3NJIA

S114a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLAPDPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njiA00
3IN0A 2FQDA 1BAWA 2ZWNA 3ABGA 2EINB 1OCZB 5F7BA 1F56A 3AW5A 2PCYA 1BXVA 4L0PB 2QPDB 5PCYA 1GW0A 2FT6A 2NRDA 2RACA 4G7QB 5ANHA 1PLBA 4N8UA 4F2EA 2FWLB 4E9RA 3EH4B 5B1BB 4BWWA 1NIFA 1AQ8A 2IWEA 2X88A 1AZNA 3ZX1A 3PAZA 1PLAA 1E30A 1IC0A 1AACA 2FNWA 2VM3A 4BXVA 1PF3A 2A3TA 1SFDA 3AG4B 4JHVA 3T6WA 1A4BA 2UXGA 4G7SB 1OOWA 1A4CA 1L9OA 2GB2A 1KBWA 4NERA 4YSEA 5A7EA 1GS8A 4G7RB 2FQEA 1WS8A 2VSMB 4GP8B 3S8GB 1URIA 3FYEB 2EIJB 2VMJA 3N2JA 3NJHA 5I5IA 1J5CA 2FT8A 2YAOA 1XB8A 2BHFA 1NIAA 2UXVA 5B1KA 1EZLA 3SBQA 2PCFA 4UAHA 1BYOA 5D4JA 1AR1B 4P5RA 3UAAA 2PPFA 2Y1AA 1VLXA 4GXFA 4AX3A 2IAAC 2UXFA 2I85A 4GY4A 4TXVB 1E5ZA 4K9JA 4RH4A 4A2FA 2IDQA 4E9YA 3C75A 1OCOB 1V54B 2YAFA 3FU8A 2BP0B 4KO6A 5AKRA 4GYBA 2YXVA 3T9WA 4MFHA 5B7FA 3CZUB 3NJIA 2TSBA 2XXGA 3WG7B 2X87A 4DPAX 4YVNA 1GYCA 4UANA 1I53A 1PNDA 3QJVB 2HX7A 3T6ZA 5LDUA 1T5KA 4DP5X 1N70A 2P80A 5B7MA 3QJUB 3EF4A 2BWDA 2YAPA 2UX6A 2ZONA 2VW6A 3FSZA 4KO7A 4G70B 4YSPA 5I6PA 4FAAB 1SNRA 2DWTA 3X1BA 1OV8A 4YSCA 3RYMA 3EHBB 3AG2B 3HEIB 4P5SA 3PPSA 3FQYA 1ADWA 4HZ1A 1L9QA 1J9RA 9PCYA 3NJMA 2HLEB 2J56A 4DP6X 1WA0X 2DWSA 2AVFA 1AZCA 4AZUA 1QHQA 5I6OA 1A8ZA 1MZYA 2R7EA 2WO2B 2DYRB 4HCGA 1M9WA 1AS6A 1WAEA 4A66A 3FPYA 3PAVA 3TASA 5I6MA 3T6XA 1L9SA 3KW7A 2Q5BA 4DPCX 6PAZA 1NTDA 2PPAA 3T6VA 3T71A 1J9QA 4G72B 1NWPA 1DYZA 3QJQB 1MDAA 1KCBA 3UGEA 6PCYA 1PAZA 2FQGA 2TSAA 4W1TA 2VW7A 3CDZB 2OV0A 1BQKA 5I6LA 3QPKA 1GY1A 3GYRA 3PAUA 4AKOA 2UXTA 3D12B 3DTUB 3KW8A 3ZBMA 2QT6A 3ZDWA 1OE3A 1XMEB 2XX1A 1L9RA 3FQ1A 2GBAA 3FU7A 1J9TA 4KOCA 1ET8A 3NSCA 2BP0A 2EIKB 3ERXA 2XU9A 3SBPA 3X1FA 1SFHA 1RCYA 1A3ZA 3QQXA 1GS6X 2HRHA 4NAJA 1NIEA 4YSAA 1AOZA 1PY0A 2CALA 2R7EB 3NP3A 4CSZA 4YSTA 3WI9A 1XB3A 1PMYA 1R1CA 1TU2A 4YSOA 4AI7A 4DP7X 1IBZA 4A68A 1W6WA 2PP9A 1MG3C 1XB6A 5I5MA 2PPDA 1ZDQA 1ET7A 1ET5A 1CC3A 1CYXA 5AZUA 3WKPA 3OMAB 3X1GA 1OCRB 2H3XC 1JXFA 5D4IA 5TK4A 1KCWA 1L9PA 7PAZA 1ID2A 2XUWA 3H4FA 1JZJA 2FT7A 1SDDA 1KBVA 4A2HA 3N55A 2DV6A 4W9ZA 3DKHA 2XV0A 1CYWA 2AZUA 3NSFA 3FPXA 2AFNA 1KDJA 4DP0X 4YSQA 1NPNA 2BWIA 2IWFA 3CVDA 4A2GA 1M57B 1A4AA 2DYSB 2JKWA 3FU7B 3QJSB 2ZOOA 2E86A 3UADA 1SF5A 4BK5C 1BYPA 2EIMB 2OCCB 2XVBA 1AG0A 3IE9A 3JTBA 3FQ2A 4DP1X 2CAKA 1HAUA 1ZIBA 5I5JA 2YAHA 4F2FA 4YSDA 5FC9A 2IDUA 1NZRA 3QJTB 5D4HA 8PAZA 3CDZA 3JT2A 4F7KA 1OF0A 5AFAA 3H4HA 4WTQA 3S3BB 4HHGA 4Q89A 2XX0A 4CSPA 1HFUA 1NIDA 1RZPA 3TBBA 3NYKA 4HCFA 3AG1B 3IN2A 1ETJA 2HZHA 3DIVA 1FA4A 3CG8A 2QDVA 4BWUA 3CVBA 4HAKA 1ILSA 3UAEA 1SDDB 1ASOA 2VN3A 2CCWA 3FSAA 3IBOA 3X1EA 2MTAA 2YAMA 4WKXA 1WA2X 4DP8X 1W8EA 3NSDA 4YSRA 3OMNB 4E9SA 1PNCA 1FWXA 2XV2A 4YSUA 2GC4C 1ASQA 3ASNB 2W88A 1GY2A 3U25A 1BEXA 3S3DB 2AANA 4JHUA 3NT0A 4A2EA 1JERA 3UACA 2WO3B 1QNIA 1AS8A 4HIPA 2HXAA 1IKOP 1SJMA 2I7SA 2MRYA 3NP4A 4HALA 4BXSV 4M4RB 1V10A 5B1JC 2BP8A 2J55A 3ABKB 2B3IA 2DY2A 1B3IA 2B08A 2CUAA 1NDTA 1NINA 2PP7A 1TKWA 3HB3B 4E9VA 1QLEB 1E5YA 3TBCA 2VM4A 1ILUA 1WA1X 2Q9OA 1BQRA 1AG6A 4NB7A 1DZ0A 4DP9X 1SHXA 3L45A 2GSMB 5B1JA 5IY5B 1CUOA 4BWTA 2BZCA 2W8CA 1GR7A 2BW5A 3NJNA 2J57A 4KO9A 2YARA 4KNUA 3IEAA 1JZHA 1JVOA 1ZPUA 1A65A 4ZK8A 1JZFA 1X9UA 4PCYA 5F7AA 4DP2X 2N0MA 1KGYE 2AZAA 4DPBX 3ASOB 4G71B 1JXGA 1AIZA 2IDTA 1KV7A 5B1AB 2XYBA 2GC7C 3MBWB 2PPCA 2JFCA 4YSSA 2LLNA 7PCYA 1SHWA 1J5DA 1PLCA 2GIMA 3AG3B 3QJRB 3FU9A 2YAEA 4YL4A 2I7OA 3OQRA 3ABMB 1KYAA 2BO0A 4QLWA 2J5WA 1BXAA 2VSKB 1E67A 1PCSA 1N68A 3OMIB 4BDVB 2H5UA 3X1NA 2BP8B 2EILB 3AY2A 4EF3A 2ZXWB 3WIAA 1BXUA 1ZIAA 3S3CB 4N4YB 3V9EA 1V55B 3AZUA 2XWZA 4X4KA 4JKNA 3V9CA 1ASPA 1JZEA 2IH9A 1OE1A 3PCYA 1PZAA 4HCIA 4HHWA 1L9TA 2FQFA 3NJKA 1RZQA 5E9NA 2CBPA 3MX0B 2PP8A 1RKRA 5B3SB 1PZCA 5I26A 1M56B 4A67A 4E9TA 3OD3A 2XV3A 2CJ3A 1AZRA 3TU6A 3FT0A 3X2QB 4M3HA 4YVUA 2BZ7A 2XLLA 1AANA 1OCCB 2YAQA 2IDSA 2JXMA 5I28A 2YQBA 3CVCA 2PLTA 4FA7B 4KOBA 2FJSA 3PLYA 1AS7A 4ENZA 3NJFA 2PPEA 4E9XA 1NWOA 3SBRA 3EH3B 5EHFA 2QDWA 4KNSA 3WNIA 2IDFA 3BVDB 4E9QA 2H47C 2QPEB 5I6KA 2IWKA 2VW4A 3NJLA 3G5WA 1GS7A 4QKTA 3H56A 2BW4A 1JOIA 3S8FB 3FS9A 1AZUA 2GHZA 1AZBA 3NSYA 3NJJA 3FYIB 1MZZA 1ZV2A 4PAZA 3ZIYA 1WS7A 1CURA 1UATA 2HX9A 3FSWA 2WSDA 1SF3A 2Y69B 1J9SA 2IH8A 1JZGA 1JXDA 2XXFA 1NPJA 2FTAA 1BQ5A 5I6NA 3NJGA 1GSKA 4UF7C 1KDIA 1PZBA 3GDCA 4AKPA 1IUZA 4DP4X 3ABLB 1NIBA 2GI0A 1ZDSA 5TK2A 4GP4B 3WNJA 1NICA 2YXWA 4Q8BA 3UABA 4GP5B 3OM3B 2P80D 3EH5B 1JVLA 4BDVA 1FFTB 3PXLA 2HX8A 4AKQA 1HAWA 3WKQA 1IBYA 1YLBB 2OJ1A 3SQRA 1X9RA 5PAZA 1AAJA 4KO5A 1OE2A 3TA4D 1E65A 1MG2C 1W6LA 1EHKB 3FSVA 4KNTA 5B7EA 1TEGA 1JZIA 3BQVA 1TEFA 4E9WA 4A2DA 2HRGA 2UX7A 3GXUB
chains in the Genus database with same CATH superfamily
1H0DA 3B9AA 5IJCC 4PD4J 2QQLH 1NGZA 1VA9A 1QVOB 5EOTA 2ZWNA 2BY2A 1J0JA 1R33A 1GCYA 3MNZA 5HJ3B 5DC4B 3BIKA 1RY7B 3FHQA 4Y5YA 2MPAL 5PCYA 1EHLH 3GRWL 4TUUA 2PYEA 1DLHA 1GSMA 2OSYA 4UQIM 3ZE2E 1F4HA 3F7KA 4F2EA 4AGPA 4PY7B 4JQIA 5LG6A 3TEYA 1M2VB 2KLSA 2N7BA 1VSCA 5E00A 2XWXA 5IHLB 2X88A 1HOCB 3PQYA 1B0RB 4HZLA 4DQOH 1M6UA 1RIHH 4JFDD 3GZOA 4G8GB 3TBSB 5GS2H 4N8VB 4YHIA 4EO5A 4NUJA 3IMSA 1U33A 2BVEA 3D39E 4G7SB 1QSFA 4NI6A 4WK2B 4XC3H 5AOLA 4ZUVB 3BWUF 3GSNA 4NERA 3STZB 1OGAA 3P40A 4N28A 4XWOC 1QTPA 4AZ8B 2ALWA 4S1SL 4BEIA 4P4RB 5FHBL 1N5AB 4PLOB 5HYFA 4Q6IC 4OJFH 2WOBA 2QSQA 3N2JA 2ZKHH 1AKJD 2GEEA 3TVMA 4A38A 4E41D 1Z9LA 4QXTA 3TYGL 2EH7L 1HXYA 3FTVA 5HXMA 2WXIA 1WIUA 2YRZA 4YLBA 2NY7H 1WIPA 4YHZH 3MLVH 5JHMA 2ESVB 4XBGA 3KPNA 3DUUA 1XSJA 2Y1AA 3BGMB 1NCWH 3MJ7B 1ZLSH 3L4YA 5FK9B 3NPSB 2J6EL 1EAJA 2G2RB 3ELAT 2BMKA 3O0RH 4RX4D 4NNYB 3VWKC 1NC2B 5AW0B 4RETB 5BRPA 4WNJA 4E9YA 2VERA 4X4ZA 1P4IH 3WN5A 2YAFA 1DBJH 3SDXE 4EN3C 3KLAA 1CU4L 3IGFA 4BHUI 3BP7B 1MRFH 2IBZY 1C12B 5F6HJ 5IJKC 3KYOA 5CEXB 4LLQA 2X6BA 4PR5A 3EOYG 1QPPA 2EQDA 4X6DB 2R2HA 2DQDH 4PJIA 5D7LA 1E8ZA 2R4SH 4UMGA 3AC0A 2Q6WA 2VITA 4P2QD 4RRPM 2BSDA 1MCOH 2E8YA 2VXTL 4G70B 3IMWA 2BNRE 4FAAB 4U6VH 3EOBB 2DWTA 5HGHB 1LEGA 2AMGA 4YXKL 1OKEA 5EA0L 4MB3A 1GHFH 5HVHB 2Z92B 5SX5K 4XNUL 2ADGB 4M1GH 5ILTL 2C1PB 1CQYA 3H1ZA 2DWSA 4WEBL 3C5SB 3VYOA 5JR1H 1XGZA 2KZWA 4YHNB 3GNML 1TTFA 3IRPX 1FFPA 2OJZH 2OMUB 2R7EA 3DYPA 4AQAB 5IEHB 5SWQB 1MN4A 2NNAB 4UQBA 4YJZL 3O3AA 2E5EA 4UZGA 3GJFK 4HMCA 2RALA 3VQLA 2CWRA 3TASA 1CF1A 2VAJA 5DDHA 1FDLL 3EF7A 1F1AA 2G75A 5L2KD 3MV01 5GGVH 1XF5B 4X6CE 2BWQA 3TH3T 4NRYA 3VYNA 3T6VA 4TRPH 4AYBA 4G72B 3QUXB 1CCZA 1NFDB 3VXSE 5KJRL 4GKOA 1T22B 4HS8H 2AI0H 5EU6A 3GIVA 3GIZH 4FJYA 4N8CH 5GGTA 4GI6A 4FRWA 1JNNL 3ZU8A 2P5WE 2NUTB 1MJJB 2AQTA 4LSVH 2ZG2A 5A2LH 5A6LA 2JELH 3R19A 2ADYA 2WCSA 4JKPL 4P0DA 3T2NH 1KPVB 3NESA 4JFSA 3FQ1A 2XKNA 3DLQR 3E2HB 1H6FA 3GUTA 5GS3A 4HMDA 4N2HA 2APTA 1FFRA 2HJKA 4LRNH 4AK1A 2NCEA 2DQFB 3BZEB 5K39B 4JR9L 5ALCH 4OGAD 3U9WA 3WTSA 1U91A 2HFFB 2HP4A 2XQ0A 4KI5E 4JHZA 3K4ZA 1GAFH 1QR1A 4TUKL 4LLWB 3NQIA 4PREA 1DLFL 1YEHL 3CXHK 2XQYK 4XCCH 3S3PA 1TJGH 3VFUA 1K6QL 3WKPA 1E6JL 2FZ3A 4KGLA 5IEKB 2X09A 2X9ZA 2DTSA 1RERA 1MCPH 3VSVA 2FSDA 1G4MA 2V2XA 1Q72H 2GJ6B 4OLUH 3I6LE 4NJAH 1H9VA 1ZT1A 2VLKA 1N26A 3BUBA 4JM0A 1GGCL 3H7BA 3MR9B 1AO7E 4NDMB 3S8WA 3I9PA 3DKHA 1ZSDB 4NHUA 1IBDA 2XV0A 1CIDA 4HQQH 4WFGD 3SDAB 3HC3L 1SQ2N 4JM2B 1QBLH 3L5HA 4K7PH 4P59H 1PKOA 3MO1B 3UJJL 1SJVA 1LDPL 4CNIB 4PVBA 4HJJH 1SVZA 1XH3A 4BZ2A 5EWIL 2VISB 4G8IA 1QLFB 1G9NH 4FFZH 2X6AA 1DEEA 1N64L 3IJHA 4RSVA 2WGNB 3VI4B 3FQ2A 4DP1X 2X89D 2XJKA 3RWGA 4RESB 4AL8H 3VI3A 5AZEL 4EE2A 5DS2A 5E6ZA 2YD3A 2E9JA 3GSXB 1EVUA 3H4HA 4N9OB 2A9NH 1W0VA 1FNLA 2QSVA 1EUTA 3BT2H 4GKSB 1E0OB 2J2ZB 5B39G 3VRLF 4MMXC 4HWBA 1D5IL 2BNQA 4K3GA 4NCC2 4O02L 5D2LE 3GPSA 1CD1B 1FCCA 1JF5A 4PS4L 4UNVA 1P6AB 1MFEL 2R29L 4PTUB 3U2IA 4JFQB 4ERSH 4MJIE 3CZJA 1FA4A 2X2UA 2AKRB 3RPIA 3RVUC 1IV8A 4BWUA 3B2VH 35C8L 3H54A 3DUSA 4O2EA 1CGSH 3WHXB 3D69B 4K2UL 4PY8J 1SDDB 5IG7A 4H8VA 1NC4D 4OQTL 5KSAD 1T83C 5IW6B 3KVPA 3U4EB 3FCSA 5CN2A 3ARXA 2EKSB 1Z7JA 2DEWX 3CCHA 2OZ4H 3KPSD 3UTPE 1FZMB 5FOJA 2ZJSH 4BCYA 4D0DB 3C60C 4FG4A 2A73A 3GZQA 3FB7A 3P0GB 3V8CA 4LLMB 4PJHA 3DK0A 5IZ7A 3GI8L 1ZA3A 5ESAA 1GH7A 3HB3D 3RI5F 3ARUA 1BDYA 2BVPA 3KLKA 3BXNA 4NO5A 3VU1A 1XF3A 4D8OA 3KPQB 5DQDL 4HIPA 3CQFA 2VSCA 3WNMA 1BPVA 3TZVA 2XN2A 2VT0A 3VFOA 1WBXA 3ULUL 4ALAC 2WN3A 3GI9H 2QV2A 4J4PA 4LSPH 1WZ1H 5A43C 3K81A 1JZ6A 4GOSA 3UTTB 4W9IC 3FT1A 4B9JA 4NPJA 3KEDA 2D3JA 4JMXA 4MWFB 1KJ2H 3IMRA 2Q86B 5I8OH 3GLAA 4HUXB 3SE6A 3EO0A 2E27L 3QDME 4HFWA 1LK2A 4I18A 1MREL 3MYJB 1J48A 3SZKC 1SHXA 4K3JH 3I9AA 5B1JA 1U36A 1GR7A 4NZRH 1SLWA 2DI7A 3LKRA 1IT9L 5EZLB 1W72A 4D9QE 4N6RA 3GMPA 3T3PB 4ZFOB 5A2JH 5B21A 5MHSD 3RJOA 4Q2ZB 3QG7H 3H3BC 3LRHA 1J18A 3BP6A 2CXKA 1JYNA 2XYBA 4X7DC 3MVSA 4TULH 1E4WH 1NGQL 4DW2H 2WUCL 3CFKB 3QR2A 3VYPA 3HHRB 1YEFL 2QQNH 3Q01A 5EO0A 5A7BA 1ZHNB 3FB8A 5L0QC 3VMPA 3QFGA 3UP6A 3T0XA 4PIRF 1F18A 3FU9A 4GRWF 4Z7VA 3SPCA 3G6JA 2LR4A 4PJHF 3B9KB 5ADPL 4OZIB 2C9QA 5KSBE 4LLAA 1F4XL 3S5ZA 1YEWA 5GGRA 3JV0A 4HT1L 1A0QH 2CK0H 3LQMA 1JTOA 2APWA 5DUBB 5DJ8B 5DZLA 1FVCB 4PJFF 3GM8A 4DGVH 2J8UE 1NAML 1U3YA 4N2DA 4EIUA 5EZIH 1ZIAA 4OUUA 2ZNWA 4HLEA 5C7ZA 2V4LA 4YEFA 5A2CA 1SOKA 2JLLA 2NY6C 2XWZA 3JT0A 3O4LA 4GIPD 2O5NA 4YXLH 1S5HB 4IMKA 1HQRA 5HHVL 2NQ3A 3VXUA 3RWJB 5AW2B 4Z95L 2VDOH 4TSBH 1AHWC 1DQJB 2ZOLB 2VUYA 3QO0B 4N24A 4X6EB 5KSUA 2EC8A 3HMXA 3QDGE 4M6NH 3VFNB 3NCJL 1PYWB 3FB5A 4M8VA 2CO6A 2WOYA 2I07A 4DQAA 3ARFC 4DK5A 2EDHA 1AVAA 5DZAA 3X3FL 5ABDE 2Z35B 3GSWA 5TDPA 3Q0HA 4L1TA 2BVUA 1HQ4A 2QHRH 5B38A 4KJQD 1GZQB 4KQ4H 1E28B 2HRPH 5F7KC 3UTQA 1CFNA 1FJ1B 4XI5C 4MXQC 4AENB 2KH2B 3BVTA 1ZD6A 4HSCX 4IU2A 5ISZB 4XBEL 2OXGA 4GNKB 1GZHC 3UYPA 5FDWA 5IVNA 4HJUA 1JXJA 4H2AA 3ZYZA 3P4OA 2CQVA 3ARDB 4JO5A 4AVKA 2D0FA 4W6YB 3EJSA 4ZT1A 2KBGA 1T0MB 1TSRA 2RCSL 5ADOH 2F53A 1OAZL 1EMTH 1ZHLB 3RWEB 2YMTA 4XVTH 4XNBA 4ZS7L 1AGDB 3QRLA 4S1RL 4GAGL 4R4FH 1PJWA 2Y3NA 2D03L 1N8OE 4FQLH 4Z7QB 1L6XA 2ID5A 4Z77B 3UJTL 4NRZA 3V8OA 5HJDA 1P9MA 3RPBA 3BKCH 5GJTH 2A99A 4IIZA 4F7PA 1SUJA 4OB5L 5K93A 1MFDL 4C56D 4FHKA 4C55A 1CGYA 1RUQL 3L5WA 4KFZC 1KYUA 4KQ3L 5DEFB 4ACTA 2NR6D 4TLUA 2DKUA 3HOGA 4FTVB 2LVCA 3S37L 3WTWA 2D7TL 3MJ8A 4MMZB 5EU7C 4BDVA 4LCUB 2IALA 4NNXB 2LGNA 4PLKD 1FORL 1NBQA 2ZUXA 4NM8H 2EDKA 5PAZA 4XNXH 1AAJA 5DQJB 1W6LA 3LRMA 3FSVA 1E8YA 4QTIH 3DX1A 5B7EA 1YJDH 2WXGA 2Y6SD 2HVJA 1XBDA 4JFOB 5ANMA 3I02A 3N6YA 3UEQA 3KPRD 1BAWA 1YPZA 3GBNL 3HG1B 5F21B 5DZJA 1BZ7B 1TQCB 2FYYB 3LH2H 5EF1A 4U1KB 5DMIL 4FLSA 5T1MA 2NX5D 5HGBA 3WO4B 2FT6A 4F7TB 5CD3A 3D3VA 1OAKH 4Z0XA 3U36A 4YX2H 1FIEA 5IT2H 1Z5HA 2WZPD 2DLTA 4WWNA 3FFCA 3PWLA 5GZND 3QQDB 2ATKA 3CX5K 5JOFB 2X28A 5KAQG 4H7VA 3Q6GH 2ED8A 1PD6A 1U3HB 5JDSB 4FFZA 3VX1A 4O2FA 3W38A 3O6LL 3IPFA 4W4OA 1DDHA 3B5TA 2QVFB 2BP5M 3MLWH 4UQ3B 4DGWC 3VXRE 4YSEA 3E0GA 3MBXH 1KPRB 2AQ2A 2J1KA 4Q56A 1NFKA 4DGYL 1RXLA 5T1LB 3BEVB 3UBXI 2H3NA 1JZ7A 4PP1D 3EXJA 3CLEL 3LKQA 2VMJA 3ZO9A 1Z32X 4MSWB 3S7GA 5I5IA 1HEJC 3VG0L 1AD9A 4UQCA 1DBAH 2XVKA 2YKLH 5EC1A 3DOIA 1CICB 2ZSWA 1CDBA 5AW4B 3EFFB 2D7QA 1EZLA 4JFZL 3CHXA 4QNPF 1C08A 2VXQL 3FOLB 3TCTA 4PJDB 5SWZE 4GY4A 4NKDA 2FH6A 2NT0A 1AMYA 2CKBL 1IKNA 1QSVA 4KKNA 2OZ4A 3OKKB 1FZKB 4WY7L 2OJEA 4ICWA 3RAJH 4JUTA 4EI0A 3CN2A 4HBCL 4WJ5A 3KHQA 2FH8A 4H88H 1QNZH 2Z93B 1MJUH 3ESVF 2Y06H 4ISVB 3H9SA 4G8EB 4PWEA 3GJEB 4UANA 2HX7A 1YDPA 4HIHB 1MCSA 2P80A 5KS9E 3CBJB 3QJUB 4FGMA 1PX4A 1JGEB 3N1GC 3PL6D 5I75C 5A6MA 4PJAB 1R3LA 1WD9A 3V6OC 5K9KB 1FC1A 3NH7H 3X13A 5DLMH 1A1NB 1SJEA 4KHXL 3MACH 1YUHB 3K5RA 1S8DB 4P57A 4AV0A 4KDTC 1L9QA 2DQTL 5JPNA 3PV6A 4MXWH 2NY0D 9PCYA 4FC3E 1P7KB 3WFCH 5GGUA 3BFWA 2NQDA 3MBEB 4WDIA 2V9TA 3JWDL 4P46C 4PJBE 5E8EA 4XN4A 5I17A 4WHDA 4YUEL 4D9RE 5FGCE 2AJSH 1E43A 4XWGH 4KUZL 1UJ3B 4I48A 5AVZB 1V5JA 1HXKA 1M3IA 4F33A 4MMYA 5HYJE 4L29B 5GRVK 2PXYC 4Z7WB 4X5XA 3RTQD 2X4TA 3HI6L 4OIAA 4PJCE 4PJXF 4M1DL 3ESOA 3P54A 1ZXKA 1IJNA 3LZQA 3MLZH 4J12A 4U1SB 4GG6A 1VZHA 4DAGL 2F5BH 4ZSOE 5I0ZA 1WBZB 4KGJA 2ZKYA 1HKFA 5E7FA 1IGIH 2N1TE 4J6RH 3TBVB 2LOEA 3NA9L 1GGIL 5FYLE 1YYLL 3KJ4B 2AV7B 4JO1L 3DX9A 3LZNA 1ZVHA 3TBYA 1YNLL 3P2DA 1C16B 3VRJA 1BM3L 4FP8H 4Z7OB 2GBAA 1LP9A 1FLTX 1LL1A 3HUJB 2BSEA 5DJ2B 3DSFL 2QGCA 3MOBL 4EEEA 3L6FA 1QSEE 2IQ9L 4NQCE 2H9GA 5ENWB 1CZ8H 2AK4D 2WLIA 4ODSL 4BKSC 4ZTPH 3M7OA 1KTDA 1NIEA 5FHAH 3I6GB 1IGYA 2XN9E 1J88A 5C0JB 5GS1A 4JS7A 2APXA 4MKMA 3ZE1E 4P5TC 5J11C 1NANH 3BPOC 4F57H 1DFBH 4O5LL 1C9SA 2JB6B 1SMDA 5J12B 1Q1JH 3GSQB 4Y4HA 5BRZA 3S4SA 1DQLL 4OCRL 3B2DC 1A3RH 1QLRA 5BQDA 3VW3L 2BDNH 5FKPA 2XA8H 4LEXL 3DUHA 4I3GA 3HPJA 5CIPA 1S9WA 1A6ZB 4A7QA 4CMHC 1G1OA 1UXMA 1UA7A 2ZCZA 1OSPL 5AUMB 1G7HB 1FNEA 1VZIA 3MYZA 3PXHA 2ZYSA 3ECBB 3RVVC 1S9XA 3QR1A 4KY2A 1OB1B 4QYOA 3GSOA 3T0EB 4M8QB 2QEJA 2BY1A 4XP1L 2PUQT 4R97B 2ZUQB 4DP0X 5C0IA 3QJFA 4XVSL 4PRPD 3MFFB 3VVVA 4HUNB 3KNBA 3V0EA 1RK1B 2RHEA 1QHOA 3TIDB 3CSYB 1BYPA 1ODUA 2XVBA 1A4KA 2OI9B 4HKJB 1CE6A 3RKDC 3UAJC 3ZTNH 1NCHA 1S7UB 2FX7H 1EJOL 2YAHA 3T4AC 4H20H 1NZRA 4JPQA 5DHXB 4ZPVB 2XIBA 4LEEA 1UFGA 3HN3A 4MNQA 3T2OA 3CDZA 4RGOH 1I4FA 2R9HD 4HAFA 2J8HA 3MMEA 3E38A 2AJUL 4X83A 1VPOH 3N40F 1KN4H 3PGCA 4RMUA 1DVFD 4Y19E 2YGNA 3HE7B 4OSUL 3LKOB 4ZMOA 3TBBA 4OZGE 5KUKA 3H2PA 3AWFA 5F72S 5I1GH 5IMLB 1CDCA 3DOSB 4ZMNA 3CFDB 4HWUA 1NDGA 4KHTH 2IOOA 4Q7DA 1ROWA 5GGSB 4BCXA 5DHVB 3UTSE 4UZUA 4FFYH 3QUYB 3R8BB 1BWWA 5EEVA 4AT6B 3L3JB 5E0QA 3UC0L 4LP4A 4B9ZA 3IAPA 4PBDA 3HBQA 1O9ZA 2APVA 1CS6A 4GAFB 5DJCA 1S9YA 5F3BB 1NCTA 2PABA 1RZ7L 5BUAA 3K6SA 1XL4A 2ARWA 1A9BB 5CLZA 1NLDL 5I6XC 3WIIL 4LLDB 2ZXEB 2YUVA 1S7SB 1QRNA 4ENED 3K6IA 1NKGA 1MCWW 2WBJA 2WIIA 3L1FA 1U8NA 4JREC 3ZKXC 4GEJA 5EUOF 2P8MB 3UACA 4PRNA 4ZAKA 3CFCH 4EDXA 1BFOB 1RMFL 5ALBH 2O5XH 4XC1L 2I7SA 4JN2B 1SBBA 3ULVE 4JK0D 1L0YA 3DHPA 5FW7A 3BKYH 1MAKA 2J55A 3JTSA 2R15A 2IAMD 1YEKL 4X9GA 2XY2A 4CW1A 1AE6H 1RP8A 2EVGA 1GYVA 2QTVA 2EDMA 4N0RA 3MCLL 4LNRA 3VCLB 1WA1X 1HX0A 4B3VA 3DJSA 2DYPA 3GSVA 4IK7A 3SYOA 2Q8BL 4PJGB 3NTCH 2OBGA 5FKAA 2A4CA 4IRJD 2IBGA 3SE8L 5J6SA 5DO2D 1D5XB 4B5ZA 1Y6KR 5MI0B 5BW7C 1WITA 3CJJA 4C54A 4RISH 1UYWH 1UT1A 4ODXA 1JVOA 4DSYA 2QSCL 2QGDA 3DTXB 5D1ZB 2WB7A 5I1CH 5I30L 5J6HB 1TEYA 3RL2A 5FM5M 1F3DH 4TSCL 3O3BA 2FWOB 5I16A 5IROD 1TXKA 2AVGA 1NCBL 1KT2A 4EIGB 3OJDB 1NKOA 1D9KD 2J44A 3FL7A 4HX1B 4O02B 5IB1B 1P5VB 3ZRFC 3BZ4A 1FGNL 4QRPA 3G5VA 3O8XD 4EUPG 3O3UN 3MRJA 4QHMB 4X99B 4AM0B 1YCSA 4X6BA 3QUML 3V4LA 1BIHA 4XPBH 2NY4B 5E1IA 5L8JB 3OQRA 5I76A 3NAAH 2MTPA 4QLWA 4O58H 5E70A 5LCVL 2RFXA 4G9FB 2BS8A 4KMQA 1BXUA 5ICZB 4UV4L 1QZNA 2V3FA 4QY8A 3MNVB 4GBXA 3NIGB 1IL1A 1ZT4A 4NENB 1WWBX 5FYJE 4J23A 3SCMC 2X3BA 2VSDA 2YEZB 5MENA 1UM6H 5DJZA 1H3XA 3II3A 2WAHA 3VXTA 2JLPA 3GGWA 3L7FA 4MDJA 3JTTA 4XMLL 1SPDA 3B2XA 3W3BA 2NZ9D 3E1ZA 2V9RA 3AU0A 5CHNB 2XPGB 1B4RA 3ZW3A 1JFQH 4OIBA 1RKRA 1PZCA 3D0VA 1MVYA 1G1CA 1NGXA 2Q87A 3G04A 3ZRCC 3OD3A 5E99L 2VKXA 2CJ3A 2X4UA 3C8HA 4LL1A 3RWIA 4JG1L 1CGUA 2WY3B 4KPHH 3GB7B 4JVWA 1HN1A 1RU9L 2JXMA 5KW9L 3ZDXF 1JI2A 1FFOB 4HUWB 1OTSC 3FQWB 5CWSB 3DGGA 1EGJA 1NWOA 1FL5A 3E80A 3GK8H 3DJZA 3WMSA 5I6KA 1VGEH 5DF0A 4OZHB 1PQZA 3BH9B 1M7IB 3NJLA 5JW4M 1Z9SB 2J5LC 3SY6A 1UACL 4EIZC 2RJMA 4JFYA 3H56A 2A6KB 5IW3A 1AGFA 3O3DB 3NFNA 2WWMD 5HYIA 4L1LA 2OMWA 4WO4D 1IB5A 3RKPA 4W6XB 4F9PA 3MCKA 4P48A 4WEUD 5L88L 1D5BB 4ES9A 3KPPB 3P9LA 4DPRA 1KACB 4YHLH 2CMRL 4JDZB 3FZUD 1VF5C 2AJZA 5I1IH 2GSGB 1H5BA 1NIBA 2EXWC 5CZRA 1XWVA 4NHCL 5DURB 5HY9B 3O6KL 3IYLW 4FYSA 2PKDA 3VQ1C 3VM5A 4UNTA 2DQUH 5HI3C 1X4YA 4ZW8A 5JORB 1Q0YL 3VFPA 1QLEH 3N5AA 4TSAL 3MRQB 4JZOB 3GQFA 4EXKA 4M7KH 3WTVA 4WCYL 1LWHA 4J8QA 4UT9L 1NAMB 5HPMA 4HLZG 1AY1H 4LHQB 3SE3C 5FGBA 3NIDB 1OE2A 3NPSC 1E65A 3OJVC 2OMVA 4FZ8L 4WKZB 1P7BA 2O6FA 2X6UA 1HCVA 3CXHJ 3V4VH 3KMDA 2IGTA 3C5ZB 4HKZA 4K3DH 1NGPH 2Q8AH 4A2DA 1X5YA 3GXUB 1BVNP 2BRRH 2HT3D 1ZS8B 1LDSA 1RK0B 2ZUUA 3R1GH 4RFEA 5F7LB 2WUBL 3MX0A 1KB5A 3BHBB 5KANG 5F9OL 5LGYA 4X9BA 3U6XS 3HCVB 3QNFA 3SDXA 1N4XH 2DQCL 3D48R 1YQVH 2ZCHH 3K1KC 4Z3EA 1BGXL 4G6AD 4S2SA 3AT0A 4ONHA 4D9LL 3DX7A 4DZBA 2BFGA 4E9RA 3STLA 3G7TA 3REWB 1MFUA 4G7YH 4S1DD 2P45B 1J9CT 1ZV9A 2FX8H 1IAOB 2XCMC 4LQ1A 4LCCA 3SDCB 5B39A 3L3HB 5BVPH 2BK8A 4FQIL 1NDMB 3GSUB 5HVHC 2BNRA 1MFAL 1MIMH 3FUMA 2TRYA 4WUUA 4YWGH 3S2CA 1PDKA 2O93L 4U3XA 2EZ0C 5ACZA 1HXMA 4KKCD 1EFXA 5SWSD 2CR6A 4BZ1H 1DJZA 4JVUA 1YMMA 2IPKA 3BZFB 3UFIA 1XH1A 3MUJA 1BJMA 1KTBA 3OKMB 3L1OL 4HJTA 1M1SA 2WXMA 4OD3H 2GFBA 4U3SA 2H26A 1D6VH 1GKOA 1OAJA 2X4PB 4U7MA 3RX9A 1PD1A 3LZPA 2ZXCA 1R3IH 4XVJH 3O2WL 4ONFH 3QUXC 4FFYA 4AXWB 2IAAC 5F3HA 2CJUH 3QJHA 2UXFA 3DECA 1ZEAH 4R7NA 4RVBA 5DD0H 3CLFL 5JIHA 3UPRB 1A5FL 5FAAA 5C08E 3MJ9H 4WUKH 4X6CA 2C7UB 3BAWA 3RVWC 3MV7E 5E7BA 2IFFH 2AQRA 1JGUH 4HIIB 5AKRA 3VXSA 4BQBA 1C5DB 5GS0L 1Z9NA 4OAWA 1AQDA 3KGRA 4OZFA 4U31A 3AREB 3GTTA 2CLRB 4QRUB 3N44F 4PJ7B 1RUML 1UVQA 2P5WA 4FHJA 3E2HC 1EEZB 3QJVB 4NKMA 1PU0A 3HVNA 2A6JB 3L4XA 4Z9KB 1EZUA 3QJXA 2A6DB 3DO4A 4WHYG 4W9LC 2UX6A 3K4DA 4F91B 1E5AA 2ICWA 3H53A 5LAXB 3GRWH 5LG1A 2MH4A 4IK6A 4EZMA 1PSKL 1BWMA 4JFEB 3P4NB 4P3WA 5IWLA 3AG2B 2AXHA 3BVUA 4XTRC 3A67L 1J9RA 2Y22A 3TCLB 2HLEB 5C0AA 2WXHA 1KBGL 3BPLB 5DC0A 4DEPB 2AS5M 4RMQA 4NUMA 5MEOB 4ZZFA 4RQQB 2XPYA 5FB8A 3S35H 3FN9A 5I6OA 2R4RL 4JANB 4KUCF 2AAAA 1U8HA 5AKTA 5CN1A 3ARGA 3MUGB 3I74A 2DJ4A 5DFWH 4IGBA 3V5DB 3X14A 2X4RB 5DYOB 5G5DB 2IDCA 1I8LA 4L8DB 2Z4TA 4ZTOH 3TNNB 1BEYL 5BS0D 3CDYA 3PWUA 5E9DB 2VDPL 2ATPA 3LKSA 5EC2A 4JM2C 1MPAL 2HLFD 3TYGH 1CFTA 1ZA6A 4AYGA 5D1QD 1CD9B 2HWZH 5HD8D 2QPUA 3COOA 3ELQA 4XO9A 3UZQA 1QEWB 3O81A 2X38A 4OF5A 2J6EH 3MKGA 4E9LA 1ZKAA 3QORB 4LU5L 1NBCA 1LO4L 2VXUL 4TMPA 1EEYA 1BBDH 2J8OA 5I15L 2EDXA 4AY0A 1UFUA 4L0ZA 1G6RA 1H19A 2WXRA 2YLHA 2ZOKA 4M61B 3UERA 3WGVB 2CKBB 1MAMH 4XNYL 3QRGL 1SRDA 1UOWA 3GSRB 5IK3A 1JGLL 2IWGA 2PMZA 3P02A 1SFHA 4TF4A 2KPNA 4PG9A 1OGTA 1XR9B 2HUEA 1URZA 1USQA 1WFMA 3DSNB 4PU2A 3VXME 1PGRB 3IGAB 4QCIA 2R1YA 2BP3A 1P1ZB 3NZHL 3ZMNA 3KYKL 3BSHA 3HZ3A 3QZBA 2DZEA 4JHBA 4AI7A 5DZPA 4DP7X 4HKBB 4X8XA 4BQCA 5AKSA 5HHOD 1HL5A 4JY5H 3X17A 1ZDQA 3L3IB 1RZGA 1OANA 2NTFA 3WLWC 4JFUA 5C0DA 4XNUH 1L6ZA 1KNOB 2R69H 1VFOA 4RIRB 7PAZA 3AS1A 4IRSB 5INCB 4WEBH 1JZ4A 3H4FA 1NCCH 1U41A 5HHQB 4JFDB 4JPKL 4U1MA 2JCCE 4BK4A 4P05A 4ZXBD 4IOFD 2FJHB 4HHAB 3EDDA 2H8PB 2FDBP 2BHYA 1BJ1J 4KITB 2XWRA 1M71A 4YSQA 3PY9A 1TO5A 4H8HA 1CLZH 1QX1A 5E2VH 1AKJB 5DEJA 3R4RA 4QHPA 3W11D 4BK5C 5K5YA 3C8KA 2D31A 3P0VH 4YNYB 1VGKA 4WJKB 5DLLA 2BNUB 5IV2A 4BH7A 1TF4A 3S5LA 1ZLDA 3ILQC 5I5JA 3VWKA 3MA7A 4A6YA 3RY4A 3FF8A 3EJZD 2JJTC 5H2BB 3FQRB 1T7YA 2Y7SA 4L3EE 4PSPA 2BVQA 4NQTA 3B1UA 3ILEA 2VMEA 4FNLH 4Y5VB 5ITFB 5TQ0H 5AFAA 4EN3A 2DWXA 4WFGE 5GZOC 1GKEA 3O6MH 4Q89A 5CZXD 3V9FA 3LS4L 3TEWA 4MAYD 1FO0A 3U0TA 3QDMA 2RR3A 5ICXB 1MLBB 1EAPB 1V05A 2WQXA 3CVHL 1IX2A 1FRGL 3GLZA 1NCAH 4XCNA 4LVNC 4L5FL 2V3EA 2BCKA 5JXEC 1P2CA 1EEUA 3MRDA 4P2QB 4BKLA 3E9TA 1RUAH 1LWJA 4TUKH 1YEHH 4B95C 3I3BA 4L37A 4YDVB 3PDOA 5I5RA 4FNRA 5DJXA 2F61A 1JPSL 2FX9L 2WD0A 4DKTA 3SY0A 2XOTA 1FWXA 3B9KC 4MA3B 4LXFA 1DSFH 4UUJA 3ZGIA 4F5CE 4HS6B 3NFSL 4LRIC 4PM1A 5LXGL 1TSHA 3PG2A 4I88A 5LGHL 5FYLH 1OO2A 3LIUA 4I3SL 2ITCA 3U46A 4YO0B 4YQXL 3UX9B 5H37G 3Q3GA 3L3DB 4KVNL 1R5WA 5HGAB 3CDGB 1GZPB 2Z6FA 3CWGA 4LHUG 1AS8A 1PLGH 4NQVA 2HXAA 2J8UA 3R0MA 3UH8A 5HBBA 1FZJB 5IBTH 2BP8A 4M6OL 4N90E 1CGWA 1MW0A 2HLAA 3ATDA 3TPUB 1RHFA 2C9PA 4JVPA 4LMQE 5L2KB 2EUZA 2IMNA 4YGAB 5IMKA 4YBLC 3FN0L 3QEQE 1K8IA 4WQOA 5KYXA 2EEXA 1RL1A 4MDIA 3ARWA 1PZ3A 1L0QA 2E8ZA 3EYFB 3OXSA 3QDGA 4ABUA 4J2QA 4CVZA 1IAKB 1TG8A 3QIWB 4PP2B 3RDTD 3ZTEA 1CGXA 4PH8A 2GSMB 3CZNA 4JKWA 4X5PA 2W8CA 2XNAA 1RI8A 2DQIL 2OP4L 2R2BA 2YJLA 3L4UA 5AZEH 4ANUA 3LZLA 2BSRA 4QRRA 1OF2A 4KNUA 4EUPH 2Z91A 4FABL 3CC5B 3ZT5A 7FABL 3ARDC 4PLJC 2H7WA 1V7NH 3DVGB 4PPTA 3FUEA 1D5IH 5L7XL 5BZXA 4O02H 1BMWA 1GC1L 3K74B 3Q5OA 3HS9A 2CGZA 2R29H 1V7MH 2PCXA 3FDWA 2TRHA 1UTDA 3MBWB 3K4AA 2A0LD 2GTZA 5FYKD 1UH4A 2B7DT 35C8H 4GUCA 5KVEE 4FN0A 1GOFA 1HHKA 5ERWB 1NEZB 3UXFA 3BUTA 3CFEB 3WXVL 3ZZ1A 1RIUH 4GB9A 3ABZA 4OIIH 4U6TA 5C07D 3EYOB 1AZZC 1K4DB 2Z64C 2JMRA 3CK0L 2XG4A 3MRIA 4Y2OA 5DRWB 1ZVSA 3UYRH 3OMIB 4NWUH 2WINA 5GXBB 1ZANH 2VXVL 3FRPG 4H8PA 2DLIA 4HFUL 2DTMH 3TTSA 3ZMRA 5IVXB 3S3CB 3LHAA 3BPCA 1TKWB 2OTWA 3SD5A 5I66A 1C5BL 4XHJC 3PWJB 5F0PB 1J86A 2WVUA 3WY3A 2IBZX 5GRUH 2IH9A 3N41F 3QDJD 4UM8A 1EERB 5AOJA 3PCYA 3WLBB 5ESVA 1MXGA 3MRFB 5CJ8A 3HAEG 5GISH 4JY6A 5CNHA 1QFWM 3DX6B 2O4EA 3PQYD 4HXBH 2E74C 4WFEE 4GO6B 4V1DA 2W0FB 3KL5A 4K3EL 3AM8C 1H3PH 3GO1H 2HJLA 2XV3A 2YK1H 3L2NA 4RGMB 4YFEA 3D85D 3E6HB 5D93B 1OGAD 1KENH 2E7BA 2BC4B 1CDYA 1NH6A 3CU7A 2JKIS 5I28A 43CAB 4UQAA 3N40P 2VXSH 3ZMEA 3LKPA 1TQCC 3TVMD 3WO4C 2VUKA 2QTEA 1IT9H 4U7KA 4ZQTA 1CFQA 3U79A 4LFHD 2W0LA 1UXWA 4IM8A 4JDTL 2HMIC 3G5WA 4JDVB 2Y36L 1OLLA 1BVZA 2B77A 4QHUB 3SPVB 4YLCA 2VC2L 1SY6L 3BC9A 1U3HC 3V0FA 1NPUA 1BIIB 1JP5A 1XGQB 3TBTA 4BE6A 1YN7A 3F5WB 4JO8A 1E40A 1TETH 3NSYA 4B53A 3FYIB 4KTGA 4XMTA 4B9CA 2AC0A 2WUCH 4PGZA 1T83A 1DP0A 3CU1A 5FO8B 1NBVH 2HT4D 1FE8H 4UT6A 3ULVH 2FTAA 1NC4B 3U30B 3QUGA 1ZJAA 1U4FA 1WCBB 5HDBF 3KPSB 3VXRA 2YXWA 3C60A 4XN7A 3QUMB 2FGWH 4WK4B 4HJEA 4GLRH 2BOCA 5D7LD 5C2UB 1WT5A 3VD3A 3JV4B 4H1LG 3O6FA 5IQNA 4PWHA 2HX8A 1T7ZA 5ESQA 1NKRA 3DMMD 4NN7B 3PJSA 3GKZA 3L1EA 3WBDA 2YWZA 1IE4A 4NP4L 2R0WL 1GGTA 5BQ7A 5DI8A 1OM9A 5E2UH 2G5BA 2L04A 2YMXL 3UTTE 4GMSL 4Y9CA 4GQZA 4IU3A 5BV7H 4ODTH 5E08H 4QRSA 3NCJH 2YLKA 1K4CA 1TFHA 2DMHA 3LD8B 2JKTM 2P43B 5GRJH 1N0XL 3SEPA 4C56E 5SWZA 5T3ZD 3OLDA 1F8TL 1OK0A 4L9LB 2K8QA 1NSNL 1N67A 2NYKA 3M8OL 4UMSA 5GSVB 5F7EL 3N1QC 4DGUA 3BZDA 2PO6D 4G7QB 4GS7B 4ELKA 3I3DA 3V4PA 4YHML 1N5YH 1FNSL 4ZNEE 2EYRA 1JHKL 5DJ6B 2CG9X 2HFGH 4C4KT 1MHCB 4UDTA 3C2AL 5KS9A 4YIQA 5CJOH 2YD8A 3MTXA 3OGCB 1E30A 3QUZA 4LDEB 4FXKB 3FT4B 5EU6D 3U9UB 5IB4B 3KPRE 2OFQA 4OI9A 4OF6A 1UKSA 3JV6B 5FYJH 3ZXAC 4BUQA 1IARB 3MRKA 4A2MA 2JK5A 1AI1H 2AJXH 1A4BA 4GXUN 5F96L 3U4BL 4AQOA 1A4CA 1YEGL 1P1VA 4GAGH 3NZSA 4GRWB 1ADQH 3OKOA 4JFTA 4N0CC 1UENA 2PF6A 3P77A 3AQYA 2IH3B 1M7UA 4MQ7A 3G3LA 1UJ3C 3V7AE 2F5AL 2LABA 4U1GB 5I1DB 5AVQB 4YE0A 5TH2A 4PJFB 3OHXB 4JAMB 4KKPA 3CPLB 1MFDH 3BCFA 4FA6A 4ZOCA 2OX5B 2UYLA 3QXVA 2UUDH 5D7SL 5BMFH 5HVGB 5ITBL 1BYOA 1K5NA 2GTQA 2D7TH 4NZUL 1QBAA 4EDWH 5DMGC 1DJSA 2X6CA 2XWDA 3O2DA 4FADA 4W4NA 4A39A 2R8SL 1AHWA 4OTXL 2DH2A 4L1HA 4WHYH 5CEZH 1JUFB 3HS0B 4L8CB 4KO6A 1HHIA 1J5OH 5CLXA 5IVZA 3U0WH 4JM4H 2TSBA 4EJ1C 2C9UA 2CO4A 3WG7B 5A3ID 4DPAX 4QRQB 1J1PL 2E6QA 3CXDH 2D7NA 3KYNB 4MBRA 4ANVA 1O6SB 1I9IL 4JPWL 5EBWA 4ELMB 2WVVB 4AEEA 5C0BE 4JKLA 5E6YA 3MNDA 3FSZA 1GZHA 1OWWA 4ATTA 2KLTA 2X4OB 3PE9A 4HSAC 3DNKA 4NWTL 2Y7LA 1R4XA 2OL3L 1XL6A 4MS8D 4KMLB 2I9TA 3PPSA 1ADWA 2GT9B 4U1JB 5L6YL 4PB0H 1T5WA 2QL1A 2E0PA 2R0KL 3QO1A 4FFWD 1ZT7A 4XNQA 5J12C 2XN9A 3FO0H 1EXHA 2WMPB 1JNLL 4I4WA 4OFYA 2ZUTA 2AVFA 3SB3A 4OD2A 1J8KA 3CZKA 3T5WA 3NSJA 3BFQG 3VFGL 1O7DC 5IHZB 3D33A 4HCGA 3MA9L 3QG6B 3OLGA 5EOQH 3ARVA 3LKNA 4YZFE 2V7HB 3T6XA 1IGFL 4MA1B 4TM9A 2YJQA 1HHHB 2BNQD 2VR5A 1PG7X 2FO8A 2VDRL 4L1BA 4IMLB 3T0EC 3ARBA 1JGIA 1TJHL 3DK2A 4YDKL 4J3OG 4OV6F 4R97C 2ZUQC 5KVDE 1GTFA 4GAYB 3E8UH 5IBUB 1DN0A 4GAJH 4RWHA 4NO0A 4GJTB 3ZKMD 4FA8A 4WI3A 5TE7L 1RPKA 3GXMA 3WIFB 4GO8A 1QTYT 2OI9C 3GEFA 4RDQF 2VN6A 5JIKA 4KX9A 2V17H 5D72H 2OXHB 1HDMB 4U1IA 3UTOA 2LQRA 4LLYA 4H26B 3QAQA 4HBCH 2OTUA 3FONB 4M1CC 3NSCA 2BP0A 4XMKH 5C86A 4G9DB 2NLJB 3AVEA 5HGDB 1CGTA 4RNRB 3IPBA 3WEOA 4JRXE 1AXIB 1MFBL 2Q3AA 2EUVA 1P4LB 1A3ZA 1KLUB 4FQJL 3HE7C 3T0WA 5E5UB 1J05B 2YSSA 4NAJA 2ZXBA 3KBFA 3LIZH 1ND0A 1TQVA 5EEXA 1NOLA 1T1ZB 2HFEB 3ME0A 4YBHA 1I7RA 3BKJH 1DUZA 4Y19A 3OZ9L 4JFHD 4YSOA 5DFVC 2NX5B 5TDOA 2D2CC 5C71A 2PW2A 4PGDB 5EFIA 3NEOA 3NK3A 3V6ZB 1KFAL 4CC4C 2ENJA 5I5MA 1XO8A 2OK0L 2CO1A 4F3FA 2VIRA 4HXAL 4L2LA 4HETA 4P99A 3OMAB 3IS0X 1OCRB 2DQTH 4WU5B 1KCWA 4ZFGH 5LBSA 1EPFA 4NUGL 5IB3A 3V7AG 3ROLB 1G84A 3EYQD 2FT7A 2VZSA 4XBPB 1FZOB 2GJZA 1YEEL 1ORSA 2FUQA 1XF2B 3LRSA 5I1LB 3WEAA 1WFJA 1G9MH 2NY5L 3B6SB 4HWZB 1PVHA 5AALA 3A6BL 1HVXA 3DETD 4JY4B 5CCKH 3MNMA 3VDAA 1I1AD 2H4EA 1JPFA 1SXSA 3BAEH 3KHOA 1GGBH 3FU7B 1G0YR 3QZOA 3Q1EA 1U21A 3PIQB 4UTBH 4BFJA 3VXOA 1OOAA 2E7LA 2I5YH 1M7DB 3C6LA 5KG9B 5DQ9A 1HU8A 2X41A 3ZK0A 4XR8C 1HIML 3VFTB 2UWEA 3FF7A 2VDPB 4ZS6D 3PUCA 5D1XE 5J9PA 3GT6A 4EKJA 4ODWB 4PYHA 3BE1L 1S7TB 3X12B 2VE6B 3QZMA 1OPGL 2DRUA 4OLYL 4M4RA 3WCYA 4M8RA 3MV8E 4B6ZA 4U6XA 2GAZA 4IRZA 5MI0C 1F6FB 2CNYA 2AMUA 3KPLB 4HCFA 4L9DA 3MOBH 1VACA 3P4LA 5JXAL 4FLOA 5DHYB 1IGCL 4IBUA 4BINA 2WQAA 3RWHA 5D1ZC 4MD5A 1SYVB 3CVBA 5ICYA 3VXUD 3FO1A 2M83A 1F00I 4PJ5E 5CD5C 1NCOA 2ZCKH 4ZUSA 1U8MB 2CCWA 4KZEH 1QKZH 1WWWX 1F4YL 3PL6B 1I8KB 1OT1A 4O5LH 3OKLA 5E03A 3HC4H 5TE6H 4NKIL 4W70A 1Q9LB 4HBQA 1I7UA 2XACC 2K9FB 5LN4A 2GW5A 3LSOB 4Y2DA 1KV3A 1QFHA 2NY4C 3VW3H 3HKZA 1T2JA 1NM9A 4FNQA 2QPSA 3RVXD 2NY0B 2R1WB 2CZNA 3RG1C 4HJGA 4IBSA 1FYTA 1ACYH 4B41A 3LCYA 3TA3D 2NQCA 3IDIA 4D2NA 1DQML 1O6VA 3TIEB 1YN6A 2I25N 3VMOA 4UIMB 2AXFA 3RNKB 5JHLL 1QNIA 3TN0A 5IB5B 2PXYA 1OGSA 2F53D 5HHPB 3T2QA 3CMOL 3VQMA 4XP1H 1GYUA 4E42B 4GW5A 3HMWH 4M62L 2WKOA 4N2FA 3RTQB 4UQ2B 4J8RB 2X4SA 5L9DL 3G5ZB 1E9OA 3LYRA 5FF6B 2JVUA 1F13A 1LQSR 1QRKA 2VH5L 3MUHL 4JCLA 5IR1A 1UB6B 2L7JA 3HZVA 1IIKA 2V5SA 2W81C 1ILUA 4Z7NE 5JTWA 1MWAA 3VE0A 1JPST 3ULUC 1JIBA 1AGCB 2DJSA 3N9GH 2BZCA 1KCUL 2XTLA 1WFOA 4A55A 4KO9A 4L8BA 4UYPA 2OYPA 4PCYA 4MLSA 1R17A 4DVRL 1JXGA 3B7YA 3FO2B 3Q1SH 4AYFB 1KJMB 4DKDC 4Q9RL 2EIZA 3AWEA 4XPGH 5I1AA 4IBTA 4XGZA 1J8SA 1LNUA 1BZ9B 1MI5E 4IIQA 1V3LA 2AK4B 2R1XB 3KD4A 3TJHD 4LL4A 3ZDYB 3CVHB 5D9SB 4P5TA 5DJAB 4L0YA 2CUIA 4QKXB 5E4EB 4GQ9H 2I7OA 5E94A 3KG5A 4JN1L 5HI4D 4Q97A 5T3XD 2Y23A 1TZAA 3C87A 2JF1A 5IP4A 4JQXA 3WIAA 3BD4A 1X5XA 4AMKL 1U8QB 1T6VN 2ZXAA 4JJ5A 1B2WH 5CSGA 2EVJA 3FH5A 1XVSA 3QIUB 1H6UA 1MNUL 4EQ3A 3D3VD 5IQ9A 2X2HA 4JGUA 4BIKA 3DROB 4X4YA 3T0AA 1KELL 1EJFA 1CK0H 1RZKH 2OR9L 2QVTA 6FABH 5A16B 3OAZH 2ZYHA 4O4YL 4RA3A 2FQFA 3MGTB 3ES6A 2FIRT 3EDEA 4PRPB 1UQSA 5AW8B 1Y7VA 3ZZQA 4WV1A 1WYJA 3JWNE 4NQXB 3FHEA 4YVUA 3QXDA 1P5UB 1DFXA 1GIGL 2BOBA 4L4TE 1T66C 4ZMYA 3VD4A 5I18L 2Z0UA 1BD2A 1Y07A 1M6OA 3HVDA 2A74B 3PWVA 3NJFA 4YFDB 2WWKO 5IFJB 5C9JB 3T3ME 3TEUA 3BJ91 3SGEH 3U6RA 4WI5A 5C7XL 5DD1L 1JK9A 3S2AA 2XVLA 1DVFB 2V2TA 5F88A 3TBWA 3B3BA 5E2TL 4GUPA 1HINL 1P4BH 4AG4H 1S9VA 1S6NA 3HC2A 3LEYH 3N1FC 4PRBA 3SDCC 3OSVA 5KEZA 3S8FB 5EOCH 3HG4A 1EDYA 3DV4A 4XCFH 1OAXL 3BRGC 4LBEA 1MHHA 2XZCL 4XPAH 1FGVH 1GL4B 1PZ5B 3NIFB 2MQ0A 1D5MA 4JPVH 2WANA 4X8JA 4AIOA 1FAIL 1UB5B 4IDJH 3NJGA 1GSKA 2WXNA 3N43F 4KKAD 4UF7C 4AKPA 4NC1E 4JO3H 2AJ3B 3WXWH 4Z7IA 1TR7A 3QH3A 4FNPA 2Z7WA 4YK4B 4XE0A 3TPKA 5AL0A 1DVSA 2GCYA 3H9HB 3O9WA 1CN4A 4KKLC 3MLXH 3QNYB 5LCVH 2P80D 4PJEF 1YY8B 1FIGH 1JRHH 1OB0A 1CFBA 5C3TA 1R5IB 2MJWA 4TVPD 4G6JH 3NCYP 1YLBB 5B1CA 3QJOA 4UTCA 3MRCB 1WAAF 3CFBA 1XEUA 3QA3B 5CP3H 3RIFK 3SQBA 4UV7L 1X5JA 2IH1A 1K85A 1Z9MA 4OVUA 3BQVA 2CO3A 4N2IA 2Z4QA 5FW8A 3S3JA 2FJGB 3VX0A 5BCAA 4ABQA 3TWCL 4XMVA 3WELA 4YDJA 2K4AA 1LEKB 3ZL4L 4UINL 4XPHL 1CLYH 1KTRL 1U2YA 3AREC 4GRMA 5G55A 1T3FA 5KVEH 1B90A 5E99H 1ZV5A 5CKGA 4JG1H 2BFVH 4M7JL 3VH8B 1P0SE 1BQHG 2QPDB 4LSUL 4R90L 5B3JE 2EDLA 3MZGB 3T0BA 1AP2A 5L4JA 2HN7B 4IRJB 3MRHB 1Z6JT 4YHPB 1TQSA 4TVSa 5GRXG 3QFDA 3SYAA 2ARJB 2Q76B 2V7NB 1KLFA 3HA0A 5CFHA 1AZNA 4NYLB 1PKQB 5KBMA 4Y1SA 1UKQA 2ZXGA 3IMTA 3EFDH 4I2XE 4NPYA 4AGLA 2VDQL 4HCRA 4HWNA 1X6LA 3BPLC 2UXGA 4MD4B 4DEPC 5K9OA 5DK0A 1G1KA 3X3GL 4F9LA 5IKCB 1I75A 4G7VH 2KYIA 3US0A 2VC2B 4YHKL 1A3QA 2FL5A 4LT7A 4ZW5A 3ULAB 1A02N 5H35B 3IVKB 3O8XB 4MQXC 2DLEA 3LEVL 3LPWA 3F58L 1J5CA 1MFCH 1JV5A 2EXTA 4MA7L 5DRXA 2CIIB 2XXMB 3AS0A 4LSQH 2V9UA 4P06A 4L8SB 4UDUB 2ATAA 4K8RD 2GQHA 3RUGE 4PHXA 2FR4A 4NHCH 1KCSL 3OKYA 3NACL 2PPFA 1RFDL 1A7QH 1B3JA 2K3HA 2K70A 5C0NC 1DQDL 2XBZA 3FQTB 5DEGA 4AX3A 1AJ7L 5HHMD 1DL7L 5GRVL 3S88L 4LCVA 4N2MA 3B9DA 4FKKA 4FEIA 3UL4A 2ENQA 1T4KB 2F54A 5H37A 4LEOB 4Y4HD 1LMIA 3FU8A 3JWNG 5BRZD 5FO2A 2D9QB 3QORC 3BESR 4LHUA 3SOTA 4OGXH 3B2UD 5IFAL 1JPTL 1CL7L 3EHBD 4J28A 2XXGA 5AWNH 4XNAA 4F58L 3MLTA 5AW1B 4B7IA 3IDMA 5CO1A 3RWCB 1J1XL 5D7KE 1QVOA 1NFIB 1P6WA 1L9NA 2DM4A 3WSQL 5HJ3A 3WD5L 1ZTXE 3G6AB 1WEJH 3POHA 3RYMA 1R0AH 1QABA 4KH9A 3MRRB 4GXVL 4PMEA 3MV9B 4FFTA 3VXMA 4LDOB 4PY7A 3W5NA 5JYLA 4AQEB 2RD0A 3IU4H 1LE9A 5AW3B 3KGTA 4BBWA 4DKEL 3KE0A 2CLVA 1WHOA 2BIIA 1B0RA 2OMXB 2FBJL 3BDXA 4FZEL 4J3OH 2WO2B 2P4AB 4G8GA 3CHPA 1CE1L 3RWDA 3SGDI 1T2QL 3V79C 2X3AA 4ZDHB 5DUML 3QHZH 2DWEA 2W80C 4WO4B 4QGTA 1AXTH 1JV2B 4N2NA 2GI7A 4ODVL 3KW7A 4CN4A 4ALAL 3JWDC 2P24B 4Y89A 1N5AA 2DMGA 4R26H 4XODA 2JCCA 4LK4A 5J13B 4JZJB 2PETA 1M1XB 2CDEB 2J7LA 4LPYA 2VDNH 2TSAA 3FRPA 3P4MB 3UP1A 1TZGH 3GKWH 1EO7A 3CH1B 4U1HA 2ICEB 2ESVA 5CINH 5C0CE 4LQFH 2CDFA 4HIJB 5DCCA 4CN1A 3QEGL 3BGMA 4KXZI 3B83A 3MJ7A 5I8EB 1A5FH 5FK9A 2GJJA 1NC2A 3D8MA 3MLRL 3GJFB 5JOPE 2DQGL 3WU1A 4FKHA 2H2PC 4M43L 3HAEA 3CFTA 4Y5VC 1II4E 3CDCA 3THML 5AB1A 2XTJE 5LWYL 1ESOA 3A5VA 1FL3A 3MZTA 4TV3A 1Z5LB 2WBJD 1GS6X 4L3EA 2WP3T 4MD0A 1HEZB 2C26A 1UWFA 1WUNT 4MAZA 4HUVB 2CKNA 2Y3AA 4ZAKD 3SKOB 4APXA 4YSTA 2BJMH 4NPKA 1IBGH 2CHNA 2VKWA 4RGND 5F7WC 1JK8A 1PSKH 2F8OA 2OTPA 4G11A 4K5NA 4B60A 4KZDL 2XQBH 5JW5B 3EYUL 1Q0XH 1C5CH 5HGHA 4BGLA 2VLJE 4S11A 2CDGB 4RAUB 2NW3B 4AQZA 1XSOA 1S7VA 4GW1B 1AIFA 3T0DA 1DBML 3ARYA 2E56A 2OL3B 2Z92A 5ACMA 2DYPD 5D2NB 2C1PA 2HPTA 3TH4T 1M53A 3C5SA 4LLUB 1D6EB 4MA8H 1HSAB 1FL6B 2O6CA 4RAVB 4BFGA 5AB0A 1NBZB 4YHNA 1KPUB 5SWSB 4AQAA 3QW9A 2OMUA 1YQ2A 3F8UB 4GIOA 4P4KA 4F2MB 4F5CA 5I1KH 1MJ8H 3ZSSA 1KDJA 2NNAA 4KC3B 4HWEH 4DHLA 2CPUA 3D09A 3CVDA 5D5ME 2MQGA 4X80H 4XP9L 2VDPH 3JQOB 1MPAH 3UZVA 1E9PB 4P2RE 1P84J 3UBXG 4XNMB 2VDRB 2XETA 3JZ7A 4Z3HA 2A7BA 3BKMH 4H1LA 5BO1L 3CPUA 5D6CB 4DO5A 3WKYA 4HS3A 1KBPA 2QQLL 1SDAB 4EZJA 3DPBB 4EXPX 1TU2B 3IFNH 2MHAB 1PEZA 2MOVA 3QEQA 1G7IA 2OMBA 4HP5A 2XKUA 5M95B 1ZLWH 3CTTA 4ZX4A 1D5RA 1EHLL 3BN9D 4X6DF 1H6EA 5EO1B 1JGLH 3GMRB 3K7UA 2HZHA 2BLFA 4GBXD 1S3RA 4ZI8A 4K5PA 2DM7A 2EE6A 5MEND 4GO9A 2DQFA 2ZP9A 5K39A 4RBPH 2XWCA 1IQDB 5GRYA 3TJPA 4QI3A 3KYKH 4TKWA 2HFFA 3ZQ9A 15C8L 2VLRE 1D5ZB 1JFHA 1RIHL 4DQOL 2WWNA 4OGAC 3X1EA 5KZCD 1DSYA 1NLBH 4LLWA 4CAGA 1U8LB 4E9SA 2Z7UA 5EEZA 1OD9A 5F93C 1TZ8A 2RA1A 3UIZA 2F9BT 2J1YA 3D9AL 5IEKA 5E8PA 5CF3A 4XZ4A 4OJFL 4QHNB 3ORJA 2ZKHL 3VFSB 2YRPA 2GJ6A 1W72L 1HSBB 3A21A 2AQNA 4ZNCD 4DWHA 1BX2A 2XFXB 3FAWA 3MLVL 1SJMA 2DQJH 2ZCLH 1XR8A 4NDMA 1NCWL 1ZLSL 1CL7I 1NFDF 3WJMB 3O0RL 3EBIA 3WL9B 3SDAA 3LJ3A 2P44B 3K8LA 4JHAH 3IKCB 1A6AA 2YOCA 3TCXA 5BS0B 4M3KB 2Z65C 1P4IL 3V0HA 4CNIA 1SDYA 1DBJL 1E5YA 1SOSA 4NNPH 2C5DC 1WGVA 4Y2NA 1AG6A 4BQ8A 1MRFL 2KERA 3BEWB 1F4WL 3VA6A 3L45A 4DTGH 5I0VA 5KBKA 5DWUH 1N2RB 2IOIA 1CUOA 4RGMC 3M1BB 4BWTA 5D93C 1HWGB 2DQDL 5FUOH 4PS8A 3K1DA 3KCPB 2XWJA 1YY9D 1Z2KA 3VXPB 1JZFA 3D39D 3CQPA 3VRIB 1WWCA 1E50A 3HBGA 5AD0A 2Z8WC 3TNMA 1MCOL 4ZYKB 1TFPA 3LS4H 5TGBB 5EIIB 1N7MH 2AXGB 4U6VL 2X7LB 1XGTB 1YMHB 1FRGH 4NRXB 1GHFL 3GS0A 1KY7A 1KYFA 1PLCA 4JFQA 2APSA 2AKRA 4QOKB 1RVFH 1I7TB 4M1GL 4C47A 5CLYA 2WLJA 3W37A 3DDFA 5KYYB 3WHXA 3D69A 1PL3A 3A22A 4MCZA 4NO2A 4RRPG 1LD9B 2BH0A 2VR9A 3D52A 5HVWA 4IYKA 2R0ZH 5BJTB 2R2EB 5JR1L 1KYAA 2JTYA 2UUDK 1BXAA 2OJZL 4G8FB 1RK7A 4UBDD 1I1RA 3U30C 3WIHH 4YDLB 5HHOB 1WDAA 5KSAC 1JPSH 1MDTA 1NM4A 3U7YL 1OZTG 5DHMC 4PWFA 3V6FB 3D07A 5EN2B 2NZ1A 4N0UB 2YKKA 5FUCE 1MVUA 1OP9A 1XGYL 2I9LA 2WLKA 3B2PA 4D0DA 3L4ZA 1TZHB 2O5YH 1I7ZB 4JPIB 1NMAH 2EDOA 3LV3A 4JG5A 5GGVL 4LLMA 4LAQH 4TRPL 5TDNB 3S0PA 4NO3A 4NQDE 4JM2F 4LGPB 1JZEA 4K94H 5AAWC 2CR0A 2B59A 4HS8L 2AI0L 1DDTA 4NN7C 5CR1A 3N91A 1L9TA 1T1WB 3GIZL 4N1CA 2CO7B 3NQKA 1DSWA 3CSTA 1MCEA 3EOAB 4LSVL 5B3SB 2BNRD 4EMZA 2JELL 3VI4F 4BK5A 2IGFH 3AAZA 4N2KA 4DO6A 4YE4H 1NGYA 1BXXA 3T2NL 4D0BB 4L9LC 1OZUA 3UTTA 1IAMA 3BUDA 2Q86A 1JHTB 1Q38A 2ICWJ 2PYEE 1FN4B 2JJTA 4H25B 2FJSA 2AEQH 4LRNL 5CCHE 3MYJA 4EAEA 3K8MA 2OP4H 1BZ8A 2VMFA 3IDGB 3EH3B 4ZFZA 4GS7C 2IDFA 1HCFX 2ED7A 4FYQA 1MKFA 4QXUH 4G1EA 4XVUD 2JSFA 4W9GC 1GAFL 4AW4A 1ULVA 2EJ1A 5IF0B 1M7XA 3BP5B 4MAYB 2OR7A 4R2GD 1HCYA 4ZFOA 4FJZA 4WFHE 4MHHI 4X50A 3LN4A 1QSFE 4XCCL 1KN2H 3LNIA 5E5LA 1JMZA 5DS8B 3NJJA 4Q2ZA 4FXKC 3SIKA 1TJGL 4P23A 4W81A 4Y4KA 3QQ3B 2XN0A 1MCPL 3VXSD 4AQ8C 3CFKA 3FQNB 1Q72L 4OLUL 1WHPA 2B20A 3H3PL 2V2WB 2P5WD 3E7JA 3B9KA 5BNXD 2D8KA 1OW0C 3SPJA 4A7TA 2FVNA 3BLKA 3OHXC 2P47B 1SXBA 3WNLA 4HQQL 2UVEA 3CSBA 3GTVA 4HUMB 4K7PL 2VLLA 3GMOA 4P59L 4G83A 1C5BH 1EAQA 1IBYA 3LH9A 2WZAA 4RMTA 4FQQA 1T89A 2WLHA 3ROOB 3BJLA 1A7OH 1G9NL 4FFZL 4KNTA 4A7GA 3SE9H 1PCXA 1MXDA 2XICA 2M8XA 1CVRA 1Y0LB 3HS0C 2W07B 4HK0B 4KI5D 4DOHE 4AL8L 3VFNA 1XCQB 1YNKH 2N59A 1PYWA 3L95B 3IU3A 2EINB 1K72A 1JN6B 1OCZB 2A9NL 3BT2L 3IAQA 2Z35A 4RZCB 1X7TA 1RD6A 1GZQA 3IXAB 1XH0A 3OX8B 3NCWA 1WICA 4HA1A 4KJQC 3I75B 1GJWA 3RDTB 5FV2A 3OF6D 4ERSL 2PCPA 3T3PF 3I6LD 2GKIA 4BWWA 3PABB 3B2VL 2YXMA 3GRBA 1CGSL 3W9DB 4GINA 3FB6A 1H8NA 4TNWK 3B37A 2QZ5A 5C0BA 5BVJB 1AO7D 3CZFB 1T0MA 1PLAA 2VAAB 4JDTH 4LCIH 2I32A 1ZHLA 2OMNA 3RWEA 1G4RA 2OZ4L 3C09B 2ZP0T 4BH8A 2V6HA 3V5KB 2EDNA 2GITB 4WWKA 4G7RB 4OZIF 4PV1C 4BHUA 4WW1B 2JQZA 8CGTA 4M9PA 4AW7A 1CO1A 1PW3A 3O11B 1WGOA 1FFNA 4KH2A 3VD5A 3O45A 5C07B 3SHSA 3JWNH 4MA1C 1H0DB 4TYUA 2YBGA 1H3GA 1NGZB 4TVPL 5CBEB 1OHZA 2BM3A 2F6AA 4Y16A 3UAAA 4IHOB 3FJTA 1FBIH 3MNZB 4AE0A 4OCWH 1GPOH 2WVTA 2I85A 3GI9L 3MGAA 4FTVA 1BZQK 5TQ2H 2WLYA 4MMZA 4LSPL 1WZ1L 3II2A 4LCUA 2NR6C 3BISA 1JVKA 1XZWA 2CLZA 1JI1A 1OVZA 1DLHB 1V54B 1KJ2L 4MJID 4U3CA 2D7PA 1XF4B 2C4FU 3QDJB 4GMSH 3N0AA 2W0PA 4PLKC 5DQJA 4OT1H 4V2BA 3VGFA 3RVTD 4PCTA 1K3IA 1TITA 1HC1A 2X87A 4K3JL 5D96B 4OF0A 3PQYB 3T6ZA 1J87A 1FV1A 5T5FH 1T5KA 3VSUA 1N70A 2Y6SC 4JFOA 4JFFE 3VRLE 4MNGE 2YAPA 5ID1A 3UTPD 1A1OA 3D85B 3L2LA 1KSRA 1QI4A 2HCZX 2CJTA 1OGAB 1GRWA 3KCWA 1RURH 1BZ7A 3HR5A 1OV8A 3QG7L 4U1KA 4OV5A 3V0IA 3H8NA 1FNSH 4JRXA 4ZPTB 1TPXB 4TULL 1I85C 4FI7A 3A6CH 3FUHA 3NJMA 2QQNL 2F7RA 1NCJA 2J56A 4QXTB 4J5VA 1WA0X 3QQDA 5AOZA 3B7RL 5JOFA 4J1UB 1XZ0B 4XBGB 3VVWA 2VLKE 4Z7QF 3KPNB 1QHQA 3DUUB 3ZE0B 3IJ7A 5GZNC 3BWAA 2DYRB 5F96H 3K3QA 1A0QL 2QQQA 2BMKB 3N3EA 3TC9A 5T33L 3ZYOA 1A6UH 4DGVL 3MLYH 4OM1H 5EZIL 1DJYA 3CH8A 1BFTA 3WN5B 3O0LA 1X5FA 2N3JA 3BSZA 2OZNA 3KLAB 3BEVA 5T1LA 3V0JA 5MP6L 3QDMD 4YXLL 1YYCA 3VFMB 2EYSB 4MSWA 2VDOL 3KVDD 4TSBL 3AGWA 1I1FB 4PP1C 5IUCA 1CICA 4M6NL 4X42A 4PJIB 2ICCA 5D7LB 4D9QD 3EFFA 1B0WA 1OXYA 3W81A 2VITB 4XMXA 5CU5A 2KPWA 3J07A 3OXRA 4O2CB 3VI3E 5IW1B 3RILA 3QQ4B 1A9EA 3DMMB 3F7PC 4PJDA 4KQ4L 3NZUA 5JQ6H 2HRPL 1LEGB 5B22A 3FU3A 4ORGB 3OKKA 1HL4A 1KYDA 5D1XA 3BGAA 3M88A 4L3CB 1IGTB 3QQXA 2DB8A 4HUKB 1WFIA 2AP2A 2ZX8A 3V6BR 1I9IH 4ISVA 5ADOL 4G8EA 3OG6B 2EYTA 4ZUWA 2B2XL 4M3JA 3V7MA 3C12A 1EMTL 1FFPB 2R7EB 2V33A 3MV8A 5F9JB 4HIHA 8FABA 3FFOA 4L4VB 3RGVA 3O3AB 3U6XA 4P2OA 5LLIC 1JGEA 2NT1A 2F08A 2PO6B 2ZE0A 3GXPA 5IMOA 4JW3A 1AC6A 1IC4H 1DQKA 1EXUB 2OQJA 5DDHB 5IW1A 3PL6C 2G75B 5K9KA 4FQLL 4M7ZB 1A1NA 5DSCA 1WE5A 4NRYB 1YUHA 1EANA 3PJLA 4PJ5A 5CMAA 5B8CA 5L6YH 3MSPA 3CFNA 4PJHE 3BKCL 5GJTL 5T1KA 3QDGD 4ES8A 4AJVA 4HW6A 4TQEL 5EU6B 5CP7B 1P7KA 3Q44A 3ZR6A 3ARZA 3MBEA 4NSKB 4A2HA 1RHHA 2NY0C 3OAZK 3N55A 5SX4H 4W9ZA 4OJEH 3UZEA 4F8QA 4JG0H 1QI3A 3FPXA 2O26U 1UJ3A 3M17A 3VWJD 1GVIA 4L29A 2FBRA 2OLDA 4XXWC 2W60A 4NM8L 2G60H 4NAMA 3SYQA 1TJHH 4AC2A 2HT2D 1AG0A 3RTQC 4U1SA 4NT6B 4OCYL 4ONOA 1YJDL 4XP5H 4NKOB 3CXFA 1U91B 4GSUA 3W39B 5EBLB 4FQHA 1FH5L 1WBZA 4DIXA 3IDJA 4POYA 4U33A 1QR1B 2NNCA 3ZKSD 2E9WA 3DXAE 4ABWA 4FQCH 3W2DL 1ZVNA 4FE9A 3LH2L 3BFOA 4WW2A 4F7CB 1I8UA 1BVNT 2ODIA 3JWOL 3PFUA 1OAKL 2FZ3B 4YX2L 32C2B 3AG1B 5CBAA 5IT2L 4L3AA 3HUJA 4PJAF 5JHDE 4XO8A 1ZT1B 3FRUB 3Q6GL 5C2BH 2HRLA 3PGFH 1UWXH 3FSAA 3U4KA 5F1NA 4C57C 3I6GA 4Z7VE 3TM6A 1MFNA 1HCZA 3G6JE 4YPGA 3L3OA 1NCDH 3RQ3A 1UG9A 4NHUB 5IB2B 2H32B 2MTAA 3IWVA 3QCVH 4K7PX 4JJOA 2Z31B 4V1DD 3MBXL 4PRAB 4ZFQA 1MI5A 4Z78A 1XH3B 1WCQA 4JQVC 4J3BA 3T1WA 4FF9A 1IGMH 3NCBB 1GJUA 4TTDD 3IJHB 3O4LE 1DBAL 1F2XK 1YEEH 4Z7WF 2WO3B 2C1OA 3HNSH 5AUMA 1BQLL 2NY5H 1W0WA 2IIJA 5EUKA 1W0VB 1OB1A 2BNQB 3NDZE 1IFGA 1NDTA 4E68A 3RVUD 2B16A 2ZX5A 3RAJL 4H88L 1RK1A 3RPIB 1QNZL 4LDCA 1TTAA 3OPUA 2FAUA 4FLHA 4HKJA 1DZ0A 1UXSA 4O2EB 3PJNA 4AIEA 1S7UA 1MCLA 2Y06L 3CFJA 3WFEL 4ZBJA 2DWDA 1P5UC 4Z7OF 2EDJA 3FCSB 3HUJF 4Z6AT 3IEAA 2RGSA 3ALPA 4DCQA 3VXRD 2JQMA 4UNIA 4ETYA 3RIFF 1BYNA 3DVNB 3IBEA 4J3WA 4X4XB 4L4TA 3P9MB 2A6IA 3IXTA 2R9HC 3O6FD 3IJ9A 2X53A 2GTWA 1YEDA 3FB7B 3N04A 3NH7L 5DLML 2RTTA 3MACL 3BRDA 4PJ8A 2MCMA 1DVFC 1ZA3B 4XH2B 3BWSA 3CFDA 4LKCB 3WFCL 4NO5B 4K0OA 1G7QA 4DVBA 5DHVA 3M1CA 2O1AA 1GC1C 1SEBA 2WO4A 3QUYA 3NCFB 3KPMA 3V0AC 2OPCA 4N0YH 3L3JA 5SWZD 2F8VA 2AJSL 1WBXB 3VFOB 1M05B 2YPLE 4XWGL 3B9EA 4GMTH 4MLIA 1ZLVH 4ICXA 3NCMA 2WJ5A 1I9RH 4YK4C 1B4JH 1NGWA 1VEPA 2ZG1A 1E6OH 1MW2A 1UWGH 3ET9F 1WPCA 3NCYS 5AVVB 1DE4A 3EO0B 1S7SA 4R4NC 3VD0A 4I18B 1LK2B 3LPPA 3NCXA 3MLZL 2HKHH 5D6DC 3DHJA 3AXLA 3HN5A 4ENEC 1CFMA 4QNPE 2WBWB 3OPZH 2F68X 3LKRB 3WY1A 5E9NA 2N0KA 2XA3A 1IGIL 4WNQA 1W72B 1YEJH 4J6RL 4X2UA 1CDHA 1T21A 4OKDA 5F3FA 4N6RB 3QUZD 5T3XE 5ANME 4HEPG 2Q20A 1HWWA 4JN2A 5LGJA 4O9HL 1I1AB 2O5ZH 1VDGA 3QNZB 3T77A 3NOIA 5LO7A 3WTYA 3RHWF 3GLDA 4TNGA 4Q0XH 1QACA 4MCYA 2IDSA 1U30A 3D3VE 4DO4A 2V37A 1OWRM 3T04D 3VCLA 3FB8B 5F9AC 1X9QA 3GTNA 1CZ8L 3FFCE 3W0WB 4ZTPL 5TD4A 2VQ4A 5FHAL 4D9RD 3WY4A 5GGRB 1CG9B 1XGRB 1Q9KA 4IRJC 1H3TA 4HJ0D 1OAUL 4Y5XB 5DO2C 4C4BA 4PJBF 4F57L 1DFBL 5HYJD 4NQSB 1ZOXA 1WK0A 3EJTA 2WJ7A 4PGBB 4OUUB 3K6FA 1Q1JL 1UA6H 1CXLA 5J6HA 1X6NA 1C8PA 1A3RL 5KYWB 2BDNL 1UATA 2XA8L 1HS6A 3VXUB 3VGEA 1J9SA 4HX1A 3QARA 2R0LH 5F89B 5IB1A 5IROC 1TYRA 3BCDA 5DWPA 3SGKA 1I8MB 1PZBA 4UIKH 2EXSA 4JN1H 3ABLB 4H0GA 4QHMA 4I2XA 4X99A 4AM0A 1JZ3A 1KB5L 2CO6B 2FK9A 2F1BA 3O8XC 2APBA 5FYLD 1KCRH 1E5BA 3QGVA 1NEUA 3GSWB 5B38B 4OQTA 4L8SC 1COBA 1MH5A 1FFTB 4PJXE 3UTQB 5FW6A 1CFNB 1PZ2A 4G9FA 5J3HD 1JWUB 4XP6H 5ICZA 2QFRA 1MNUH 3K0WA 3MNVA 3UYPB 5FDWB 3TA3B 1QSED 4AIZB 2FEJA 4NENA 2WZ6A 3P4OB 3VTTA 3P9WB 2I69A 2YEZA 3F6JA 1TEGA 1JZIA 4JFXB 4O4YH 2K0RA 3ZTNL 4E9WA 3P73A 1W16A 3BDBA 3QNXB 4H20L 2UX7A 2XN9D 3KYMB 3HG3A 1ED3B 3GINA 4N8PA 5F7DA 4OFYD 3H9SE 3IAGC 3UGUA 4LVOB 3QIBA 1HOEA 5CHNA 1ORQA 1EO8H 2XPGA 3ZN6A 3V0WH 2CR3A 4PJGF 3T65B 2NYYD 2AEWA 1F56A 2NZ9C 1VPOL 3U9PH 1KN4L 3MDJA 3SKMA 4L0PB 4EI6A 2UZYB 3KGUA 1YVLA 3FC8A 3R18A 1KCLA 4KK8D 5I18H 5I1GL 5E6IA 3UBHA 2YD5A 5I8CA 1AQ8A 3ARBD 1FFOA 4HUWA 1NL0H 3PGDB 1Q0EA 4FFYL 3FQWA 3L5WB 4F7EA 5CWSA 2QLVB 2D4DA 5DD1H 4XXDA 5FYKH 5E2TH 4LLVA 4OZHA 4JHVA 1M7IA 3MJ8B 4TPRH 4Y9FA 4L5FE 5D7IB 1GS8A 3O3DA 4KY1L 1OAXH 4P46B 2IV9A 1OAQL 2WWMC 1N8ZA 2EIJB 1KGUA 3OC8A 1D5BA 3KPPA 3OTTA 4CA4A 4WO4C 2FYVA 3LXUX 4U2YA 4OZ4B 4GSXA 1T0PB 4GG6E 3AU1A 1UCTA 3CFCL 3NIGF 2GSGA 3TH2T 1JWSA 1RSFA 5ALBL 1G7MA 2O5XL 3BUYB 1YPZB 3FZUC 4GPVA 4AJWA 5J13C 4JZJC 4LKXA 4TXVB 3UYOD 4Y19D 5HGBB 4A2FA 4JQIH 1OQXA 5CD3B 3U36B 4ZUUB 2ICEC 2OA9A 3L48A 3QWQB 1ZLWK 4OI7A 1NAMA 4S0TD 1K9TA 1RLBA 2Q10A 2WTRA 1MQKH 4NJ9H 2AAVA 3TL5A 3HNTL 2DQHL 3T09A 4OZGF 2NNXA 3NTCL 3UTSD 2IPUG 3ULUF 2ZF8A 5C0CA 3ALXA 2Q7YA 3C5ZA 3OZKA 4I77L 4O2FB 3GSNH 4NQEE 4RBPK 4DP5X 2Q2EB 3SYCA 1ZK9A 4RISL 3OJMB 1UYWL 1KC5L 2FE0A 1ZS8A 3LN5B 4HISA 2HT3C 2WIMA 4FI6A 1S7WA 2ED6A 4BFIB 4PRHB 5I1CL 3HCVA 2VGLM 3UAFA 1HKLH 1X5HA 5DVKA 5F1KC 3B7UX 3D18B 1UZ6F 4G6KH 1H9DA 3LKQB 2Q3ZA 3FQYA 3JVGA 3KWXA 4YMPA 4L05A 4G82A 4G6AC 4X0NA 4FL4B 3UGXA 4ODUB 2XIIA 5EC1B 1U8PA 3C6LD 5LNEA 4E5XB 2LTQB 2WSKA 1IAOA 4AGQA 3SDCA 4S1DC 4ODHH 3L3HA 3CN0A 4WWID 3ULVD 1C08B 4OR1A 2QR0A 3NAAL 3WJLC 4O58L 1G6RL 4NKDB 3N43B 4HOWA 2NDFA 5D2NC 3PAVA 3EOTH 4PS7A 3S96B 4X0KB 3VDCA 2IQAB 4WJ5B 4KKCC 5EUOE 3BZFA 1TLKA 3IETA 3GHBL 5FA3A 4PJEB 3OKMA 1UM6L 1OQOA 3FW6A 3KPTA 3U0PB 1UCBL 2OMZB 4NOBA 3GPEA 3UGEA 4CU8A 1W9XA 2X4PA 3DX3A 1YDPB 4UT7H 5BZZA 1BQKA 4EOWH 1VCAA 3NIDF 3SGJC 4MNQE 4GSDH 1JFQL 3LZOA 3NPZB 4YAQA 3KW8A 3GXFA 4QUOA 1N18A 3P11H 1X7QB 1L9RA 1SJEB 4FHBD 5T3ZH 4Y2DD 3GZPA 4P57B 2EC9U 5JPNB 4HIIA 3PV6B 1C5DA 2E7DA 3DJRA 3LPOA 4MGXA 1A64A 1B2YA 1KJ2B 4B0MM 4F58H 3LN9A 2C34A 3AREA 3Q2WA 5L2JA 4P9ML 3DYMA 1SXZA 1IEBA 3NCCB 3CE1A 4Y9BA 3GWJA 4N6QA 4AV4A 1W0YT 3ZVVA 3KM2A 1EEZA 3PYCA 3STBA 5I17B 2ERJB 1VGEL 4WEEA 4CSZA 2A6JA 3TN0D 3HIZA 2C4FT 1R3HB 4MMYB 2AXJA 4D3CH 2Y2TA 5D7JA 2PPDA 2C9XA 5CN3A 4KMTL 5IESH 2X4TB 2O6PA 5FYJD 5CM1A 3P4NA 4YBQD 3ZKND 5TK4A 4ZQKA 5GGTH 1OSYA 3H9YA