3NJIA

S114a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLAPDPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njiA00
5ANHA 1PNDA 3EH3B 3KW8A 5B1AB 1GYCA 4DP4X 4CSPA 4Q89A 4E9VA 2IWFA 3X2QB 1A8ZA 1BYPA 4UAHA 3NJMA 2AFNA 4TXVB 1KCBA 2QT6A 1NPJA 4YSOA 2ZXWB 3FSVA 5D4HA 1ET8A 1ID2A 1SF5A 1JVLA 1MZYA 4BWTA 1KDIA 3BQVA 3HEIB 5I5IA 2PPFA 3QJTB 2N0MA 4DP0X 2ZONA 3PAUA 4BWUA 1J5CA 2BP0A 4W1TA 4E9RA 1ZV2A 3UACA 1E30A 1RCYA 2B3IA 3IE9A 1TEFA 1ILSA 3AY2A 2HRHA 2J55A 4NB7A 3X1NA 2HRGA 3ZDWA 1KBVA 3ERXA 2XVBA 2UX7A 3GXUB 4YSCA 5TK2A 3ASOB 2YAFA 2CJ3A 5AFAA 3WKPA 2R7EA 2IDFA 1NIFA 4L0PB 4YSAA 4YSUA 1QHQA 2J5WA 1PF3A 4G71B 2CUAA 2IDQA 4BDVA 3V9EA 4E9SA 1TKWA 3KW7A 3QJQB 3T6ZA 2VM3A 2DYSB 3S3CB 1AZUA 1XMEB 9PCYA 4CSZA 2IH9A 1SNRA 1PLCA 5I6KA 2YAOA 1F56A 1JZHA 2OV0A 5EHFA 1AOZA 4GP4B 1ASOA 2YQBA 5FC9A 3T6XA 1FFTB 1IBYA 2J56A 3MBWB 1AZRA 1L9QA 2DV6A 3WKQA 2H3XC 4K9JA 4BDVB 1L9RA 4RH4A 1BXUA 4KO9A 2YXVA 1OE3A 3WNIA 2VW4A 2E86A 1ASQA 2H5UA 1OOWA 4M3HA 4G70B 1AG6A 1W6WA 4N4YB 5PAZA 4A68A 2ZOOA 1I53A 1A4BA 1OCRB 2BZ7A 4A2GA 3X1FA 2I7SA 4DP1X 2TSAA 2BWIA 2NRDA 4MFHA 1ETJA 3FS9A 4X4KA 1SF3A 2WSDA 1RZQA 2IDTA 1N68A 4P5SA 3CDZB 2XX0A 1HAUA 1NPNA 2X88A 1SDDB 5D4IA 2PPEA 4KO5A 4KO7A 1IC0A 3FYEB 1J9RA 4AZUA 1JZFA 4KOCA 2CAKA 2EIJB 3OMNB 3QJSB 1BXAA 2VSMB 3N2JA 2RACA 6PCYA 1J9TA 1AACA 1DYZA 3ABKB 2PCYA 2GBAA 4DP5X 2UXTA 1IKOP 1GSKA 5I5MA 3FU7A 1IUZA 2EIMB 4Q8BA 5I5JA 2Q9OA 2AVFA 2VM4A 2WO2B 4KO6A 3WNJA 4HALA 2P80D 2GIMA 2I7OA 4A67A 4FAAB 5I6MA 1M57B 1E5YA 1ASPA 2PP8A 3EH4B 2FQDA 5B1BB 3S3DB 2CALA 3NYKA 4YSPA 2XXFA 1ET7A 5B7EA 1PLBA 2H47C 2GB2A 3T71A 3S8GB 2XX1A 2PCFA 4YL4A 4BXVA 5B3SB 1X9RA 2W8CA 5E9NA 1NWPA 4KOBA 4E9XA 2VN3A 4A2FA 4PAZA 4DP7X 1BQKA 1N70A 2W88A 4DP2X 5I26A 3AG1B 7PAZA 1NIAA 1MDAA 4HCFA 1EZLA 2AANA 4A66A 4G72B 1X9UA 1L9OA 2Y69B 1OF0A 4AX3A 3GDCA 3NJFA 4YSTA 1AIZA 2OCCB 3NJNA 1PY0A 4F2FA 2EILB 2UXFA 1R1CA 1GY2A 5B7FA 5LDUA 2BWDA 2IDUA 2MRYA 4HCGA 1V55B 1OCOB 2HX8A 2FNWA 1J5DA 3FU9A 1AR1B 2XLLA 4GP8B 4G7QB 2BW4A 4DPBX 3ZIYA 2VW6A 1KDJA 2EINB 1PLAA 4UANA 1ZDQA 3T6WA 1NIEA 2PPCA 1GS6X 5I28A 1VLXA 3WIAA 2PPDA 3AZUA 3WG7B 7PCYA 1GS8A 4JKNA 4YVUA 5PCYA 5B7MA 2JFCA 3EH5B 2IWKA 2UXVA 2YXWA 1A65A 4HZ1A 3EHBB 4HIPA 1AZBA 1V54B 1EHKB 3DIVA 3PCYA 2WO3B 1BXVA 2AZAA 3S3BB 3NP3A 4ZK8A 3WI9A 4E9YA 1JZGA 1L9SA 1CYWA 1NDTA 2LLNA 4P5RA 3ASNB 3ZX1A 1GR7A 3FPXA 1JXDA 3X1EA 5B1JA 3RYMA 1W6LA 1CUOA 4HHWA 1IBZA 5F7AA 1ILUA 2PPAA 1XB3A 4ENZA 3H4HA 1PZCA 1AZCA 3V9CA 3CZUB 2R7EB 1PAZA 1JVOA 1MZZA 2IWEA 3NSFA 4BK5C 3MX0B 1KYAA 1JXFA 3D12B 3OQRA 3EF4A 1WA0X 2Y1AA 4A2EA 3NSDA 1JOIA 2CBPA 3UAAA 3CVDA 1A4CA 4YSDA 5B1JC 3FQ1A 2XV0A 3HB3B 3PLYA 1UATA 2XUWA 2JXMA 1J9QA 2FT8A 4G7RB 2BHFA 8PAZA 1SJMA 3QQXA 3ABGA 3FSAA 4AKPA 3ZBMA 1T5KA 2GI0A 2BZCA 2DYRB 2BW5A 3JT2A 1PCSA 2X87A 3T6VA 3ABLB 1AS8A 2XV3A 3H56A 1ZIBA 2FWLB 1BEXA 1XB8A 3SBRA 3AW5A 1NIBA 5AZUA 3FU8A 2HZHA 3H4FA 4NERA 1SDDA 4W9ZA 3TA4D 2QPDB 2IAAC 3CDZA 1OE1A 3NT0A 4N8UA 3SBQA 3IBOA 1AS6A 3NJHA 1PMYA 3UAEA 2YAEA 1ZPUA 3L45A 4YSEA 3PXLA 4G7SB 1RZPA 5I6NA 1SFDA 2DWTA 1GS7A 4A2HA 1J9SA 1A4AA 2JKWA 1L9TA 2B08A 3N55A 1M56B 1CC3A 3FU7B 4KNTA 3IN2A 2P80A 1AANA 1A3ZA 1ZIAA 2J57A 3FT0A 2UX6A 4BXSV 2GC7C 3QPKA 6PAZA 5I6PA 2PP7A 1AG0A 1AS7A 2TSBA 1V10A 4WKXA 5IY5B 1OE2A 1E5ZA 2DWSA 1GW0A 3OMAB 1ET5A 1CYXA 2BP8A 4UF7C 4F7KA 2IDSA 2FT7A 4YSRA 3IN0A 1MG3C 2FTAA 5F7BA 1URIA 1NTDA 1JZIA 4KNUA 3FSWA 4JHVA 3S8FB 2UXGA 2BP8B 2IH8A 3FQ2A 2XU9A 2HXAA 1AZNA 1JERA 3NJIA 4BWWA 4YSSA 1TU2A 1XB6A 3QJUB 3SBPA 3PAVA 3TBCA 4DPCX 1E67A 2YAQA 3NSCA 2DY2A 1ADWA 2HX9A 2XXGA 3IEAA 1PNCA 4DP9X 1BQRA 3NJGA 5B1KA 2VMJA 4GP5B 3QJVB 2QPEB 1HAWA 1SHXA 1BQ5A 3X1GA 3FYIB 3TASA 4HAKA 4FA7B 2BP0B 1ZDSA 1NWOA 2XWZA 4A2DA 1JZEA 1PZAA 1NINA 1GY1A 4GXFA 4WTQA 2XYBA 4EF3A 1CURA 2AZUA 3X1BA 2FQEA 3JTBA 3QJRB 2CCWA 4HCIA 3FPYA 4YVNA 1WS8A 3PAZA 2FJSA 2PP9A 2YAHA 1KV7A 4E9QA 1FA4A 1E65A 1BYOA 1NIDA 2Q5BA 1JXGA 3CVCA 5AKRA 3UABA 1B3IA 1QLEB 1NZRA 4QLWA 3GYRA 3NJKA 1YLBB 4GYBA 3TBBA 2A3TA 2QDVA 2I85A 1QNIA 4E9TA 1KGYE 2MTAA 4JHUA 5I6OA 1AAJA 1TEGA 2YAPA 2EIKB 3UADA 3DTUB 4YSQA 4AI7A 1WS7A 3AG3B 1FWXA 4AKOA 2BO0A 3SQRA 3OMIB 2OJ1A 1SHWA 2YAMA 1L9PA 2QDWA 3ABMB 1M9WA 3NJJA 4HHGA 5I6LA 3DKHA 3CG8A 1OCZB 5D4JA 5TK4A 3OD3A 1WAEA 3BVDB 4NAJA 3AG2B 4DP6X 1KBWA 1KCWA 2HX7A 1NICA 3U25A 3G5WA 3C75A 1AQ8A 2FQFA 2VSKB 1DZ0A 2GHZA 1OCCB 1W8EA 2FQGA 1HFUA 1OV8A 4AKQA 2VW7A 3NSYA 4GY4A 1BAWA 4KNSA 2XV2A 2FT6A 2GSMB 4PCYA 4DPAX 3TU6A 3AG4B 1SFHA 2ZWNA 1WA1X 2HLEB 3UGEA 1RKRA 4E9WA 3CVBA 3NP4A 4QKTA 3FQYA 5A7EA 4M4RB 1PZBA 2PLTA 3OM3B 2YARA 3PPSA 1WA2X 2GC4C 3T9WA 3FSZA 4F2EA 3NJLA 4DP8X 1JZJA 1MG2C
chains in the Genus database with same CATH superfamily
3ZPDA 1SBSH 5BZXA 1S78D 4BBWA 2DYPD 3KPLA 3KPLB 5E08L 3DX2A 1ZD6A 4O58L 3QWOB 1CD1A 3SO3B 3V0IA 5IW6A 1M7XA 2CGYA 3UAJD 4E9VA 2ZXQA 3DGGA 5MHSD 4LASH 5KZCD 3LNHA 4X6DA 2QQLL 1N3NA 3MV01 5CJXA 4ZXBC 3WEBA 3HHSA 3V7AE 1NUFA 2RQEA 3AXHA 3VAEA 5EOCJ 2XWXA 3JWNH 1QFHA 2BY2A 3BQVA 5BOZG 1HHJA 4BFRA 3PIQB 3MRGB 5EO9A 2XJLA 1NM4A 2CLZA 1JWSA 2WKOA 4FS0A 2IQAB 4ICXA 3FQWB 4L8BB 4OJFH 4P46A 2XN9E 3HZYA 3S3SA 2ZCKL 1MCJA 3MCLL 5I1JL 3T1WA 2W65B 2HRHA 3FU5A 3LEVH 5ESVB 2YIHA 5C0EA 1JPTL 4PJXA 2V2TA 1IJNA 1BJMA 1AD0A 2WJ7A 2HRGA 3T8XA 3S36L 2R0ZL 5F7LB 1AR1D 3UJTL 1FBIL 1BMWA 2X4PA 2NXZD 5JA9A 5J13C 1ZTMA 4KMLB 1EK3A 4OJYA 4EI5A 2WP3O 4YSUA 4JY4B 5ALCL 1EHNA 2C8NA 1UA6H 1JCVA 4PJ7A 1OGAA 3WEXA 3RY6C 1ORQA 2I9LB 2P5WE 3Q2WA 4L1TA 5C7XL 2CUAA 1T83C 1JGDA 5EUOE 5GS1A 1UEMA 3WD5H 3S3CB 4L5FL 3KJ4C 1BVNT 1WFTA 4U3HA 4GT0A 1T1ZA 1JZ3A 3A24A 3MRRA 1A7OL 1MCPL 4PWFA 1YYLL 4WW1A 4Z7WE 3T4AA 5CEZH 2H8PA 1FG9C 4HXAH 4Y88A 1O6SB 4E2OA 1JZ7A 4MKMA 3O4LB 4MNQD 4N6RB 4KROC 5FDYA 3BAWA 3WELA 2I24N 2V7NA 3OPZH 4P9HC 4HIHB 3D30A 1WZ1L 4HX1A 1BFSA 4LEOA 4BKLA 1A9VA 5DA0B 3PREA 4WHDA 1I75A 3IGLA 2GYSA 4G1EB 1NOFA 2FBJL 5DUBA 1G5AA 3WHXB 4WFEE 3SHSA 1GCFA 1BX2B 3CVHB 3QORA 3EZJB 5DC9B 3E7JA 2YC1B 4GAGH 4PJAE 4CC0A 5FGBC 3PQYB 1H3PL 1I53A 3ULVH 4KROB 2RA1A 5DD3L 4FZEH 3QRFM 1CFSB 2BWIA 2KC0A 5F72S 5LNDA 3EO1A 4OGXL 3B9DA 4PCTA 3WTTA 3MUY1 5B1CA 4U6TA 5C0CE 2YEZA 3VYPA 3M7OA 1KOAA 4HOZA 2WN3A 4KO5A 5IFJA 4BSWA 1AJ7H 1AGBA 1J9RA 3LEXB 4NEHB 1KEMH 5F21B 1QOKA 5KW9L 4DNLA 2R51A 4Y16D 4JG5A 2MSPA 4ODSL 4U0RC 1LQBC 2RACA 1U36A 1DYZA 5KYWB 5KOVC 2NXYC 1RIVH 1T03H 5E99H 4LRNH 1IKOP 1HCYA 4HLJA 4XP9L 3CFQA 4BE6A 4Z76A 1P84K 4Z9KB 4RZKA 2GT9A 4LAJH 2G3MA 5LXVA 2R4RL 3PGCB 4XRCA 1CDBA 1IEBB 5L8JB 1WCQA 1M71B 2D3JA 3QR0A 1P1ZB 4ODBD 5KSAC 1I1YB 4ES8A 4R8WH 1TTCA 4FEMA 1GHFH 4KRMB 4HS3A 1TF4A 2CALA 1FSKB 4N0UB 3BYTA 3GHBH 1UM6L 5DMIH 4DN4H 1XGPB 4FQIH 1BJ8A 2E3VA 2IAMA 3GBLA 5LBSH 1TKWB 4UZGA 3L3OA 3QCUH 4B9PA 3DVGB 4NKDA 1ZT1B 2GJPA 1U42A 3ATAA 3PWJB 4G6FD 4HHAA 2D31B 1U2CA 4MMYA 5I2IB 15C8L 1NIAA 2AANA 3D69A 1OM3H 4G8AC 4GW4B 2BNRE 5DEGA 3H9HA 1N7ML 3G6JA 3VXQA 4BCZA 5I8OL 3H9SE 1QSEE 3N9GH 2N59A 4QHKJ 4PJXB 2ZWLT 4NT6A 5JPMC 2V2TB 4FI7A 3FRUB 5DK2A 3Q5TA 2BVPA 1XSKA 5B39G 3B3BA 3TO4D 4H2AA 1YC8A 2IDUA 4OM0H 2QSVA 3EH1A 1OCOB 2BIIA 5EU6D 4LGPB 4NQSA 4AQZA 1AR1B 4AJYV 3GMNA 5HI3D 4RZCB 3CZJA 1B0WA 4KK9C 3TIDA 3WAKA 3IDJB 1JP5A 2MNWA 1WEJH 4TUJA 1P7QB 3WKML 2ZG2A 2WZPD 5DD5H 4LHUA 1GS8A 7PCYA 4RAVB 1UB5A 2EADA 3EOAA 3O9WA 5KBNC 1TSHA 3HTLX 5A3ID 2DJUA 4NWUL 1BD2D 2Q7NA 2KLTA 1IQDB 2A9NH 3ARDD 5GRVK 3I6KA 2DJMA 5INDB 4FQJH 3WI9A 3TN0D 1CGWA 2VERA 2VJ8A 4UQ3B 4P8QA 4YH6A 35C8H 3HR5A 5LBSA 2NUTA 3OQ3B 4XO3A 1SBBA 2FX7H 3EYOB 4OM0L 5IVOA 2B3RA 3S3PA 3TCXA 1E4KC 1OWRM 4HUUA 1LO0L 5F7AA 4WO4B 4R3SA 3AT8A 2Z31C 3EO9L 4FNSA 1AZCA 4WW2F 1G43A 4NQDA 4LLQB 3KYMA 5T1KA 1N5AB 2FSEB 4I2XB 5ISZD 1HSAA 5EPMA 1JWMA 3D12B 1CWVA 4HC1A 2F53B 4TVSa 3RX5A 1UQSA 1JOIA 3F05A 4QUOA 3FHQA 3HCVA 1A4CA 1NCJA 1C5CL 3MRJA 4HBQA 5T5FA 1WGOA 3FJTA 4WHTB 4R4FL 5I71C 4XCYA 1JD7A 3PP3K 4WCYL 3FSAA 1SGKA 1UACL 1WZKA 3E6HA 1THCA 1B2YA 3RZCB 3TTYA 2BVTA 5DZJA 2O5YH 4NN6B 1OANA 5CJQH 5F9JA 1I8LC 3GSUA 3KXFD 4M7LH 3X14A 4YLCA 5FKAA 3OSVA 4HUXB 4WWKA 3BQUD 2VDRL 2VJ0A 1WG3A 4P2RE 1JYVA 4GUQA 4N85A 3TEUA 4MD5A 4UOW1 3VFMA 4HKJB 1YEEH 5F7DB 3CHSA 1H5BB 3NJHA 3EFFB 3N1FC 4X6DF 3HR5B 1RJYB 4N2OA 3RDJA 1SFDA 1WVZA 5JMRA 2Y7QB 4N0FB 3HAEA 2OXGB 5K1VA 4HKBA 1GS7A 1MW0A 4OBSA 4XN5A 5IHUL 4NM8L 1N6QL 4R2GB 2GK0A 3EDFA 3RPKA 1HL8A 5T5FH 1UZ6F 4LE8A 1Z9SA 4DERA 1QA9A 1ZSHA 2QVKA 3EGSB 4CVXB 1RJZB 2X2UA 4HJ0C 4UOQA 3JUYA 1NCGA 2DQGL 1J0IA 4N2MA 4PJHE 4XMLL 1LD9A 5KBMA 4PJXF 4LLAA 4Y4HB 5J6GA 1I1AD 2Y24A 2EACA 1MCNA 1DN2A 1TTUA 4RA3A 1OWWA 2FT7A 5IR1B 4HZLB 3P9LA 5FYLD 1RURH 3WXVL 2NUPA 2UY6B 3MLSH 3QEUB 4GRMA 3DX4A 3PHQA 1HCVA 1QABA 2B1AH 3DDFA 3T2OA 4EI0A 5IB3B 1MKFA 1IM3A 2XG4A 3BEVB 3CZLA 5HDOA 1L7TH 3Q5YA 3ZYZA 1FYTA 2J21A 2NNXA 3FO1A 3NA4A 2VWEE 3KGRA 4XMXA 3QQ4B 2I5YL 4U1NB 4YGVB 4FLSA 1MSPA 3RGHA 2JNZA 3BFWA 2J8HA 3GLDA 4JY4A 1N8ZA 3RU8H 3FMGH 1GYVA 3EYVA 1WO2A 1YN6A 4XBPA 3P4OB 2R1WA 4L29B 2OSXA 2VABA 4P2OA 1DBAH 3T8XB 3FUMA 4QOKD 4PJBA 2EYTB 5FB8B 5HHXH 2D7TL 4A2MA 3KE0A 5A6MA 4G8IA 3R1GL 3TASA 1SVCP 2ERJC 4NJAL 4UINH 5C0BE 4EI6B 1LO3L 1CGSL 3REWA 4L1SA 3GSVA 3EGDA 4PV8B 1UTDA 2JE8A 3F6LA 2C3XA 4A2DA 1PZAA 4L05A 3WIIH 2DOCA 3II3A 4LSRL 4HVBA 4OV5B 2VE6A 2ZT9C 4H5SB 1P0SE 3D2TA 1CFVL 1XR8B 5JZ7C 2OQJA 1BWWA 1S7WB 2AQNA 3SO5A 4DKDC 5I0VA 1WS8A 4JPWL 4MVBD 4NXSA 1VESA 2ZUWA 3VXOA 5T3XD 3D3VB 2BIPA 1E65A 4G6KH 2A83B 3C2AH 4D0CB 2A0LC 5JPNC 2ZCKH 1HHKA 5ID1A 3AS1A 3BRDA 4G8EA 3VFSA 1PBYA 4GRWE 3IT8D 3GIVB 4XAKE 4GKLA 1RH8A 4LCUA 3G6JE 2KZBA 1IQWL 4X2UA 1AY1L 5I6OA 2AJZA 1QUNA 4F92B 2B2XL 2EDEA 4C4KT 1D5BA 1YVLA 4X7EC 3AY4C 3F58H 5F7EL 5D2LB 5GSVA 2CIKA 2OJ1A 3CSTA 2J7LA 3DJRA 1NMBH 3OB8A 2AMUA 2CXKA 1O0VA 4TVPE 2P8PA 2FGWL 2A9CA 3WS6C 3I75B 4P0DA 1SHMA 1NCWH 1G9EA 1PEZA 3N85L 3SDXF 4RISH 1NGPL 3TF4A 2NOYA 3DETD 4FXGC 3D2UB 3ZL4H 1G1YA 3I02B 4WF7A 5CHNA 1MFDH 4Y2NA 2JKTM 2QZ5A 1TQTA 4PJCE 4X50A 3TN0A 5JA8B 4NWTL 4IHOB 4OAWB 1WF5A 2UV3A 2A99A 5K39A 4N2HA 4N0RA 4ABUA 3MN8A 4KXBA 5CLTA 1DLHB 3S2AA 1NBCA 3B2DC 1NAKL 1YEHH 3SOBH 1ONQA 4N2IA 4TVPL 3O6FA 3K6SB 4GRMB 3SKJH 2NCEA 1CE1L 1T1ZB 4NQDD 2XNAB 3QFJA 3L3DB 4X7TB 3QQDA 4CU7A 5AAPA 4QRRB 2EDNA 1FL5B 1NGPH 4B95C 4ISVA 1N0LA 2GEEA 5J6HA 5L9DH 4MCZA 3LPGA 4JUSA 3FH7A 1ORQB 3QZMA 4QKXB 2J6EH 2HFEB 4Y4HA 1UVQA 2CNYA 3BD3A 4HXBH 4J2QA 4A6YB 4YFLF 5I16B 2R2BA 5AW0B 1P5UC 3FSZA 4F2EA 1E8YA 3SJVD 4N0UA 1KG0B 3WY4A 4ZD3H 4IBVA 2DBLH 1RHHB 4AVHA 3BLPX 4F8LA 3L3HA 4MMZA 1EFXD 1S3KL 2X40A 4XXCA 1INQB 4AV5A 2ARJA 2K8MA 2G3XA 3KPMA 1U41A 4QF1A 4QXVA 3KDMB 4NZDA 2VTFA 3LZQA 4YSOA 5D1QD 3SOBL 2B7DT 2D03H 3EHBC 1K4CA 4QT5B 3W2DL 4TSBH 3VMPA 4K5LA 3U4EA 4BZ1H 1R3JA 1CI5A 3EO9H 3NGBC 3C5SA 2IGFL 4X9HA 3S7GA 5I5IA 4PLOB 1CGXA 4O9HL 4YL9A 4F7MA 3EHBD 2ZOTA 4TNFA 3ULUF 2GW5A 5DK2B 5F9AC 3QDMD 4ILDA 4E9RA 4IIQB 3E6FA 1JF1B 3D25B 1SEBB 2WMPA 5EEZA 3FFCA 1CTOA 3KBFA 1ILSA 1EAPA 3HE6C 4FKEA 2IG2L 2DMBA 2F54E 1HSBA 3F7YB 3IKCA 3LN5B 4WW2A 1S5HB 2JCCB 2O6PA 4XWOC 3IAGC 3IU3B 1OF2A 1VPOL 1MY7A 3KXFB 4WIQA 1F4WL 1CLZH 5CS7A 3WY1A 2WINA 2XTJB 1JIBA 3F7RA 4HLEA 2VDLL 1N6UA 2AJYL 5KSBA 2FRGP 1BQLL 1QWUA 3L5JA 9CGTA 2EH7L 4PS4L 4NZ8A 4YSAA 2E4FA 1G7IB 3DYPA 1DR9A 4PRPA 3RX9A 2YPKA 1DHKA 5EFIA 4LBEA 1UCTA 1H9VA 1HZHH 3RZCC 1CLOH 1Z3GL 3IFNL 5AW2B 4Q14A 4CBPA 4EN3B 1IFGA 3FQXB 4HUWA 4HS3B 3QG7L 5AALA 5ENWB 3L7EA 4G59C 4R0LA 3U2JA 7TAAA 1XF3A 3PV6A 2V7NB 1F86A 3SCMC 2XQBH 2A6JB 1A14H 4CADA 2YD8A 3RLSA 2OKMA 5I6KA 5GHWH 4HJIA 2D2CC 4XMWA 2NY5L 2W9DL 5I8OH 1PPIA 1R5WA 1KB3A 3GMRA 4J6IA 3WLBB 4X9GA 2BDNH 1X5ZA 3SDXB 1KB5A 3QDAA 2JB6B 3BPCA 1AOZA 1R4XA 1YPZB 2E56A 3L5XL 4YLQT 1U8HB 1NGZB 5SX4I 5DZVA 4C56A 1CVRA 4TVPD 2ENJA 4YDMA 5BXFB 2HLAB 4MX7B 1A3QA 3H85A 4QRRD 1HCZA 1CU4H 4XXWA 2AK1H 2MQGA 4G5ZH 4PJFF 4UQBA 3GSOA 4L5FE 3T6QC 4BZ2L 1DQKA 2NRDA 5ESVA 2YC1A 3KPRA 4XN9A 2CDFB 2XX0A 4GIOA 1RP9A 1A4KA 1ECYA 5D4IA 4PR5B 5CEXA 1J10A 5DGRA 5ITFB 4KWUA 1Z9MA 1EMTH 2A0LD 2OFQA 4WKZB 3T3PB 2K78A 5DJZA 5I1KH 5JOEA 3KEDA 2WBKA 1E5CA 3G3LA 1IKNA 1IU1A 1ZTXE 2BVUA 3LXUX 1UYWH 3VDBA 1NBZB 4HK3N 4Y5YB 1GSKA 1UKSA 1WIOA 3PPEA 4X8JB 5G5DB 2OMVA 3GK8H 3I3DA 2FLRT 2EIMB 3DGGB 5DJ6B 4ADGA 5IG7B 1GGCH 3MRRB 1T3FB 4FABL 3U83A 2EDBA 5I6MA 3IKKA 1KGJA 1M57B 2WUBH 1QTSA 2PP8A 2FZ3A 5CO1A 3SQBA 4MAYC 5KG9B 5TDNB 3EH4B 3MXWL 3UJIL 5GS1B 4EIUA 1QW8A 1LQSR 4CKQA 4JDVA 4B9JA 4PJBF 5K9KA 3V6FA 3T71A 3SYPA 5I1IL 4ZTEA 3Q7JA 3MRKA 1TQUA 1NWPA 3O3BB 3N43B 4KXAA 3ZR5A 2VN3A 1UJ3C 3FC8A 2XYCA 1HH9B 3IF1B 1DEEB 1N10A 1N70A 2CR6A 1XH3A 3TV3H 4WI2A 2Y7OA 3VSTA 2X4NA 4HPYL 1MDAA 3WFCH 5ECJE 3FTWA 3GFUA 43CAB 5ITFA 2WWNA 4JG0L 4XCYB 3ME0B 2VR4A 3GDCA 5BOJA 3D52A 3SDYH 1NBVH 1QLRB 1YEFH 1P9MC 3QIUA 2O6EA 3V8CA 1AIFB 2B14A 4N2BA 4KJQD 3VUAA 4D3CH 1LO4L 2A9BA 2ZUQB 4PEEA 2EEAA 4PP1C 4JG1H 3WIFA 4HLZG 2X2HA 4WI8A 5AG8A 4UIMA 1A6UH 3P54A 3JWNE 1NIEA 1CDIA 2C4FT 4FFZA 3EJYD 1A0QL 3L1OL 1EFXA 3OPUA 2BHUA 1GC1C 5E0QA 3ZE2B 3QCVL 3DO7A 4Q6KA 3UL4A 1F58H 1G9NH 3FTUA 1OLLA 4PJFB 5HDBF 3EH5B 5TD4A 4ZX4A 3SGKC 3B1UA 1CXLA 1OGAE 2FD6H 4U1GB 3N9GL 1ID5I 3R4DA 4F8TA 3RGBA 4NP9A 3G6AB 3SJVE 1BXVA 4PVNA 2G75A 3SDXA 3QHFL 4APQA 1N7MH 4I9WE 2A7BA 1NDTA 4KY1H 4WHYG 5AKTA 3BRGC 3PHSA 1WWWX 2WCPA 4FQJL 4MJ5A 1G9MH 1S9VA 2GJRA 4KUZH 3D87B 4ZS6C 4UIKL 1DFBH 3THML 5BRZB 2HTLD 5EN3A 3QUZB 4JHAH 4M7LT 2C26A 4JZJA 1CICA 4UQ2B 2DM7A 1T22B 4QCIA 5BJTA 1P2CB 1WHOA 4Y89A 1J5OH 4P3DB 3NSDA 5MEND 2K45A 3UAAA 1I3UA 4YOKA 1GHFL 3CFTA 5C07A 4OAWA 3WL9A 2IDCA 4ZXBA 5J3HD 3KJ4B 3AREB 1KIPB 3UTSD 1IEAB 1SJMA 1IZKA 1T0NB 1MWAL 3EOBA 1OAJA 4K94H 3B9KD 1E9OB 1RUQH 5H94A 1UKQA 2DYRB 2F08A 4NO3A 2X2YA 2Q6WA 5DUML 3VD5A 4P57B 2X87A 2AVGA 2NZ9C 3DLQR 1AKJD 3RE0A 1AGFB 1E27B 4UBDC 4FFWC 3MLRH 3QRBA 1W9XA 2P48B 2EUXA 1NIBA 1NAMB 3O3DB 4XP5H 4F7MB 3JSSA 2H1LM 4W9ZA 3TT1L 4POUB 1RUAL 5DD6B 3JZ7A 3SE3A 15C8H 2RH0A 2KPWA 3G6AA 3LKSB 4PJIF 4LSVH 1CTMA 2EECA 5F0MB 3QZWB 1HQRB 5L2KE 2EQDA 4J3XA 3MTXA 4G6JL 4W68A 1SYSA 4J8RA 1MIEH 2CDEA 3VACA 4P2QD 2VXQL 2F53D 2MQCA 4LHJB 5AVYB 3SY0A 2ARJB 4QRQA 5MI0B 4KKRA 4XBGA 4D94A 2OMVB 2ARWA 5IKCB 4EN3D 5BZDA 4HJ1A 4J4PD 4Z3IA 2XVKA 2D7NA 1I7TA 1I7UA 3MLXH 3RNKA 4ATTA 3ATEA 3MKGA 3KPSA 4N2GA 1I1FA 3O3BA 5ERWB 5IMLA 4CL7A 5KEZA 1QAWA 2UX6A 2VXSH 2O6DA 1I8MB 4M4RA 3ORJA 1YUKB 2PP7A 2BOBA 2HVJB 2CG9X 1V10A 2NT1A 4WKXA 3SD5A 5KYNA 3DTXA 1U30A 2FH8A 4X83A 5KSBF 3PGDB 3BSHA 4ZQKA 2GG1A 1SJHA 3QNXA 5C3LD 2Y25A 1QPKA 43CAA 2A74C 2ZXCA 3ZTNL 4YO0A 1KYFA 1FZOB 4KNUA 1G6RA 3UTSE 3ILDA 1NDMA 4HD9A 3PP4H 1PDKA 5L2JB 2XG5A 5BUAA 3TT3L 3MLXL 4HKXA 2ZPKH 4O2CB 3D3VE 3ZLQC 2OP4H 3J8F7 2JIXB 3NDYE 3QUML 1JERA 2A6DB 3KCPB 4BWWA 3OX8A 1XB6A 3S36X 3LPWA 1VB9A 2WXGA 4FFVD 4YE0A 2YAQA 2R8SH 1BSIA 1Q9LB 1YYML 1WT5C 2NY2C 1FHNA 4NUGH 3BISA 3ZW3A 5FWQA 2VMJA 4K9EC 5BRZA 2KDYA 4JANB 2K6ZA 2R0ZH 1H3UA 5GRUL 1LK2B 2WXFA 1UH2A 3OZ9H 5I66B 4UNTA 5C0CA 5ACMA 5CFAA 4WJ5A 4DESA 4WW1B 2QGBA 3NA9L 1OGAD 1ZLVK 3NRPA 1DANU 3SPVB 1X5AA 2XZQH 1LP9B 3CDCA 3S3JA 4IS6B 1GA2A 1SUJA 3WLWC 3QZWG 5IZ7A 4PJFA 2FQEA 3QJRB 3PGDA 4G8EB 2EEFA 4P07A 4Y5VC 1QI4A 1NDGB 5SWSD 3LCYA 1FDLL 5AQ0A 3CFEB 3AMLA 4MZ3A 4PJCB 4Z5RB 1BVZA 1FNSL 1G7PB 4CC1A 4RMUA 5EU4A 3QUKA 1Y1UA 3T2NL 1S7QB 1XF1A 3GBNL 3HZKB 1NZRA 3RWJB 4OY9A 1WBZB 3APDA 4J3WA 4WENB 1FGNH 4OJCA 4QLWA 1B4RA 4JZNB 2VLKE 5JHDE 5KOMC 3B56A 1QKZH 3CZFB 4NKIL 1ZV5A 2HWZL 4AE1A 4AIOA 5F96H 2NX5E 1OAUH 2YMOA 1IBDA 1AAJA 1INEL 1TEGA 4XO4A 1MXGA 4AEIL 4BA0A 4DEUA 3IMSA 1CF8L 3IM1A 3CFBB 4J6RH 5BPPA 2BO0A 3U7YL 1W72L 4IOSA 3ZMNA 2IALA 4Y19D 5EO9B 3U2IA 3S34L 1JFQL 1M9WA 5E94A 7FABH 5ADPL 4M6AA 1WZLA 2HH0L 2A2QT 5FV1L 3FBQA 4N2NA 4Z7IA 2J6EA 4L8SC 3CSBA 5KSBB 1KCWA 1A2YA 3CZGA 1IGIH 3C75A 1F4XL 4P2CG 3DMMA 3VWJD 4YGVA 5AVQB 1YEDB 1T1WA 2GHZA 1X44A 1EAPB 3VM5A 1OAUL 3LB6D 4TNVF 1EX0A 3AXLA 4IOFD 3CSYB 3P11L 3W9DB 4CU6A 1AKJB 4I1PA 2XV2A 2ZSVB 3H42L 4UNUA 1BZ9A 1EJ8A 4XNZB 4M93C 4Y5XC 1AE6L 1BM3L 3GBDA 2EIBA 2UZIL 4HIIA 2G5UA 3NP4A 4LFHD 1QPPA 2PW1B 4MAYA 4QTHB 4UQ3A 2C9UA 3CFCH 3F6IA 4QRQB 5MEQA 1D6VH 2OMWB 4J3OG 3KPMB 3BIBX 1TJMA 3MOAH 1U8LB 2R2CA 2UY7A 4GI6A 4HS6B 4PM1A 1JGEB 5INCA 2FD6L 4AQOA 1DBKH 4ZX5A 1JUFB 3KW8A 2G75B 4JFFA 4HZAA 1T4KB 4ZTPH 1ZLSL 2BFGA 3UTOA 3WGVB 4APQB 5FYJU 5J1TC 5GSRB 4P46D 2I9TB 4QRPA 1OVZA 2L4OA 3Q05A 3HJEA 5IFHH 1JYWA 4EO5A 3WN5A 5T1JA 1ODAA 5DO8A 3TVMB 3MTRA 2EUWA 1ET8A 1SF5A 1SN2A 3KYKL 1MFAH 4XBEH 3UBHA 4YQXL 1MFBH 3F62A 5F8RC 5IVNA 4YHLL 3OWRA 4ZXBD 1KB5H 1MFMA 1NL0H 2DQMA 1ICTA 3RWGA 3R8BB 1VF5C 2ZUUA 3GMOA 1LMKA 12E8L 2X05A 3UACA 2C3HA 4S1RL 3P77B 3VXQB 1GRWA 2VLRB 2F7OA 4UUJA 3TO4A 3BYYA 4JS7A 1KJMA 4K2UL 5IMKA 3SEPA 2J55A 1R3HA 2IPTL 1S78C 2PNDA 3L3GA 1CGYA 5I1KL 3U6XS 3IU4H 2ITCA 3CC5A 1TZIA 1WWAX 4Z78B 3PUUA 1L6PA 3N06B 4QRSA 4XO5A 2APTA 3T0EE 5T1MA 4TOYH 4L0PB 3PV6B 1N0LB 1V7NL 3ARWA 1DVFB 3RHWK 3Q6GH 1PQZA 5E2VH 3HIZA 3VA6A 4N24A 1IC4H 4P2RA 3KYNA 4L9LB 3KWTA 1IGFH 3MNMA 3PNWB 3DOIA 5GS2D 1XR8A 1JTOA 3TFKC 1E28A 1N12A 1SMDA 2RQ8A 3V0VB 1PG7L 1W0WB 2XV6B 5TH2A 4GSUA 2IIJA 4RGOH 5KG9A 2MH4A 1I9IH 1RU9H 1HQ4B 1DVFC 5DTFB 5GGSA 3HG1E 1XSJA 2X28A 4PJIA 2CBMA 3ZDZF 5A2KH 4M62L 1ADQL 5ISZA 4OZ4B 3QDME 5L4IA 5A2FA 1QLFB 3U1SH 3WKQA 1BECA 1I7RA 4KU1A 3UTPE 2HLFD 5DJXA 1P7QA 4HJEA 2EUZA 5HJ3B 2E86A 2AJ3B 4MQ7A 3FT9A 4OFYA 4URTB 4CMHC 4PB0H 1N9PA 3BE1H 2IADB 2Q3XA 4NXKA 5C0CD 2GCYA 4Q6IA 4FERA 5PAZA 1RP8A 5GZNC 3D08A 3O11B 1I3RB 2ZOOA 3GI8H 2BZ7A 5DSCB 2CK2A 5CWSA 3QH3B 3ZRCC 4TNWK 2EDKA 4Y1AD 5F3FA 4JFEE 3FS9A 5ACZA 2WIMA 1QR4A 2QSQA 1U58A 1RZ7H 3FOMB 1TEYA 1HAUA 2KPNA 3BP7B 5SWSA 3CFKA 3EADA 3D0VA 1J86A 5DUBB 2XCMC 4LXFA 2BSEA 2V2XA 1LE5B 3RTQD 2CAKA 2JJUA 3OMNB 5C3TA 4JHAL 1FQ9C 1I8IA 4RWYH 3EJZC 5C0NC 2CGRL 2PCYA 1SYVB 4WWOA 3C5XA 25C8L 5AL8A 3CUPB 3L3OB 3GM8A 3K4DA 3RI5K 1FL5A 5J6HB 3MBED 2HVKB 1BG1A 3GDBA 5I1EH 3SDCA 2WO2B 4AQ8C 4IOSD 4LB8A 3L95A 1UM4H 2NUPB 4MZRA 4X7CC 3LVEA 2GTZB 2WWKO 5GGRA 5D7IE 5IB4A 1C16B 1RZJH 3V9FA 2FHCA 2D03L 1RVFL 5F89B 4G9DA 4U3SA 2XXFA 3J7HA 3TWYA 4NPKA 4G6AC 4I3SL 5SWZE 5DI8A 3CZNA 4LMQI 1F13A 4FTVA 4LP5A 3BRFA 2XWEA 4H2CA 1U8KB 2NZIA 4Z3TA 1OP4A 3QW9A 1TTFA 4IU2B 3WTXA 3IWUA 2NPLX 3WUWB 4S11A 2ITEA 4XX5A 5DLLA 2X4PB 3UTTA 5DQDH 4KC3B 2EH7H 2XFGB 1A6AB 4PS4H 5EU6A 1XD1A 2X53A 5LCVA 1GGUA 2GSIA 1TTGA 4CKVX 1CLCA 5TQ0L 1YDPA 7CGTA 2NY3C 5EDSA 5EWIL 2FB4H 4BYHA 1R0AL 2HMIC 4HCRA 4AX3A 4HQQL 3I6GB 2Y3AA 3MV9A 1FLRH 4JMXA 4M7KL 3VGFA 3SKJL 3V0DA 4XVSH 1SEBA 4XNAA 1MREL 2MCPL 4GXVH 4X0NA 1HE7A 2WLMA 1YRKA 2MNUA 4XO8A 3UROR 1HE8A 3TFBA 5TTRA 3LZPA 3JTSA 3KPSB 2CLVB 2ZG1A 5MHSE 4R5XA 2FWUA 4B27A 1OAYL 2EIDA 3LQAL 4OT1L 1NMCB 4JO2L 4BD4A 2W9EL 5B3NA 2WBJA 5T1KD 5I1HL 5CEZE 4I5BB 1J05A 1GAFL 1W0WA 2CO1A 2WQUA 2AXFA 3VRIB 1I9EA 2J1WA 2WO3B 4PJBE 3O4LA 1KY6A 4UT6A 1BEYL 3S3BB 4DK3A 3OGCA 3BKYH 1XF2A 4FJZA 2Y6TE 4H88H 4ZNEE 4J3UA 3ARDA 4ZO7A 3UX9B 1RZIB 3MRNA 4Q4IA 3LNFA 1RXLA 4P5TA 3TIDB 4L1HA 2VABB 1G0YR 5D7JD 2YK1L 3LHPL 1IGIL 3V9CA 4N3UA 4S1DC 3PWUA 4HF5L 3IRZA 4JJOA 2CUIA 3EDEA 2FEEL 3B3IA 4M00A 2YZ1A 5FYKL 3TZVC 5KVDL 5CF3A 1FVDB 4XE5B 3HN3A 1Q0XL 4IOFC 5HYSA 4IMLA 4MZIA 3DTDA 3QQ4A 1IQDA 4XHJC 1R46A 5KAQF 3NIFE 4FQXC 2WOYA 3IJSA 3FFCB 4XMKH 3NTCH 4JUTA 3TA3C 5IB5A 3VWJC 4CU8A 5AVRB 4O51A 3FONA 3DSFH 5ICYB 4B41A 2BZCA 3MRLB 4P2RD 3ZHDA 3O6MH 2DJSA 5FV2A 3O4LE 2VIRB 5T1DH 3BO8A 4FE9A 5I17B 1RUKL 2VDOH 3QDGA 4NZTH 5DQJB 5AZUA 5FYKE 4KQ3L 1FFNA 2HZHA 2VQ1A 3E8UH 3H4FA 4XPFL 1SDDA 3CU1A 1OP3H 4HDIA 4XTRD 5INDA 3WEOA 1JHKL 3IBOA 3U46A 2FGZA 4H1LB 1PMYA 3QO1B 4YSEA 5ESAB 4NQVB 5HYSG 5DS2A 1HHGA 5D8JH 4NJ9L 2BSBA 4EDXB 4D0BA 3PJNA 3ARPA 3INOA 3NIFF 1J8HB 1P1ZA 3EF7A 4BFEA 4OI8A 4A2HA 1KACB 3V4PH 4Z77A 4M6NL 2EXYC 4ZYKB 1L9TA 2OL3B 4YEEA 1NGQL 1JL8A 2ZTBA 3NZSA 4EVNB 4FNRA 2C9PA 3Q9PA 1VADA 1JHTB 1D5ZB 1U3YA 1ZE3H 3PJSA 1KC5H 4J3VA 4OF5A 1E9QB 4H8PA 3KM1A 1HC1A 4F3FB 2PF6A 1Q1PA 3SDAC 4R4BA 5JQIB 4QTIH 6PAZA 1XVSA 5DS8B 3CWGA 4PH8A 1NKGA 3BAEL 3QIBB 4Y1AA 3PL6D 4JDEB 3APCA 4U33A 4G9FA 4UF7C 4MQXC 2VB5A 4X6DE 5KVGL 3IDIB 3Q5OA 3B2MA 4WY7H 3T0DA 4BKTC 4X6EB 1CT8B 5FO7A 2F1EA 1PIFA 1CD8A 3BUPA 3V4VH 5J56B 5D9SA 5DGQA 5HHME 2EE6A 2ISDA 4Y2LA 4NCDA 2L7QA 1YECL 3R06A 2P3YA 2F7IA 1J8HE 3T4AC 3UPAA 2HXAA 5T5FL 5AVSB 4ANVA 1MI5B 1ZGLP 4N2FA 3K8LA 2Y7SA 3PAVA 1IFRA 3KWXA 4FFVC 1UHVA 3AREC 4URKA 4DUXA 4F37F 3GBML 4PJXE 2P24A 5ELIA 4AUJA 3NJGA 3RWIA 4W4OC 1P4IL 1QSFE 1I1YA 2ATPB 3SE6A 4HUUB 5JOPE 3KPOA 1BQHB 4OF7A 2HKAA 4Y2DD 1M6UA 4XR8C 1SMAA 4XPBL 3LZRA 2WW8A 2J5LC 3MLSL 4Z7OF 4XBMA 1ZDSA 2VLLB 4JN1L 4ZD3L 3IGUA 2FX8H 1NINA 4K7PH 5EU4B 3FFCE 4EF3A 3GXTA 1TFPA 3STBA 2FJGA 3VXSD 4RAVA 3UBGA 5JOPD 4YDJB 4LDEB 3W39A 1Y07A 3G08A 3GRWL 1JZ6A 2AERT 3QZNA 1BXXA 5CR1A 4PJAB 2YAHA 4BSWB 3FN3A 4JFHD 3CDGA 4GH7B 5DURD 1DQJA 4J4PC 1F90H 5AKRA 1DJYA 5I74B 5EU6E 2Z64C 2AEPL 1R3KA 3C5ZB 3FUEA 4Y8DC 5KTEH 4FFYA 4XB3A 4DGIL 4JJ5A 4DZBA 1UH3A 2VLRD 1QNIA 3APMA 3ULVF 4ODHH 1Q9KB 2HMID 4OCXH 1TNMA 4WUUD 3U46B 2XTSA 4K5MA 4E41B 5HYJA 5TFSL 3UMTA 3WEAA 3KPTA 3IDGB 1MWAH 4U6YA 2HB0A 1Q0YL 1A3LL 3TH4T 2R1WB 1JNNL 4EXKA 2F74A 4FQ1H 1TJIH 2IADA 2DDQL 1MRCL 1QUPA 3V10A 5HPOA 5I17A 4HKJA 2ALWA 3G5VA 1YEWA 3F01A 1XL4A 3OD3A 5AAWA 3VFNA 4NAJA 1XH0A 4ZG1A 3UZVB 1EHLL 3T4YB 2GHWB 3R7RA 5I1CL 1FO0A 2FQFA 2FL5A 4A6YL 5J3HC 1ORSA 3JBG7 4EKJA 4HMDA 2JB6A 1HESA 1KB9J 4PBVC 4RMBA 4RRPA 2L8AA 3T3ME 4MXVF 3FW6A 3PQYD 1K85A 4MA3A 2CCVA 4IBQA 1BZEA 1WAPA 3NQIA 4U1KB 1GKEA 2HVJA 3CVIH 4ZAKB 3VXPA 4F15B 4ZUSA 1C8PA 2G60H 3EJZD 2QL1A 2Z92A 3PNWA 1MOEA 1ZVHA 2Z92B 4OQ1A 4E9WA 3KYNB 4YHZL 5DEFA 4DFIA 1B88A 1VJSA 5KSUA 4OLWH 2JELH 1GC1L 2DQFB 3O4LD 4AK1A 5DT1H 1DJWA 2R27A 4I48B 4G42B 5DDHA 4R7DA 4W9CC 3OKYA 3QFDB 4AMKH 2Q8AL 3SJVA 3CFMA 1VFUA 1HWWA 1LO3H 4Y4FA 4UINL 2QQNH 2NY5C 5IEHA 5B1AB 4LSPH 3VTTA 3PFQA 4LVNB 3EO1B 5IHBA 4YHOL 3KLAA 5E4EC 4M8RA 3O6ML 5EEUA 5JQ6L 4WLCA 5EOTB 5I1LA 5KBPA 2P5WD 2HT3D 3CX5K 4Q6IC 3OF6A 2ZYSA 3G04A 2XTJC 1PZSA 4U7MA 4EIGB 1P5UA 2ZG3A 1YA5A 4F8PA 5F9JB 3WFCL 1XTLA 1JNNH 5C0AA 1J5HA 3WJJA 3CN3A 1SMOA 4JN2B 2ZONA 1MFVA 4IBSA 2LE9A 1F41A 3WN5B 2CDGB 1FL6B 5JUEL 3BE1L 4MJ2A 5EDXA 1G7LB 3E8VA 3HC0A 5HYIA 3TNNB 3L4YA 1KXTB 2YS4A 2H1PH 2V5TA 4P23A 4IBUA 1TEFA 5DJ2A 4I3RH 2DQHH 5T5NF 1KFGA 2XN9D 1K72A 3EUUA 4FQHA 2XVGA 4H0GA 1UQSB 4ZBJA 5IVZB 3WKNA 4ODUA 4EKXA 3UAFA 2OZNA 2YAFA 4D0DB 4NDMB 3DX9A 4G1MB 2IDFA 4JHWL 4V33A 2R2BB 5IQOA 2C9SA 3BKYL 4ENED 3QCUL 3K91A 4TUKL 5T3XL 2VDRB 4M1GH 4HIIB 3QZPA 4PRPD 4ZUWA 4K8RH 2LHAA 1TKWA 2AEQH 2FUQA 3QJQB 4W6WB 4MNQB 2ATAA 3VQ1C 4TSCH 2W9EH 3UTTD 1N6VA 1GYAA 4WEBH 1R19A 3MRFA 3SDCB 3ZO9A 1P7HL 2YAOA 3KL5A 5BV7B 1A6TB 1DQVA 1J1OL 2X4OA 3FO0L 5FECA 5MEOA 4B9CA 3O2DH 1VHPA 4GXVL 2LU5A 2W65A 2IPKB 4JGJA 4MMXA 5K39B 2ADGB 4WI0B 2BP3A 3T6XA 2IBZY 5JHDA 3TONA 5GGTA 1RIVL 1T03L 4XXDB 1AZRA 1OAZL 2DV6A 3ENEA 5GGRY 1QFPA 2D4FA 4XVJH 4N20A 5GZOD 1L9RA 2UZYA 4RH4A 4JO3L 4Z7QF 1ZT7A 1CU4L 4ANXA 3GTTA 4L3CA 1OCWH 2CSPA 1O75A 1RZKH 1CR9L 2AAAA 5H2BA 2E75C 3V4VL 3ZE2F 1S7RB 5DCCA 3RFZB 4N0YL 3IVKA 5AUMB 2I7SA 4WY7L 1SOQA 4LVOC 3EYSH 4KKBD 4MFHA 1LP9E 4HPOL 1UCBL 3LMJH 4X4KA 3NGBB 2F61A 1CFBA 4APXB 3BZEA 1AKPA 3RJOA 2IDTA 2OR7A 2X88A 5B38A 1T7YA 3QFDA 4OLYL 3OB0H 2P1YA 3T65B 1G4RA 4WJG3 1WHPA 4MDJA 4CAGA 2QLVB 2H32H 3IPFA 1KXQE 3BXNA 1ZANH 4IDLA 3QWRA 2VSMB 1YEJH 3CFJA 5IBTL 2MIZA 5LBVA 4ODWA 1DSFL 3QG7H 1FFOB 1PYWB 3DXAA 4NENA 1ZRUA 43C9B 1F11A 1IMHC 1GZPA 5AB1A 3LIUA 5HYJD 4E36A 4FTVB 3DROA 4HPHA 4JE0A 3S35L 3TX4A 1PX4A 3RWDB 3NBNA 1SLVA 3SCMD 1E8WA 4LKCA 3MXVL 2AJVH 3UJJH 4LLMA 4QRFA 5EZOL 3VXNA 1ZKAA 4G8IB 1ET7A 1TQSA 3D6GA 4U1JA 1PJ9A 1ZCRA 5DURB 4LCYA 1PLGL 5EC1B 2XX1A 5EOCL 1KTDA 3RZCD 4NZTL 3D06A 3Q44A 1MI5A 1C08A 1PZ5A 4RFEA 5JR1H 1PG7X 4TLSA 4X5PA 4A2FA 5JW4Q 4PJ5D 3L7FB 4R90L 3MA9L 3K2UL 3ILPA 2B15A 1E4XH 4B53A 4HGKC 4DOHE 1NCDL 4A66A 5E6ZA 5FO8B 1KPUA 1NGXA 4HUVB 5FGRA 3OSKA 4HWBL 4ODHL 5IB5B 1FN4A 4PJEE 3HBPA 5DJYB 5IBLD 3OJDB 3ZKXC 4DGIH 3PWLA 5JOFB 2OCCB 1U58B 3IDMB 7FABL 4ONHA 4KVCH 3OKKB 2GAZB 4M29A 1TZAA 1UXWA 2W80C 2E6PA 4IRJD 2AV1A 5JW4R 5LDUA 2X38A 4M62H 3MUGA 4ZFZB 1L0PA 3O11A 4J6RL 5DSCA 2J6WA 2ZNXA 3FQNA 5TDOB 1J5DA 3BP5B 5FOBA 3FTXA 4DEPC 4EVNA 1J18A 5FYJH 1CBVH 1LD9B 1GS6X 4ACPA 5I73C 3EXJA 2Z4TA 3HHSB 2VN5A 4L1LA 3ARFA 3WIAA 3SDDA 3D3VD 1WH0A 2F58H 5E70A 4JKNA 5DLMH 1SY6A 2ZCZA 4EDXA 4GO8A 2C4FU 4R8WL 1I8UA 1ZV9A 5CZKA 2NY0C 4HS6A 2BNUB 4XPBH 2PWHA 4ZO9A 2Z7WA 4ABWA 1DBML 1V54B 4KXZH 2G0KA 2HYMA 4Y4HC 3WNPA 4HKZB 3FB5B 1S9YA 3ZZLA 1Z9OA 1AHWC 3L7EB 4R0LB 4UI2A 1CIDA 5M7QA 1U6AL 1Q0EA 1XCTB 3GBMH 3MV7B 4LNVA 3TTSA 3EYQC 4YXKH 2O6CA 3FTZA 1SJEA 2NY2D 2G2RA 4GT7A 4ENZA 5IIEB 4I87A 4OFKA 3HB3C 4WFHD 2ZOUA 3BUDA 4NNXB 3EYUL 3NEEA 3K71B 1XIWB 1X9LA 2IWEA 2PXYB 3RFZC 5JIPA 3V4PA 3L48A 1NUNB 1ZY9A 4P4RA 4L4TD 1P69B 4OZ4A 3EF4A 3IU3A 5JHLH 1NUDA 4KTEH 4G8GB 3CVDA 1J8HD 2XI9A 1IGYB 3BDYH 1IGYA 2LU7A 3DRQA 3PLYA 4ABVA 3B5GA 3QULB 1JV2B 1RLBA 3OF6D 2DWXA 2ZJSH 3D0LB 3OAUH 4L2LA 4AKPA 4FNTA 4IK6A 4L4TE 3BP6B 4KHTL 5DVKA 2AQ3A 4BFJA 4S0SD 4M1CD 4JPQA 2VUOA 5I8CA 2OR9L 2VDNB 4X6FA 3SDXE 3P77A 1Y7VA 4JDZB 2CO7B 2CO3A 3SOTA 4NC1C 2EZ0C 2XWCA 1IZJA 2G3ZA 2W0FB 3E1F1 4NN7C 5I71B 2ZZUT 4IRZH 2EDQA 3DHMA 2F5BL 3MNVA 5LN8A 4JE4B 2QGEA 1AMXA 4TMPA 3MBXL 1AS6A 3EO0B 4B7LA 1HWGB 1GGBL 1JV5A 4I5BA 4J1UA 4X5WA 5LG1A 3NIDF 1ZA6B 5JHDD 3OKLB 5HGDB 5B21A 3MLWH 3JTSB 5DR5L 4F57L 5CCKH 5IOKA 4AV0A 3N40F 2WIIA 4YNYA 1TQBB 3K5RA 4DGVH 1E5AA 4P4KA 2D3VA 3P2BA 3I9PA 3SE3C 3DX6A 5EH1A 1RK1B 3B4NA 1MVUB 3AS0A 1TOXA 1SJXA 1TQWA 5C0IB 3O45A 4AENA 2ZYHA 4M6OH 3LQAC 4MQSB 3OMAB 3TCLB 3HRZC 5CJOH 4YHYC 1XGQA 1Q72H 4M1DH 3L5WA 5EUKB 3I9IA 5CD5D 4XP1H 4FYQA 3BPNB 3LEVL 4IHOA 3MCKA 2X3BA 1BV8A 4O51B 1D7FA 3G5XA 1BF8A 1MQ8A 4PJIE 4MJID 5IQ7L 3CXDH 5F7WC 2D7OA 1AZNA 1QW9A 2PR9A 3MA9H 2GI7A 3TBCA 4QTHA 2ED7A 1M2VA 1JZ4A 3HPJA 2DY2A 2VZTA 1ADWA 3WNLA 5DVLA 3BZFB 3GSRB 2JJSA 4UM8B 4NKIH 4GP5B 1XX9C 2G2RB 4E9LA 2O26U 4JX0A 5I74C 1V3MA 2YFOA 5LLIC 4Z8FH 5A6LA 3IB4A 4OVUA 3LEYL 1ZLUH 5TH2B 1BM7A 2BK8A 1GVIA 3T0VA 4PMEA 4Y5XA 2BOBB 3ZYIA 2AXWA 4RDBA 4MMZC 4XXCC 2XN9A 5FEBA 1W0VA 3JTBA 2UYLB 3T0XA 1KN2H 2FIKB 1XCWA 2FIKA 4KVPA 3RTLA 1T66D 3PJLA 3SE9L 4PJGB 1T80A 1HTYA 1Q94A 2EEDA 3U9UA 3QIUB 1KBKA 3KR3L 2ZAHA 3L13A 4L48A 4L4VA 5J06A 3NJKA 1N18A 3C9NA 2WXRA 1LEIB 1R0AH 1JTPA 1P6AB 2K6WA 4AIXA 5KSVA 3KPNA 3SE8L 1WV7T 1CFSA 3DTUB 3LKPA 2VAAA 1FWXA 4M8QA 5DJYA 1OTUD 1RUPL 4L3CB 3SQRA 3OMIB 1PW3A 1NAMA 3O3DA 3VCLB 3L3IA 4PGDB 1MEXH 1BYNA 4LHQB 2HKFH 3OKEA 5I18H 1DL7H 3F8UB 1WCBB 1ESOA 1N8ZB 3FT2B 1XEDA 1G7PA 5MP6L 2ZKWA 5D1QB 3MAWA 1FLTX 2E8ZA 2YSSB 4LAQH 4OIFA 5C9JB 2P44B 3L6FA 2OA9A 3EOBB 3MLTA 1OOAA 1S9WA 3WIHH 3V52H 4JKPH 4LEBA 3U25A 4HPYH 5KN5A 3JYCA 4ZTPL 3IETB 5D5MF 4GMTH 4N2DA 4EI5C 4YPGA 1S5IH 3SKNA 3K0YA 3ZSSA 4JRWA 3VB9A 3ARFC 3MOAL 3ULVD 4HISA 2IMMA 4PW9A 2VLME 3ZE1B 2YPLD 3WSQH 3N44B 4GSRA 4JZJB 2JSFA 2VYRE 3L17A 4Z1PA 3N41F 4NGHL 4L8DA 3WFEL 4LSUL 3BVWA 2Z31D 2ZCHH 3VFRA 2DAVA 3MMEB 1SYVA 1K3ZA 2QQKL 3IFOB 1GGCL 1RERA 3RUGA 3SGDH 4GG6B 3S37X 3T9WA 1S7UA 3NJLA 5D71L 1CS6A 1JZJA 5GGVH 2B4CL 3OR7B 5EUKA 1FNGA 2QV2A 3AXLB 3HI1B 5CLXA 3K2KA 4K23H 4W9DC 3RWFA 3HUJB 1FZOA 4IBZA 2WPGA 4MJHA 1GYCA 3U7WL 3VYOA 4Y1AE 4ODXB 5K59E 4FGMA 2ITDB 3O6KL 4KAQL 4UAHA 3DX8B 1DLFL 1BVKA 2AKRA 3VNZA 1S8DA 1NMAH 3KJ6H 1X5XA 2MQ3A 1W72B 4LDCA 4H20L 2PCPA 3M1BB 2VC2B 1M7DA 1X4XA 5DK3A 4JM0A 5ES4B 2XTJE 1LO5A 5B3JF 4LZKA 1BZDA 4QRUB 5K9JH 1UXSB 5FCUL 3AFLA 1Q72L 3HEIB 3FDWA 5D70H 2B4CH 4BZ2H 5EN2B 4ZDHA 1FAIH 2QSCL 3S98A 5AZEL 2P46B 3TZVB 2RJMA 5INCB 3VSQA 1JI1A 1QTYT 4YXHL 2OMUA 3H2QA 5SX5K 4EE2A 5BVPH 3WTUA 4I9WD 5KYXA 5EZOH 3EO0A 4TLKA 4NUJA 4E0RA 2OTUA 4F27A 3GEFA 3GMQB 4KQ4L 3WUZA 4NGHH 3TBVB 1KBVA 4ZQTA 3ERXA 1E3ZA 5TK2A 4HS8L 2XIDA 5C2BH 1EBPA 4ZXBB 2CJ3A 3IRPX 3LRMA 5F9OH 3ULUE 1MLCB 4E41E 2C3VA 3SCMA 1FV1A 1IT9H 1XDTT 1UH4A 3IAPA 1KF9B 4OD3H 1KELH 2IPUG 4HC1L 4X8CA 4JL1A 3T1FA 1GGBH 4NUQA 1T1XB 4MA3B 1JWUB 2K70A 5E6ID 3A6BH 3B9VA 2HN7A 2VM3A 2Q76A 3RURA 1AP2A 1NMCC 4PJ5A 3CSPA 4UYPA 4TF4A 2HJLB 1S9VB 4MJIE 2NY6C 5DJ8B 3VQLA 1AXIB 1CN4A 1JD9A 2DBJA 5AKVA 2WBXA 3ARFD 1JF1A 3TBSA 2NXZB 1U2YA 2H3NB 2OR9H 4NQQA 2WQ8A 3ESPA 2FX9L 4HU2A 2H0JA 3MROB 3P2DA 1UURA 4HOMA 5FHAH 5FA4B 2AJYH 2VSDA 2W91A 1FFTB 5JW4M 1OSZA 1L9QA 2C9VA 1KBGH 5F71A 3GMOB 4BDVB 1RZKL 2WKLA 1MFAL 1FIEA 4XWGH 4Y16C 4FHKA 3QUYB 4G80B 2I25N 4FQXB 5DZPA 5L0QB 5LWYH 1JPGA 4FZ8L 4JK0D 5AW3B 5C0AB 1BVKB 1J88A 1LWRA 4DETA 3PGFL 3T2PA 2X1OA 4X5LA 1J12A 3QXDA 4MDIA 1A4BA 1LLAA 1LNUA 3QZBA 5BQDA 1BFOB 3ZTJH 4JFDE 3DECA 5I1DA 4YBLC 3SDDD 2MTPA 2OMNA 1R3KB 1J1OH 2WSDA 3FO0H 5L7XH 1EEUA 3OKLA 5F0JB 4HIXL 4FYTA 3GLAA 3UTSB 3BP5A 3CMGA 4A39A 4LSQL 3AB0B 3FQNB 4I1NB 1T6WA 4J7RA 1K3IA 1FL3A 3HI6L 2MFNA 2X4NB 4PCSA 5K93A 1K8IB 4QAMB 5ERWA 5IMLB 2KMWA 3KGTA 4DP5X 4PLKD 4KROD 3RVUC 2WXMA 1HCFX 3UC0L 5BCAA 5BZDB 2KQMA 4OIAA 1IUZA 2BS9A 8FABA 4L4VE 2UWEB 4B50A 2FX8L 4R7NA 5MEPA 4KV5F 3M17A 3KHOA 4N9OB 5B38G 2H6PA 1QSFD 4I3RL 3DDGA 4IDJL 4X4XA 4DTGH 1PSKH 5KYWA 4GI8A 5B3SB 2A6DA 3MACL 5I75B 1PG7W 1I8LA 2A4EA 3CHOA 3CU7A 2NQDA 3C6SA 3V5DB 3C6SB 2K0RA 3ZHNA 5I9QC 2E7DA 3N04A 3S34H 2AW2A 1HINL 4HKXB 1FNEA 1FF5A 5IMMB 4PY7B 4J3OH 1RZFL 3VD1A 1BDYA 1S5HA 5CGYD 1GKOA 3JV5A 4KK8C 1PAMA 1T21B 4X6BB 3AU1B 1N8OE 4CMHB 3NCCB 2W60A 4XP6H 1YECH 4M02A 3AY4A 2CIIA 1KIPA 3D9AH 4XHQA 2W95A 1KLGB 2AQ1A 2QQNL 2YMXH 1G6RH 3QO0B 3ETBJ 1HNGA 2HPTA 2UY6A 2ID5A 5D72H 2MRYA 2V33A 1PIGA 1JNJA 3SDDB 1BGXH 2HX8A 1QBML 4L8CB 1H8OA 4UIKH 3THMH 4AGQA 3ESNA 5BRQA 5CNHA 4LLDA 5C0DA 1S7WA 1N59A 1LWJA 4OZFB 3T6WA 4RBPH 1C5BL 3L3OC 3IS0X 4NZUH 1T2JA 4KRLB 4NFCA 2NY1D 2DLFH 1YUHA 3T0EB 2PTUA 1BD2B 4N3TA 4DPRA 2FCBA 3KPRB 1INDL 1S7SB 1FVEA 4LL1A 1AZBA 1UWXK 3V4LA 2J88L 3ARSA 4RSYA 5DMKB 3GBEA 3PABA 2AXJA 3VRJA 3NP3A 4LCIL 5DUPH 1JZGA 3EJCA 3IJ8A 3L9EA 4JMNA 4WDIA 1HH6A 2BSSA 2PR4L 2BSTB 4W9IC 5L8KB 3FO9A 5DQ9B 5D5MA 2WGNB 1BBDH 5CGYC 4OZIE 1F4WH 1S7VB 1X5IA 3P9WB 3QI9B 4P23C 1ETZB 1SOKA 1SXSA 1HX0A 3BDYL 5LVEA 4ALAL 1PAZA 4BJLA 1JVOA 1A7QL 3NSFA 3MUHL 3RJDA 3V0GA 1Q9LA 5D1ZD 2DI9A 3OKOA 3TYGH 3PP4L 4LCYB 5EC1A 2N01B 3UYRH 4ZSOE 3ZMEA 3S4SG 3DSFL 1RQ5A 4C56E 4DKEL 1JN6A 4P23B 3IDYC 3QEQB 4LMQE 5K1JA 2EDDA 2XZZA 3QXWA 3RUGF 5DJ0B 3LNIA 4Q9QL 4QYOB 4FG4A 5BS0A 2O93L 3L2LA 3ABLB 1GZPB 4N86A 5ILTH 5BO0D 2NTFB 4XGZB 4NERA 1TCRB 5HHQA 5FGCB 1Y1DA 3VRIA 2WWOA 2LTQC 4LPCA 4Q56A 3UAEA 1U8PB 3P40A 2HUEA 2WQSA 1JZ8A 2YPLE 3OAWA 1JHLL 5CBEB 4KZEH 3MLZH 1FYTE 1KLFB 1SOSA 2F53E 3AITA 2Y7NA 5DDHB 3SDDC 4JHWH 2R29L 3SPGA 3N3EA 4Z7NB 2X4TB 4J3BA 2VRQA 4KY2A 4MJ6B 1INQA 4OCWH 3HR6A 3SY6A 5DZOA 4N0CD 3FUHA 3N55A 4PJEB 4UU9B 1CC3A 5IOPA 4KK6D 5L4FA 1AANA 4AITA 4CN4A 1W16A 1Z0NA 2X0VA 5FFLA 1IBHA 3MLRL 5ISZE 1R34A 3VD2A 4LOVA 1G4MA 1ES0A 4QR7A 2J57A 4HDIB 1WJ3A 1BFVL 4QLRA 3PP3H 2BFVL 3X3GL 1R3JB 2V17L 4MRCA 1OE2A 3C6LD 1PJWA 3BH8A 3MRHA 4IGBB 3MRIA 1ZS8A 3LIZA 1L5GA 3KBEA 3MRLA 4HG4J 3DRQB 3IGAB 4XVUC 4PJ9A 2FO4B 2WC7A 5E1QA 1T0NA 3ZKSD 3EIFA 2OJEB 1XAUA 1J1PL 4WI6A 3PDDA 4P4RB 1FIGL 4W9LC 4N1EA 4UNIA 3D48R 2X4SB 2H0PA 3VXTB 1NMBL 1U95B 4W81A 3QEQD 2DD8L 2NZ1A 4YMPA 4ZS7H 4HJSA 3PWJA 4HHAB 4X9BA 3QJHB 1CICB 4UQ2A 1Z1WA 1DJIA 1NANH 5DT1L 4A7TA 2APBA 1AYOA 3ZIMA 2WYIA 5CBAA 1BQRA 2XQ0A 3GQFA 2JJTC 2JELL 2XA8L 3FB5A 3OHXB 3UTZA 3I6KB 2DLGA 1HIML 5IROC 1SHXA 5CZXC 5D7LB 4UQIM 3A6BL 2HVKA 1MW3A 1ADQA 4GMSH 2WTRA 4UDUA 3QK0A 4PGBB 1NCBH 1UM4L 2FLBT 2AEOA 2PKDA 4GIAA 4JJ5B 4P4KC 4XNZC 3WS3B 4PB9H 1FYHB 5LG6A 1KEGL 4Y5YA 4MKTA 2QPUA 3HE7A 4NHUB 4GXFA 3LDBB 3SPCA 3C87A 1CURA 2VR9A 4KUCF 4J3OD 1XGRA 2M26A 4BK4A 1A6UL 4PJ5E 1GZQB 3MX0A 4KK9D 1KJ2A 1HHHA 2CCWA 4LVHB 3WYRA 4KJYB 3ARYA 5IM7B 4WV1A 4DOHB 3TJPA 1QI3A 3CVCA 3IMWA 3TPKA 5FYJE 3NCYP 3R1GH 2QSTA 3A5VA 1X4ZA 3TO4C 3VTAA 4ZMWA 3FRUA 4L8SB 4OCSH 5B8CC 1XV8A 1IIIA 2R0WL 4NSKB 1I3RA 1ETB1 4I4WB 2DL2A 3UAJA 4OV5A 4JHUA 3RY5A 5HD8C 2ICWA 5H37H 5IK3B 4FNLL 5H8DA 3APNA 4LARL 3QDHA 2GUOA 5I2IA 1DQLH 1B6UA 1K4DB 4MZ2A 3GM0A 5DRZA 4TTDD 3D5OF 3KD4A 3PQYA 2VR5A 4P59H 2RB8A 3Q3GA 1JGLH 4XPHL 5FB8A 4KMQA 4NN5C 3UC2A 2XBDA 5FYKH 3U2SB 3G5ZA 3CG8A 1OCZB 4BV1A 3HG0A 3WDJA 4DT2A 3AWEA 4YK4C 2VLLA 3QI9D 5ICUA 3AUWB 3NACH 5JXEA 3FUJA 3K8KA 1KLUA 4NFDA 5GGVL 1XF2B 3ZKMC 5IJKA 4H5SA 3RA7H 5D71H 5E9DB 1AQ8A 3OLGA 1RZGB 1WPCA 2WXNA 4N68A 1WQVT 2FQGA 3NN8B 4Z7QB 5A16B 4BA8A 1WTGT 4M5YH 2V7HA 3M1OA 4AGPA 1JCKA 4EI5D 1B4TA 1XO8A 5EZPA 1DBJH 3O81A 4P2YA 3NIDE 4JN1H 4YR6A 5I76A 4NLHA 5I6XC 3HI5L 5MI0C 1KPRB 3VFPB 3V6ZB 2AXHA 1AXSB 4MNHA 2JB5L 2C34A 4G9FE 1WA1X 4FYRA 5D1ZA 1G7QB 3AADB 3UGEA 2MHAA 4Y1SA 1A7BA 1F45A 2OL3L 3RAJH 3KMDA 4L9DA 3MLUH 3OM3B 1P4IH 2YARA 3ARBB 5IK3A 4HJJH 2DQDL 3NJXA 3M88A 3NZ8A 4XP9H 3D0AA 1LGVA 3PU7A 4Q97A 3BT2L 3E6FB 3MREA 2GK0B 3MBEB 2C9XA 2HJKA 5AW4B 2R0WH 5DJ2B 1A8ZA 4Y4FD 2QKIA 3F7VB 1FUNA 3FHAA 4YHOH 4N8VA 4RZCA 3U1PA 1T5WB 2G4EA 3VXUE 1GYWA 4FQXA 4JO8A 4KXDA 3QNZB 3ZDZE 2FGWH 1PEWA 1MZYA 4MQ7B 1YC7A 1JDCA 2Z0BA 3Q06A 4WFHE 3WXWH 4HH9B 1MH5B 5JW3H 4DP0X 3V4VB 3BAEH 3NACL 1N3NB 1AY1H 1C7SA 4LBAA 2CKBA 3W1ZA 3MRCA 5ANMA 5CU5A 2F19H 3IE9A 4I88A 5HYFA 4FX5A 4M6MH 2PN5A 2FO1A 1NCBL 4HETA 1RK0B 1A02N 5ITBL 2SEBB 5I8EA 4BFNA 2E9WA 3BT0A 3MKKA 5CBEA 1HI6B 1Y18A 1YJDL 3GMRB 1K5WA 1Z2KA 1KN2L 1JWUA 5AYTA 1NIFA 2EXSA 3EH2A 4D0CA 5E2JA 1LL1A 5L2KB 3W37A 1QHQA 3BWZA 3GIZH 1KIQA 3GB7A 5CMAB 2DIJA 3EBHA 4TSAH 5C08D 2LABA 2CGRH 2B4CC 4CGTA 2E9GA 3Q8AA 4PG9B 1C5DB 4JFDB 3KW7A 3T6ZA 4N5UA 2JQMA 1EHLH 1QI5A 3ROOB 3MOBH 4JFOA 2D0GA 5F44A 1R3LB 5C0RL 2VDKB 3BZ5A 1F56A 2YUVA 5BQ7B 3D9AL 1DQQB 3UG3A 3DYOA 3QEQA 2P5EB 2WVUA 5IJVB 3HHMA 1OQOA 4UV7H 3GGWB 5FO7B 2ZUSA 3N5AA 1YY8B 4UT6H 3G5YB 1G84A 2F0CA 1IBYA 4UV4H 1R3IL 2Z93B 2V17H 3OBAA 4NQUA 4K9JA 1GGYA 4G6FB 1BXUA 3ZE0B 1EEZA 1RFDL 1LO2L 3O6LL 1Q0XH 32C2A 4OGAC 2ITDA 2XA8H 3RPIB 2C1OB 4Z7AA 3U0PA 1TZHB 2F74B 4MA1C 3QWOA 4O4YH 3EOTL 3X1FA 4MMXC 2CLRB 1LJMA 2WBJB 2P42B 4F8OA 1RU9L 3LNDA 3RWJA 2MOVA 4TNVK 4HZLA 2Y06H 3L3HB 3LH9A 4H4NA 3DV6B 4HEME 4MMZB 4K7PL 1OK0A 5DMIL 5FWRA 3P30L 1C5DA 2O5XH 3MLYL 3QIWD 3ARFB 5G4MA 5I82A 1MCWW 5IVXA 3H54A 4F58L 4XN8A 4GI9A 3DVFA 4L23A 2X3AA 1GGIL 1WBXA 1U8MA 1A6VH 4YC2C 4PTUA 4Y19B 1TVBB 4YFEA 1V7ML 4V11A 5I15H 2XKNA 2N56A 3PXHA 3OXRB 5HVWA 1YMMB 1X6NA 4O2FB 2VQUA 2BFVH 3X3GH 2YD3A 4QAWA 4U1MB 4LNRB 4WGKA 1D9KC 1NCOA 2GIMA 1CL7I 4OZGE 5C2UB 4NS0A 3CH8A 1MREH 1YPZF 3OG4B 4M8UA 4PSRA 3S96B 5F7HA 3RVTD 3VVVA 2P43B 5KN5B 3DUHA 3IJSB 5DRXB 1FLRL 2ZWYA 3BGMA 2BPBA 5IWLC 4YHPA 4W9HC 1AJ7L 3PGCA 1AXTH 3WE6A 4FLRA 3WE6B 3QI9A 3VGHA 4KKNA 4ALAH 1JVKA 4KHTH 5A2CA 4LCWB 1X5JA 3U6RB 3V4UH 2JVUA 4RMWA 1VAHA 3VXSE 4XAWL 3HRZB 4XBEL 4YHYB 8CGTA 4PRHD 2OJEA 3AS2A 2DW5A 1RPQA 3ZL2A 4ICWA 4QRPB 3H55A 2WOBA 1UC6A 5I23A 4JRXA 1DBBH 4AYGA 3TT3H 2Y5TB 2J88H 4S2SA 1KBBA 1CLYH 3C5JA 3EBGA 3APFA 2NNCA 4ZOCA 1RPKA 2NY0D 5HDWA 1U8MB 1R1CA 3UXFA 4MQXD 4QHUB 1MHHA 5EU5B 2SODB 3SDAA 4MAYB 4KI5F 1GZHC 1CL7L 4OTXL 4GG6E 4ELKB 5DFAA 4H8UA 3E9UA 2VW6A 4KTDL 4WNSA 3LZLA 1TTBA 5C09A 3V6ZA 5C09B 1E9QA 4W9KC 2FAUA 4A7GA 5ID0A 3QEQE 4L3EA 1CD1B 2A9NL 2WNWA 2FJHB 3WG7B 5PCYA 2JKJA 4O02H 3MV8B 5HHOE 4KV5E 3FF7A 5AB0A 1M3IA 4A55A 1WISA 1OO2A 3GNML 4ZODA 4PJEF 3RPIA 4PRNB 2D7TH 3DIVA 5IBLC 1JDAA 3VWKB 4E9YA 5F3BA 4G6JH 2G2NA 3IDNA 2ESVD 4JFZL 2WLKA 2PYEE 1KCKA 1R33A 5E5MA 3FPXA 3T3MB 4JHBA 5FKAB 2ADIA 5FW8A 4U6VL 3BUTA 5B1JA 1UT9A 1E5UI 3DIDA 4XP5L 3RKDC 2IANB 4PHZA 3FBKA 1U4FA 3JV6A 5FPIA 3GT6A 4S1SL 4ZZFA 3D85B 1MZZA 4GW5A 1HQ4A 2Q3AA 3EYVB 1T20A 3CHQA 3GXIA 4GAFB 1PX8A 1F02I 4IU3B 4IM8A 4G2AA 2BP5M 2WCGA 3FK3A 4GRWB 5JIDA 1U92B 3HB3B 3TBTB 1AFVL 4FFYH 1U91B 2QR0B 2WLZA 3TS8A 4TNWF 1FYTD 4WI4A 1G87A 2XWRA 5D7LA 1B0GA 1D2OA 5IMOA 3GSQB 5DJ8A 4AH2B 1I7ZB 5JDSB 2VZUA 2YN5A 1PLGH 4FRWA 1ANUA 1YAIA 1G7HB 2AK4E 3FUFA 3VQMA 4PJCA 3U79A 5K69A 1K5NA 5F6IC 2OW6A 1ZT1A 4XVTH 1E3XA 2DQGH 3SBRA 1IC7L 1NOAA 4CSTA 1IM9D 5FLVA 1GZQA 4PWIA 5BO1L 4FADA 1PL3A 2QVMA 1AO7D 4WSJA 3DHPA 3I9GH 4UDTB 4YE4H 4W93A 5EU7E 5F1IB 5T1LA 4CW1B 3LQAH 3VDAA 4N5ED 4LLWA 3ULAB 4ZMAT 3I3BA 3MYJA 4L3FA 3RI5F 4LVEA 4DVBB 1CJYA 1AD0B 5ICZB 2W1NA 2H32B 4TOYL 2VDPB 4MWFA 5I19H 3CH1B 3LHAA 3PHOB 4KBPA 4WWNA 3ISWA 3IU4L 2DWEA 3AGWA 3DPBA 2CO4A 1QSEB 4XC1H 5CINH 3SPHA 3RBSA 1BZ7B 4QNPF 4Y7OC 4GKNA 3BH8B 3EDDA 3QUZD 4A7VA 4AQ1C 4KGLA 4D9RD 5LGYA 1ZEAH 2EDFA 3HNTH 3FT0A 3D09A 5DD6A 4BXSV 3QPKA 2JTDA 5GGQL 1M1XA 4MXWL 5GZOC 3FL7A 3TESA 1E5ZA 1MDTA 1GW0A 1KLGA 1D6EB 3KDPB 5EOTA 5I1LB 2R2HA 2EO1A 1RD6A 4P2QB 2H2PD 3BJLA 5F0PB 4NO3B 2FX9H 1DJSA 2Q6WB 5F7BA 4XOBA 2VCOA 2R1XA 1GOGA 2R1XB 5E2UL 4U2YA 4WVRA 3G6DL 3L8QA 3ETSA 3MRIB 4MMYB 1IGJA 1CQYA 1HXYB 1MFUA 4PS8A 3WOVA 2MPAL 1T89C 2X4QB 3MV8D 4WHYH 3V0VA 2XU9A 4MB3A 2CRYA 5IF0B 4RDQG 4LF3B 2VUYA 6FABL 1MVFA 4RAHA 3SBPA 3RKDD 5EIQA 1E67A 1LO0H 2BIQA 2PYEB 4XVOA 1UGNA 4XGZA 3W3BA 1U2HA 2WANA 5GS0L 5I73B 3DJSA 3N1QC 4OKDA 1KY7A 1U8KA 4OIIL 1I1AB 1E4WL 4WEBL 3CH1A 3MJ9A 4LL4A 4G3YH 2M1KA 4WFGD 2FEEI 4EEEA 4A7SA 5F89A 3FO9B 4DF9A 3NABL 8FABB 5E2UH 1AGDA 3CZFA 3IAQA 3OVUB 1URZA 2BP0B 5JLZB 3WFBH 2VMEA 5H35B 3HLAB 3CIQA 2RHEA 3SYAA 4F7PA 4QRUA 2OTWB 1RZ7L 5IB1A 4FQLH 4WEUD 5GGQH 1OPGL 4U1LB 2QVIA 1KT2A 1P5VB 1RZ8B 3IMBA 3WEXB 3HC4L 5E9DE 1UGKA 1WCBA 2D73A 1P6WA 4PB0L 1LE5A 2ICWI 3O8XC 1B9KA 4JY6B 4PGEA 1T04B 1CLVA 5IVXF 5GRYA 4AGLA 5F93C 1MFEH 4XC3H 1KPUB 2C9RA 4HUVA 1TZGL 4OJAA 3C8KA 2EIKB 1IT9L 4HBCH 3UADA 4KKQA 5FO9B 2P8MA 3AG3B 4B3EA 4P9MH 4AG4H 3VYNA 3OKOB 4S1QH 2OI9B 4PWJA 5C2BL 1Q9OB 1WAAE 1TYRA 2UY7B 1SXZA 3A6CL 2DH3A 3VXMA 4KQ4H 3NJJA 1TJHL 2OMYB 3BSZH 5FK9B 2R29A 3QXUA 1GJIA 1TPXC 2CHNA 1EEYB 5LBSL 4D7BA 1XL6A 5DJCB 4L37B 1AZZC 5ABAA 4HIHA 4LLDB 5C0DB 4JG9A 1YPZA 2D7PA 5LO7A 5EZLB 4ODVL 3DBXB 5AZEH 3BVNB 2WBWB 5JPNB 4O58H 1BW8A 1Z32X 4C4BA 4I0PD 1A6WH 4HUCA 1BPVA 4K55A 1SBSL 2XQYG 3ATDA 5E6SB 4OD1L 5FUZH 3BAIA 3HVNA 1JDDA 2EYRA 4H20H 4ZFQA 3TBWA 3BEWB 2PYFB 4D8PB 4NENB 3VFVA 1D5IL 2AGJL 4PIRF 2BVQA 3QG6A 2NDGA 2VLJD 2JCCF 3ZHFA 4JFEA 5GIRB 4OV6F 4DPAX 3HG3A 4JPKL 3ROLB 4AYFB 1KEML 1A25A 1ETA1 4QGTA 5KW9H 4J5VA 5AAWC 4KGJA 5DEZA 3TA3A 4DP8X 5I1CH 5ACZB 2V5SA 2IALB 1CFNB 2ZJSL 3OAUL 1ROWA 3ZUCA 5KWYC 2YEQA 1SPDA 4PRBA 2Z4QB 3NFNB 5DFTA 5E8NA 3TZVA 1QHPA 2NX5D 2ICWB 2XBZA 1QNZL 2GJZB 3QRGL 4UUJB 4A7GF 1M3JA 1BYPA 2ZPKL 1KGCD 1RULH 4QPEA 4N25A 3KWVA 5F0LB 3V0WH 1KCBA 5DJDA 4FQ1L 2VZ3A 1K6QH 2UZYB 3FO2A 3ILEA 5D4HA 4RGNB 2J12B 1VFAB 4XCEA 4PJEA 4UU9A 2IVFC 1T7WA 5ICXB 1KJVA 4ZMNA 1U3HC 3IMVA 5JIHA 3QJTB 2OCJA 4BZYA 4K8RC 4PJIB 1NDGA 3PJSB 4HSCX 4MQTB 4Z3EA 1W2KT 3BEWA 1ZV2A 1A6TA 1ZJAA 3PFUA 4NQEB 1OSPH 2D4DA 4PVLA 1YYLH 4WUKH 5FW7A 2I9TA 4EPSA 1Q9WA 5DZNA 1S3KH 2WUBL 1ZHNB 4GB9A 2Y2WA 1QQDA 3EXLA 5JPNA 4W9JC 3ZT5A 1H6UA 1HL4A 4R5TA 2EDYA 4R2GC 4YHKH 5D4QA 4LSTH 1K5NB 4XAWH 1VGKA 4BE5A 3V4UL 1O5PA 3QAZB 3EJRA 3UBXG 2DKUA 3IJHA 3VXRB 1DUYA 4L0ZA 5C08E 3HW7A 4BDVA 3QJOA 3VSUA 4Z95H 2DYSB 2VIRA 2ZUXA 1AZUA 3AREA 3GZQA 4BH8A 2YSTA 2FH6A 3BCFA 5IHHA 2N1TE 2VR6A 2DI7A 3WE1A 4AC2A 4IOIA 1KJMB 3CN4A 4PJCF 5I19L 2I60L 4OF6A 2BSRA 2CHWA 4B9GA 2QELA 3MCLH 3LB6C 5EC2A 4FL4B 3MFGB 1JFQH 5EHFA 3MNWA 2WVSA 1K9TA 3KEHA 3L9RB 5C6PB 3JQOB 5JHAA 1ZS8B 1SJHB 1NM9A 5SX4H 2X2JA 2D2OA 3P4NB 5TF1H 3BN3B 5LQBH 1ZGLB 5JR1L 4F58H 3I2CL 3NCBB 3RWCA 1SM3H 2AV7A 4JQIA 2XT1B 5CXPA 2Q86A 1EIBA 2AABH 3UGXA 3V5KA 1IC5H 5D7LE 4CVUA 4RFOL 3VB8A 1MNUL 2AQSA 3F5WA 5CP3A 2R23B 1S7SA 3QARA 3AQYA 1MAML 3DO7B 3B8SA 2EC9T 1IQWH 5J57B 2W92A 5AOJA 4ZAKC 1TFHA 2IOOA 5EV7A 2BNUA 2AJXH 1JRHI 1N68A 4D2NA 3MNVB 3MRDB 4Z3FA 2ZKYA 3FYEB 3QC5X 3E38A 4U05A 3JXAA 3O6LH 4AZUA 4LLWB 3WIFB 2GFBB 2PTVA 3C2AL 2Q1EA 4XTRC 3D07A 3GB7B 4MA1B 4EOWH 5EFIB 3ECBB 3IXAB 5D2NB 1KSRA 5EZIH 3BP4A 2DH2A 1L9MA 4B0MB 3S5YA 1KGWA 1A7RH 1M7DB 1A0QH 4NPJA 5AOLA 2FECL 4IS6A 2DQJL 3N43F 3L3DA 5I5JA 4ODXA 2AQPA 4JFYB 1MPAH 1H3WM 3KHQA 3QB7C 3WTWA 3MV7D 1IFHL 2NNAB 3RWFB 4BFGA 4P2OB 2OCFD 3K6DA 4OF0A 2GSGA 1DUZB 4X8JA 1ZLVH 3S3DB 2QR0A 1LK2A 1NEUA 4F57H 5DHVB 4ZUUB 5CCKL 1S7UB 2EAEA 4BINA 2XSKA 4YDKH 5SWSE 1NJ9B 1XHHA 3BKCH 4KTDH 3C60B 3F2LA 4S1DD 2FJFB 1QO3B 2HJFB 4AEFA 1QO3A 2HJFA 4PUBH 2EE9A 3ISRA 5FXCH 3GEWB 5D93C 2NYKA 3LZOA 4GW1B 4RGND 4W9EC 3FB8B 3HMWL 2AKRB 2X41A 3QIBC 2DWYA 3H7BB 4OKVB 4M7ZC 3ILQD 3QPQC 2DIBA 1E7UA 1J9CT 1TDQA 3BKJL 4DGYL 4HIQA 4NKOB 2GTZA 3IFLL 3BVXA 1WC7B 1NPUA 4UZUA 1DBBL 3QUXD 4F2FA 2A9AA 4PY8J 3QRGH 4J28A 5T1LB 4CW1A 1MCFA 2ATKA 3BI9X 2BWDA 1FZMA 3DOSA 2NNFA 1SLXA 2AJUH