTA 2P80A 3NJNA 4A67A 2Y69B 1JXFA 2PPAA 1PMYA 3PAVA 2PCYA 2YAOA 4Q8BA 1OE2A 5I5IA 3UADA 4UF7C 3FQ2A 1NWOA 2IDSA 1AR1B 1GS8A 1KYAA 4BDVA 1T5KA 3PXLA 5EHFA 5AFAA 1W8EA 2HXAA 3UAAA 4DP2X 5I6LA 2XX0A 1FFTB 1GR7A 3UABA 4F7KA 2CBPA 1XMEB 3S3DB 4YVUA 1DYZA 6PCYA 1ZV2A 3MBWB 1NWPA 1WAEA 4G7SB 4G71B 1JXDA 3QJVB 3GDCA 1E67A 3T6ZA 1AG0A 4BK5C 5B3SB 3QJQB 1HAUA 4P5RA 1CYXA 3NSFA 3CDZA 1OE1A 3NJFA 4GP4B 2VW6A 3JTBA 1ZDSA 3OMIB 4KOCA 4G7RB 1TU2A 3BQVA 2VW7A 2IDFA 3AG3B 1TEFA 2QT6A 3IBOA 4QKTA 2GHZA 1KCBA 4GY4A 1V54B 2DWSA 2UXGA 3WKPA 1M9WA 1OF0A 1PNCA 2CUAA 7PAZA 4L0PB 1JVLA 1JXGA 1OV8A 2I7SA 1HFUA 1MDAA 1SF3A 2QPDB 2FQGA 4KO7A 3OD3A 1AIZA 4UANA 3X1GA 2PPFA 4NAJA 3FPXA 5I6KA 2VM4A 2MRYA 1KDJA 1L9TA 2EIMB 2XLLA 3CDZB 3H4FA 3AW5A 4YSCA 1ZPUA 1L9OA 3NSCA 2XXFA 4JHVA 2ZOOA 1CC3A 1JOIA 1BXVA 1L9RA 1I53A 2AVFA 2JXMA 3NJMA 2IDUA 1V10A 2JKWA 2BP8A 5I6PA 5ANHA 4AKQA 4AKPA 1SNRA 5D4IA 1AS8A 1XB8A 4WTQA 1YLBB 3JT2A 3EH3B 2FJSA 1SHWA 4E9VA 2QPEB 1ADWA 2DYSB 2YQBA 4HALA 2HX8A 3FYEB 4YSTA 4PCYA 1EZLA 3CG8A 3DIVA 3WKQA 1NIBA 2AZUA 2DV6A 2HX7A 4KOBA 2UX7A 5IY5B 4JHUA 1HAWA 1TEGA 1WS7A 4A2DA 5B7EA 4DPAX 1JZJA 1PZAA 2IH9A 4N4YB 1MG2C 1PZCA 3DTUB 1ASPA 1TKWA 1CURA 1JZFA 2X87A 4G72B 1ETJA 1MZZA 2UX6A 2BZCA 8PAZA 4A66A 3DKHA 1BXAA 3X1EA 4YSUA 3NJLA 2FTAA 2DY2A 2YAQA 4YSRA 1NTDA 2GIMA 6PAZA 1CYWA 1KBVA 2AANA 1AG6A 2MTAA 1W6LA 1OE3A 2H3XC 4KNTA 1AAJA 4A2GA 1GYCA 2XYBA 2BW5A 4E9TA 4YSQA 5FC9A 3AG2B 1A4AA 3S8FB 3FSZA 1J9RA 1VLXA 1ZIBA 9PCYA 2EILB 1AQ8A 2IAAC 2I85A 3FSAA 4A2HA 1JVOA 1IBZA 3ABGA 3SBRA 3FYIB 1BAWA 4A2FA 2VW4A 2TSAA 1ID2A 5B7FA 4GP5B 3RYMA 1N70A 4AX3A 4G7QB 1J9SA 2NRDA 4KO6A 2J57A 3AZUA 3EF4A 2LLNA 4DP1X 1XB6A 4G70B 4BWWA 3H4HA 1PF3A 2FT6A 3ZIYA 3ABMB 3T6VA 3NP4A 2YAHA 4P5SA 3QQXA 1JZGA 3S8GB 1JZIA 4YSAA 3IEAA 3PPSA 3FU7B 4DP6X 3SQRA 1AZBA 2YXVA 5B1AB 1OCRB 1AANA 1V55B 2JFCA 5TK4A 5B1BB 1IUZA 3H56A 3HEIB 4DPCX 1ILUA 3CVDA 1ZIAA 4HCIA 1RZPA 4GYBA 1SFDA 5A7EA 4EF3A 3ERXA 2GBAA 4BXSV 1OOWA 2BO0A 1A65A 1GS7A 3NJKA 4HHGA 4AI7A 3NT0A 1SDDA 3QPKA 4YL4A 1J5DA 4E9SA 4HCGA 4HIPA 4DP5X 1J5CA 2IDTA 5I5JA 2PP8A 3IE9A 4F2FA 1SHXA 2HX9A 1FA4A 1E30A 1KV7A 3NJIA 2OV0A 1AS7A 1X9UA 5B7MA 2X88A 3PAUA 2OJ1A 4YSEA 1KGYE 2DWTA 7PCYA 3QJRB 2CALA 3FT0A 5PCYA 2B08A 2VN3A 5LDUA 1PLBA 2PCFA 4CSZA 1SDDB 3WI9A 3T6WA 4HHWA 3KW8A 1OCZB
chains in the Genus database with same CATH superfamily
5E6RB 3V5DA 1G7PB 1MY7A 5LQBL 2IQAA 1FP5A 2YUXA 35C8H 5IREA 1I3UA 4Z7AA 3S6CA 2YFOA 3GI8H 3UTOA 2IO5A 1SEQH 3W9DB 3UTTD 5DDHA 2BXYA 3CZNA 2XUWA 1IM3B 4FQQA 3EJUA 4C55A 4HEPG 2LW3A 2CUHA 4XMPL 1K5WA 2XNAA 1BJ1H 3AWGA 4JY6A 4XX1G 4EI5D 3GINA 5A16B 3WEXA 2CO3A 5HI5D 3RWIA 1FG2B 2WN3A 4ZMXA 1WITA 2R7EA 2ARJA 1DVFB 5FGBA 4YDJB 3CVBA 2ED7A 2H2SC 4X7CC 4APQC 3KMDA 4X5WA 3BI9X 3GC3A 3TTYA 3IMWA 1QBBA 4R8WH 2L7JA 1IGFL 5JDSA 1G4RA 3QAQA 3K8KA 1NKRA 4M7LT 4R0LA 2HFGL 3FO1B 3WY2A 1HNYA 2D73A 3U9PL 3HNTH 3C5SB 1FFQA 4JFHD 1BZEA 1GKEA 3SE9L 1IQWH 4OY9A 1MQKH 1T4WA 1VFUA 2FJHA 2JJUA 4KDTC 4MNGB 2QVMA 2ZCHL 1UA6H 4XZUB 4KNQA 4GI6A 4H0LC 4GUPA 1BYNA 2EIBA 4EI6A 1G7QB 1KXVA 1NEZA 3Q2WA 4LE8A 3V4VA 5T3ZL 1FVEA 4L3FA 4U1SB 2D31B 3OGCA 1O5PA 3QUZB 3VFWA 5DUJA 3IJ7A 2P43B 4AK2A 4J3WA 3Q6FB 3TBSB 3Q5YA 1WO2A 4LFHG 2KUTA 4X6BA 3VD0A 1DFXA 3I9GL 3RRQA 5CJXC 3H2PA 2A1WL 3PWUB 2CGYA 2VLME 5TGBB 5TE6L 3QDAA 2L0DA 3MBEB 2NT0A 3CAFA 3R4DA 4GOSA 4LOUD 3VWKA 3VXNB 4K3GA 3VW3L 4PJFA 3HJEA 1LE9A 4GSRA 5T1DL 1KC5H 4NQCE 5IEHB 4G42A 2FX7L 4YR6B 3WJMA 3R1GH 4F2MB 5DMKB 1MCPH 3RKPA 4N25A 4OV5A 3GSWB 1KMGA 1RJCA 5I2IB 4ZUVB 1TT6A 4TRPH 5HGGS 4FQJH 3IDNB 4HPOH 2Z35B 4O9HL 1IAIL 1LNUA 2OMTB 3CFCL 2BY0A 2HWZH 2FIRT 1C5DA 2D3LA 4GBXA 4OD3L 4HUXA 2IALB 5IKCA 3K91A 3GHEH 4WFHE 5E2WL 4QHUB 3EYVA 1Q72H 5IB1A 4EPSA 1GJUA 4OM0L 5JO5A 2ZPKL 3BUPA 4WK2B 2IG2H 4X5XA 5C07E 3ZYOA 3SQOH 4KI5E 3B9KA 3U48A 4QJ5B 4Z23A 2WWKO 4NRZA 1NIEA 3HLKA 1J86A 4AXWA 2J4WH 5AW4B 4ZMAT 4MD4A 3N91A 3T3ME 4QHLB 3L2NA 1E4WH 3UDWC 4W9GC 1A0QH 2GITB 3QDGD 5DRXA 3WJLC 4DHLA 4KX7A 4Z77A 4LSRH 2EE0A 1G1YA 5DLLA 4ZI8A 3DO7A 1KBWA 4HS3B 3HLAA 1CXHA 4OFYA 1T0NA 1RCYA 4NUGH 3C6LC 2AK4E 4UT9H 5F1NA 5GGQL 3VFSB 5C08A 1J9TA 1FIGL 1CO1A 1CS6A 3QJZA 1NINA 2DD8L 4WVRA 2J6EH 5F88A 3SO3B 3O8XA 1I9JL 1U8NB 5EIIB 5GGRB 5DRWA 4X4KA 1ZTXH 5J4MA 4XXDB 3BIAX 4HQQL 4WHYH 4XCCL 1MCRA 1F1GA 4DNLA 1HHHB 1YHPA 2B0SL 2H32B 3BKYL 4KKAC 2GQHA 3CSBA 4U1MB 2VDPB 5DHYB 2ESVE 3GMLB 4BK8A 4U1IA 4JW3A 4DVBB 4LQFL 1OAKH 4N0RA 3V7MA 4NQQA 4IU2A 4LGRB 3QCUL 2DQCL 3SBQA 3UPCA 5IROC 4CN4A 2K45A 2BHZA 4Z6AT 2VDPL 2HFFA 2R83A 2H9GB 5T1LA 3FRUB 2AITA 3MFGB 4U1HA 1B90A 2OAAA 2MNUA 5IB3B 3G6DL 3PJNA 2ZP8A 5I1CL 4YDKH 4QHNB 5FCUL 1TJMA 2FSEB 3MNWA 2GIXA 3PV7A 2GTZA 3UTPE 4BCXA 4LEXL 4HX1B 5JIHA 2DMHA 1NMBH 3FB7A 5DVLA 5SWZE 1OK8A 5L88H 1HU8A 5JHDE 1PY0A 1MRFL 4HAGA 2YD4A 5MHSD 2Z91A 2VB5A 4P2QB 5GS0C 3W3BA 1UWEH 2OJZH 1L7IL 3PUCA 2B2XH 4NO2B 4RFNB 3RGVA 5TPWH 3LH8A 3DX6A 3CHSA 1G7JA 1CFTA 1JPSH 1ZSHA 1JWUB 5B8CB 4LIQE 2O93L 1Q9LB 3QC5X 3NTCH 1E2WA 2Y22A 4H1LH 4MMYB 4ANXA 5IV2B 1JZ3A 3FTGB 3EGSA 3ULUE 1P7KB 1K85A 3SDAC 1X6LA 5J12B 4MTMA 2R0WL 2R23B 4N3UA 1U8IA 5GJSH 2VYRE 1OHZA 4M4RA 3UAAA 3T65A 1OAZL 4NNXB 4OLUH 5FGSA 3LMJH 4D9RD 2VM9A 2VC2L 1NKGA 4MXVE 4XC1H 1IT9H 1R0AH 1E40A 4JE0A 4GFTB 1ETA1 2BJMH 3REVA 3L5JA 3ULVE 1U9KA 1MXGA 4L8BB 2HT3C 4QHKI 2VR4A 4UT7H 3O6FB 2VW6A 3RKDD 3L5HA 1CF8H 2XBTA 4HGWA 2RCSH 2K7QA 3KPNB 2JB5L 2HH0L 1DBKH 4U3HA 2O5ZL 2BSBA 5FUOH 5KSAB 1FRGL 5FFOA 2FO4B 4LOVA 3B8YA 3ARED 2IADA 4RZKA 1N59B 3GMNA 4M29A 3VDAA 3B4NA 3SCMC 1OF0A 3FUKA 4N8VA 4IRZH 4I0KA 3KYOA 4LQ1A 1EAPA 3QB7C 5MP6L 3QULB 1JMZA 3HA0A 5F93C 2YZ8A 1KIQA 4JPQA 5D93C 1CT8A 2NSQA 3MRFB 4KY2A 4JDTH 1U8LB 1RK1A 3WKNA 1O6SB 3PHQB 3HC3H 1RJYB 2WKOF 1GCYA 5F1OB 4EN3D 1P7HL 4XCYB 3CDZB 2XLLA 1EUUA 4HKXA 1L7TL 3AW5A 4ZYKA 4UTAL 1J10A 1KCRL 3LDBC 3GS4A 3C60D 3DROB 5CCGE 5HHOD 3VXSB 4RLDA 2B39A 3LNHA 2X0VA 4WRLA 1R24B 1VDGA 2X6VA 1WC7B 4JFTA 5BOJA 4MVBD 5D1ZD 5AAMA 3LS5L 2YXMA 2YQ3A 1JUFB 2UZIH 2Z7UA 4FP8H 3W82A 4Y4FC 3ZQXA 2RMNA 1UD5A 4P4KA 1UACH 2R1WB 1A5FL 4KI5C 3QP3A 3GJFK 3HAEG 1XCTB 5CD5C 1CLZH 1T83C 2OFQA 5DD5H 4URTB 1D5IH 3QEQE 1KTBA 4LLYA 4PCYA 5M7QA 4KY1L 2OZ4L 3CG8A 3Q9PA 4PG9B 1U3JA 3WFZA 2C9RA 3FKUS 4BUHA 3IDXH 3BO8B 3VQ1C 2EE3A 4HOWA 1ZLVK 2A6IB 2WW8A 4HZLA 5FFLA 4O58H 1BAFL 4NRXB 5D96B 5LAXB 5F7DA 3RG1C 4ECNA 5HYQA 1MWAL 1EZSA 2IH9A 2NX5E 3A0OA 3CFQA 4WV1A 2OXHB 3B2MA 3UTTA 1MSPA 2Y07H 2UX6A 1VGKA 4OCNC 1A6TB 1BZDA 1R5VB 2EDMA 2X4SA 4TSAL 1D5BB 3F5WA 4XAKD 1F4XH 3FT3B 3HS0A 5IMOB 4Y4KA 2EEFA 2DY2A 1HH6A 5E6SB 3ZO0A 4EI5A 1ZPLA 3ZDXE 4KKLC 2X3BA 3O3EB 1WD8A 2OMVB 4HLZG 3JV6A 1K3ZA 4F80A 4G11A 4Q6YA 1HKLL 2HVJB 3TO4A 1CFQB 1R3IH 3LZPA 1G1KA 1OAYL 1SMAA 3MRLB 4BKTC 4HIHB 1E6JH 2OMWA 2EE6A 1XEDA 4KAQH 1PLGL 1IL1A 4UTCA 3KBHE 4OSUL 1EHXA 2ATAA 4J3OF 2OPCA 5GRUL 5ICXB 3N50A 1A4KB 3J8F7 1OALA 2BS8A 4WU7A 2FSDA 2WB1A 2VW4A 1C1EH 5CWSA 5B7FA 1UOVA 3MNDA 2IOIA 3DLQR 1XIWB 2WZAA 3S3PA 1UOKA 2QGEA 2JTDA 4JFED 4IRJB 1JNHB 1KN2H 3FFCE 4NKQB 5A2CA 1RZFH 4AYEC 3PGCA 4DN4H 1IGYB 3CVHH 2Q8BH 4JKMA 2JKIS 5AZEL 2PWFA 2VDRL 3ZIYA 3CTTA 3POCA 4ZW5A 1S5HB 2ZF9A 2HTKC 3V5HA 5DK2A 4P5SA 4S2SB 1JZGA 1A22B 5T1MB 2OI9C 2Y72A 3SZ6A 1KJ3H 1GOGA 4HBCL 2BRRH 4DSYA 3EFOB 5B1BB 3FT2B 3ARYA 4KC3B 4LVNC 1QZNA 2CO4A 3CVDA 2ZSWA 5DD6B 5CEYB 3CD4A 4JM4L 2GJZA 3JVGA 5ADOH 1ZLWK 1TPXB 5SWSD 1NBCA 1ZLDA 1MFEH 3MXVL 4L1TA 3GM0A 3LOWA 1CWVA 5K1VA 1SDDA 2WQAA 1EHLH 4NBXB 4JQVA 2OTUB 4HC1L 4ZQKA 3BH9B 4OZIF 4EN3C 2DIAA 3WKMH 5I5JA 5J1TC 2BNQE 1P6WA 4Y1SA 3RTQC 1INDL 3ULUC 4HJEA 2EH7L 2HVKA 4UZUA 2P24B 5JR1L 1SXZA 4J3OD 3LQAC 4AL8H 5F3BB 3N43B 3BKJL 4J1UB 5LVEA 1PZSA 3KBEA 2ZUUA 5DWUL 3RHWK 1PYWA 3GJEA 2OR8A 3NRFA 3L7EB 4KU1A 4RA0C 5B38A 5C0FA 4YBQD 2AXFB 1A8JH 4F37K 1VFOA 4JPIB 3JV4B 3S4SB 2BNUB 2PCFA 1GAFL 4IMKA 4Z3IA 4AM0A 5BZDB 1MFCH 3CMOH 3DECA 4YLQT 1JGUL 3UZEA 3QZOA 3QRGL 1LO5B 2J12B 1P2CB 2A74B 3ASOB 3B2XA 3ABKB 4Y2OB 2PW1B 3ZZSA 4P07A 1C5BL 1ZSDA 3IDIA 4CVXA 4OZGA 1XXDC 2XVLA 4WFEE 3M07A 4YSSA 2CJ3A 3QIWB 3HG5A 3OJMB 1MEXL 4LLMB 3WBDA 3OM3B 1OLLA 1KUMA 1P5UB 4GAFB 4APXB 4YVNA 2BSTA 1AR1D 4XVUD 1JDCA 1JG9A 2C7UA 4UDUA 1CGTA 3N40P 3ZSTA 5CU5A 3ZDYB 1JN6B 5H37G 4O2EA 3RB7A 3NGBB 3ULSA 3MFFB 5C2UB 2FYVA 2FR4B 1DO5A 3DOIA 3O4OB 5CJOL 5DJZA 1P1ZA 4GSQA 5DJ6B 4L05A 1G1CA 1YC7A 1DQQB 4IBSA 4PJGA 3I02B 1KF9B 4TPRL 4XHJD 4NN7C 4XO4A 1SEBB 4QIRA 2AEWA 5DEFB 4CMHB 1CFVL 3NCJH 4FFYA 3IBEA 4YHML 1ODAA 1B4LA 1TDQA 4X50A 5DC9B 5E6IC 3PGFH 1OAQH 2XN0A 3QFDB 5IG7A 4PJ5E 3UIZA 2AV1B 2CE6A 3QIUC 4DP8X 1QWNA 1PG7X 1ZHBA 3RGHA 3VA6A 3AM8A 4YHIB 4U1KA 4JO2H 4HKBA 4HIEB 2VAAA 2UXVA 3WL9A 1NUNB 3TL5A 2RH0A 1N7ML 1JZHA 4J8RA 3VMPA 4OJFH 3RAJL 4IDJH 1B6UA 1NEPA 1EMTH 4C4KO 1XR8B 5EBMA 1E4KA 2E7BA 5IK3B 5JUEL 1A7NL 4GRWE 2X4TA 1U30A 2FATL 4PWKA 5FLVA 5I30H 2W80C 4TUOB 3VXQA 4JRLA 3VCLA 1CK0L 3UCQA 5A7BA 2ZNXA 4K9EC 3VACA 1H3PH 3NRQA 4PRBA 4YUEL 1CGWA 1E7VA 4BQBA 3KL3A 2F54A 2MQCA 2GCYB 3SJVE 3PQYE 3G6JA 2LU7A 1YECL 2P8LA 4OLVL 2X38A 3MRPB 3D0LA 4DCQA 3IJSB 3BC9A 4BEIA 1AC6A 4MJ4A 4Z7WB 2XTJB 2BSCA 1UM5L 5LAPA 3INOA 3QNZB 4NO0A 2WKLA 1TJIL 2M1KA 2XX1A 5JW4N 3AG4B 3U36A 1F42A 3MRDB 3RVWD 4JFXA 5SX5K 3V79C 4N0FA 4HF5H 3EXJA 4Z7VB 3JZ7A 5C0EB 3VXPA 1WFTA 4PBXA 5D7SH 3S88L 2VH5H 2FJFA 3O3AA 1TVHB 2YARA 4I0PD 2AABH 5F1SA 3V5KA 4R90H 5D4QA 4ZX4A 4Y4HB 1U95A 3P4MB 3RFRA 5F8QC 5T5FA 3CBJB 4YSDA 1OSYA 1UXSB 4IIQA 1FPTH 4V1DB 1PL3A 1GRWA 1A3RL 5EFIA 3M45A 4JS7A 4YBQC 3T6QC 3QGVA 2BVTA 1DQIA 2YC1B 1FGVH 1IC5L 2OX5A 5H94A 4BRVA 3V4PA 4MBRA 4WF7A 4LLAA 3A6OA 2XG5A 4S0HA 5F0LB 5E8EB 1OCCB 1LQSR 4X7EC 4F15B 1ZHNA 4R7LA 3QNYA 4RGOH 4AGQA 3BE1L 5ETUB 4KX8A 1BFVL 5EU6D 3HNSH 5FKAA 4AYDC 1WTGT 4KH2A 3AREA 4FJ6A 1G6RA 2XPGA 3LN9A 4JKNA 1WWWX 2EZ0C 3VFTA 2OYPA 4RIRA 3UTQB 1Z9NA 2XIIA 5JHAA 1KJVB 4F9LC 4HT1L 2E27H 3WFBL 2VR9A 3NPZB 2R0LL 3LPPA 4XVUC 1RUML 1ZLUK 5C86A 5DYOA 4TQHA 3H42L 2QLVB 4H7VA 4R3SB 5G4MA 1MIEL 2J8OA 4N9OB 4QGTA 2OSXA 2X1PA 5J57B 4I77L 1HILB 3HKZA 3RPIA 5DJYB 1I8MA 5DT1H 1TOXA 2AKRA 4QYOB 5HHOA 4LPTA 5F1KC 1WZAA 2F0CA 4XHJC 4TTDD 5I6OA 5C0DA 4N1HB 1RHHA 4KXCA 5A6MA 5GHWH 1ZA6B 3D2UD 1R17A 5GIRB 1TMCB 2VZ3A 2A9CA 3OJ2C 1TYEB 3ORJA 1YJDC 2HTLD 2D0GA 1AOZA 4GUQA 1UA7A 2ZWKA 4P9HL 5HD8D 2HLAB 3PY9A 1UHVA 3L95B 1C16B 1CUOA 1AH1A 3OAZK 3RL2B 1ZXKA 4OZFB 5I28A 1AQHA 1IC0A 4H13C 4LZKA 5JW5B 1USZA 3N1MC 1JZ6A 4WO0A 4WWKC 1ITBB 5C70A 5JIKA 4QF1A 2D9CA 2WLLB 3A3YB 4XPAL 2R9HC 2QPSA 1UOLA 1I75A 5E8NB 5FPIA 5ABZA 5HDLA 1QAWA 3GUTA 1JWSA 1KCSH 1QUNA 3DSFL 4OU3A 1G7MB 5ALBL 3FOMB 3T4AB 5CLZA 2NDFA 1HT6A 5HVWA 4PJIE 4DP0X 4LCIL 1PG7L 2VDMB 1RZ8B 4PI0A 2ADFL 1MFAL 4DTGL 4Z9KB 4OGZA 1TZHB 4I18B 1B4JH 4LLQA 3GMOA 4MJ5B 4GS7B 5C0JA 3MLYH 4N87A 2I60H 5IFJB 1AIFB 2RFXB 5C0AB 2VDML 5E4AA 4Z7QE 1TQBC 3U2IA 1NAKL 1YN6A 4N2GA 1SLVA 3MODH 3V8CA 2UWEB 2WAHA 4I85A 3QWOB 1W72B 1NBZA 1LP9B 3W1ZA 3QFGA 2H8PA 1Q9OA 1NCUA 1S4IA 4IOIB 2XI9A 1AXTL 2ZXCA 1QA9A 4G8GA 2CBOA 5IOPA 1KXHA 4FTDA 4TLSA 3CFUA 1AFVH 1ACYH 1A7QL 4U1NA 3VFMB 2XZCL 3I6LD 4FJYA 2K3TA 4PJXE 3WGVB 3MO1A 5DJXB 1IM3D 2C9UA 3MBWB 1S3KH 4N2KA 5FM4A 4KZDL 1UT2A 1UXWA 4JZNB 4JFUA 5T33H 4FG0A 2H6PB 4RAUA 3BT2L 1AO7E 3HMWL 4PVLA 1R9FA 1OWWA 4U6XA 4DO4A 4L4TE 1Z5YD 2BVPA 3O9WB 1M4KA 1X5GA 4IOSD 2IDFA 4XI5C 3UPRB 1DVFD 3UJJH 4NZRH 5D55A 5FS5A 1NL0L 4GY4A 1YSOA 5I1LA 5F7EL 2YEVB 2ZXQA 3TEUA 3GRBA 3APFA 1I7RB 4RVBA 4ZXBB 1CICB 2CBTA 3O2WH 2JQMA 3EOAB 4GQRA 3CXDH 5ESVB 4N0UB 1MDAA 1KJMB 3QI9B 4XMTA 3IVKA 4KO7A 5DLML 5FYJE 3X1GA 1DBML 2EH8H 3O4LA 3NCYP 5T3ZD 5FEBA 3QEGH 3Q8EA 2DQTH 1A9EA 2QQQA 3BAIA 4HUVB 4LVOB 4JN2A 5IW1A 1WHOA 1D6EA 4RMTA 3RNQB 3OXRB 9CGTA 3LPFA 4D0BB 5HJ3A 2XWTB 2K4AA 2X7LA 3MRCA 1TU2B 3GBNL 4JB9L 4NO3B 2D3VA 2CHZA 5E9DB 5A1AA 1MJUL 5DJ2B 3LN4A 1BXVA 2GAZA 4GEJA 4PIRF 1KGUA 2F5BL 3GJFH 2JKTM 1IC1A 4JFDA 4XP4L 5BXFA 4BM7A 3MLXH 3FZUD 4WU5B 4AEEA 4PJBB 3DURB 3L9YA 4S10A 4ZTEA 1U3HA 4R7NB 3OC8A 2WINA 3BVXA 1ZLVH 4FFVD 4FNLL 1OGSA 5I71C 3MBED 1RMFH 5DQDL 2X2YA 32C2B 4AMKH 5KVMC 4GQZA 2DQUL 3DIVA 2H41A 3AWEA 3O6KL 1JWMB 5IWLC 1GIGH 4W81A 1IMHC 2C3HA 1WS7A 4ISVA 2LE9A 3SN6N 3ROOA 4JO3H 4HJSA 3BIKA 4L8DA 1MUJA 5CGBA 4AQ8C 12E8H 1BOYA 2J2ZB 1ECYA 3LIZL 1CDJA 4H8WC 1D3CA 2AJ3B 5LO7A 4PJ7E 3EFFB 1FVDA 2XJLA 1I8LA 1QRNE 1XGPA 3HBQA 4JM2A 3NJLA 4DZ8B 4BFOA 1KBVA 2XIDA 1XF5B 4NJ9L 4IBZA 5CEZE 4HJJH 2DMCA 3AGVA 5FYLH 4JY4B 5LN4A 1A6ZA 2H3NA 5C6WH 4CUCA 5C7XH 2JK5B 2BY3A 1WZMA 4LVHC 1E27B 4DEWA 1AQ8A 3RFZA 1MAJA 3JWNE 4TVSa 1G6VK 5I1AB 2FLBT 3MLUL 4NFCA 3WUWA 2XETA 5IHLB 2Z92B 3BEVA 3AJ7A 4NLHA 2O61A 4W68A 1S9WA 4GXVL 1IAMA 1FBIH 3K2UL 2LU3A 5FKPB 3TBVA 3QXTA 1CPUA 4PV9A 4OM1L 4QO1A 1G43A 1ND0A 3HBZA 1IC4L 5CUSL 1YEGH 1OM9A 1WIUA 2WVVA 1HCFX 4PGBA 3T6VA 1HCZA 4FZEL 5FWRA 2NCMA 1ZANH 2CGRL 3BZEB 5HHQA 3RX5A 2B5IB 1PZ3A 4NQDA 4W9KC 2FLMA 3Q13A 1A21A 2XHNA 1FNGB 3QPQC 4XR8C 1ZLWH 1NLDL 2FX8H 5B1AB 1KB9J 3CN0A 3H56A 1WYJA 4Z18A 2L7EA 3CXFA 2Z31A 3COOA 3O6LL 3S2AA 3KBPA 3NZ8B 1YUHB 1P4BH 3QJHA 5BW7C 2J1ZA 3C5ZC 2ZTBA 2COVD 2X89D 3HG1A 3HRZA 4GG8B 2Q20A 3KL5A 5KVDH 4KUZL 4FMKA 5E70A 5GGUA 1XHHA 1QO3B 4LF3B 1CVRA 2DQHH 4HUWB 1TJGL 3ZKMD 3MBXL 5F7HA 2GJ6E 1JCKA 1RSYA 2AMGA 4DP5X 3OG4B 3QCVH 1U58B 5C8JB 3VD9A 1I9EA 3NFPB 4I1NB 1HXKA 1CTNA 4WEBH 1FA4A 4PJFE 4ZUWA 2FJUB 2V3DA 3MI6A 3O2DA 4YFLF 1KIPB 2MMXA 2VERA 4HPYH 1M6OB 3IMBA 2JIXB 4ZJ9A 1YDPA 1OP9A 5J1SC 1Z9SA 2DWEB 3QJRB 4PG2C 4BZ1A 4OCYL 1M42A 2DKUA 1KCKA 3HI1A 5C0ND 2WBKA 3MJ9L 5EOTB 4FFVC 4FNTA 2Y3NA 1DJWA 2VDKB 4POZC 4EZJA 2YHGA 4RETB 4P2QD 2A83B 5FGCE 5CINL 4XMKL 3TIEA 3ZRFC 5J11B 3O41A 3RWDA 2E56A 2YMXH 5AW3B 3SKOB 5T5NG 4PJCA 5EU6A 2OW6A 4X2UA 4LCWB 5ID1B 1CD0A 5FXCH 1WZKA 4WGKA 3BWUF 1M3JA 2LLLA 5FOBA 3NACH 3GPSA 3G6AA 5EULV 5EZLB 4IU3B 3S37X 3ATFA 1P69B 5BO1L 3IMUA 4JQIA 3HHSA 4HWBH 1WFJA 2YGOA 4PTUA 2BP5M 1IFHL 3N6YA 2NTFB 3HMXL 5MEPA 2N7SA 3UOAB 1NDGB 1QLEB 1T5XB 4BKLB 2H3KA 5KW9H 4XMVA 3VFVB 1D9KC 4KKRA 3S0PA 1X9RA 2GSGB 3AXLB 2J88H 2W0PA 3NIGF 2ZAIA 1XGQA 1E3ZA 2BWDA 3HZYB 1X5MA 4UYQA 5DURB 4G8FA 5C08E 5CBEB 4J3TA 2QKIB 1AE6H 5D72L 4TVPE 2FIKB 1SQ2N 4LHUG 4R97C 1A1MA 4F8OA 3O6FD 2F7RA 2F08A 1U91B 3GTNA 3P0VH 5CFHA 1UZ6F 2TRHA 5CHNA 3D2UA 1LEIA 3OF6D 1DFBL 4ODBD 3GXDA 2VERN 4MA8H 5KSAD 2EJ1A 5B39B 3KYMA 3Q3GA 1IJ9A 5AALA 3P9LA 4ONGL 1UM4L 2WSDA 1MCOL 1U93B 2R1YB 3D50A 4ODVH 4Y1AB 1V05A 3QPXL 3VXMB 1LYQA 5FA3A 1HS6A 4U1GB 1BZ9A 3TT1H 1DN0A 3QA3A 3MJ8B 4BGDA 3CH8A 3V0VB 5EPMA 3IMRA 1NBYA 3US9A 1KIRA 3E38A 3MACL 4O51B 3OJDA 4M5SA 4P5MB 1ORQB 3KPSA 1BD2B 1PZBA 1KZYA 1YYMH 1N67A 1U4FA 4N0CC 5D2LF 5IFHL 2ZWNA 1EPFA 3QHFH 3U9UA 3L45A 4UQ2A 2YQ2A 1JE6A 3NCCB 4IW4C 5GSRA 3VXSD 4A2LA 5L4JA 2FWLB 3RI5K 5INCB 3FQXA 2CLZA 3FMGL 4OTXL 2O30A 4KZ0A 3WFDL 1KYOJ 1NCAH 1FC2D 5SX5H 1GGBH 1UTDA 1NAMH 3CN4A 2FL5A 5ESQB 1A66A 1KENH 3P11H 3S9DB 3C75A 1PFOA 1JTOA 1U8MB 3IS0X 2ITCB 1IZJA 3OHXB 3REWA 4PJEB 4OUUA 3A4AA 4JANA 4PW3A 5FO9B 3JWNC 2PR4H 3PAZA 3RWGA 4BWUA 2DQ6A 3R8QA 4JKPL 3RDTC 2X4NB 4HKZB 2PLTA 5JXED 1G7PA 1OQOA 1Z32X 5EORL 4ZAKD 4F8TA 1Q1JH 2J3SA 4K7PY 4CSPA 3CK0H 4YHYB 5BRZB 3BQUB 4J7RA 4QRUB 2R29H 3EDKA 5CLTA 2AFNA 4LMQE 3W9DA 3VSQA 3NSJA 2OSWA 3T0BA 4K3JL 4L4VA 3MSPA 2EVIA 4LPXA 4LKXB 1IM3A 4KTEL 1YAZA 1V5JA 3OKMA 5F7MC 1JFHA 5TJWK 2CO6B 3TX4A 3WXWH 1MOEA 2AJYH 1SF5A 5DHXB 1AP2A 4PUBH 5DFWH 5A16A 4KBPA 3UACA 1NCJA 5KS9B 1BFTA 2CMRL 1UWXH 2AK1L 1K2DB 3LEXB 1A6WH 4GT0A 3S48A 2AJUH 1AOHA 4JY5H 5BUGA 1SVBA 4Y16B 4Y2NA 5LBGA 4L48A 2WYTA 4F58L 5DMJB 2J1KA 1YQVL 4DVRH 2IXQB 2CJUH 4MCYA 4PCTA 2MCAA 3FO1A 1NBQA 3N43F 3QIBC 2ZNWA 3AQDA 4M6NL 3UJTL 1KXVC 3HHRB 3VXUA 2NQDA 3CU7A 5J12C 4N28A 1CGUA 5D6DC 5LB1A 2OYMA 3UGXA 2F8XC 2C3XA 2XG4B 3ZE2B 3ZYJA 1BP3B 2GEEA 4BQCA 4IRJD 3PG2A 3ESUF 3G5VB 3MRJA 4MNGA 4XX5A 5D1XB 2X28A 4UDTB 1AHKA 2R2BA 3FN0H 4KK5C 4NM4L 5MENE 3T71A 4U1SA 2D31A 2OYKA 3CQPA 2M8XA 3QUZA 1BMGA 2YWYA 3CC1A 1OO2A 5HYSG 5KVFL 5EO0B 3OAZH 1XL4A 2QELA 2B3IA 3TBSA 4AVIA 5KVGH 4UAHA 1WEJH 5CP7A 4F9PC 4XNZB 3PWUA 2C9VA 4Y0GA 4AYID 5LXVA 4NZJA 3BPCB 1OQXA 2DKSA 4G8EB 5E99L 3VXNA 3FDWA 4HXBH 2XICA 2ZONA 2HSIA 1T1YB 2O6CA 4PP2A 1N9PA 4W6XB 5IEHA 4YR6A 4F2MA 3KGSA 5DMKA 3GSWA 4YSPA 5EA0L 2HJKB 4QTHB 1JGVH 4ZUVA 1A1OB 3U79A 4QRRD 1HCVA 3U1SL 4HDIB 3L4CA 4ORZC 4KTDL 2DLFH 4DP4X 3B9KC 4OT1H 4LHJB 4PLKD 4PW4A 1G5GA 1OP5K 3NAAH 3DIFB 2IALA 3WDHA 3CQFA 3D34A 2OP4H 3H8NA 4H40A 2B1HH 4TQEH 2QSQA 4D0CA 3HUJB 5I1JL 3IDMA 1F5WA 3I3BA 3MLZL 3MZGB 5FO7A 1ROWA 3L4XA 2G0KA 2V8MA 2YAOA 4U3CA 4X9FA 1IQDA 3F7VB 4P23C 4AMWA 1JBJA 1Y6NR 3A5VA 2BNRB 4QHLA 2B59B 4L9LB 2JKRM 1EFQA 2IBZX 2WP3T 3PUUA 7TAAA 3W11C 4K5LA 2AGJH 2GITA 4P8QA 3V0FA 3W37A 1M9SA 3UC0H 1I8IB 4WUUB 4BHUA 1EZVX 1BX2A 3GXFA 3WE6B 4DKFH 4HS3A 35C8L 2L4OA 2DI8A 4K5PA 4KXAA 1SOKA 4ZAKC 3GI8L 3MXWH 2QGCA 3VFSA 2CBPA 5LBVA 1UG9A 3B9VA 3QIWD 1OW0C 5HYJA 2DM2A 2FGWH 5B3SB 3T6ZA 3MA9H 1BGXH 1OARH 3QJQB 4HU8A 3H53A 3HE7B 4F91B 5FW8A 1EK3A 5GGRA 5JORB 1CZ8H 2GG1A 2HN7B 1E6OH 1CGXA 4KOCA 4Z7WF 1V7ML 3LNEA 3L7FA 4R83A 1X5YA 2QT6A 1MRDH 4KHXL 2IOMA 1KFGA 2BPBA 2W9EH 5EOCH 2O5YH 1MNNA 2H32A 1M9WA 1VF5C 4HV8B 4Z7VF 3VG0H 4R8WL 1HYSD 2DDQH 4U1MA 5I1GH 4I3SH 1HKFA 5DHYA 3GMLA 1WWBX 4GB9A 1UEYA 1D6VH 1JXGA 1K8IB 2Q7YA 4MLIA 4Y5YB 5IVZB 2C9SA 4DVBA 5I23A 3HNTL 3KYAA 3ZE1B 2Y0SA 3NCYS 1QPXA 3ZDZB 2X4PB 1MQKL 5HHPB 4L1DA 4IRSC 4E5XA 2H9GA 1E43A 1L0YA 1UA6L 4KJWD 1NANI 1T0OA 1L6XA 1AGCA 2ZOOA 4PRNB 5DD1H 3FUJA 1XF1A 3H9SA 2FCBA 3KPRA 5HTSA 2MOVA 3BPLB 4ENED 1L9NA 4ZX6A 3V6BR 4QHNA 4JG5A 4LP8A 2FSEA 2A9NH 3OKOA 2VL5B 1YLBB 5D6CB 4A37A 2GJJA 5JMOC 4H8UA 2N1TE 1T6WA 2YQBA 2BFGA 3KPQA 2KBGA 1C8QA 3S36H 3JYBA 2X4QA 4M9OA 4PSPA 2NY4D 4MQTB 3SPIA 1NIBA 4PRHB 3NZHH 1KC5L 3SE6A 4IBUA 1LWHA 1IBBA 1TPXC 1M1XB 2Y7QB 3R1GL 4KJPD 1MCPL 2DAVA 3AT9A 4NZFA 4XC3H 4BUGA 4BFIA 4NO2A 1C8PA 1NC2B 1UUSA 1WF5A 1JZJA 2PXYC 1JGIA 1JWUA 2XTJD 4FQJL 4HPOL 4GIOA 4BINA 4AYFB 1Q9LA 1YYCA 4JPVH 5EB9A 1ETJA 4WENB 2HWZL 2WAQA 1HDMB 8PAZA 4ELKB 5IV2A 5JPNB 3GXPA 3LPGA 2WTPA 1P7KA 1TETL 1T1WA 1WBZB 2JCCA 4PLKC 3UYRH 3DX4A 2ICWJ 3GHEL 4G6AD 3FRPG 3SE4A 4J3XA 4LNVA 1Q72L 4E42A 4Y4HD 4PJHB 3D9AL 5HDQH 2FHFA 4X6EA 1T2XA 1GHFH 2GTQA 5E6UB 3X13B 3IAGC 4XOBA 3E2HC 5TE4H 2IG2L 4I4WB 1ZS2A 2UYLB 3SQOL 3LNIA 4V1DD 1RJLB 2AJSH 3D4YA 2J4WL 4OZGE 2V2WB 3HR5A 5DZLA 3RL1B 3ABGA 1E4WL 4MXQC 1A0QL 1ITCA 1NSNH 4OF3A 5D1QB 3UG5A 4R5TA 3RZWA 4LSRL 5F6IB 5EEYA 4OFPA 2W60B 2DL2A 4L29A 4J2QA 2HUHA 4RMBA 3HI6H 1CFNB 2C9PA 4UT9L 1IVLA 4DP1X 1ULVA 2FO4A 5HI4D 2E9BA 2W9LA 3AU1B 3ABMB 3LN5B 4KK6D 4PJGE 3X11B 3QULA 5T1KA 2IFGA 2JWYA 3G04B 3S8GB 4XNYH 1A6PA 3EG9B 4X4MA 1RJYA 4XN4A 3WOVA 1J0JA 2VLKB 3JZYA 3ZKSD 2AMUA 3V6OE 1IUZA 4XCYA 1B6DA 1ZIAA 1LP9F 1KPVA 3FUMA 2R39A 2ZG1A 1DVUA 3MOAL 3DROA 3VXSA 1I7UB 3FQWB 4OGYH 1OAKL 2EXTA 5EU5B 4Z7UF 4WI0B 5ESAB 1JUFA 2Y1ZA 2VR8A 4EDXB 1XD1A 5AL0A 1MJ7H 4HIPA 3MYZA 4GIPD 4OCSH 4KMQA 1J5CA 4GMTH 1XCTA 5B22A 4B7LA 1U8PA 1I1FB 1F97A 3I85A 1KT2B 1T0PB 3D09A 3K1DA 4HFUL 4U0QB 3MN8A 3GGWB 1MQ8A 4ZODA 2F54E 5DJAA 5JXEA 1QFWM 3V10A 4Y4KC 3G6JE 1W0YT 2A6IA 4OJEH 4JRXB 2NYYD 3FB6B 4KRMB 2A9AA 4NRXA 5LAXA 4XVSH 4R4ND 2YPKB 3KJ6H 4BYHA 2HUEA 3AITA 2XA8H 3TO4C 3UPAA 4AENA 3T6WA 5L88L 1A6TA 1MDTA 3FBQA 1R5VA 1OCZB 2WZPA 4PRDB 4BIKA 1P6FA 2OJZL 1UWEL 2NY4C 3P40A 4H1LB 1TR7A 3JTSB 1I1AB 1WFUA 3NCEB 4G1EA 2B2XL 2WCPA 2OMVA 5TPWL 2BC4A 1UB5B 1JPSL 4M61B 2HVJA 5C0AD 4N2DA 3FSVA 1CFQA 3IETB 2YQGA 2O72A 5E4EC 4AEFA 3PNWB 3MRLA 1BZ7A 4X5RA 5F96L 4W9ZA 4XP1H 1SYVA 4NNYB 4P2CG 1LL1A 2BLFA 5E95B 1UVQA 2BH0A 4NN6B 4D7PA 3BPNB 4PJBF 1COBA 1A4KA 5FUCE 4LK4A 1K72A 1MHHA 2A73B 3IDGB 1QFWH 4G6AC 5GJSL 2HLEB 3BP7A 3GBEA 1S7SB 5M94B 1PSKL 1XIWA 5HJBA 5D8JH 5AOIA 2LTQB 2LV4A 3LMJL 3DARA 1JNHA 43C9B 2EQDA 3BP4B 3NJXA 4Z3GA 5E5LA 4XC1L 1NUDA 1GMEA 2X9YA 5KYWA 1J0IA 4TS6A 1R0AL 2BJML 2CDGB 3F6LA 1IGYA 3DETD 3BAXA 3ZT5A 2BXZA 2DH2A 4UT7L 4XPBH 3EBAA 4N9GB 2EXWD 2IJ0C 3JVGC 1CF8L 1J9QA 3ZL4H 3O9WD 2RCSL 1E9PA 1XR9B 3QJUB 1Q0YH 5LG6A 3E6HA 4M6MH 4Y1TA 1KCWA 5J6HB 3AXIA 1A7RH 5FUOL 2D7TH 3EFOA 3GKWH 3FT2A 2TRYA 4NQUA 4Y7OC 1HTYA 1FZMB 1CICD 1PVHA 4IRZL 4ZXBD 3RUGF 3ZDWA 1URIA 4JHZA 4U3XA 2WZ6A 2MHAB 4OJYA 1FV1B 5HHOE 1PDKB 3QI9D 3TBTB 1B0WA 3MMEB 3FQ1A 3HC3L 1R3JA 1HWGB 3QE5A 5HPMA 4OCLC 3UZVB 3ZKXB 3M88A 5E51A 4PN6A 2OTUA 3BH9A 1LTXA 3II3A 4Y9FA 1OGPA 1OANA 3LPWA 4HJTA 1M7DA 4H26B 3GEWB 2Q1EA 3VXUB 3BUYA 3CHRA 1ILSA 1WHPA 1A8ZA 3WO4C 4ZFZA 2E7DA 4P9HC 2P24A 5I82A 3FQTB 2NCEA 2P5EB 1FZOB 1B4RA 3ATDA 4J1UA 5JZ7C 4FP8L 4NUQA 2IV8A 1SN0A 3QR1A 1UACL 4JRFA 3ESPA 3F83A 3TFKD 5B1CA 1ZHKB 3LXBA 2AXFA 4FFTA 4HGKC 2H7WA 4ZS6C 3CJJA 5GGVH 1FLRL 4KJQC 5DD5L 3S4SA 3PABA 5JQHC 1S8DB 1D5IL 4OJAA 4G6JH 5BZDA 1GGCL 1VADB 3QZBA 1RZGB 4KFMA 1Y6KR 1OGAB 1KIUB 1PAZA 2VDLB 4XAKE 3IDXL 1U92B 1KBBA 1LO5A 4B9YA 1P2CA 2KZBA 2XC8A 2P5WB 4HFWB 2O6PA 2PW1A 2NW3B 1N8ZA 1AXSA 1YY8B 3L5WB 4XVJH 4YHOH 4FYSA 1SZNA 4C4UA 2E7LA 4LLMA 4X83A 3ZTDC 1ODUA 3T4AC 5FECB 1RK0A 2FECL 1F4XL 2ZX8A 3IDUA 5J3HC 2F2HA 3IFPB 2VISA 4LIQH 3AT8A 1IM9B 4NO5B 3CVIH 1E5ZA 1J88A 4WI9A 4U7MA 4HETA 3U0TB 4C47A 1RH8A 3VD1A 4I18C 1CTOA 4G8GE 4HMDA 3KPMA 2W9DH 4GS7C 1D7FA 1IAOA 3I3DA 3ULUH 1R3IL 4ZMTA 3V6OC 5AOJA 4KAQL 5DJ6A 1DQQA 3K4AA 3I02A 3CHQA 4LAQH 1NCHA 5DEFA 4KWUA 1NFDB 4X9YA 4IYKA 1C1EL 3OG6B 4AZ8B 3QFDA 5D5ME 4WTZG 4Q9QH 4IIZA 1WAPA 3X1BA 1T6VN 3ULVH 2OL3A 2CXKA 3BUDA 2Q8AL 5BS0D 1KN2L 5D70H 5AZUA 1KB9K 3IDYC 1VGEL 1BVLB 1RZFL 1YEFH 4TQ8A 3T0XA 3QEUB 4DN4L 2F5AH 4J8QA 1P4LA 2FHBA 2IH8A 3CVHL 2Q8BL 1IAKB 3DETC 5BNXD 5LCVL 1XR8A 4L3CB 1T2QH 1KULA 4QRBA 2DTML 3ZL1A 2WXGA 1ZGLA 5IK3A 5KBMA 3O4LE 4TUOA 4Y2DD 4CL7A 1RFDH 2VLJB 3MGOB 1A64A 4ACPA 2XZAH 4C54A 5IBLD 4PS7A 1FYTB 2DM4A 4KRLB 1A25A 2ATKB 5ADOL 4AVKA 3GSOB 4PBVC 3BEWB 2BP8B 2A3TA 3F65A 3ZLQC 1XBDA 3QR2A 4WO4A 2GCYA 4DZBB 4JFDE 4LRIC 3T0WA 1AJ7H 1J5OH 1T7XA 4IQHA 3MRPA 3IJSA 1EHLL 2ODIA 3FQYA 4ILDA 3QNZA 1FWXA 1E65A 2EDQA 4IIQC 3LSOB 4F7PB 4OGXL 5ADPH 1BW8A 2AAAA 1M6UA 2BIQA 1TVHA 3BGFC 5FUCC 4K55A 3WE1A 3TLRA 2J73A 2FYYB 3P4MA 1DHKA 4IKKA 2HKFH 2X3AA 4Y7MA 3MV7E 2JIXD 1LO2H 1II4E 4N22A 1XCXA 4OQTH 3T3PB 3DX2A 4G1MA 1JFQH 2DB8A 3N1PC 5FIEA 4EZMA 1BVKB 2FLRT 4V1DA 3VWJB 1YA5A 2BFVH 2ERJC 4L2LA 4EIBA 2XWEA 5KJRL 2WQXA 2YLHA 2L04A 2YBGA 2VR5A 2Z7WA 1GC1H 1MFCL 4HP5A 3NCWA 2WNXA 1CU4H 4OF5A 4QDGA 4DQOH 4HG4K 3TYGL 4K9EH 3VG9B 5I76B 3MNVB 2VLLB 3FB8B 1AHMA 4FTVA 3HC0B 4UT6H 4LCWD 1KB5A 5ECJE 1I7ZB 3MUUA 4OVUA 5HDBF 1SJVA 1AG0A 3FO2B 1DCLA 1CYXA 1TJXA 3ARFB 3BVTA 5E5MB 3UTQA 1KJVA 1ZDSA 2SEBB 4LDLB 1S78C 3ZOAA 1H8SA 3L8QA 4CNIB 5L2KA 3RBGA 2BVQB 3EDJA 1EJ8A 3IBOA 2VLRA 5KN5B 5IOKA 4KVPA 4PHXA 4PJEF 4QGYA 3OR6B 4PEEA 3SGEH 5DURD 4NZUL 1NEZG 5EUOA 1MLCB 2GFBB 4PP1D 3NZSA 1HILA 2WBXA 2ZIDA 1G84A 5DJYA 1I82A 1WFNA 2PTUA 4PVMA 3NCJL 3HS9A 3NQKA 4TNWK 2P44B 3CZLA 5LNGA 3A21A 5LNDA 1OAQL 3NVQA 3BP5B 3RBSA 4ZQTA 4QT5A 1Q94A 1T5WB 5BCAA 5I6KA 4NQDE 4IOFD 4NC0B 1KDJA 3LKRB 3GRWA 4MCMA 4HK3N 4JO2L 2G2RB 3IGFA 2GKIA 4Q7DA 4MAYA 4MBOA 2XXFA 4XNUH 4Y1AD 1RUQH 3L95A 4WW1B 3VXMD 4ZMPA 4OJFL 1GKOA 5FYJU 1JCVA 3VM5A 4ALAC 3N5AA 4IDJL 5EF3A 2CKBH 2O5NA 5KS9F 1CIDA 3UP6A 5JW5A 3TEXA 5SX4I 4WW2C 2NLJB 3NIFE 1BFOB 3GLDA 3P4OB 3NEOA 3HG1E 5J6GB 1QTYT 5DUMH 2YEZB 2R4RL 2CIIB 1RZIB 2X2HA 4PSRA 5E8NA 1BD2D 4Y2DC 4B9KC 3FCTB 5CP3H 1G7MA 2IDCA 3FOMA 4F8NA 1H3PL 5I1KH 1JL8A 3BSHA 5IBLC 3GDBA 3V0GA 4GSDH 2E76C 1BIIB 3OPUA 4X7TB 1RZ8A 2XA3A 1T2JA 4FG2A 1USQA 1MLBB 4CU8A 4BFBD 1OVZA 3GZOA 1SJHA 3HBPA 5ID0B 2X40A 5BVPH 4N4YB 5IFJA 1TQSA 3GIVB 3OR7A 2EADA 2RFXA 3FULA 5C0AA 5I16B 4R26H 3KYKH 3RIKA 5KVFE 1S46A 3BJLA 1WBYA 4TQPA 4DO6A 2V37A 3AS0A 2J5LC 3CHPA 3CZFB 3EAKA 3DMMB 5IW6B 2UWEA 4O2CA 3QWOA 1AD9B 1W72A 4UM9B 1YJDH 2GIMA 2AANA 1P84J 2OQJB 5D7SL 2VH5L 2OL3L 1DSFL 4WY7L 2AABL 4R90L 4IOIA 2OYLA 3HG4A 5IVXB 1J1XH 3P3YA 1XGZA 4J4PD 3CLFH 5BRZD 2VMFA 1A4AA 3BQUD 3S8FB 3I3EA 1ZIBA 1NFIB 3FSAA 2XKUA 4OCWH 1OLZA 4ODWB 4PJCE 3S97C 2XWXA 5DJ0B 5DJXA 1AGDB 1A4JB 4UM8B 1FGVL 5DR5H 4AG4H 2H6PA 5GSVB 1BAWA 3INUH 2TSAA 4AYBA 1MH5A 2N7AA 3O9WA 1UD8A 4KV5F 4P4RA 3UGUA 2ZXEB 4JCWA 4RGOL 4B9JA 4HIIB 5CIPH 3TN0B 4KI1A 7CGTA 2O4EA 4N26A 4Y5XB 3WIHA 1I7RA 1R19A 2W0FA 3GMMB 3BZFB 5KYYB 3EOAA 3U9WA 1V3MA 3HUJF 4YO0B 2E27L 5ESVA 4N0UA 3AACA 3DRQB 2WBJC 4JDEA 1KJMA 1MCJA 3QI9A 3IEAA 1F4YH 1V55B 4XAWL 4HUVA 5CZXD 3PL6B 4NBZB 3RNQA 3VRJA 5D1XD 2HLFD 1HQRA 2HT2C 1VEOA 1GA2A 4GYBA 1U3HC 5E9DA 4NO3A 2BWQA 3VFPA 4UAOC 3HAEA 5DT1L 4PP1C 4UOW0 4EF3A 3ABZA 1B4TA 3P3RA 5CD3B 1JPEA 4UIKH 1RK7A 1ES0A 4JFSA 4FF9A 2A5UA 4F8LA 4LSSH 5GHWL 5JHLL 1M7IB 4WU5A 4OFQA 4XPTH 3DURA 3FO9B 4ZOBA 1P7QB 4R7NA 5IF0B 3P30H 1GPOH 3KPSE 4ZDHB 4AIZB 3R19A 3QUGA 2RGSA 4KMTL 4H2CA 2BK8A 3Q01A 4GRWH 1I85A 2PKDA 32C2A 3NCXA 1E30A 1K8DB 4WEEA 4NHCL 3MRNA 3ATEA 4WZ9A 3NJIA 1TTRA 1LK3H 1HXMB 1JWMA 1X7TA 3SQBB 5B7MA 4A55A 2MOQA 4FYRA 4GKNB 1KTKE 5I66B 3UO8B 2X1WL 1BQLL 3MUY1 1IILE 5J89A 1AI1H 3BN3B 2Z65C 3ZE1F 2A0LC 3ZDZF 2FT8A 2WO2B 2YPLD 3LXUX 3IXAB 3D3VD 4MCZB 5DSCA 4Z8FH 3K4DA 1B4JL 1R3HB 5IT2H 4P5TB 3MLYL 4JY4A 2I60L 3EYUH 1A3ZA 2MPAH 1PW3A 2DEXX 4ZD3H 2JK5A 1JDDA 4JN1H 1MREH 3FL7A 4JZJB 1JNNH 4JFOB 2BNRD 3MODL 3SOTA 1GOHA 3I6LE 4L4VE 5FO8B 1XO8A 2HAZA 3FUNA 1VRSA 3BPOB 4EO5A 1U8CB 1VFMA 4U0RC 2JI2A 4WUUD 2Z92A 2C4XA 2WHVA 5C9JB 4MAZA 3A6BH 1AFVL 1ACYL 2ICEA 4QTIH 4WWNA 4UWQB 1EO8H 2ZCKL 4JPKH 2VDOB 4P9MH 4QOKA 5FKPA 4RH4A 1S3KL 4GXFA 1EEYB 2AI0H 3CX2A 3U46B 3RLSA 5T33L 3HE7D 4XP6L 4U6YB 4TOYH 2CQVA 5EBWB 4F8PA 2Q3XA 4H8WH 3N04A 4NWUH 3K0YA 1AQKH 4HCRH 2O5XH 5J1AA 4NSKB 5BV7H 1ED3B 1F4AA 1FNGA 3U0WL 4NZRL 1AMXA 2G4EA 5BJTA 2XPYA 5D7HA 3B2VH 5FV2A 1FNSH 4R7DA 1URLA 5EEVA 3KDMB 4PJHF 3H3PH 3O2WL 1HH9A 2ITEA 3BESR 1NIDA 4LRNH 5JNYB 3LV3A 4F7MA 4ZMQA 2EECA 4GG8A 4M3HA 1J8HB 5LQBH 3DVNB 5KTEH 5B1JC 3QEGL 2YXWA 2WUCL 4MYPA 2DQTL 1QO3A 2EDTA 4LF3A 4WIQA 1MHPH 4HUWA 3BCDA 4GSUA 2CAKA 3VNYA 4A7QA 5L0QC 3LZQA 2PR9A 4RGMB 5LGYA 5CZXC 1U58A 5C8JA 4FX5A 1UZ8B 2EC9T 2JELH 3QARA 4U1JA 3ZRCC 2OJEB 3SDXA 1X7QB 1ZCRA 1CI5A 4XB7A 4GW1A 3CVCA 4HH9B 3MLXL 1N68A 4F2ME 1KIPA 2MWCA 1M6OA 2JIXA 2DWEA 5I6NA 3FSWA 4KQ4H 4ABQA 2NY3C 4AGPA 4HD9A 1AD0B 3CFJA 5DEGB 2HRHA 4XMLH 1IGFH 1RMFL 2QKSA 1TQCC 4X6CA 4AMKL 4PRHD 4FQPA 3NDYE 1TCRB 2G3ZA 3KZ8A 3EYFB 1QABA 1DUZA 1FNEB 1NC2D 1NFKA 1B9KA 1WH0A 3EYOB 4JO3L 5H37A 4X8XA 2UVFA 3SKOA 4I9WD 3MU3A 4LCWA 4OZHF 3X12B 1HHGB 2MCPH 1IAIM 3EH1A 5ID1A 5KVEE 4BRJA 4G43B 3RIAF 4YLBA 2EVFA 3EJCA 1FSKC 2M26A 2QQKL 1IIIA 3IAPA 3MRIA 4IU3A 5EUKA 4WWID 3A4DA 3QUMA 6TAAA 2CHNA 1WFOA 2NTFA 1WA2X 3C2AH 3ARXA 1H3TA 3GFUA 1G0YR 5DVPA 5FYLL 5L4FA 3EH2A 1QSED 2HYMA 3GXNA 3M8OH 5C7XL 2Y2WA 3AXLA 4HIJB 2J8UA 3HZYA 4QRTB 4RDQG 4TKWA 1TFPA 2ZUYA 5CBEA 2IEPA 1L9SA 5FGRA 4ZO6A 1R33A 5HYJE 4Z0BL 2FIKA 3QORB 3CFEB 5D1QD 5D7IA 4L9LC 5AB2A 3O3BB 4B97A 1JZ5A 2FZ3A 5T1DH 2WQVA 1OTTD 2ISDA 2C34A 3UTZB 5IJCC 5BZXA 2X4OA 4OFIA 1A4CA 3GSNH 5GQBA 2DLTA 4A1RA 5B39A 1FBIL 1SXNA 4X80H 4O9HH 1IAIH 4DOHE 1GTFA 2XN9A 5IUSA 3TESA 1U93A 2R1YA 3EBIA 4Y1AA 1YEGL 3O11A 4OD3H 1OP3K 2N0KA 3ZTCC 5LXGH 4QEGA 1NCCL 2VQ1B 2AQPA 2ZD0A 3V0VA 5I8CB 1MCHA 2M83A 5AW7B 4MRCA 2ZPKH 2VLKD 3L1EA 4B9CA 4O51A 3VFRB 5FF6A 3K8LA 1ORQA 3F12B 4IJ3B 2LHAA 3ARBD 4BXVA 4FS0A 4FFWC 2VZUA 4YWGH 2ZXBA 5FW6A 5FYJH 4JREB 3VVVA 5I15H 1P4BL 2WIMA 3LB6D 3H9HB 5INCA 4QKXB 1PCSA 3H9SE 4A68A 2EO7A 1DCEA 2OR9H 3KPRE 2H2PC 4MXWL 3K0WA 3B3IB 5KVDL 8FABB 1FHGA 5B38G 4PTTB 3FQUA 4OFVA 5ESQA 4F3FB 2DQHL 5I1IL 3B7SA 5EZJB 3IFLH 3MGTB 4E9QA 2ZSVA 1FIGH 5I0XA 2YRZA 5CKGA 2VUYA 3QCVL 4YDZA 4Z7OB 3BZ4A 3OHXA 2WNWA 3L3OB 1CN4A 3O3DA 3B2UC 2TSBA 5FO9A 1DQJB 4CADB 3FS9A 4WEBL 4CU6A 1K4DA 2X4NA 3QZMA 4HJIA 4NN5C 3HJ0A 4H8PA 4ZO9A 3P77B 4MJID 3QQ3B 3BPLC 4BBWA 4HPYL 4HQQH 4JRXD 3TH2T 5E08L 4J4PA 2J72A 1THAA 3BZ5A 2XY1A 3BQUA 1CE1H 3IF1B 3BKYH 2HJLB 5IHBA 2ZUVA 1URZA 2EKSA 3TF4A 3QUXD 3NEXA 1H5BB 4LKXA 2ATPA 3GSUB 3ZHDA 1S7UB 3KLLA 3M7OA 1U36A 2CO6A 1CJYA 5AFAA 1Q0XH 3PJSB 2JCCE 3R06B 3V8OA 1I1AD 3D87B 2BDNH 4OBSA 5HGHB 4R5VA 2EYRA 1N0XH 4FQLH 3CGTA 3K74B 1SDYA 2YMXL 2IFFH 4G80B 4N6QA 2ADGB 3QDME 4IJTA 3K6IA 5F97E 3BD4A 4YDIH 1K2DA 1L3NA 2NDGA 4Y16A 1QOKA 2A4CA 5CEZH 4KRPB 4WFGE 3NACL 1UJ3C 5LUMA 5GGSB 2IXQA 3ROLA 1NMCB 3JTBA 2WZ0A 3KG5A 5I1CH 3VTAA 2A9DA 3WXVL 4GAYB 2VXQA 1LK2B 2EIEA 3DUSA 3II1A 5KW9L 2QADB 3JWNH 3PWPA 2XG4A 4A7GA 4L8SC 3DWTA 4EUPB 3G5VA 4JR9H 5D1XA 4TUUA 5AVYB 1AE6L 2D7QA 3U2JA 4M56A 1I8KB 4EMZA 3LD8B 4RESB 2NY1C 4LPYA 5F6IC 3L6FB 3CFBB 1FAIH 5DJCB 3TCXA 3VFUA 3MVSA 1ZPUA 1L9OA 1QP1A 2NYKA 4ODVL 4LCCB 3EYSH 1MW0A 3BPCA 6CGTA 3H1ZA 3CN3A 3TT1L 1LO0H 3ZE0B 1T1YA 2JKWA 4FEIA 3VXSE 4MD5B 2D7OA 3QJXA 2R0WH 2FEJA 4HD5A 5E1GA 3N9GH 4AKPA 2A6KB 4R4FL 4X99A 3WIIH 2ICWI 5A43C 1F1DA 2CR0A 2F7OA 2NNAB 2VC2H 4HDIA 3V4VH 3VGAB 3MLWH 4RMVA 4HALA 1NAMB 3MRBB 3HZKB 4Z0XA 3FTWA 1NFDF 1TG8A 3ARBC 3QHFL 4HUUB 3QYMA 3VXUD 4F33A 4ADJA 1JV5B 4KOBA 3NBNA 1I3VA 5KAQF 5JA9A 3BISA 5LBSA 4OD2A 5GGTA 1JGEB 2F74B 1UZGA 1NCAL 2P5ED 4MB1A 1GGBL 1NAML 2AAVA 2AQRA 2HH0H 2JB5H 4G7VH 1JAEA 1KENL 4ZZKA 4TQIA 3EBGA 3P11L 1CURA 4WAFA 1WCBB 4MB5A 2QLYA 1LM8V 1TZAA 3IU3B 4YXHH 3DYMA 1BXAA 4QHPA 2I9LB 4G3YH 4PGCB 2BNRA 1HHJB 3E8VA 2B59A 1CR9H 1P4UA 2G5BB 3VI3B 1AG6A 3WJJC 3BAKA 2Z0BA 5GZOD 4Q14A 1OGAD 1I8IA 2YN3A 3VJ6B 1PKQE 3WE6A 2HG5B 2P5WD 1I1RA 1S7VB 5CO1A 1Q1JL 5C0BB 3ZTEA 4JAMB 3CK0L 5IQ9B 1J9RA 9PCYA 3RU8L 3UMTA 4O5LL 5C97A 2CK0L 4H20H 4DWHA 5JLZB 4LLWB 4G8AC 3QUXC 2VN7A 1TKWB 4UBDD 2DM3A 1OT1A 2AJYL 3FJTA 1IM9D 4PUBL 4Q74A 5JORA 2HN7A 1MFDH 3RYMA 1HOCA 2WOYA 5LG1A 4HXAL 5I1HH 4Y89A 2NY6B 3P9MB 4BUQA 2HKHL 3GSVB 1BF2A 2B14A 2CCLA 2LLNA 5KANI 4GG6B 3CFDA 3MV9D 1KGCD 1RUPH 3UEZA 3TV8A 1A6WL 4JFPB 2AJUL 3H4HA 4JY5L 4RAVA 4HV8A 4LPWA 1YUKB 1ACCA 1YEDB 4DVRL 1H3GA 2CJUL 5IVZA 1K8IA 1HL5A 3R0NA 3BP6B 3T3PF 3IAQA 2B1AH 3STLB 1U2CA 4H8QA 3S36X 1DJYA 3QQDB 4JQXA 3O6MH 4TVPH 1T20B 1F90H 5F6HJ 2BOLA 4P46A 4GO8A 5ISZB 2HMIC 3VB8A 2AEPH 3VXRB 3FN0L 1TNMA 5DJDB 3TZVB 2X12A 3PHSA 3MCLH 3H3KA 4CC4A 1QMUA 1Y6MR 3SYQA 1JV2B 1PU0A 4YL4A 4I2XA 1J5DA 4E9SA 3RVTC 5KVGL 1YMMA 2CHXA 4APQB 4FKKA 4ZMZA 4NCC2 3PF2A 1NC4B 1WEJL 5FA4A 5D6CA 2E8ZA 5LHDA 4ES8A 5AOZA 4XOCA 1YNTF 1FYTD 4F2FA 5AQ0A 2EDDA 2DWDA 1KWGA 2EE9A 1A3QA 4OF7A 5EZPA 4JFFA 5GRUH 4L1BA 3A24A 3W57A 4XXWA 2OJ1A 4NCC1 1TVBB 4ZOEA 1KGYE 1ICTA 4OKVB 2IH3B 1JGVL 3IWVA 4EQ2A 1LJMA 2PYEB 4AYFA 2XWJB 4QPEA 1HDMA 4OT1L 4OZ4B 3RVVC 2EO1A 2J44A 2P8PB 1WWAX 1WGVA 3NAAL 5DZ9A 3L4WA 4P2YA 3TP4A 4LL1A 4K94L 4NZTL 3FFDA 2DS4A 2UVEA 4FLSA 4JRYA 5IESH 1OCWH 5AVZB 2B1HL 2G3MA 4KKBC 4PJHA 4TQEL 5BRQA 2GBTA 3X13A 2YD0A 4N0YH 1U8KA 3PP4H 4HBCH 4I4WA 4LCUB 4XX1E 3SPVB 2UYLA 4GLRH 2LGNA 1E5BA 2EINB 5IQMA 1NMAL 2V2WA 2YEQA 1KGJA 4FG6D 1E8WA 3RL1A 3TVMA 4JM4H 3ARDC 4ORGB 3BRGC 1NM4A 1TTFA 3UROR 5BUPA 2AGJL 4LLVB 1D5MA 2AXGA 4DKFL 1QR1A 2ARWA 2W60A 2DZEA 2ZUWA 3ZDYE 5DUPH 4OLZH 1KCUH 4DUWA 1CFNA 4LLUB 3MXWL 5L8LB 2NTSP 4HC1H 4PS4H 4LL9A 5A3ID 1AR2A 3L13A 4JPWH 4Q9QL 1OD9A 3AU1A 3MA9L 1BGXL 1OARL 3GM8A 2YGVA 1UJTA 3ARFD 3LN5A 4CU7A 1BEXA 3X17A 1H9DA 5JYLA 1CZ8L 2Q76A 2DIEA 1E6OL 4WK4B 4FEMA 5JR1H 1ECZA 3G04A 4UBDC 2R69A 1RU9H 3BUBA 5IMKB 3BKJH 3DPBB 1RZ7H 3D12B 2VLKA 5DWUH 2W9EL 5EOCL 2L7UA 3CZEA 3F04A 1BBJA 3VG0L 2PPCA 3W5NA 3DSNB 2DRUA 2QZQA 1SOQA 4I3SL 3UTSB 5I1GL 4M5YL 1GAFH 2EABA 1B3IA 1D6VL 5IVXF 2EYSA 1JZEA 1A14H 4J3OG 4IK7A 3OPZH 3CDYA 4HWNA 2CXGA 3QFJB 3C6LB 3QRGH 5AVXB 3L1GA 5EU5A 2FK9A 3FU6A 4WI0A 3EGXB 5DQJB 5ESAA 4YSOA 4BZ2A 4EDXA 4AW7A 2GW5A 1GL4B 2EDFA 3ZN6A 5I19L 2ILLA 2K6YA 4GQPH 1I1FA 2GK2A 2FEDC 1KT2A 5DD1L 1SBBA 4Y88A 2B9BA 4M43L 3GGWA 1I4FA 4N2FA 5E2JA 2ENSA 3K46A 1CLOH 1VHPA 4E9WA 5HI3D 3NJGA 4N2CA 2YMTA 5IHUH 3FB6A 2BZDA 2X44D 4MMZA 4YGVB 3T0EE 4XCEB 3A67H 4Q2ZB 1X5JA 1ZV5A 3S36L 5JW3L 3NZUA 4GQQA 3E9TA 4FXKA 1HQ4B 3NZHL 3W2DL 4JKWA 3SBPA 1CFVH 3FH7A 4W6YB 2CG9X 2XWBB 3BSZL 3L3GA 4FNPA 2KT6A 1WZ1H 1XGYH 1JNJA 1UB5A 5E24E 3VUAA 3I50H 3IETA 5DQ9B 2NSMA 3PNWA 4JPVL 2BSDA 2FO8A 3PDDA 1AKJB 4V1DE 3DMMD 2Z9TA 3WUWG 4GAJH 4NNYA 4UM9D 2P45B 5SWQA 3TA4D 4AL8C 3EO0B 3APCA 4W1TA 4JHAL 1CFSB 3S5LA 2H26B 2JV6A 1GMIA 2UXFA 5C0RL 3IJ8A 1YEJH 3IDGA 1MI5A 5HDQL 5JOEA 1GHFL 1MFBH 2CZNA 1A7NH 3TFBA 1S7SA 2Y06H 5F9OH 2FATH 2R2EB 8CGTA 4RAHA 4QRQA 1MHEB 4G59C 2AJSL 3X1FA 4FTVE 1SXCA 2CPUA 3N44B 4WNJA 43C9A 5J56B 3ENEA 4BFGA 1KCVH 2CDGA 4ES9A 1WLHA 4AC2A 3US1A 2N59A 1R3LA 2YSSB 1P4IL 3D85B 1PQZB 5AKRA 4M8QB 4X7FC 2R15A 3FONB 2VQUA 1NKOA 4LL4A 1WG3A 4N9GA 4JGMA 4ZX5A 1IARB 2H6UA 2HZHA 4HWZB 3U2SB 4ZTOH 2H0FA 1XR9A 2IDQA 1BOGB 1DEEB 3P1VA 5L2KE 4OLVH 2X2UA 3CSPA 4ABWA 1IRAY 4V33A 4B9IA 5J6HA 1N2RA 2VLRE 3QQ4A 4EVNB 1UM5H 4FJZA 1SYSB 3MV11 5TDNB 5EUOE 3KR3L 4KZCA 3SDAB 4F7EA 4NQSB 1ZEAH 4NCDA 3VGFA 1FV1A 3ARFC 3KE0A 2XV6B 2YGNA 3ETBF 3RA7L 3NQIA 1PDKA 5F9WB 3TBTA 4XNYL 3RDJA 2B1OA 4PGDA 4XCNA 1FUNA 4P2RE 3UZQB 5E9NA 2N56A 4PRAA 3PL6D 3HZMA 1GS6X 1INQB 1A3RH 1R75A 1ZV9A 4LDEB 5TF0A 4U6TA 4UV4H 4H26A 2WUBH 3A6CH 3LKPA 2MH4A 2VSMB 2Z8VC 1SQMA 4FXLA 1D7CA 1WPCA 4ODTH 5D1ZI 1RJZB 4X6DE 5EEZA 2EVHA 2NY5H 4TNVK 2ED9A 3FQTA 1Z9MA 4YX2H 3MNZB 1FZOA 3ZYZA 1N6QL 1MELA 3BE1H 1VACB 1BFVH 1P7QD 1MJ7L 1RZKH 4OCSL 1KG0A 3SCMB 2J56A 3KWVA 4GMTL 1F1AA 1ZHKA 5IGXL 5IJKC 3SGKC 4P48A 3V4UH 3AG1B 1KNOB 1VADA 5D93B 1RZGA 4NQCB 3WFBH 5GZOA 1OGAA 1KIUA 2EEBA 2PYFB 3QZNA 5AAWA 3H42H 3QUYC 2MJWA 3DX1A 4IMLB 3GNML 3STBA 4Q8BA 5I17A 4XVSL 1WUZA 3KJ6L 2NW3A 3DGCR 1IKNC 1YY8A 3L5WA 5GS2D 4XWGH 1S9KC 2XA8L 5I8EB 3LDBB 1ONQB 4I77H 4DW2L 3HE6A 5KZCB 5FECA 4M93C 2UWEE 1Y07A 3IJEA 5C0CA 3IFPA 2DIBA 1UWGL 4P5TD 5JW4M 4X6FB 1FL5B 2CIKB 3U0TA 4Y4FB 4XO5A 2Q87A 5K69A 5B4MD 4YVUA 5C07B 2BIHA 4JFZH 2V5SA 1VESA 1UH4A 2FJGB 2IQ9H 4P9HH 1BMWA 5DI8B 2GSIB 3CX5K 2ORBL 4GH7B 4XP1L 4V11A 5EC2B 1Z5LB 2DJ4A 1OE1A 3FNKA 2ZOTA 1SOSA 4AJVA 4GKSA 3JUYA 3UAFA 4H0GA 3VQMA 1QFWL 2AXHA 3KS0H 2NW2A 3WYRA 2JJTA 5D8JL 2WLIA 1H3UA 2YUWA 4X8JA 4XPAH 3T2PA 3VYNA 2ZX9A 3LRHA 4RMUA 2WO4A 1BVLA 7PAZA 3W39B 5FM8A 2CNYA 3FTYA 1FO0B 1IAKA 2V5TA 3P3SA 1HFUA 3HFML 4LCIH 2WXJA 1SF3A 2QPDB 5A2IH 3K6NA 3IKKA 2ADFH 4Q0XH 4BJLA 4DTGH 1SY6A 3ZL4L 2MRYA 5HDRA 1Q0YL 4WO4C 3LZRA 1JXJA 1KOAA 1A7RL 2VLJA 3MGOA 2D7TL 3GKWL 3DX9B 5CR8A 5CZRA 1WE5A 3HN5A 2HB0A 3T0EC 3FQRB 2D9QB 4R7VA 4YFDB 4FFYH 2ESVB 4BK5A 2FD6H 5E9DE 1F6AB 3GSOA 3BEWA 2BP8A 4WNQA 1IEBA 1YEEH 2F7IA 4U33A 3ALPA 3KWUA 3H55A 1DDHB 2LFEA 5L8KB 4ZUTB 2EDWA 4A6YA 5TDOA 3RNKB 2BIIA 4AJYV 4BH7B 2QPEB 2Z4QB 3TEZA 3FYEB 3PL6C 4FQCH 2D7PA 2KPWA 3KLHD 1F11A 3SGEI 1IGTB 2AZUA 3LSOA 4F7PA 2MQ0A 4W9HC 2ZUQC 2KI6A 3HMWH 3TA3C 2YD7A 2OI9B 2O26U 4WSGA 1JZ4A 1NOAA 1TTUA 4LCYB 1XTLA 1BVNT 3SY6A 4KRNA 3AUWB 3BLKA 4LVNB 2N01B 3VWJA 3D39E 2WK2A 5GGVL 1JHKH 2IMMA 3N3EA 3N06B 3EJRA 4RSVA 3WD5H 4JVUA 1QPKA 1Y0LB 3WY3A 3WU1A 2NR6A 3I6KB 1T0MA 1CI3M 1ZLEA 3MNVA 2PTTA 5DLMH 2VLLA 4EOWL 2QQLL 3FB8A 1YPZF 3HC0A 3KLKA 4YHOL 1I7ZA 2QV4A 3Q6GH 5FYLD 1P53A 3RTQB 3VNZA 4W9LC 4JB9H 1KFAH 3UAJA 3FO2A 1ZT7B 3I74A 4A2FA 3RHWF 4M3JA 3WTTA 3ZUCA 4UTBA 5IR1B 2QPFA 2F5BH 2SEBA 4LIQL 5T5FH 2PABA 4CNIA 4F37F 5D7LE 1QSVA 2BVQA 2W65A 3CLEH 3G5ZB 4FKEA 2RAMA 2VQ4A 2W9DL 3DJZA 4G70B 3ULUL 2VABB 5KN5A 4KXBA 1NCNA 5J06A 2BCKB 1QRKA 4QOKE 2G30A 4ESKA 1XQ4A 2YAHA 1M05B 3QORD 3VI4F 1D5RA 1YMHA 3G5YB 3OSKA 4LAQL 5IM7B 3U4BH 4U2YA 4MAYC 3QO1A 3BPOC 2WB7A 2BSRA 1TYRA 1JK9B 5J7CC 43CAA 3BP5A 3EJSA 1CDHA 4NWTL 1Q4NX 1T5WA 5FWQA 4JGUA 4EZLA 1F2QA 2V7NB 3LJ3A 4HYTB 4KK8D 4DPCX 5IZ7A 3ULVL 5D70L 3KWWA 3N85L 1DUYA 2ZZUT 2G2RA 3LIZH 4X9BA 2WWKT 3QJOA 3SY0A 4WW1A 5JOPD 4QI3A 1NCDH 3ERXA 4KXZH 3EO1B 4U3SA 1OOWA 5EG6C 4LO9A 4LEOB 4JFWA 2NLJA 3BZDA 1BFOA 2YEZA 4U6VH 4AT6A 2CIIA 5ICUA 1KCLA 3KPOB 2XZAL 4W6WB 2XWCA 2BIMA 3QO0A 3FCTA 3NJVA 4NN7B 1NFAA 2F1EA 4FABH 3T5WA 1GJWA 1TMQA 1MW2A 3WN5C 1BIIA 2DQFA 4X7TA 2YGPA 5E6IB 3SDXE 2MQGA 4MJJA 3QIUB 1N3NB 4BK4A 1MLBA 4PVBA 1QYGH 5DMYA 5PCYA 1J5OL 2VTFA 1V7NH 2KLSA 3GIVA 4JMXA 4K4KA 5I16A 3FH8A 4YLCA 2AW2A 3GXMA 3K2UH 3M17B 5F70A 3PWLA 4OM1H 2WWMC 4RCAA 5IW6A 2GTWB 1CDYA 1Q9WB 1U33A 4HGMA 4E9XA 1SJEA 4P57B 5ADPL 1AD9A 4UM9A 2J5WA 1S9XB 3QEQB 3WG7B 4YAQA 1HK6A 4X6CE 2OQJA 2BZ7A 2CA3A 4ZO8A 5K39B 4HJ0D 2NZ1A 2X6UA 4XP9L 4ZW3A 3WTSA 2HKFL 4ALAH 1N0LB 4OQTL 3QG6B 3HN3A 1JFQL 4D2NA 3JWDL 1H0DB 1NFIA 2NX5B 1U8QA 2ROXA 1AKPA 5DK0A 4TYUA 4LCWE 3GWJA 4PYGA 1AGDA 1MF2H 1A4JA 2L8AA 1WCQA 3LEYL 1B9ZA 3MRHB 1ZKAA 2YD1A 2QR0A 4UM8A 5L4IA 1DJIA 1GC1L 1Y1UA 5KSVA 2BMKB 2VWEC 1XH3A 5GSVA 3Q1SH 2XKNB 4TUJB 4EE2A 2EXYC 4DQOL 4CGUB 1IE5A 3ZK0A 4K9EL 4NM8H 2X4UB 2VSDA 4N90E 1QBMH 1EJFA 2CUIA 2APXA 1FL3B 3QXVA 3TN0A 1YO4A 1QKZH 4PLJC 5ERWB 3SDYH 1DQVA 2F58H 2J8UE 1QFUH 3H9ZA 3VD7A 1KTCA 1ZS8A 5KYUB 1RP8A 4RISL 4YO0A 5IVOA 4PJAF 3DRQA 5D7IE 2E6PA 3ARGC 2CCWA 3SKNB 2VNCA 5FK9B 1CXEA 2QADD 2YO3A 3AAZB 1A02N 1MFUA 4I48B 2VSKB 1UURA 3VI3F 1HYRC 2WYZA 5TDPB 1WRFA 4Z5RA 2XN9E 3DGGB 3WEBA 1M7XA 4NFBA 4KH9A 4CKQA 3N1GC 1X5IA 3C5JB 1C7TA 5CD3A 5JDJA 2CHWA 4S11A 2F1BA 3PJLA 4FQXD 4XMKH 1M7IA 4LBEB 3TH4T 4FA8A 5FO2A 4L0YA 3VD4A 4HJGA 2CKBB 2ZCLL 4LEBA 5JPMC 4XMUA 3FO0H 1P7QA 3WFHB 3HCVA 5IF0A 2GT9B 2Z64C 1IGMH 4HSAC 5FDWB 4XNUL 1FYHB 1RUQL 5L9DL 1M7UA 4I3RH 5DRNA 1F8TH 2CKBL 3NN8B 4TF4A 3ZMEA 1K8DA 3IE4A 4AQ1A 1M57B 4GG6F 3OSVA 1TJHL 2AV7B 3SQBA 1WV7T 3I2CH 5DUML 1X5XA 2BM3A 2BP0A 4YHPB 1ASQA 1TZIB 4GKNA 2HP4A 1WFIA 1JF6A 4IHOB 1DQLL 3UGEA 3QNXB 5I1KL 4F8QA 2BNQB 2VIRB 4GSDL 4G6KL 4OZIB 4GIAA 4JREC 1BQ5A 4JLRB 3WTVA 3KW7A 4HLEA 4MASA 4MCZA 5D2NE 4UOW1 1QFHA 1R3HA 3GSRB 1VERA 1PCXA 2OMYB 2YWZA 5BVPL 1DFBH 1E4XH 4F7TB 4R26L 3WO3B 3MLSH 3AUVA 3KYKL 4ONGH 1TITA 1UM4H 4NP9A 4BDVB 5I18L 2ICEC 4ZPVB 1TTAA 5T8IA 5B21A 3QPXH 1OSZB 5FO8A 1YJDL 1MCWW 4MNQB 1U8CA 3RIFK 4WWKB 2OULB 4RFEB 1HZHH 5IBTH 4HKJA 1BXXA 4NKMB 4LKCA 2BRQA 5C0BD 3CLFL 4HJ0C 3D25B 1O7DE 3U7AA 3N1FC 2X3CA 2VITB 3E3QC 4MA1C 5D7JC 1N18A 4N24A 2EICA 4M6OL 2VO8A 1QWUA 1JRHH 1EEYA 5DC0A 3U46A 4M1GL 1H5BC 5CIPB 1ASOA 1SUHA 5DR5L 3V6ZB 4AG4L 3INUL 5EBWA 5F0PB 3X3GH 3EJQA 1TZ8A 5TH2B 3FMGH 2EDRA 3HPJB 2NY6D 3P4NB 4R7XA 3T77A 4HUMB 4NSKA 3QXAA 1ED3A 2QTVA 2SODB 1W80A 2RJMA 3PWPE 1NICA 3ZE2E 3Q2LA 3TWYA 4OF0A 5D1XE