3NJIA

S114a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLAPDPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njiA00
3OQRA 3TBBA 3UGEA 2GSMB 3ABKB 3AZUA 1JZIA 1RZQA 2VM3A 3EH3B 3X1NA 1NWPA 3TBCA 2VW6A 2ZOOA 2BP0B 2GI0A 2BO0A 2BP8A 2MRYA 3FYIB 4YSEA 1AQ8A 5B3SB 3ZDWA 1W6LA 3NJJA 4FAAB 3WNIA 4HIPA 3S8GB 1AS6A 1AZRA 2R7EB 4DP4X 2IH8A 1AZNA 1HAUA 1A65A 3CG8A 5I6MA 1BQRA 1PF3A 4AZUA 1AZUA 1BXAA 4KNSA 5TK4A 1JZEA 4YL4A 2WO3B 3FPXA 2E86A 4YSRA 2FT6A 2GBAA 1OE1A 1HAWA 2XXGA 1OF0A 3HEIB 1OCCB 5I6PA 4CSZA 3AG1B 1EHKB 4A2FA 1XB8A 3FT0A 3CDZA 3DTUB 5ANHA 4BDVB 1AANA 4AKPA 3JTBA 2IDTA 1GS6X 4HCIA 1OCOB 4A66A 1L9RA 2BWIA 4QKTA 4NB7A 2DWTA 1SFHA 1WA2X 3AG4B 2B08A 2W88A 4A2HA 1PCSA 2OCCB 1T5KA 3ZIYA 4F2EA 2X88A 1XB6A 2ZONA 1XMEB 1ZIBA 3ABGA 3PAVA 4G7SB 4A2EA 4DPCX 3SBRA 3N55A 4ENZA 4HCFA 2GC7C 3PCYA 3KW8A 2LLNA 4AKQA 2IDSA 2P80A 1NIDA 4G70B 4G72B 2PPEA 4YSPA 3TU6A 3V9CA 1NTDA 4AX3A 5B1AB 5TK2A 3WI9A 1GS7A 1RKRA 4KOCA 3WKPA 4W9ZA 1TEGA 3UADA 1A4CA 1KDJA 2BZCA 1E65A 4E9YA 1NIEA 4A2DA 3FPYA 1J9RA 4PCYA 1PNCA 4YVUA 2J57A 3S8FB 2VW4A 3ABLB 3FU9A 5D4IA 1OCZB 2YAEA 1BYPA 2QPDB 3KW7A 2XWZA 4YVNA 3TA4D 4EF3A 2VN3A 1PLCA 2EILB 1TEFA 4E9WA 1F56A 3FQYA 4YSCA 1E5ZA 2AVFA 5B1KA 1NPNA 4G7RB 4QLWA 1PLBA 3D12B 5AZUA 3NJIA 2DV6A 1SHXA 3PXLA 3FU7A 1BEXA 2IDFA 3UAAA 4E9SA 3X2QB 4KNUA 4ZK8A 1OCRB 2QT6A 2XLLA 1BAWA 1PMYA 4JHVA 1E67A 2XU9A 4P5RA 1M9WA 2IDQA 1JZGA 1PLAA 3T9WA 3GYRA 1RZPA 3IN0A 1E30A 5B7EA 1OE3A 4BXSV 3NJMA 2I85A 2H5UA 1I53A 2YXVA 4DP6X 3SQRA 2IH9A 1NINA 3GXUB 1ZPUA 1PNDA 4YSOA 1IBZA 1IC0A 1SHWA 1MDAA 2AFNA 3T6XA 4DP7X 2I7OA 3ASNB 3HB3B 3T6VA 2J55A 3QJVB 1AR1B 2YXWA 4HHWA 6PAZA 1KDIA 2J56A 1KBWA 3FSAA 1SDDB 2EIKB 2PLTA 2IWKA 4JHUA 1X9UA 4DP0X 2PPDA 1IUZA 3OMAB 5A7EA 5I6LA 3T6WA 2VMJA 2W8CA 2IWFA 1OE2A 4YSSA 5B7MA 1CYXA 2H3XC 2PPCA 4DP2X 3QJRB 3NJHA 5I6OA 1A4AA 2Y1AA 3NJFA 1NIFA 3RYMA 3QJTB 1ETJA 1B3IA 1KYAA 4P5SA 3S3DB 3NSCA 2DY2A 4YSTA 3AG3B 5I5JA 3SBQA 1KCBA 1JZFA 2CCWA 1ET7A 1CURA 2PP9A 5E9NA 1WA1X 1A3ZA 1GSKA 1JZJA 3AY2A 7PCYA 1V55B 4BWTA 4UANA 4E9RA 1AZBA 2YARA 1DYZA 4L0PB 1RCYA 2XV0A 1OOWA 3MX0B 3QQXA 3X1FA 2XX0A 2FTAA 1ILUA 5EHFA 5B7FA 1AOZA 2WO2B 2BP8B 1ID2A 1M56B 3NSYA 1BQ5A 4MFHA 1NICA 3FSZA 3DIVA 3G5WA 3ABMB 3BVDB 4BWWA 3X1EA 2GHZA 1JXGA 3MBWB 1ET5A 2FQGA 4DP8X 1NWOA 1QNIA 1GY2A 3T71A 4F7KA 3H4HA 3FQ2A 1XB3A 4A2GA 1J9QA 1L9SA 3ASOB 3OM3B 4G71B 3FQ1A 3NYKA 3OMIB 4PAZA 1AG6A 3JT2A 5F7BA 9PCYA 3WKQA 1A4BA 2BP0A 1MG3C 2UX7A 1NPJA 2XX1A 3X1BA 2CALA 2VSKB 4AI7A 4GYBA 3FS9A 1QHQA 4DP5X 2EIMB 1AIZA 2VM4A 4UAHA 2PCYA 5I5IA 3CDZB 3NJKA 5D4HA 3FYEB 2R7EA 2QDWA 2YAQA 3QJUB 2FQFA 2YAMA 1CUOA 4DP9X 2QDVA 1JXDA 1L9OA 4E9VA 3EF4A 5I5MA 3ERXA 4TXVB 3T6ZA 1YLBB 2JXMA 2RACA 4UF7C 2FJSA 3SBPA 2DYSB 1CC3A 3OD3A 2XVBA 1JXFA 1L9QA 4Q8BA 1MZZA 2JFCA 3IN2A 1BXUA 1MG2C 1SF3A 2FQDA 1ZDSA 1L9PA 1TKWA 2BW4A 2IAAC 1URIA 1MZYA 3EH5B 2HX8A 3AW5A 2XYBA 5B1JC 1JERA 4YSQA 2CBPA 4BDVA 1NIAA 1W6WA 2HRGA 3CVDA 2Q5BA 3U25A 1HFUA 4G7QB 1FWXA 1GY1A 1V54B 2GIMA 2DYRB 3NSFA 3NJLA 2TSAA 2ZXWB 1PAZA 1EZLA 2HRHA 1V10A 3GDCA 4A68A 4N8UA 2IDUA 2GB2A 2XUWA 4KO9A 4M3HA 4E9TA 4JKNA 2XV3A 3X1GA 3FSVA 2UXGA 2FQEA 2I7SA 1PZCA 1X9RA 2YAPA 1FA4A 1ZV2A 1ILSA 2XV2A 4DPBX 4HCGA 2GC4C 1PY0A 2HLEB 4X4KA 1NIBA 3PLYA 2IWEA 1ASOA 1OV8A 5F7AA 1JVOA 2X87A 1AZCA 4YSAA 2UXVA 2FNWA 1KCWA 2PP8A 2YAFA 4HZ1A 1KBVA 1L9TA 4KO7A 2AZAA 3PAUA 1J9TA 3PAZA 3QPKA 4A67A 3FU7B 1SFDA 4AKOA 5PCYA 5LDUA 2B3IA 3QJQB 4GP5B 4Q89A 1A8ZA 2CUAA 3BQVA 3EHBB 4HHGA 1ADWA 1SJMA 3UAEA 3QJSB 3S3BB 1ET8A 2FWLB 1KV7A 2FT7A 3IBOA 5PAZA 2HXAA 2AANA 1NDTA 5B1JA 3NP4A 1JOIA 2PPAA 2FT8A 3IEAA 4HAKA 3NT0A 4BK5C 1SF5A 5IY5B 1PZAA 3NP3A 1SNRA 1W8EA 4YSDA 1J5CA 2HX7A 3WG7B 5AFAA 3CVCA 1GYCA 4FA7B 3DKHA 5B1BB 2Q9OA 1CYWA 7PAZA 5I6KA 2BWDA 4GP8B 2TSBA 1UATA 2YAOA 3NSDA 4N4YB 1PZBA 5FC9A 1ASPA 2OJ1A 4NAJA 4DP1X 2CAKA 1WS7A 1J5DA 3H56A 3ZBMA 1E5YA 1GW0A 2Y69B 4BWUA 1IKOP 2XXFA 2MTAA 4W1TA 1AG0A 2OV0A 2PP7A 3FSWA 1ZIAA 1TU2A 2NRDA 4GP4B 2P80D 1AAJA 2ZWNA 2PCFA 1BYOA 2BW5A 2YQBA 1BQKA 8PAZA 3L45A 4E9XA 1BXVA 4NERA 3FU8A 4CSPA 1NZRA 4WKXA 2EIJB 4HALA 1DZ0A 1GS8A 1SDDA 2J5WA 5D4JA 2UX6A 4M4RB 2A3TA 2VSMB 2HX9A 2N0MA 4KNTA 3CZUB 4F2FA 1AACA 3NJGA 4WTQA 3C75A 1WS8A 6PCYA 1FFTB 1N70A 2HZHA 4GXFA 1J9SA 3AG2B 4YSUA 5I28A 2YAHA 1AS7A 1VLXA 1JZHA 3IE9A 4K9JA 3S3CB 3UACA 4GY4A 3TASA 4BXVA 3WNJA 2EINB 1GR7A 3H4FA 1IBYA 5I26A 2H47C 4E9QA 3WIAA 1M57B 1N68A 1ZDQA 4KOBA 2AZUA 2BHFA 2WSDA 3PPSA 2PPFA 2DWSA 5I6NA 1WA0X 1QLEB 2QPEB 4RH4A 4DPAX 3NJNA 3ZX1A 3EH4B 3UABA 4KO6A 1AS8A 3CVBA 3OMNB 2UXTA 2VW7A 2UXFA 1R1CA 1WAEA 1KGYE 1JVLA 1ASQA 3N2JA 2CJ3A 2JKWA 3V9EA 2BZ7A 5AKRA 4KO5A
chains in the Genus database with same CATH superfamily
1OP3K 1PJ9A 1SN5A 1CFQB 2DIJA 4LPXA 1GPOH 4NRZB 1R33A 3OXSA 4OVUA 1DJXA 3GUTB 3II2A 4J3BA 4QGYA 4JDVB 5CJOH 5TDPB 2PR9A 4B5EA 4MAUH 2OZ4L 1NCWH 3CK0L 2BY1A 4PBDA 5HJBA 4EXKA 2DQMA 2WIIA 4ZZFA 1IJNA 2R69L 1DCLA 4W70A 4TNWF 3ZZSA 4YR6A 3D2UA 3UZQB 3ASWA 2WV3A 4PTUA 2B0SH 3S8GB 3HVNA 4NQEB 5F3BB 2UVFA 1MOEA 4Q14A 1E4WH 2DKMA 3S9DB 2CR0A 2DTSA 1BEYH 1I8KB 3GRWL 3D7PA 5D7LA 1SDAB 1NCTA 4WHTA 3V6OA 2R29H 3HUJE 4I3GA 3S4SG 2ZUWA 5B1CA 1VEMA 4GAGL 2YPVL 1X7QA 5KVDH 5T5FL 1OVZA 1JPST 5DEZA 1ORSA 4YZFF 3ZJAA 3F6LA 3ZHNA 2BWQA 4V1DD 1MNUH 4LSQL 3C08H 1YNTF 5DMIL 1J8KA 3VQMA 2DQGH 2IH3A 1KENL 2FO8A 2WQ8A 3HG4A 4P57B 1N9PA 2X2HA 3SYAA 4EI6A 3LRMA 4X4XB 2MKLC 5A1AA 1F1DA 1ONQA 2A9ML 2EZ0D 3HI6H 3MJ6A 1TJHL 4U05A 5ABDE 2JI3A 1FFOB 4P2OD 3SE9H 1FL3A 3E6FA 3BVNA 4BFRA 4K8RL 1P4LA 3REVA 5KSUA 1EAPB 1XGUB 4XMWA 1N7ML 2OKMA 1EUUA 4U1MB 1WA2X 2ZF9A 2IGTA 2YBRA 4LU5H 2EE6A 2FCBA 4RAHA 1KT2A 8FABA 4MRCA 1MVUA 3KD4A 3L4VA 2PR4H 3H9SD 2WB7A 5IJDC 1SVCP 3RQ3A 4O2EA 1WF5A 2QFPA 2GT9A 4UV4L 3ZZ1A 3ZL4L 2RB8A 3WHE0 2F8IA 3K8LA 1KCUL 1IL1A 3OGCB 4JZOA 4UTBA 2F54A 1QZNA 4C56D 4W9GC 3EDFA 2R1XA 5E5MB 1G6RA 1JF5A 2NYKA 3R1GH 3WTUA 2CDFA 4G6KH 4RWHA 2VR3A 5L0QB 2CUIA 3KWWB 1AO7A 3MYZA 2CHNA 3D4CA 4PQXA 4GNKB 3U6XA 1ZEAH 2E9JA 5AW8B 2D7QA 1ES0A 1Z2KA 3RPBA 4A2DA 1IFRA 4OBRA 2OW7A 1YEIL 4L8SB 2CRIA 4YVUA 3FU9A 3S88L 4WFGE 2AABH 1M7UA 3MLRL 4PRAA 5LAXB 3B5TA 1PQZA 1IKFH 3PWPD 4TUOA 4YVNA 2AKRA 3JWOH 5AD0A 1UQSB 4MGXA 5FYJE 2BVTA 1RK1A 3D4GA 2H3KA 5BVJB 5C7XL 1WZMA 1S7QA 2ATAA 1BVNP 1C5CH 4N25A 1IAKB 4PFEA 2J88L 1N5AA 2X1WL 3S4SB 1EHXA 4WV1B 4AMXA 2DPKA 2EZ0C 1DQLL 3O41B 5HVHC 4YSCA 4IM8A 3S0PA 4P2OC 4IKKA 3MCKA 4HQQL 1AQHA 2MJWA 4J3OF 4OZIE 5HYJB 1O7DC 5AAWC 1M6OB 3D12B 4AXWA 4MCYA 1L0XA 3RJDA 2WGXA 1YEGH 2BNUB 2YJLA 3CN3A 4P48A 3UTTB 1DEEB 4E9SA 1B9ZA 3HS0A 4R7VA 4QOKB 2WD0A 1HHJA 2CGZA 2Y0SA 4ELME 4GRWE 2DTML 2GG1A 3GMNA 4DGIL 2P8LB 1UT1A 2E74C 4KI1A 1CICD 2CIIA 3L3JA 3NFSH 4AIXA 2PXYD 4WUKL 1UXSB 2XTJE 1MFDL 3BKJL 2E7HA 1I31A 4OGZA 4KMLB 4OF6A 4TSAH 5GZND 4AEHH 4TPRH 4N2GA 3WY4A 1HXYA 3DJRA 4D0BB 2ZPKH 2VR6A 4Z78B 2HPOA 1VDGA 5CLTA 3ARBD 4NT6B 4XPHH 4HCRA 5D2LF 4KAQH 3EBGA 3RWGA 3K46A 5EO0B 4JHUA 4ZAKC 1CGTA 2FUTA 5CZRA 4XC3L 1FG2B 2WZ6A 3IMRA 2W0FB 3OMAB 3THML 3NCBB 1SOKA 2UZYA 5D1QE 4F91B 4X99B 4QYOA 5HHVL 2VMJA 4H0HB 5DK2A 1IFHL 3BW9B 1TNNA 2GHWB 1HTYA 5DVOA 1KJMA 3MJ9A 4G8GD 5I6OA 3MREA 2RMNA 4OZ4B 4M5YL 1KTDB 1FI8C 4GEJA 5DDHA 3GXMA 3GFUA 3T2OA 5I1LB 1INQA 4FTVE 1WAAF 1ETJA 3FFCD 5EOTB 2L7UA 1MVFA 4PJ8C 4ZDHB 2APVA 4UZUA 4Y5XC 4H44C 4LCYA 4HEMA 4F7TA 3P0YH 4HPOL 5EA0L 3HR6A 4BGLA 5MENA 3G3LA 4Z0XB 1JZFA 4C54A 1XXFC 5HJ3A 2EIZB 4FERA 2VRQA 3NRPA 43CAB 1CICC 2ZD0A 1T3FA 4M1DH 3VGAB 1K3IA 2PXYC 1B6UA 3ABZA 4D7BA 3KPSD 4ADIA 1EO8H 4P2RB 4L48A 1KCVH 2K45A 4P05A 1MPAL 1QNZH 2FH8A 1Q9KB 2Y2YA 1AOZA 5C09D 4N2AA 4UQ3B 2QPFA 5GZNC 4HP5A 3Q5YA 3LKNB 2QKSA 5C0BB 3F84A 2N7SA 2Y25A 3O4LD 1QFHA 4JG5A 4Y4FB 5JW5B 4HWEL 3K1DA 1MHCA 1KGXA 2LU5A 3VE0B 4BWWA 1BV8A 3OF6D 4W9CC 3ZMNA 2EE2A 3ARBC 3O6MH 4JFXA 4NLHA 2FQGA 1M4KA 2PTUA 2ICWA 4F7KA 3NH7L 3OPZL 4JM4H 4GKZB 4G8AC 4UT6L 3ZTCC 3BT0A 2PYEB 3CXDL 4EN3D 4QRSB 3PWUA 1RU9L 4Z7WA 1JSYA 1NFIA 4LNVA 5F7BA 5D96B 3QWNA 3OSVA 4CKQA 4HBQA 1AQMA 5CWSA 3AFLA 3VU2A 2UX7A 4XX5A 4NNYA 3VWKD 3ZXAC 2FIKB 1KJ2H 3CVIH 1YYMH 3QUXB 2BRRH 4H8PA 2C3WA 2CIKA 2FEDD 4GI6A 4R4ND 5T1DH 5HHXH 5IKCB 2BIIA 4YXHL 5E8EA 5GGRY 2ICEA 2BMKB 2EH8H 3VXNA 4F3FB 2QDWA 4NZFA 4ZMOA 4RGOL 1QX1A 2F6AA 4QTIH 2NY6B 4F5CE 1TTRA 4AJYV 1JUFA 4N0UA 4MNQE 4X7SL 5I1JH 5AWNH 2K78A 2ZX9A 2X40A 1T7YA 2PWDA 3GJFB 4GAJH 5AW0B 1SF3A 3Q8EA 1ZDSA 5DO2D 1UXMA 5KYYA 2W80C 2HMID 3EDKA 5AVVB 4JJ5B 4QTHA 4LCCC 1TFHA 5K39A 2ZXQA 5EMYA 3TV8A 1JPTH 4BDVA 3QDGB 1NIAA 4JO4L 4NENB 2KBGA 1SY6A 4BYHA 1DVFC 4IBUA 1FWXA 4I2XB 5TFSH 3B2PA 2ZXWB 1L7IH 3NIGB 4Q58C 1T5XA 2APWA 2YPKB 1H3PL 3CGTA 5TDNB 4ZMPA 3QPXL 1MY5A 2WUBH 2QHRH 4EN3C 1UGNA 4AM0Q 4YGAB 1V3KA 4MXWH 1FBIH 2EDDA 3GNMH 4OLEA 4N0FA 4UMGA 5T1MA 1V3LA 3CHQA 1W80A 1OGTB 3EH2A 4LPVA 1ZHNB 3EYUL 2AJYH 4PG9A 1QEWA 1D3CA 1YEJL 1IEBB 5HYSA 5J11C 4WJ5A 5KS9F 3U7YH 3HC0A 3MNWA 3PLYA 2FEDC 4R4NC 2ZWSA 4R5VA 1OW0A 4EJ1C 4GO8A 4HLZH 3EIFA 4J7RA 4K5MA 1WVZA 2ARWA 2JJVA 4KQ3L 3VFUA 1Z9NA 3V8CA 1NEZA 3N5AA 1IKNC 5F7NC 2XVLA 1RUMH 5F2FA 5J1SC 1ZA3B 1VFBB 1T4KB 3PAUA 2AQTA 2DD8H 2VMEA 5MEOA 4LLMA 2WINA 3D51A 1H3VA 4UM8A 3VXTB 1M05A 1E9QA 3WSQL 1ORQA 1RP8A 3B5HA 3UIZA 4WI0A 2ADJA 2P8PA 4GUCA 5DO2C 3RUGF 1ZS8B 4J3OD 4OV5B 3KWXA 1HT6A 3NN8B 5DJYB 2HMIC 4GO6B 5B1JA 1RULL 4O51A 1DFBL 2NY5C 4UIMB 4M93C 1QSVA 1QEXA 5IY5B 2D9QB 3L4ZA 4XCYB 1IBGL 1RZFL 5FM4A 1UA3A 4XN9A 5JW4N 1GYCA 5EBWA 1RV6X 4MLIA 1D6EB 4RESB 4CVWA 1S7RA 2E4TA 4GP8B 2H4EA 2BSBA 1FE8L 1U4EA 1UACH 4FOMA 4WNQA 7TAAA 4EZMA 1EFXB 4LVEA 3IJEB 5FO7B 1H0DB 4MA8H 5JUEL 4HISA 2MTAA 3PP3H 1NC2B 3N1FC 2QKIA 2NRDA 2BS71 3IMTA 2R2BB 3JSSA 3SCMD 3VI4A 5FW8A 3HFFA 2IPKA 4Z3FA 1EDQA 2YQBA 4N8CL 4PP1D 3QO0A 1EIBA 5HHOE 1LHZA 4NERA 2YEVB 3IDUA 5D7IB 4CSPA 5C8JA 1HN1A 5CZVL 2UZXB 1SDYA 2WNGA 4NXKA 2HKAA 1E6OH 4G7VH 4TNFA 3W82A 4EUPH 1JK8B 3QBTB 5E9DB 3PHSA 3NUKA 1CXFA 2UWEA 3UYPB 3VFTB 3ULUF 3WIHA 6PCYA 5JHDA 2Z4TA 4PB9L 2APSA 4QHKI 1VPOL 1FSKB 3B9VA 1VEPA 2WZPD 2Z8SA 2ZOKB 3FU3A 3SKJL 3KWVA 4XNUH 4J3OC 1RY7B 5E95B 1DDHA 1OAQH 4PJAA 2EVGA 2B20A 2J2ZB 4JFHE 3RNQB 2E7LA 1B3JA 3B2VH 2Z31D 3K72B 4HJJH 1KG0B 2RALA 4HLJA 1QBBA 4YUEH 3O4OB 4L3EE 1E3ZA 4I5BA 5HHQA 4DUXA 2PPFA 2Y36L 5GZOA 2FJFB 5ESVB 4QRTA 4OGAD 4PJGB 4Z77A 1X5FA 3EH4B 4RA3A 1R1CA 5CLXA 1YZZA 4JHZA 5GGVY 4E41D 5CEZD 3GHBL 3MUGA 4N1CA 3IFLH 4KO5A 3EJZD 1IE5A 4K5PA 5JA8B 3MX0A 5IB1A 3MGOB 3X1NA 1U30A 4HX1A 4O02L 3DX3A 2NX5D 1XGQA 3SCMC 4J3UA 2OI9B 1FLRH 1F4YH 2UV3A 3FO2B 5FGCB 4EOWH 4L9LB 3QIWD 1NGZA 1MNNA 1B2WL 4MLSA 1BBDH 3WNIA 4WO4C 2HRPH 1VF5C 4G8EB 4ZJ9A 5MHSE 2GJ6B 4IBYA 5B39A 4F92B 1ZXKA 3NCMA 4ALAH 5C0EA 3ARFD 2R51A 4YPGA 5E5UB 1A7BA 2OL3H 3MRRB 4NZRH 1MCQA 1WHOA 4OD1H 1PIFA 2ZCHL 4PRIB 4N90D 4TMPA 5E4IA 2HVKB 3B2UD 5EF3A 3IKCB 1PLGH 4PSPA 4FYRA 1KY6A 4X6CE 5G5DA 1XD1A 3EUDA 3G08B 3ZY7A 5JTWA 1I85C 4M8QA 1Y1DA 1FNLA 2AEPH 2WY3B 1XH2A 2PCPA 4HA1A 2JKXA 2EEXA 3AM8A 3DMMD 3OVUB 5ENWB 3TN0D 5B8CB 3QORB 2ZOTA 1ECZA 2CO3A 2R56H 2Z31C 2H45A 3PL6C 4L37B 2V5RA 1U8HB 2XBDA 3F2LA 4FMVA 1GS6X 1HHHA 5I18L 3PWLB 3EUUA 4NOBA 1JWUB 2BOLA 4OGAC 2CHWA 4IRZH 4X42A 2ZUTA 1EFQA 4N0YH 4XVSH 2ZJSH 1KIPA 3UG4A 1YEEH 1T1YB 1JN6B 2FNBA 2J5LB 4M48H 4N20A 4P5KB 1ML0A 3RL2B 5LQBL 2OK0L 1J1PH 4FFYA 1K4CA 1KACB 1TT6A 3EJZC 3T8VA 3GBNH 5DHXB 2KQNA 4HCFA 3EYQD 4FFWD 2F08A 1W0VB 5C0AE 1HVXA 2LLNA 4IEFA 3D3VA 2VLRA 4QCIB 1YUHA 4RMVA 1DVSA 5LNEA 3BIBX 5KN5B 3U4EB 3HFML 2W38A 2X28A 5E2VL 3L9RB 4MAZA 4DUWA 3BAJA 3BHBB 1UWFA 1EHAA 1KDJA 4YFEA 4E9YA 3MROA 2FX7H 3EYOB 5F7WC 5EORL 2ROYA 2R2HB 2J57A 1YY8A 3B2UC 3QWQB 5DD5H 2CLRA 2L3BA 4WUUD 1AD9B 1MAMH 1EHNA 3DETD 2W9LA 3DO4A 2QQLH 5E9AA 4Y5YC 1BDYA 4FKKA 2XPGB 1ZHKB 3ZT6A 5KG9B 1U8OB 2YGQA 2ENSA 3DMMC 4XVUD 3W1ZA 4QRPE 4OGXL 1ZK9A 4MJ4A 2Q7YB 1F3JA 2HLAA 3HUJB 4Z7QE 3H54A 3ETSA 5AYUH 4QRQB 3TIDA 4A7UA 4BFIA 5EPMB 3L5HA 2YS4A 1R4XA 4H8UA 3E3QC 2HH0L 2VDKL 1D7FA 4GRLA 5BO0D 4XWOD 1U0QA 4A6YB 3HCVB 4BZ2A 1A6UL 3O8XA 3RRQA 3UPRB 3L3DA 4ZOEA 3LS4L 3MA7A 4ZTOH 2O5ZH 4ZUUB 2GK0A 2IDQA 3F6JA 3QUGA 3BDBA 4ZFGL 3EJYD 3CH8A 1T5WA 2P5WA 2C4FT 2NCEA 3PGDA 1D5XA 2PWHA 4RIRA 5BW7A 1BG9A 4BXSV 4JPQA 3COOA 3X11A 1KB9K 5IESL 1AC0A 3SQRA 1XF4A 1JZ5A 1NINA 1INDH 2VRKA 1WUNT 1RZ7L 4IGBD 1MIEL 5ERWA 1IC0A 4LEOB 4NM4H 4F9PC 3VVVA 2HCZX 3DOHA 5E4EC 1DL7L 1A6AA 2W59A 3VCLA 5BQ7B 4PU2A 2YD0A 1F13A 1T1ZB 2DDQL 2Y3AA 3HKZA 3TWYA 2O6PA 1UVQB 3IETA 4LSUH 3CC5A 2BIQA 1ROCA 3MRJB 5DJ8A 1S5HA 3MV7E 4JFDD 5I6LA 2DF3A 3ILEA 5AOLA 4S1SH 3T6WA 2YD8A 3JUZA 1NCDL 5A6LA 4BQ8A 1PFOA 3DETC 3QR1A 5AOIA 4N8VG 1GL4B 4TM9A 1T6VN 4FQCL 3QJFB 4FZ8H 1LO2H 4XVUC 1OAXL 4ZO8A 5ICUA 5D70H 4IMKA 5GJTH 1SN2A 2EDNA 2FIRT 3FB8B 5ALBH 3RIAF 1IAIM 2XWRA 4R8WH 3ULUD 5DRZB 1IGFL 2J1YA 5JDSB 1UH4A 1CFTB 2D0HA 2CUHA 4FXLA 3S5ZA 1NA8A 1OM9A 2AQRA 3IWVA 3APFA 4M4RA 1V3MA 1JHTA 3HBQA 4XWOC 5AUMA 3LVEA 4ONOA 4EKXA 2G9HA 3MLXH 4XGZA 4LBEA 3O0RH 5BS0A 4MNGA 1BZQK 1FV1B 5AKVA 2ED6A 2ADIB 3C09C 2IBGA 5C9JA 1DYZA 5M7QA 2DYPA 2W1NA 3EJYC 3WUWA 3U1SH 1CG9B 2Q2LA 4GKLA 3X1FA 5L2KE 3E2HC 4L2LA 4WI6A 1N3NB 4UM9B 4OZIB 1NANI 1QFWM 2XETA 3VGBA 2J6EH 2BSCA 1JK9B 4IGBC 3NSYA 4L8BB 1WQVT 1E4XI 3M6DA 1BQ5A 3KPRE 3QVAA 4ELMB 3RVUD 4GRWB 3O6FB 2O6CA 2R29A 1TITA 1NOAA 3VG9C 2CHZA 3ZHKA 2MIZA 4M1GH 3HS9A 4W4OA 1ET5A 3LAFA 2MCG1 4PW4A 5IGXH 3UBGA 3VD5A 5FXCH 2AXWA 4OCYH 2XTJB 4HDIA 4LLUB 1YQVL 2BC4B 3VFNB 3LN4A 1OSPL 3ASOB 3PHQA 4CNIA 3EFDL 1QR1A 4F9LC 1XGPB 1ACYH 3DUHA 5D6CA 5C92A 4GG6F 3V4UL 1ZV9A 1NPJA 4PWEA 1M7DB 4JFQB 2FO4B 1SOXA 3QI9D 2EIMB 5CIPB 3ULUC 4B97A 3FQNB 5DR5L 1AR1D 4N8VB 3M7OA 2FQFA 5D1QB 1Q9WB 2OMWB 2KLSA 3BQUC 3BT2L 3L4YA 1UD8A 4XRCA 1UB6B 3SOBL 2V2TA 3A6CH 1Q38A 4LSDA 1MFBL 1YLBB 3BKML 1I9RH 1NQBA 2RACA 4LLVA 2W9EL 1LO4L 2WMPB 1CGWA 1LL1A 3LXAA 2XVBA 5DRXA 2APBA 1JCVA 1L9QA 1T21A 5B4MD 2W9DL 1MFVA 1BM7A 4NUJB 5H4ZA 3Q48A 1F8TH 2X3CA 4JFFA 1FIGH 1BZ7A 2Z9TA 3V4VB 4O9HH 4FYQA 4LHJB 4FHJA 4KMTL 5KWYC 4H20H 1C12A 4BKLA 5AOZA 4LP4A 3RVUC 3LQAL 1YEKL 3RY6A 4XPGL 4NJ9H 2I24N 4QRUB 1MFEH 2G3NA 1GY1A 2BCKA 3GMPB 3OAYK 3U6XS 1B2YA 4I88A 3F83A 5I73C 1XIWA 2FH6A 5D93C 3ESMA 4IKJA 3VU1A 2D7MA 3FO1A 1DBJH 1TO5A 4M43L 3P30H 2X3BA 4KXDA 4TQEL 4XCCL 2LV4A 5GRYA 2G5BA 1XF5B 4XTRD 5TTRA 3CIAA 5FHBL 3L9YA 4HCGA 4PJIF 1PY0A 3NIDF 1BD2E 4LHUA 3PUUA 4PY7B 1ZLVK 4NC1E 1N6VA 3QI9C 1FVCA 1T6BX 3OWRA 3I3DA 4MCZB 4QKXB 4ZBJA 3MOAH 1LDPL 1FGNH 1AR1C 3ZKMC 2Z35B 3VJ6B 1UJ3C 1F45A 5ABAA 2VITA 4DK3A 1XAKA 1HL8A 4JAMB 5EIIG 1FAKT 1SMAA 5ICXA 4DK5A 3TEZA 4IOIA 3BKCH 1S7SB 1P69B 5GS2D 3BVXA 2FR4B 2Q76B 4XZUB 3OG4B 4XCFL 5B4MC 4MSWB 2ZP9A 1DQQA 2DB8A 3VXPB 2P5EA 3FQUA 3FQWB 4HH9A 4UOW1 3EHBB 5DQDL 2D8KA 1WPCA 2FWLB 5D2NA 5AVYB 3UTQB 3C5ZA 4IRSA 3M8OL 1KBGL 4MNQB 3C60D 1I7RA 3CFDA 3LPGA 1I7UB 1SF5A 2X7LA 1R19A 4NCDA 4C59B 1J5CA 5JXEA 4JQXA 1R75A 4ODUB 1IQDA 4NHCL 2NY4B 1N6UA 5IMKB 3CVCA 4FA7B 2JCCF 4LOUD 3FL7A 1HDMB 2YPLE 4YNYA 5GGUB 5F8RC 4JL1A 3IU4L 5EN2B 4KH2A 5C08A 3LTVA 3W39B 1BECA 3H56A 3QARA 4F58L 3V6FA 1C08A 1M7XA 1S5IH 3QUZA 1NFAA 3PFQA 3QXVA 4PRPE 1OB0A 4PREB 3K2UH 4XTRC 4AWJC 5T33H 5GRZA 3QRGH 2YGPA 3I2CL 3LEVH 4QXUL 1NGQL 3DV4A 3HE7D 4TRPH 5DJ0B 4EZLA 5FO8A 3BRDA 4DKFL 1BQKA 4FQ2L 4L5FH 1K8DA 3K6NA 5HDBF 4F7MB 3ULVH 5IT2L 2MNUA 5FO9A 3BAWA 1AP2B 3D5OF 3FU8A 3ECBB 4QUOA 3MLUH 1C9SA 5GGRA 4G43B 3LNFA 2E3VA 1JGVL 2UX6A 3JVGC 1P9MA 3BP4A 5D7HA 5EZOH 1AACA 3UCQA 4NAMA 2XQYK 1OT2A 2WQVA 4HC1H 5A2BA 4YX2L 4EI5D 3T2QA 4PIRF 3RTQB 3SQOH 5EIIB 5FLUA 3T0EE 2H3NA 2I9TA 4YE4L 2JSFA 2Y23A 6TAAA 3IDJA 3FCSB 4Y2LA 3QEQD 4U1NA 1DDTA 1T2JA 1KMGA 2VDML 1NUNB 4KDTA 4Z3HA 2WP3O 4UDTB 5J1AB 1FFNB 4CBPA 3L95B 4JCWA 3P9WB 3KDPB 1ZLUH 1G7IA 3KPNB 2VDRB 3N43F 2DQEH 2ODHA 4Y19A 3LZFL 4LOUC 5F72S 4B9YA 4YFDB 1JVLA 3MFFA 5FGRA 4F7CA 4FD0A 1KJ2A 1ZS2A 3BGFB 4JZNB 4LCVA 3FTUA 3ZDZF 2VLLB 3O0LA 3FFCE 1CGUA 3ZU8A 3RBSA 2CDEB 2FATH 4FQXA 1II4E 4NKDA 1JHKL 1HWHB 2GY5A 4BD4A 4XNMB 4LL9A 5EEZA 4TVPL 4P2CG 2ZUXA 3HE7C 3FYIB 4L4VD 3VYOA 1RJZB 3TYGH 2VJ0A 1ETB1 4OLYH 4KROD 4PJHF 3KPPA 4P06A 2Z34A 4PGDB 5D8JL 3RWFA 2ICES 2AS5M 4AMKH 4PJBE 3FUHA 4POUB 2VDPL 3LB6C 2HA1A 3I85A 5JYMA 1J05B 4ONHB 4DP4X 5J13B 1A6TA 4CN6A 3QUMH 3S2AA 2WSPA 4MHHG 5CBEA 3TGXA 4WTWA 4TUJB 4OCWH 4YPJA 1BXAA 2BM3A 5B38G 1LP9A 3NFPB 5F9JB 3C6LA 3T5WA 3VFVA 4YJZL 5C0CA 5DJZB 3VMNA 3E8UH 3FPXA 4D9RD 1I3GH 4DZBB 4EI5C 1C1EH 3BSZL 4POYA 2FT6A 3CMOH 3WYRA 3MMEB 4KKAC 4YDJB 3I9AA 1GHFL 5D1XA 1K4DB 3STZA 4ZXBB 4RGND 1BWWA 5AVQB 3X3GH 1XF2A 1LNUA 2GPZA 2HVJA 1OGAE 3B37A 5GS0H 1UG9A 3BZEB 2FWOB 4Q6IB 3ZHFA 3M46A 2VR4A 3A3YB 2FX8L 4UIKH 4NRYB 5ANHA 2FSDA 3TA3B 4G2AA 1TR7A 1U3HB 3BUPA 5HDQL 4ZS7H 5EDXA 3RGHA 5DHEA 5TQ0H 4MX7B 4DZ8A 2BWIA 3BJLA 2XQBL 4H26B 5IOKA 3R06A 4XMPH 1MCSA 2A73A 3FCGA 2YQGA 2DQIL 4P9MH 5E6IC 5D1ZB 2G3MA 3IFOA 3IVKA 2I60L 3US9A 5H37H 5F7YC 1A3RH 1QWHA 2QMKA 4PG2C 4ODBD 5L9DL 1HYSD 2ITDA 1ERNA 4LNRB 1QQDB 4GAYB 5IJVA 5E1AB 5A2FA 4ACTA 1K6QL 4PJCF 2IDSA 3QFJD 4B9CA 4JQIH 2EVHA 2OMZB 5K93A 1NAMH 2BSRA 1QBLH 2C3GA 1T1WB 4OM0L 2A4EA 4KJWD 4G9FA 3EYFB 3BPLC 3ZHLA 1VGEH 4IIQA 4X0KA 4EQ3A 1CDYA 5IJKC 2CR3A 5ESAB 4AQ8C 4MJ6A 2EKJA 2IMNA 3WHXB 5DFWH 2BZCA 4QXVA 5CJBA 1Q94A 4PSRA 4H8WC 4OJEH 5DUBB 1I1YA 2PWGA 4AT6A 4G1MA 5KBKA 3BZ5A 2J7LA 2OJZL 4Z7UE 3D4YA 4B9FA 1K2DB 2YSSA 4RGNC 4JZJA 4ZO7A 1TPXB 1EAQA 2O72A 2VERA 5B38B 5JDJA 1HHGA 1O7VA 1XFPA 3QDJD 2YWYA 4U1SA 3T4AC 3RL1A 5JPMB 3RFZA 4X6CB 3UDWC 3PPEA 2DQTH 5LO7A 3WS3B 1QRKA 1KJ3L 2DQFB 3C8HA 4NKOA 1BQHG 1CD8A 2YIHA 3HMXH 5AZUA 3UBXI 1P7KB 2B1HH 1G9NH 3FU7A 5GRVL 2ENJA 2WBWB 1A6ZB 1N18A 4BSVA 3K81A 1PKQA 2UUDK 3CFQA 4ETYA 2WXPA 5DQJB 4XPFH 1HYSC 1E27B 1E5CA 1RZPA 4ILDA 3WMPA 4XVJH 5K33A 3WKML 1A1MA 4R83A 2VT0A 4WF7A 4HIJB 4DP6X 5JA9A 2IH9A 4DKDC 3GXUB 3QAZC 1ZPUA 2C7UA 2ZP0T 1DBBL 4KJWC 4P4KA 3MOBH 1SHWA 4EUPA 1G0DA 4WHDA 4LZKA 5IVXE 2F5BL 1WH0A 4ZUWA 2EDBA 2Y7NA 4TSCL 5B3JE 3HRZA 5T3XD 2P7TA 4JFEA 1H19A 3DWTA 3KJ6L 3WD5H 3PE9A 4XXCA 3U46A 2V17H 2BVOB 3P2DA 3LOWA 4G80B 4MAYB 5E08H 4DEPB 1JHLL 4J1UA 4PBWD 5A7EA 3MNZB 1RFDL 4DVRH 1TTCA 2LLGA 4YXKL 2MKWA 4FE9A 1J9CT 2XFGB 4WW2B 4AJVA 4FCAA 5J1TC 1BFTA 2A6DA 2GJJA 1CXLA 3FO0H 1EJFA 1CMOA 5DJXB 2DQDH 2XHNA 4UQIM 3FU0A 5DYOB 3W9DB 4O00A 1I8IA 1QHOA 5LVEA 2R1YA 4UT9L 3O3BA 2BNRE 2IGFL 2VRAA 1G9ML 2NMSA 3LZNA 1SYVB 4HOZA 1QSFA 1B3IA 2P8MB 3BE1H 1Q0XH 3HE6A 3MV8D 2AK1H 5D7JA 3CSFA 1IVTA 3HZVB 3ARPA 1GGTA 4J2QA 1YAIA 2CWRA 5EU6E 4CDHA 3FCTB 4FQJH 25C8L 1CR9H 3D18B 1ZJBA 2DLHA 2XNAB 4RZKA 5F7HA 4QRPB 3T1FB 1IFGA 1A3ZA 4AIZB 7PCYA 3RGVB 5FDYA 2DM3A 1OSZB 3QNZB 1CS6A 1BIHA 1BQHB 4XXWC 1QUPA 3MLVL 1KCSH 2YD2A 4FC3E 1XVSA 2V3DA 1ILUA 2VIRA 2OJEA 5B7FA 2R0KL 3U4BH 1D5IL 1OALA 2OL3A 2W60A 3SE6A 4NO0D 4WO0A 5TPWL 3IRCA 4QHUA 3LNDA 4UQ2A 4FNRA 1J8HA 3MBWB 3CZFA 2E5EA 4JFVA 3PAYA 1PU0A 1ZV5A 3EGDB 3BH8A 1ZT4B 3WDHA 3O2WH 1I8LC 5CKGA 3T77A 5F7EL 4CVUA 4JPVH 1AHWB 3G6DL 1AE6L 4UOZA 2QADB 2ZCKL 3DVNA 1IGCL 3F64A 2P28B 1BBJA 5A2KH 4UT7L 1D2PA 1IM9B 2ADGB 1UWXH 2EECA 1ZE3H 2VDNB 4S1QL 2DWEA 4IRZA 1BAGA 2A6KA 4E41E 4GRMB 3I75B 1C16A 4HIEA 4JRLA 2PCYA 1PZ3A 4GW5B 5I5IA 1ECYA 4L29B 4OZGA 4X7TB 5DC2A 1Y18A 2NX5E 3X13B 5D9SB 4AJWA 2ZX8A 1XGTB 3CDYA 3MDJA 3QWOB 4ZUVB 4GLRH 4EMZA 3RZCB 3RWHB 4K71B 3HN5A 5FDWB 4QXGL 4B9ZA 1MG2C 4RLDA 4RCAA 5AVUB 5H94A 4ZQKA 3GI8L 4RWYH 4NKIH 1FNFA 4I0PA 3DPBB 3CNKA 1MCWW 3EH5B 3BUYA 3HBZA 2WC7A 3MRBB 5BQDA 4M9PA 2GBUA 4N90E 5JHMA 4UB0H 3SPJA 4F8NA 4Q2ZA 5I8KH 3P2BA 2XQYG 1K8IA 1HFUA 2KZWA 2VO5A 5IB4A 3GXFA 3NJLA 4WWKD 3U9UA 4JO5A 4AVHA 1P5VB 1UM6H 3KAAA 4I18A 1MHHA 5L2KB 5L8KB 3Q8CA 3WY3A 2X4OB 3GSVA 3GKWH 1PTZA 4OB5H 3KYMB 1TLMA 4Z8FL 4R96B 4JG0H 4ICXA 4WKZA 3DYMA 4YDKL 1NLDH 3I6KA 4WU7A 1MW1A 3SDXE 1W72L 4RAUA 1P5UC 3CHOA 5DHVH 3MV9A 2PMZA 1D7BA 1KULA 4WDIA 4Q0XH 4OQTH 4PTTB 4YBLC 4X4KA 4AYMC 2ZSVB 2XICA 3IDIA 1ASOA 1YMMB 5I8OL 3NDZE 2D4DA 4WIQA 3HTLX 3D2UD 5FGSA 4G6JL 3QRFM 1LK2B 2NQ3A 3G5XA 3E1F1 1MRDH 2A5UA 4JM0A 4TLSA 1EMTL 5D7LD 2KDGA 1OHZA 3TBVA 4PRHA 4ATTA 4YHML 4LL1A 1QRNA 4X7FC 2B3IA 1KC5L 4NFDA 5I9QB 4AMWA 4GP5B 1XH3A 4Q89A 1IC1A 4V33A 5BXFA 3RU8H 2N7AA 3BQVA 3QXWA 1H3TA 1L6PA 4MA7L 1ADWA 3FQTA 5GRVK 2BIOA 3S3BB 2VZ1A 1EA9C 3WIIL 2H7WA 3IBOA 3IGLA 4WCYL 3JYBA 1MFNA 2A9BA 2ZOWA 1NAKL 2D7TH 1CF8L 1MCBA 3NP3A 3R18A 4GMSH 4JN1H 2OR9H 1KBKA 3DSFL 4DJMA 1E4XL 4AENB 4KKPA 4OH2A 3PQYE 4WWKC 1T89A 3DKHA 5IQ9B 2F7IA 1TZIB 3D1MC 2AVGA 1FHNA 3MXVL 4EDWH 4DCQA 5EOCL 2BIMA 1KIUB 3MLYH 4DFIA 4KZDH 4LSVH 5F0PB 1H6EA 3KLLA 4OLVL 1CU4H 1ZANL 3CFEB 4PVLA 1YNLL 3EBHA 1UD6A 3T2NH 4BSJA 2O1AA 4JVPA 3FO9A 1CT8B 4D0CB 1AG0A 1F1AA 3CN4A 4M6ML 3ZR5A 1TVDA 4DFHA 5K59E 3ZO0A 1X9LA 4OJAA 2K70A 2FK9A 2W0LA 2A9NH 1F0LA 1RPKA 2B3RA 2GBTA 2OMVB 3T4YB 3DARA 1ZA6A 3VYPA 4N6RA 2BW5A 3LKOA 4AQOA 3Q3GB 3QDMA 5HVHB 1DLHA 3LQZB 4P2OB 1AO7D 1U92A 1WYJA 1E4JA 4LCIH 2AEWA 2R1WB 2FRGP 1R5IA 3NRFA 1WZAA 4FLHA 5I1HH 5F89B 4RDBA 5EZJA 4QO1A 1HOEA 3OKYA 3V6OC 2JJSA 4YHNA 3MBXH 1PYWB 4LE8A 1BD2B 3PGFL 1T04B 2BVPA 3PABA 1RUKL 3DGDA 2ZAHA 4GXFA 3RX5A 4A7QA 4LASL 4XMLL 2NY1D 4ERSH 4Q9RL 5CSZB 3ESVF 4ZD3L 5EUKA 5DRNA 4LVHC 1HSBB 3GEFA 1FC2D 2Q8BH 3ZYZA 4KX7A 4Z95L 2YK1L 4PWIA 4I1PA 5C86A 2EP6A 5E5LA 4BK5A 4JFDE 4WWID 4Z7IA 2VLKD 1FJ1B 4ZMVA 2QPEB 2P24B 3F6IA 3L5XH 5KSBF 2QQKL 2K1MA 4KV5E 2EYTA 2BHYA 4G9DA 1JNJA 1YEFL 3K74B 2ZAGA 1QO3A 4HK3N 4ZAKB 4G42A 1HJBC 1AGEA 4JDEA 4N2EA 2NY2D 3SGKA 5H35B 3UGEA 5ITBL 2YRZA 3M1OA 3SY6A 3P4LA 3ZYJA 5AKTA 1OPGH 4PJ9B 4HH8A 4PGEB 3PUCA 2AEIT 3ORJA 4FQIL 1AXIB 2YPLB 1T2QH 1AQ8A 3N1MC 5A6MA 3HW7A 5FV2A 3PJNA 1E2ZA 4HWBH 3QO1B 3F7QA 2X41A 1AMYA 1SLWA 3GWJA 5ADPL 3RWJA 4LCWE 4PJ8B 1B0GA 1NBQA 4Y5XB 4PRPB 3GXDA 3MRCA 3VI4F 4POZD 4N2FA 1DQDH 4QEGA 5DQ9A 4Y4KA 3RB5A 3ZL1A 4AZUA 2D7NA 1QPKA 3DV6A 4QY8A 5FKPB 1CICB 2Z91A 1YG9A 4PGBB 5C2UB 5C0DA 2PXYB 5TQ2H 3S5LA 5E7BA 2G2RB 1MAJA 5J6GA 1F3RB 1U8KB 3EADA 4R4BB 1CGYA 3OHMB 5I6PA 3AWFA 1RERA 4UI2A 5CJQH 2UWEF 4WVRA 5ETUA 4DWHA 1M1XB 5HHNB 2LAGB 4F8OA 1MWAL 3AY4A 1VKXA 1U8QA 4AYFA 4P07A 3F58L 3ARBB 5HY9B 3EGSA 3T0EB 4P59L 3AG4B 4LARL 2IV8A 5L8LB 3HS0C 4OD2B 5CLZA 1FAIH 3H0TB 4ZOAA 1RK7A 1BPLB 2NCMA 4DGUA 5T3ZH 1T5KA 1XH0A 2R2CA 2YJQA 3D69A 3TYFA 3N85L 2D31A 3AVEA 2NY3B 3DO7B 1KEGH 4WI4A 3DX0A 2AV1B 3WJJA 2X4PA 3WTYA 2F68X 4K55A 4HYTB 3ETBF 4G8GB 1LO3H 4U6YB 4X9FA 4ZW7A 1DSWA 4XPBL 2XZCH 1G9HA 3SZKC 3P77A 1NTDA 1YPZF 3LEXB 3H9HB 1I1CA 2F74B 3EW3B 3DX9A 3S48A 4PIBA 4MBRA 3FFCB 4WW1A 3UADA 5DD6B 1A25A 2BVQA 1ZTXH 4Y16B 1S3KL 2X10A 4POZC 1U2YA 3I6SA 4YWGL 5JR1H 3BUBA 1K72A 3CFJA 2LVCA 2WBJA 4OZFG 1WISA 4XVTL 2VZSA 3HPJA 4EVNB 1T83A 1TTGA 1UOKA 2NNCA 5A6IA 1PLCA 3V6ZB 4I85A 4PJBB 1VB9A 3EG9B 4HUKB 1TJIH 5E8NA 1LEIA 4LPUA 2EKSB 3KYNB 2EEAA 5C07A 5BRPA 3A6OA 1E9PA 1AD0B 1AXTL 2CDGA 4LCCB 5C09B 3VG0H 4DKEL 1WP6A 4NQCD 5F1NA 1WFIA 2R23B 2D4FA 1J1OH 3AXHA 4NPJA 1C5BL 2RQ8A 4X6FA 4R7XA 4NCC1 1NSNH 4QLWA 1RZGA 3BIKB 4NFCA 1DVFB 4Q9QH 3QR2A 4ENED 1HSAA 3MXWH 3PXLA 1YJDC 4HIXH 4KNUA 4HJSA 3HAEG 1OGAB 3ZKQD 2PWEA 4K94H 4P5RA 4HFUL 1Z3GH 1UZ6F 5JMRA 1INEL 2W5PA 1QSEA 5IMMA 5HGHA 1OP5K 3RVXD 4CA4A 1H3GA 1IC5L 1OP3H 3AXLB 4U1GC 3GLEA 5FOJA 1O6SB 1XGRB 1DCEA 3GBML 5J11B 2AFNA 3OR6B 1UWYA 2WLLA 3T6VA 1WC7A 3MJ8B 2DWDA 4FFZH 4PVMA 3F7YB 3GMMB 1FORL 4HC1A 5F3HB 5K9QI 3HG1D 1X5XA 4J3OG 2HWZL 1YNTB 3C6SB 3FRPG 4DH2A 3DYPA 4P3DB 1W91A 3I74A 4DP0X 5I8CB 4BA0A 3DX4A 1IUZA 1XGYH 4TLKA 4NPYA 4YIQA 6FABH 1EVTC 1ED3A 3P02A 4HMDA 2HKFH 5AB9A 1IB5A 2Y7QA 4KDWA 2J12B 2J25A 5D5MA 4OKVA 1S7WA 4MQXD 4QPEA 2VL5A 1CYXA 3RVWD 2H3XC 2XIIA 2DM4A 1A4AA 3AAZA 3WFEL 2DQ6A 3ZT5A 4KK5D 1VSCA 4ZFFB 2OR8A 2YGOA 3KCPB 3U2IA 3IAQA 1A64A 4OZFB 5EU7E 4M93B 3PU7A 4W6YB 5IB5A 1NUFA 2ICEC 4Z5RB 2WBXA 2E9GA 4H8WL 1QOKA 3I02A 5JXEC 4LIQE 4YSTA 1KEMH 3RJOA 3BRGC 2C1OA 4ENEC 5HGBA 2JQAA 4WWNA 5KYNA 1HINL 2E59A 3RHWK 4AL8H 1U95B 4GB9A 1NUDA 1X5JA 3FT1A 1ZT7A 4HUWA 5AVZB 1PG7H 3M88A 3CVHB 4LSTL 4QF1B 4U1IB 2DL9A 2GIXA 1RCYA 4RNRB 4X9GA 3KJ4B 1UYWL 4GQ9L 5KAQF 3D07A 3RVXC 4RQQB 1TETL 1R3IH 4QHLB 3RPIB 2HG5A 1TVBB 1QBMH 4HZLB 1NGPH 1H9DA 3QUMA 3QZNA 2EYSA 3DIVA 4DEUA 5I71C 1JP5A 3QUYA 4RMWA 5IHBA 2GHZA 3KBHE 5I66A 3AXIA 2NSXA 3JQOB 4JHAH 1PZ5B 4GJTB 1AY1L 3Q5TA 4I9WE 4KX8A 2ESVE 2XN9D 3B3BA 3OM3B 4PAZA 4NUGL 3TJEH 2AJXL 5DGQA 2H6OA 4C55A 3ARGA 1J0YA 1KXTA 4MB1A 9PCYA 2WWKO 2BP0A 2J21A 3EJPA 4DESA 5IR1A 2E6JA 4MQXC 4NZUL 3X1BA 2L0DA 3OZKA 3RVWC 2A38A 3RWIB 4KK5C 4GW1B 1OW0C 1XSOA 3FB5A 3NCJL 1C7SA 4YLCA 4Y1AA 1CLOL 5FB8A 4PW3A 2JKIS 2AK4A 4OD3L 2W07B 3NZSA 5H37A 4EKJA 2YKLH 5C0IA 3D30A 5ID0B 2PYFB 4UAOC 4HUXA 3W0WE 1GOGA 2V7HB 5DJDB 2COVD 4M03A 3BMVA 5JHDD 4JQIA 2BNRB 1T1XB 3SYQA 1NAMA 3OLDA 4V2CB 2GI7A 5KYWA 1I1RA 4H40A 2ZYIA 3S36X 1KLGA 2BERA 3BZ4A 5BRQA 3S35X 4NI6A 1VZIA 2IADA 5E4AA 3UYRL 5EU6B 4AM0B 4KZCA 4ZRGA 1WEJH 3JV4A 4Y7OC 1I9JH 5B1JC 3SCMB 3MKGA 4FQPA 2V4LA 5KSVA 4MNHB 1UXWB 2NW3B 4WO4B 4XT1C 1HZLA 5KOVC 3UTZA 2IVFC 3JV6B 4IKNA 5GZOD 1WZ1H 2DYRB 3K4DA 4W9HC 2HRHA 1YEHL 2NUTA 2I9LA 1CDGA 1A4JA 4GOSA 4X5XA 3QXDB 3ALWA 4JMNA 4ODWA 4OF5A 2GTZB 2RH0A 3CX2A 1SXZA 5IVZB 3UC0H 3VQ1C 4U3SB 1KELL 5T5NG 2IH1A 1RSYA 2DLFL 3AU1A 2F53E 2DJMA 1NL0L 2OXGB 4RFEA 2QKIC 5FHAL 3R4DA 3PWVA 1RLBA 4X4MA 3FN0L 4BINA 3VFWA 4B9JA 4C4UA 2IWEA 2Y1VA 3HMXA 1X5GA 2Z31B 3PL6B 3X14A 4XI5C 3O6KH 4HZ1A 2BY0A 4ODSL 4ZX6A 2WNXA 3GSQA 3ARRA 3EOAA 3H7BB 3WN5A 4FQQA 1J9TA 2MNJB 1BFSA 2WOYA 1UKSA 2DKUA 3VXUA 1YNKH 3ML9A 4JM2A 3IJSA 5GRUL 3PDGA 2NY7L 3F5WA 4AQ1B 4E41B 2CXGA 3LKSA 1A8JH 1DSFL 3EYSH 3V0GA 4DGVL 4B7LA 3TM6A 3QJSB 1T20B 4HUCA 1HQ4A 1CI5A 4G6FD 5AVTB 4FQHA 2H1PL 2NX5B 4OM1L 4XN1A 1F11A 3NP4A 3LKQB 4LAQH 4C57C 3A0OA 2MOGA 2E7LC 3GDBA 1RJLB 3V0WH 3BP6B 3SDAA 3SYPA 1OAYH 1PX3A 4DAGL 1RUQL 2M1KA 3KPLB 1KUMA 2VWEE 5CXPA 5GZOC 2MEJB 1GZPA 2A6IA 1MJ8L 5B1BB 2WXKA 2AJUL 2EUZA 5F6IC 1RZIA 1QHPA 1DO5A 4N4YB 1WCBA 3QIBA 4BCXA 4HUNB 2E9WA 2JK5A 4NQDE 3INOA 5KYXB 1FZKB 2V2WB 1BQLL 1J5DA 2XTLA 1G94A 3HI5L 4MA1C 2R69H 2B2XL 5DVKA 2JMRA 4YHZL 4Y5YB 4TNVK 2VMDA 5HHPB 5IW6B 5K9OB 1QASA 1RK0B 1TU2A 3GUTA 4WTXA 3F01A 2V7NB 12E8L 4Q4IA 3OHXA 1L9NA 4P2QA 2VLRD 4ZI8A 3GRWH 1BYOA 5DJ2A 4PM1A 1A14L 1GJUA 1Z9PA 4JFUA 4FG0A 5HYFA 4GAGH 2YPVH 5T5FH 1WCQA 4RRPG 2WAHA 3QA3A 3SDXB 5EWIL 5KSAA 2HTLD 3ES6A 5TE6L 5FGBA 1JF1A 2YUXA 2ARJQ 4LSQH 5DMIH 1JMZA 1KENH 2R83A 1AH1A 3QHFL 2RJMA 4D7PA 3CC1A 1JF6A 2X4SB 2A9MH 1JZHA 3B83A 3IF1B 1PBYA 5T3XE 1TJHH 2X4NA 4BH7B 5AW4B 4AK1A 5B3NA 3KGUA 1A7PL 3OKMA 3ZDXE 1GC1C 1PJWA 1FCCA 4K8RH 4YBHA 3AM8C 3F00A 2CUMA 4GMTL 5F9OL 1N7MH 4N26A 5DS8A 3TBYB 2FLRT 5J0BA 3Q6FA 3D39E 3PPSA 4LF3B 1LGVA 1IILE 2LU7A 3EKCA 4MJ5A 3MFGB 1CGXA 1FFPA 3NSXA 3KS0J 2E7DA 2ATKA 2YUVA 3O8XD 4HJUA 4UV4H 3ZL4H 4WEBL 3TH2T 1KCUH 3TBSB 1YN7B 1NFDE 3BGMA 4KRPD 1GXEA 4YLQT 1ETZA 2DI7A 3D05A 4A2MA 5K9JL 4WUUB 3LKPA 2EYRA 2HUHA 1LM8V 2P5WD 3LPOA 1NWPA 2QVMA 2X42A 4PMFA 3WEAA 3PQYB 4IS6B 3MRFB 4LK4A 1L5GA 4DTGH 1I9EA 4B41A 1F4WL 2FHBA 4PS7A 3HZYB 5E5MA 3WTWA 5K9KA 4NQXA 3GSUA 5GQBA 2X9ZA 1D5BB 3QQDB 1URLA 3L7EA 3MN8A 1YEIH 3V0EA 4MYWB 1ZVSA 2CBOA 5T1JA 3MLRH 3JTTB 4HSQA 3CG8A 4GFXA 1U8LB 2P43B 2YBGA 4B9IA 1IZJA 3FH5A 4NSKA 3IJHA 5C7XH 3TNNA 2H32H 3C09B 2J88H 2MCPL 2WO3B 4V1DA 3L3KB 1SJVA 3TONA 1DQLH 2JKRM 1S7TB 1BX2B 3TIEB 3VSUA 3EZ8A 1OE1A 4HIQA 5IHZB 3I9GL 2CM5A 5BMFL 4HQQH 5DWPA 3E2HB 2JELH 4A7VA 3BC9A 1OCCB 1G7MA 4I3RL 3VFSB 3GMQB 3G9AB 2ADYA 1N0XL 3O41A 2XBTA 4IGBB 4JE4B 2MQ3A 4K7PL 4YDZA 3VXME 1OCOB 5G4MA 1XSJA 2DTMH 4KKQA 2WXQA 3MHZA 3VG9B 4DGIH 1OF2A 2GK2A 4GRLC 2F7OA 4C8XA 3O8XC 3PGCA 4CVZA 4XODA 1DEEA 5GGQL 3HBPA 5I17B 4WUKH 3H9SA 1KPUB 5DHVA 2ZSWA 3ULSB 4BEIA 4TL4A 5BS0D 3UZEA 1D2OA 4OQTA 4KRPC 3BKJH 3CFKA 4RMTA 4Z7VA 1CD1A 4JFDB 1XF3A 1YECL 4XO4A 1FYTD 5LUMA 2DYPD 3ZN6A 1AXSA 1WDAA 4QWWD 1NIDA 2BLFA 5D7SL 3JWDL 4FCHA 4YSPA 3V0JA 1G7LA 1CDCA 2VJ8A 2DAVA 2CGYA 3LCYA 4DQOL 1CGSL 1PS3A 4XC3H 1Y6KR 4LQFL 3UJJL 3O3EB 3UOAB 3EO1B 3THMH 5IHWA 3V95A 5E00A 3BQUB 3HN3A 3VW3L 4FJ6A 1E3FA 2G0LA 4PP2B 5HHVH 3F8UB 1N5YL 3FPYA 5EO0A 1HE7A 3FFDB 4HF5L 4KQ4L 3ABLB 3K7UA 4PI2A 3WJMB 4XPTL 3W56A 5ANMA 2YAEA 2YRBA 2WXOA 5ITFA 3LV3B 4M5YH 1U4FA 3T08A 4EDXB 4CDGC 4H25A 3F7KA 2VC2L 4QRRE 1QLEL 4WK4B 5I6XC 1ZHLA 4I4WB 3OKLB 4JFZL 4P99A 5DRWA 3D06A 3VD9A 2DEXX 1ZVYA 4IMKC 4HPOH 4X98A 5EA0H 5E8OA 3G6JA 3O11A 3BI9X 2YD1A 4D0DB 3II1A 4X6DA 8CGTA 4M4PA 2BSSA 3PYCA 5EOTA 1O9ZA 5FUOL 4NNXB 4IRJB 4RAVB 4KDVA 4XBGA 3H42L 4R97C 2YA2A 1KPVB 1JWMB 1PDKB 1U8PB 4PVBA 3CD4A 1EEUA 5I73B 5HJDA 1K5NA 2NZ9D 2OMYA 3KVPA 4TS6A 1HHIA 1MPAH 2LABA 4R3SA 3DX1A 5D93B 4OLZL 2H1XA 5GS2H 1IAOB 1PLAA 2HFFA 5JOPE 1WE5A 4LBAA 2P52A 4EPSA 2WVVB 4YHIA 5B7EA 4UUJB 1OE3A 4HWEH 4JFFD 4LLYA 4AZ8B 4HXBL 3V6OE 3N9GL 2PTVA 5AEAA 2YKKA 4NEHB 2ZX5A 3BVUA 3PJSA 1PSKL 1HNFA 1JGUH 1MDAA 3MRHB 3QI9B 1XH1A 3NH7H 3OPZH 4ZFOA 43C9B 3G5ZB 1A2YA 1AR1B 5GGSY 5LGHL 4KUCF 1UJ3B 1KDIA 4UBDD 2EEFA 3ZDYF 2ZZUT 3AQXA 4R7DB 4W4OC 5BUGA 2GSIB 3KH3A 4RMBA 1N10A 1TZGL 2EIKB 2VQ1B 4OCLC 4PD4J 1FN4B 2ZG2A 4Z7NF 4U6VL 2IWGA 2ZWLT 4DHLA 4YXHH 2EIEA 3QPQC 2YD5A 4FEMA 2EDEA 2PF6A 1IBDA 1G5AA 4RGOH 3HR5A 4LHUD 4WRLA 2Z4QB 3WTXA 1DUYB 2XYCA 5EUOE 3WNNA 3Q8BA 3MYJA 4X7SH 3KLAB 1WFNA 2BMKA 3E0GA 1KYAA 4ABWA 2GKIA 1R46A 1BJ1J 2DY2A 3L3IB 5EN3A 4NRXB 4FS0A 3QG6B 3UPCA 2F54E 5I16B 4O58L 5E70A 2ZF8A 2WUCL 1U3YA 2NZ9C 3DJZA 1NBVL 4H7VA 2FB4L 3VD3A 4GUQA 1IAII 1S9XB 4M29A 3CFBA 2C9RA 5K1JA 3VTTA 4OZHA 4WI3A 1QACA 4HWBA 4JO4H 4HOWA 3IDNB 5BVPL 4HBCL 3ILPB 5I1GL 1VIWA 3RTLA 5EZLB 3C5ZD 4Y89A 2K6WA 4WI7A 3HZMB 3O4LA 3SE4A 4S2SA 1H3PH 3ATAA 3EAKA 3KEDA 2OMXB 4EZKA 3RY6C 1Q9LA 3QPXH 3G5WA 3B3IA 5IFJB 5JXED 1FH2A 1M7IB 3MUZ1 4WGVB 4UBDC 3AGVA 1HXMB 3K0WA 1FZOB 3L3HB 2FLBT 2J73A 1XIWC 3ECQA 4NI3A 5DJAB 5I24A 1MWAB 3JWOC 1QFWI 4BHUA 1EXHA 3EYUH 3H6JA 3K6OA 4KY2A 4TL5A 4JVWA 3OMIB 5DEFA 1YEJH 1MHPL 4N8PA 4O5LL 2X89A 3VH8G 3VWKA 4YGVA 5FR3A 4NDMA 3IXTA 3QUZD 2D3LA 1FL6B 4JFYB 4KJPD 4KQ3H 2Q86A 3TO2A 4HK0A 1CYGA 5IBTH 4TSBL 3NDYE 4KH9A 4DP5X 5I30L 1FZJA 2CGRL 1OHQA 2LFGA 5DD3L 1LE5B 2ZOUA 3CDZB 1A5FL 2BSDA 5DD1H 1XR8B 5HD8D 1HEHC 3BAEL 2YAMA 4DP9X 3RIFF 3WSQH 4L18A 4ETQA 3SKOA 3FAXA 3VXOA 1VFBA 2BJML 2EO9A 2GTWB 2UYLB 2Y5QA 4IW4C 1QPXA 4PLJD 3SSGA 2J8OA 2JXMA 1XX9C 4FKHA 3T6ZA 5IV2B 4K23L 3V55A 3HMWL 4PGZA 1DN0B 2NNXA 2B59B 1X4XA 1JXFA 1A7QL 3REWA 1P7QD 1RLWA 2R4RL 3LKRB 1RULH 1XQ4A 1DFBH 1S3RA 2HJFB 3H55A 4R90L 1L9PA 3EOBA 3SKMA 5HYIA 1D7DA 1NOLA 3V0IA 1DE4B 5D2NC 3KBFA 2XG4B 4JG1H 1IBGH 1RZFH 2AQQA 3DXAA 3C5ZC 4NO2A 3ZIMA 4ECNA 1FO0B 2B1OA 2OMTA 3HE7B 3EFOA 3Q01A 1M53A 3ARED 3ZKXC 5EBGA 1FE8H 2X09A 3UG5A 5IB3B 5IMOB 3PFUA 2Q5BA 3I9IA 1U8MB 4KTYA 4JQXC 4MJIA 1LEGA 3BN3B 4WLCA 2CLVB 4XCYA 4PHZA 3VFPA 2F8XC 5DEGB 4GAAA 5IUCA 2ID5A 1BMWA 5D72L 2JKNA 4JMXA 5EZIL 2AXFA 5F1IB 3ARDA 1N59A 1J8RA 1ZMYA 2OMUB 2ZX6A 2DEYX 3GSNL 4KO9A 3P73B 4H2AA 2O93L 3VVWA 2AI0H 1E5BA 3E7JA 3F12B 3CSYA 1HOCB 1QVOA 5SX4I 3C5SA 4EI5B 3QUZC 4FQXD 4N8CH 4HEME 1T2XA 3FCUB 4KJPC 5MENE 1NIBA 5I5RA 5EC1A 5TDOB 3KVDD 4N87A 3VJ6A 5KVFL 5HYQA 3VH8B 2ESVB 4X5RA 4AW4A 4YSAA 4ZMAT 5HD8C 4HS3B 4X6EA 5IEKA 3PDOB 5MI0C 4PB9H 5DZNA 4MMYA 2C26A 2EE0A 1VPOH 1P9MC 4N9GA 1BOGB 3U6RA 3SKJH 2NW2B 2WLIA 1JK8A 1FGVL 5E6IB 3VRLE 5PCYA 3LNIA 1Q1PA 3C6LD 2VISB 4D9LL 5C0CD 4U6XB 4FJZA 3BIAX 1UM4L 3L7FB 3EXLA 4TUUA 5FM5O 3E9TA 4WENB 3RNKB 2Y36H 4YFLI 1NBZA 2WQRA 4FFZA 3D87B 2ITCB 3OB0K 2ZICA 3GSRB 3NT0A 3QG7L 4KDTC 3RP1A 1HI6B 4Z7WE 3FTGA 4Q6YA 3EO9L 1NEPA 1QLFA 1SNRA 3NIFE 3U36A 3L6FB 3QIUA 1HH9A 2C3VB 2HX7A 2VUOA 1BJMA 3BPLB 4NX0A 5C71A 4ZW8A 1SVZA 3GHBH 1EAOA 4GG6B 2W91A 3WEXB 5ICZB 5B22A 2COQA 1G7PA 2LQRA 1N12A 2CQVA 4L3FA 4HWNA 3OR7A 2B9BA 4O02H 2MHAB 1OAZL 5SWSA 1GW0A 1OTTC 3BSGA 4H8HA 4LKXB 2C9UA 4DPRA 2OV0A 1PX4A 3JZ7A 4FQXC 5D2LA 4KUCD 3T09A 1ZIAA 3QNFA 4CN1A 4F27A 3LNGA 3ZHDA 5CGYD 5HHMD 4XMKL 4ZPTA 4G9FD 4OCSL 1AGBA 3GMRB 3KGRA 3ROOB 1ZSDA 1HJCA 3T4AB 2ZCHH 3EO0A 4TLUA 1P2CA 4AYID 1MCIA 1S6NA 1HQRA 2F53B 2EUWA 3B34A 2FEJA 3DRQA 1KOAA 3MRRA 4K9EL 4LGRB 4ZFZB 1DQJA 3MRPB 3U0TB 3UAJA 1WWCA 4YN3A 4K7FB 1ZLWK 2YA0A 3C6LC 5C3IA 1RZJL 4WQOA 3G08A 5L88L 3IWUA 3TBTA 4JB9L 5IW3A 1P7BA 2M8XA 4OR1A 5D1XC 3VXSE 3ELAT 1KXQA 5I18H 1ND0A 1EPFA 4BQ6A 1A02N 1B88A 1I3RB 4UOW0 3QAZB 1C8QA 3CZEA 4KY1L 2NNAB 1HL9A 1QG3A 4E42A 1D5ZA 4MD4A 2PW1A 3T8XB 1A1OB 2DWSA 2WPGA 5LB1A 1R24B 2YC1A 3MRNA 3WIHL 5IEHB 5LQBH 3MRIB 5FW7A 4X4ZA 1KTRL 1BIIB 3VFRB 4BQBA 4PRBB 2VXUL 4R2GC 3L5WA 4NQVB 4YHPA 1JGEB 5DMKB 5HPMA 1MSPA 2JKWA 4P5KA 2CNYA 3HPLB 3I50L 4APQD 3V5KB 1CE6B 2BNQA 3MO1B 2BDNL 3TBCA 2GI0A 3HFMH 1HHKA 2MOVA 3UTSD 4D8OA 2X4TB 1W0VA 3QIWA 2R59A 4OY9A 2Y7SA 3AWEA 5E2VH 3AJ7A 1MI5D 3OG6B 4MJ2A 1T0NB 4R26H 1OSYA 1P0SE 3MODL 4E5XG 2CJSA 5IG7A 4GSQA 3QDJB 3LSOA 5EORH 2X1OA 3GK8L 3ARFA 4IIQC 2G5UA 1FVEB 5AB1A 1ZLVH 3L9RA 4F8PA 3MPCA 2PWFA 1TMQA 4OUUB 2EO1A 1D6VL 5MEQB 5AENA 1YMHB 4RZCB 4Y2DD 2YXFA 3HZKA 3WKNA 1S7VB 3ARQA 4G3YL 1A6WL 1H6UA 1RHHB 4MZ2A 5DURD 5BOJA 3RKDD 1WWBX 1NBCA 3DX8A 3POCA 3TN0A 2CJUL 4JZJC 5J5EA 1UT9A 2H8PB 2JCCB 4G7YH 3IFNL 2HH0H 4N5ED 1VFAB 1Q4NX 2VDKH 4PR5A 3CDGB 1KB5L 3MUHL 1KLFB 1A6UH 3VRJA 5L2JA 1PD6A 1PX8A 1Y1UA 3D0VA 4QRQA 3FRUA 1A66A 3RFZC 1BGXH 3LS4H 1QSFD 1IM3D 1KGWA 2F5AL 2Y22A 5FECB 1RZKL 5LBSL 1L9RA 4FYSA 1EANA 2F1AA 4A1RA 3N41F 4ZFGH 3ZDXB 2H26B 3V10A 2GUOA 3NPSB 3KWTA 4A2HA 2C3XA 3F7VB 3MRMB 5DMYA 5IESH 1MJUL 2ATPB 2CKBA 2GITA 1RZ7H 1BG1A 1MIEH 3Q9QA 2P4AB 3P11L 4W9DC 3KW8A 1V3JA 1DL7H 2IAMD 1S7UB 3P9LA 3U0PA 3K80A 4FEIA 4G72B 3M1BA 2DDQH 5CJXA 2UWEE 1ZGLB 3LD8B 4UNVA 4P4KC 1GVIA 3D85A 4LEOA 5TK2A 4Z76B 3MGTB 2XFXA 5GHWL 5SWZE 3IMBA 4LEEA 4W9ZA 1Z1WA 3HRZC 5BQ7A 3VI3E 1J8HD 3LN5B 4LT7A 4PJAE 2BSEA 2O26U 1NCDH 3C8KB 1JGDB 1ID5I 3KDMA 1KLUA 2DL2A 4XXCC 4I48A 5IFHL 4FQCH 4NUMA 4DNLA 4HV8B 4J8RA 5D4IA 3DRTA 1OAXH 4X5PA 1EZVX 1LEKB 1NMAL 1RHFA 1T7WA 3RKDC 4NM8L 5JIMA 1IGFH 1R5VB 4PJ5A 1C7TA 4XOBA 4ZOBA 3ZUCA 5KTEL 1VGKB 5CD3A 3L2NA 5CJ5A 4OT1L 4N5EC 4BFGA 4GI8A 1NGYB 3NCCB 1UB5B 3FFOA 3RUGA 3S6CA 3ZDZB 1NPNA 3N42F 4NO0B 3HE6C 3ARSA 2MQ0A 3MLTB 5D7JC 1UWEL 5JLZA 1VZGA 3IJYA 4HKBB 4NBZB 4YHKL 4JN2A 1MFCL 3FW6A 1KPRB 4JRYD 3QQ4A 1GRWA 2QT6A 1PMYA 3G04B 4XHJD 4HT1L 2W92A 1XEDA 4HOMA 1J7VR 2OXHB 3T9WA 3GRWA 1U8NA 3VXMB 3N0PB 4ZZKA 4CGUB 1JRHI 1HZKA 4OGQC 1LO0L 2H5UA 2F9BT 2NQDA 2WW8A 2YXVA 2E9IA 4YBLB 2BFVL 5T5FA 4ALAC 4XMTA 3FH8A 3HG0A 1R0AL 1MREL 3NACL 5LGKA 4K73A 2VB5A 1YQVH 5INDA 1M2OA 2GYSA 1OSPH 3N1PC 6PAZA 4MA3B 3EFDH 1A4KA 2VLME 5TD4A 1J1XL 1KBWA 1SDDB 4JDTL 5CLYA 3RZWA 4BUQA 3BPOC 3V4UH 1GSMA 4JUSA 3P9MA 1NGWB 1I7ZB 4IKLA 2AXGB 2B5IB 1F42A 2QV2A 2W65A 5MERA 3OJDB 4ZW3A 1G7QB 3PWNB 3Q43A 3GI9L 2IFGA 4GXVL 5DR5H 3MV9D 2CBTA 4NGHL 3NGBC 1CLVA 3U9WA 2OPCA 2IOIA 4LPTA 3BT2H 1SUHA 3SOBH 4U1KA 4YO0A 5IUSA 1MFBH 3BKMH 2P3YA 3U1PA 1LO4H 1FVDB 3S8WA 4P5SA 4NQUA 1G5GA 1JPGA 5D1QA 3SDYL 2W9DH 4WWKB 3D0LB 3CFMA 3SBQA 5TF0A 2X12A 4KGLA 4R5XA 3D3VE 3SZ6A 4JGJA 3FT9A 1FDLL 1JL8A 5TGBA 4H8VA 4XHJC 3QZOA 2MPVA 4PUBL 3MA9H 4LLWA 4KMTH 4FTVA 4WI5A 1ZVNA 1YEKH 1B0IA 3LQAH 4XPGH 3V5HA 3OXSB 4I0PC 2XVKA 1VADA 1Z32X 3KL0A 1ID2A 1M56B 1C5DA 2WIIB 2Q87A 4P5MA 1I75A 3HA0A 4QJ5B 1NICA 4YR6B 3D2UB 3OPUA 3ABMB 4PTUB 4QRUA 4M02A 5I0DA 2F15A 2H32A 5E1HB 3GMPA 4XP4L 3ULVF 4H5SA 4M43H 4TQEH 4DP8X 4UNTA 4XCCH 1CWVA 5JIPA 3INUL 3V0FA 5T1LD 1J9QA 4NQEE 5D7LB 4WHTB 5I0WA 5FHBH 5HJGA 3FQ1A 4R6UA 4L0YA 1X7QB 4GIOA 1OD9A 4J8QA 4MCNA 5BZWA 1ORSB 2FBRA 1LDPH 3CU1A 5C0GA 3PREA 1DANU 2F58H 4LVHB 4XN2A 2IH3B 4DN4L 3QEHA 4OBSA 4P3CL 4EI6B 3MRKA 4RDQF 4XMZA 2VM4A 2X4RA 3QDMD 4XN4A 1ONQB 2IBZX 4KVNL 4PHXA 2PO6D 5SWQA 2VSCA 3QZWA 3UTPD 1X6NA 2R7EA 2YAQA 5FYKL 2Q3AA 3C08L 4D94A 1FL3B 4XO9A 3SGEI 4CJ1A 3MLWL 3REVB 2ZUYA 1O9WA 4NQTA 5KSUB 4OJDH 4P5TD 4HSCX 5DQDH 3HI6L 2ZNXA 5IHHA 1IAMA 2LU4A 1MLCA 2FJSA 1S9VA 2YBRB 4Z9KB 4ABUA 8FABB 1KT2B 4LDLB 2Q76A 1MVUB 3M8OH 4FNUA 1KBGH 4UNIA 4YDLC 2FQDA 4O2EB 2GT9B 4M9OA 2KLRA 1URIA 3QRBA 5CZXD 1JPFA 5AOMA 4NHCH 1IL1B 4JZOB 4JRFA 2F54B 4A04A 4K3DL 1G6RB 3QNYA 4MNQA 4X80L 2CDFB 4NQSA 3V4PL 3P4MA 3IU4H 3MQIA 5JOFA 2RFXA 1AO7B 1NH6A 1AKPA 4F58H 1T89C 1PAZA 3M45A 4TUKL 1FL5A 3BUQA 4A68A 3BVTA 2XWTB 1P6WA 3C2AL 4S1RL 1ES0B 5GGSA 5JQIB 4G6KL 1G1YA 2Y5TA 1TZHA 1AHKA 4KI5E 3I2CH 4QXUH 3CSPA 1NGQH 3W39A 4F15B 3WNOA 4EZJA 2DKSA 3K8KA 1D5MA 4PRAB 1PQZB 4TUOB 5DFVC 1TVHA 4DKFH 1S9KC 2AKRB 4FQ2H 5AD0B 3E1ZA 3L3GA 2R0LL 5IT2H 1EV2E 1RK1B 4JHWL 4XNQA 2QL1A 1S7QB 4PJEF 4PJFF 4CAGA 1AKJA 2HB0A 1N5AB 1JGVH 3S3SA 4JREC 1AZCA 3KM1A 5L7XL 3UH8A 1SEQL 4KO7A 4YX2H 3V5DA 2VDQB 4AXWB 4A55A 5DJCA 1IX2A 2JJSC 4YE4H 1J0JA 3HS0B 1N0LA 4NZTL 4Y4KD 1HHJB 1SXCA 2CLZA 4M3JA 4C4KT 4UYPA 3GMNB 3QC6X 4OF7A 1BP3B 1E28A 2CIIB 2VDMH 3L3JB 1LXMA 3UTTE 1IAIL 2DQCL 2WQAA 1SJMA 1A9BA 1S78D 2WNKA 2BIPA 1ET8A 2FT7A 2NR6A 4AJ0A 3C60A 3BFQG 2C1PB 4D9QD 2XOTA 1NDTA 4ZG1A 3WU1A 4KVCL 5FYKE 3MNDA 3LZFH 3IEAA 3S3PA 1JV2A 3VWJA 3FTWA 1EAJA 3C5JA 4BK5C 2AEQH 1HXYB 3GIZL 2PABA 1F1GA 4TKWA 4IOFD 5AFAA 4JE0A 2LW3A 3QSKB 4M7ZC 1E42A 5JW4Q 2Z0UA 5HTSA 4AEHL 4Z18A 3RWGB 4NO3A 1JHKH 2XCMC 3PV6A 3QCUL 4F37F 4TVPH 1QFWL 2ALWA 3SGKC 4LQ1A 1SZNA 1DJGA 3MZTA 2UZYB 1CQKA 2XZQH 3CTTA 4QYOB 2X2UA 2JKTM 1U9KA 1THAA 3OMZA 5DK2B 3Q8FA 2ZT9C 4F7PA 4PV9A 1XDTT 4L23A 4WWOA 3GB7A 4GP4B 2VDPH 3BYTA 4H2CA 5IP4A 1KJMB 4MKTA 4Y5VA 1RJZA 2WXGA 2Q3XA 1BHGA 3MREB 8PAZA 5DDHB 4BZ1L 5GPRA 3TZVD 1JYXA 1RURL 4ZFQA 1MCKA 1WUZA 1INQB 3DBXA 3HAEH 2JTDA 2ZUQC 2EDRA 3AT9A 4JR9L 2CO4A 4LCYB 2A3TA 4F7TB 2Q10A 2N0MA 3BSZH 4ISVA 5MENB 4F1SA 5E8PA 1J0ZA 1GHFH 4PBVC 4Y4KC 3HOGA 5HJ3B 1CBVL 1ZWIA 2MCAA 1SJEA 3DI2B 2WLNA 2WBJD 5I28A 2YAHA 3U82B 3OGOE 4K9JA 4R4FL 2FX8H 5HHOA 1AIFA 1S78C 3QEQA 3MMEA 2ZKWA 3B8YA 1K4DA 2DEWX 3TASA 4GBXA 1FH5L 3KPQA 3WNJA 3IRPX 5FYLL 5C07D 2OR7A 1G0YR 1JMXA 2M26A 4NS0A 2XQBH 1IARB 4JM2F 4U1GB 4WHYH 3N6YA 3AY4C 1GW6A 4NCC2 2DQIH 3Q8AA 5F6HJ 5DS1A 4IOFC 1MHCB 2XC8A 2I60H 3A23A 1EGJA 4LLDA 1VFUA 5L9DH 1RAMA 1U58A 2FSEA 3KG5A 1A6VL 1MUJB 3K2MC 2UXFA 2ICWB 4ZYKB 4HEPA 3RI5F 1SN0A 1K6QH 3T3MF 5HYSG 3QC5X 3P3UA 4OM0H 3PWUB 3TBBA 4Z7WB 1QSED 3QCVL 1QLRA 4L3EA 4N2IA 5AZEL 1ZPLA 3WJJC 2VW6A 5CWSB 2PYEE 2VUKA 5GISL 3ULVD 4H4NA 4NNYB 1ZAGA 1EBAA 2VAAA 2XWEA 3APMA 3BD4A 1Q72L 4BCZA 2CIKB 5JQ6L 1JNLL 4JO2L 1DVZA 4B5ZA 2EABA 2P5EE 3EYFA 5E8EB 2ICEB 3VXNB 3W38A 4K3GA 5BNXD 1OM3L 3CVIL 4UINL 1W2KT 2OJZH 1BQRA 3QEUA 1JUFB 4I9XA 1EH9A 4NZJA 5DGRA 3CSBA 2EH8L 3Q2LA 2C8NA 5GS1A 2WBJC 2F19L 4X7DC 1T83C 1GMIA 4DKAA 3KMDA 4M61A 1NC4A 5ID1B 4AK2A 1MAKA 1BZDA 5KYYB 3GSNB 2V3FA 1HAWA 4NN7C 1ZGLM 5D1ZI 4Y2OA 2QBWA 3RWDA 4LVNC 1KJ3H 3VM5A 4QTHB 4A2FA 1Z6JT 2VN7A 5K39B 3PY9A 5C08E 4JPSA 4F33A 4BDVB 1AANA 2DM2A 3WS6A 1MCDA 5I71B 5DUML 3WS3A 4M7JL 1U6AL 4H0LC 3A6BL 4RGMC 2DWTA 3VDBA 5KBPA 1SFHA 3QDGE 1PKOA 1T5XB 4JKKA 1LVEA 4WWPA 3WKMH 1F97A 3EJRA 4WFED 1A6ZA 4EQ2A 2ZNWA 1FNHA 1TG8A 3NIGE 1IVLA 5ECGA 3WXWH 1WZLA 1DBBH 2X2YA 1VFOA 1MH5B 3QFJA 2DLEA 4N0FB 2XBZA 2Q3ZA 2YSTA 3A4AA 5T1MB 4OVVA 4JPKL 1NKRA 4AKQA 4N2HA 2F5BH 3VB9A 4XVOA 4HIJA 4TSCH 4PG9B 5E1GA 1QEWB 4JGMA 2JJWA 2OULB 3KJ6H 5HYSB 4WJ5B 3HC0B 3MNWB 2GJZA 3UJIL 1QA9A 5CP7A 3QUYD 3VFUB 1JHLH 1NEZB 2MCMA 2AC0A 4PJIA 2KZ1B 2YN5A 1RFDH 4YXKH 2WWOA 4UAOB 4H1LH 2Y2TA 1VACA 5C0AA 5MEOB 4LLMB 2WINB 4J3VA 3WE1A 4UM8B 1M05B 2NLJA 1E9QB 2CU9A 4QNPE 2V0AA 5GS0D 1UM5L 1ORQB 3DURA 4Y9BA 3ARGD 3IU3A 4WI0B 2IGFH 4GXUN 3FCBA 2ADJB 2P8PB 2XWJA 3CCHA 2PETA 2V8MA 2BX5A 3FJTA 4FLOA 4K4KA 1G9MH 4N3TA 4Y19E 3RLSA 4LRNL 1WV7T 1PZDA 3BPCA 5C0RL 3QWRD 4LP8A 4WU5A 3VX1A 4JX0A 4O51B 25C8H 2H9GA 2L7JA 4Y1AD 2LE9A 3FC8A 2NT0A 4O02A 2AK4D 2IXQB 3ZE1F 1XTMA 4CADA 3Q5OA 5EBWB 5C0JA 3KGSA 1L7TL 4OGYL 1S7RB 4Z23A 4FLRA 4FNTA 2FECI 3MLVH 4WNQB 4EIUA 1MCWM 1XL4A 1D9KD 5JPNA 1M9WA 1EERB 2Y4SA 2R0KH 4M8VA 1SEBA 4PI0A 1RD6A 3K71B 1GGUA 1D5IH 4I7ZC 4NYLA 5IVNA 4WI8A 1UACL 3D50A 5TPWH 1RP9A 4YHOL 3VGEA 3VI4B 2A83A 1BZEA 1U8CB 3T65A 2IPKB 3TTYA 1LP9E 4Z7VF 3W5NA 2NPLX 3QO0B 3QP3A 3QUYC 1G7JA 4HHWA 4KTEL 4DOHB 5F7EH 5D1XE 5C8JB 3G6DH 1AE6H 1R3HA 3FONA 2F61A 2ZCKH 2WCSA 1IGCH 1T6WA 1KXVA 5GGVL 1IT9L 4UT7H 5F9WC 5GXBB 2FYYA 3GJFK 3S96A 4GO9A 5JMOC 2UWEB 2F7QA 5JHDB 4L9DA 5GS0C 1E9OA 3ARGC 4JY6A 2AJSL 3A67L 3QCTL 1GYUA 4GAFB 5E9DE 3U2SA 4C47A 2R2EA 4ZNEA 2G4EA 3UBHA 1DDHB 4UZGA 3VI3B 4PJAB 5EZPA 4J3XA 3DVGB 2V9UA 1HL5A 3VO0A 4PY8J 2C4FU 3MC0A 3I75A 1JGLL 4HIHB 4MYPA 3WNMA 1F00I 3MV8A 3O3AB 3MV7A 4I5BB 5HHQB 1QAWA 2ZWZA 1V7NL 2H1LM 3VRIA 3ZDYE 4QRTB 4QXGH 4Z77B 1FFQA 5F6IB 1MFMA 3OAUL 4HD9A 2PP9A 3VXUD 1MWOA 3ZMEA