3NJIA

S114a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
b'QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLAPDPQIINRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njiA00
3OD3A 1JVOA 2FT6A 1JZGA 3WNIA 1WA2X 3WKQA 4DP0X 1J9SA 2XV3A 4G72B 4QLWA 6PCYA 1OCZB 4F7KA 2BZCA 1JERA 4P5RA 1IC0A 1ZDQA 3T9WA 4DP4X 3IE9A 5I26A 4AZUA 3FQYA 2HRHA 2VW6A 1QNIA 4E9YA 2YARA 1MZYA 5B3SB 2H5UA 3QPKA 3T71A 1WA1X 1WS8A 2XVBA 4BK5C 2I7SA 4DPCX 1DYZA 1PCSA 2CAKA 2FQGA 2QT6A 1ET5A 1MG2C 2EINB 3ASOB 2UXTA 3NSFA 2BP0A 5B1KA 5I6LA 1WS7A 3AY2A 2YAFA 4AKQA 1SF3A 3PCYA 1A4AA 2YAMA 2JXMA 4N4YB 3SBRA 3IN2A 1IBYA 3ZX1A 1V55B 1FFTB 1NINA 2IWFA 4DP2X 3PAVA 4E9WA 1KDIA 1J5CA 3FU7B 2BZ7A 3OMIB 2XV0A 4YL4A 4CSZA 1JZHA 1PNCA 1BQ5A 2PP8A 2BO0A 2EIMB 1KYAA 1OCCB 3T6WA 1YLBB 3WI9A 3EH5B 2IWKA 1BXAA 3DIVA 2X88A 3CDZB 4A2GA 4JHVA 3ZBMA 3H4FA 1SDDB 2B08A 2DV6A 3FQ1A 1ASQA 4GP5B 1KBWA 1V10A 2HRGA 2VW7A 1BXVA 2DYRB 1IKOP 2XV2A 2YAEA 3NJFA 2FNWA 2UX7A 5AFAA 1GS7A 2IDQA 4KNTA 4UAHA 4BXVA 1AOZA 1W8EA 4YSDA 1PLBA 2P80A 3GXUB 3SBQA 1ZIBA 1PF3A 2AVFA 3NP4A 1E30A 3FYIB 3CG8A 1JZIA 2I7OA 1ADWA 4W9ZA 2OV0A 3AG2B 2QPEB 3FU9A 4WTQA 1PLAA 4E9TA 2UXVA 3NJIA 2PPCA 1SHWA 1L9RA 2VSKB 1M9WA 3CVCA 1AG0A 1MDAA 5I5IA 2P80D 3TBCA 1AZRA 1SHXA 4HHGA 4DPAX 1PAZA 2PPEA 7PCYA 1I53A 2DYSB 3ABGA 2IDSA 3NT0A 3ABLB 2FT8A 1GR7A 4UANA 3EH4B 4YSUA 3X2QB 1EHKB 2IDFA 5TK2A 4KOCA 1FWXA 3FPXA 1E5YA 2GI0A 2N0MA 1X9UA 1GYCA 2H47C 2X87A 3ZDWA 2W8CA 8PAZA 4X4KA 2GHZA 1W6LA 5EHFA 5PAZA 1GY1A 2HX8A 1ILUA 2CALA 3UAEA 1KV7A 3FT0A 4DP7X 3QJQB 2R7EA 3KW8A 4G70B 1XB3A 1ETJA 1SFDA 2IWEA 3NJLA 2PPDA 3NJKA 1KGYE 4KO6A 2W88A 9PCYA 1XB6A 1EZLA 2XUWA 1TKWA 4PCYA 2HLEB 3ZIYA 1OV8A 2DWSA 2UXGA 2Y69B 3FS9A 2ZONA 5AKRA 4BWUA 4GXFA 4E9XA 2FTAA 2VM4A 3IBOA 1KBVA 4YSSA 3OQRA 3CZUB 1X9RA 1KCWA 4GYBA 4QKTA 1BQKA 1RCYA 3NJJA 1E5ZA 2J5WA 3CDZA 3JT2A 4N8UA 1ASPA 3T6XA 2AZAA 2YAOA 4AKOA 4A66A 1SDDA 2Q9OA 1OCRB 3FSZA 3FSVA 3NYKA 2XLLA 1SFHA 4GY4A 2RACA 4ENZA 3X1BA 2VSMB 2PPFA 3HEIB 1TEFA 3WKPA 1GS8A 4HALA 3H56A 4YSAA 3V9CA 7PAZA 1AQ8A 2BW4A 2BW5A 5ANHA 2UX6A 1NIEA 4HHWA 3BVDB 2TSAA 3AG1B 3GDCA 4NAJA 3X1NA 1AZCA 2BP8A 3SBPA 1BAWA 1KDJA 1GS6X 3NJMA 3NSYA 4KO7A 1RZQA 3FQ2A 1ZDSA 5B1JA 5B1BB 1ET8A 1NIFA 4ZK8A 5I6NA 2AFNA 3QJUB 2IH8A 3NJGA 3ABKB 1NDTA 1NPJA 3N55A 3QJRB 1OE3A 4YSPA 3H4HA 1NIBA 3PPSA 2PP9A 4MFHA 3PXLA 2IDUA 3BQVA 3OMAB 3UAAA 3S8FB 3D12B 3S3BB 2GC7C 3GYRA 1A4CA 2QDWA 3DTUB 4A2EA 3T6VA 4BXSV 4DP1X 1NWPA 2YXVA 1JZFA 1QLEB 4E9QA 4BDVA 1A65A 2GIMA 4GP8B 3JTBA 1M57B 4GP4B 3FSAA 4G7SB 1GY2A 1GSKA 3FSWA 4FA7B 1F56A 1N68A 4YSCA 1XMEB 1XB8A 1BYOA 4NERA 4AI7A 5LDUA 1PY0A 4A67A 2VMJA 1DZ0A 3NJHA 3U25A 4JKNA 4DP5X 3PAZA 1OOWA 1JOIA 1PZBA 4A68A 1V54B 4G7QB 5F7BA 3FYEB 4DP9X 2XXFA 2OJ1A 3WNJA 3FPYA 3ERXA 2XU9A 2XWZA 1SNRA 2CJ3A 2HZHA 1BYPA 2JFCA 3UABA 3T6ZA 2J56A 4BWWA 4F2FA 2H3XC 2QDVA 1WA0X 4UF7C 2FJSA 3CVDA 2A3TA 4WKXA 3SQRA 4HZ1A 2DY2A 4HCFA 4KO5A 1AZNA 1R1CA 3OM3B 1OE2A 4AKPA 4DPBX 1PZCA 3ABMB 2IDTA 3EH3B 1J9QA 3C75A 1J5DA 3IN0A 4YVUA 5E9NA 5I6MA 4TXVB 1RZPA 1NIAA 1IUZA 1A8ZA 1KCBA 4AX3A 3FU7A 1AR1B 1L9OA 2BHFA 3S3DB 1HAUA 5I5JA 2OCCB 1L9QA 2ZXWB 1NZRA 4YSEA 4KNUA 2GSMB 1W6WA 5D4IA 2FQEA 2HXAA 1ZIAA 5FC9A 2BWIA 2TSBA 4KO9A 1FA4A 2FQFA 2WO3B 4A2DA 3TA4D 1NWOA 1BEXA 2E86A 1NICA 1J9TA 1A3ZA 2YXWA 5A7EA 2QPDB 3DKHA 4W1TA 3AG4B 3HB3B 2IAAC 1ET7A 3TBBA 3EHBB 1ASOA 4F2EA 3CVBA 1PLCA 3NP3A 2Y1AA 1NTDA 4P5SA 4M4RB 4RH4A 2AZUA 1AS6A 3UGEA 2GC4C 3N2JA 4YSTA 2J55A 4YSRA 3EF4A 5I6PA 1IBZA 1ID2A 2PPAA 3G5WA 2AANA 2LLNA 3MBWB 4L0PB 4Q89A 1ILSA 1CC3A 1ZPUA 5B7EA 1OCOB 1MZZA 3AG3B 5TK4A 2GBAA 2R7EB 3PAUA 2VW4A 3KW7A 4E9RA 3UADA 2YAHA 1URIA 1NIDA 4YVNA 1MG3C 5D4HA 1PZAA 2DWTA 1JXFA 1ZV2A 2JKWA 2Q5BA 2FQDA 2YAQA 2MRYA 3MX0B 3FU8A 1J9RA 1JXGA 1PMYA 2MTAA 2PCYA 1HFUA 1M56B 2J57A 1UATA 1AANA 3IEAA 1HAWA 1CYXA 2NRDA 5F7AA 4DP6X 4HAKA 1JZJA 2BP0B 1TU2A 2XX1A 2VM3A 2ZWNA 3AW5A 2XYBA 4A2HA 4KNSA 2WSDA 4CSPA 4JHUA 1CUOA 2CCWA 5I6KA 5PCYA 5I6OA 1OE1A 3S8GB 1AZUA 1E65A 1L9SA 4Q8BA 4K9JA 3NSDA 4KOBA 2UXFA 3X1FA 3QJSB 3S3CB 1JZEA 1SF5A 5D4JA 5AZUA 1AZBA 4HIPA 2PCFA 2VN3A 2ZOOA 2GB2A 2HX7A 1QHQA 4EF3A 4G71B 1JXDA 4PAZA 5B7FA 1A4BA 3ASNB 1CURA 4E9SA 2B3IA 1AIZA 3L45A 1AAJA 2BP8B 2EIJB 4G7RB 4YSQA 2IH9A 4HCGA 1GW0A 4NB7A 5I5MA 1VLXA 1JVLA 4M3HA 5I28A 1L9TA 3AZUA 2WO2B 6PAZA 4DP8X 3X1GA 1NPNA 3QJVB 1N70A 1OF0A 2EIKB 5B1AB 1WAEA 2YAPA 2I85A 1RKRA 3NJNA 4BWTA 5IY5B 1SJMA 1CYWA 5B1JC 2YQBA 3NSCA 3TU6A 2EILB 1B3IA 3PLYA 3V9EA 5B7MA 2PLTA 4E9VA 1AG6A 2BWDA 3TASA 2FT7A 1AACA 2CUAA 1L9PA 3X1EA 2PP7A 1T5KA 3QJTB 3OMNB 3WG7B 4HCIA 4YSOA 4BDVB 3RYMA 4A2FA 3QQXA 3UACA 4FAAB 2FWLB 2HX9A 2XXGA 1PNDA 1AS7A 2CBPA 1AS8A 1BQRA 3WIAA 2XX0A 1E67A 1TEGA 1BXUA
chains in the Genus database with same CATH superfamily
1OGAB 1JZGA 2W5PA 1A2YA 4K3EH 4M6NH 1U8IA 1UXWA 3Q5TA 2K70A 2Q7YA 3HG5A 4M1DH 1IGYB 1RJCA 4QOKD 2PR9A 3RVWD 5BXFB 1RZFL 4ZZKA 2UWEF 3K0WA 3VDCA 1CG9B 5DVKA 2HTKD 4TUOB 4QTHB 4ZAKA 4KJWC 1ZLSL 5LN4A 1AOHA 2VQ1A 1MIEH 2CA4A 4XBGA 5T5NG 2CDGB 4PJCB 3VH8A 1INQA 4M6OH 3TC9A 3V6BR 1AD9A 1ET5A 2FJHB 2K7QA 1A1OB 4FQQA 5E03A 1ADQA 4LT7A 3CFCL 4CADA 5B3JF 3K8KA 1WS7A 2ENJA 4HEMA 3OG6B 3G5YB 3TFKC 1RK7A 3MV9E 5J5EA 1KPVA 1A4AA 3IN2A 4ETQB 2G75A 1QSFA 4XX1E 2ADFL 3GXFA 3HCVB 4Z7VB 1I9RL 2HKAA 3MLRH 4DF9A 4TNEA 5MI0B 3GLDA 5D2NC 3EH2A 3OKYA 3B3IA 3LIZA 3HNTH 3HC4L 3NA9H 5CEZD 2VIRB 2AABL 2BVQA 2H6PA 5FYJD 2UZIL 2X4OA 1FFPB 2FBOJ 4CJ0A 3LAFA 4TKWA 1FFNB 1J7VR 4W9JC 4N2DA 3PREA 5HHNA 5DJ6B 4QY8B 2QVMA 3LQAC 5HHQA 2AJVL 3FKUS 2AJUH 1FUNA 3FO2A 2C9AA 1HESA 4HV8A 3GSWB 3M8OH 3FHEA 3D4GA 3EOBA 3TA3D 3PHOB 2A6DA 2DYRB 3DUHA 3RI5F 2GAZA 4EKJA 2R8SL 4NFBA 1NDGA 1KB9J 4QHNB 43C9A 3QULA 4LHUD 4XXDB 2P80A 1NMCC 3SBQA 1RUML 1D6EA 3HNSH 3UJIH 3U2IA 4HIHB 4XVUD 1H3VA 1FGNL 3WY1A 4M5TA 2ZXDA 3LEXA 3KLHD 5GS0D 1MCLA 3JUZA 1AHWA 2FSDA 1VKXB 3GBEA 5MEQA 4R8WH 2I7OA 5EU6B 5HHOB 4N0FB 4R4BB 2EACA 1Q9OA 2F53D 2EO1A 3FBKA 3V6FB 4ZO9A 3L3GB 4GXVL 1T2QH 2IMMA 1J0JA 1YEEH 2ENSA 5A1AA 1J1OL 1NUGA 5AVXB 2CA3A 1S7SA 5TQ0L 1ZANH 5CFHA 3G6AB 1A7RL 1YEKL 1G7PB 3RGVC 3MGAA 3OKOB 3GO1L 1INEL 4KHXL 5B8CB 5IHHA 3BP5A 1NCCH 2OBGA 2X10A 4N87A 3UO1H 3QIUC 4NXKA 2VR5A 2XY1A 4YXHL 4CU8A 3S4SA 5I1DA 2FAUA 5CHNB 1NEPA 1OB1B 3VGHA 3IGLA 2HFGH 3GRGA 4U1HB 1UHVA 1CT8A 2F8OA 2FJUB 4K9EH 4F9PA 2WWMD 2B20A 1XFPA 2X05A 2GJPA 3AS3A 4OBSA 1E5YA 2H9GB 3F83A 5AYQA 4NWTH 5DZAA 3X11A 3P4NA 4P23B 3DHMA 5I6XC 4N8CH 3IPFA 4X4KA 4NP9A 5EHFA 2X4TB 2A77H 1G94A 1ZHBA 2WYTA 2O72A 4TTDC 1K4DB 2VDRL 4L1HA 3ZKSD 4HH9A 2XRAL 2AGJH 2P49B 3ZYJA 3FO1B 2X6CA 4JDZA 4LFHD 4O2EA 1C08B 1N8OE 1UACL 3KL5A 4PMFA 5DUBA 1UT1A 2V2XA 1RZ8A 3V10A 5JHDA 4PGEB 3NBNA 4NQEE 1Z3GL 2WTRB 4PW4A 5F97E 1EZLA 2OYLA 2PN5A 5D55A 3UJJL 4PB0L 4PY7B 3VRJA 3WLBB 4K7PH 3NIGE 4FD0A 4O9HL 1G1OA 2PTUA 3DUUA 4KMTL 4NKOA 3L1OL 1KCWA 4LESA 5TH2A 4MB5A 1RCYA 1CXKA 1XEDA 4ZYKB 1AQKH 2RGSA 4DW2H 2R83A 4G2AA 3Q1EA 2J5WA 3CDZA 1MFCH 4AQ1B 4EKXA 3RDJA 2OYMA 4YHMH 2C9PA 4HC1H 4ZW8A 3BSZA 3UPCA 4AKOA 1GXEA 1CE1L 1OCRB 1QBAA 2DQCL 2NXZB 2EQDA 5DLML 4OIIH 3LKNA 4C47A 4B9PA 5JNYB 4HJJL 3UROR 2D9QB 2J20A 3R0NA 1OTTD 4MJIE 2ZYSA 4LEOA 3RNKA 2XFXA 5L9DL 3RIFK 3D07A 1MEXH 2CR0A 4JEGB 4P2QE 4X7EC 1NIEA 5HYIA 2ATAA 3F05A 3BVDB 5AOZA 2AJSL 3AG1B 1XHHA 4HS8H 3O3DB 4XWGL 4Y5XC 3KR3H 1CTOA 1MCHA 1I8UA 3K5SA 1CLZH 1G6RH 4E41A 4EI5B 4PSRA 3L2MA 1RU9H 1NIFA 3ATEA 5GHWL 1BFSA 3VXPA 2OK0H 5LB1A 2ZAGA 2IH8A 1GJIA 1DQJB 4BFKA 1OGTA 3WELA 5DEJA 4TULH 3TIDA 1F18A 3EYOA 4GT0A 3GZKA 5ACZB 2OPCA 5I24A 4ZUTB 3DVGA 3GMPA 3EO0B 5A6MA 1GAFH 3PPEA 3AWEA 1J88A 3JYCA 3ZUCA 4L8BA 3U7AA 3ZE0B 1K85A 2DQFA 1UKQA 2P5EB 4QF1B 4L9LA 3U46A 5K9KB 5IEHB 1UD6A 4LCVA 1GPOL 4BIKA 1AKJD 2JCCF 3QEUB 2KLSA 4ZAKC 1EAQA 3BUPA 4EOWL 4PI0A 1EBAA 2HWZL 5HJDA 3ARPA 2K3TA 4WW1B 4E9QA 1O7SA 1J8HE 2NX5E 1R3JB 4HXBL 4BELD 3D1MC 1M57B 2A4EA 5FYKH 1A4KA 5ENWA 3DVFA 2QLVB 1EXGA 4X4MA 3NPZB 1EZVY 5DEFA 3QFGA 1MJ8L 3NVQA 1F56A 2HLFC 3KH3A 3OKMA 3AWFA 1FH2A 4IU2A 2R23B 4QI3A 1M2VA 2VMJA 3EYFB 3MRBB 3BWUF 2NY2B 3LZFH 1B4JL 1RK0B 4XNQA 3RURA 3L5WA 3KGUA 4MQSB 2XNAB 1KNOB 4Q6KA 1A6AA 3K6IA 5DRXA 5DJDB 5ECJE 1EJOL 4OIFA 3LKOB 5E94B 5I17B 1WPCA 5J0BA 4FNLH 5FECA 2ZXQA 3ZIMA 1JFQL 4B41A 1IFRA 2O5XL 1KN4L 1UXSA 3PYCA 5ABDE 2XG4A 1YY9D 1ZJBA 1AD0B 4XCYA 3IB4A 5F1SA 2F5AL 5I5RA 2X6VA 4LP8A 3QB7C 3UBGA 5I66A 5C0GB 1LO0H 2B9BA 3SKNB 1NEZG 2X70A 2MCAA 5AB9A 2NY1B 3REVB 1FIGH 4PGBB 1KTDA 5IMOB 1JIBA 4ZFOL 4QJ4B 2PETA 1BM3H 3FBQA 3OAUL 4QRAA 1INDL 1KB3A 1JDAA 1E27B 5FDWB 4QCIB 5E5RB 4BFOA 4QXWA 1AXSB 2KLRA 1M4KA 3VU1A 1IM3D 1A6UL 1LDSA 2AV7A 5I1CL 3CZEA 5JHLA 4EN2A 4XNZC 4HA1A 5I5JA 1MWAA 2OCCB 1NZRA 1KXHA 1IC5L 1ZXQA 3FCSA 5HJ3B 2G4GA 1FL5A 1P6WA 1N64L 4XCCL 5EOQH 3L3IB 3QCVH 2UZXA 4Y8AA 5IB4A 2XWCA 1A7PH 1AHWC 3L3JA 4MB1A 4XPTH 2O61B 2JKJA 4Q52A 1N7MH 3F7YA 5TFSH 5HD8C 1AR1C 3HBPA 1DVSA 1B2WH 4Z8FL 1HWGB 4DSYA 2PWHA 2XKSA 3DYPA 2RALA 4JFOA 3HB3B 2Z8RA 1DCLA 3BPLB 4QHUA 3NRPA 4N5ED 4CW1A 5HYSA 3DOSB 4LSSL 2EC9U 3JV5A 3ULUD 4AQZA 2WVVB 4NOBA 4A7TA 3GLAA 4RH4A 2AZUA 3PL6D 1ED3A 5LNEA 4BQ6A 1XEUA 1XZ0B 2XQ0A 3HAEB 1KJ3L 1FYTB 5E2TL 2AANA 5D5MA 5EORH 5A3ID 3F6LA 1SXBA 1U8MB 4URKA 4MNHA 4F9PC 5C0EB 2IOOA 5TK4A 1XF2A 1DVFB 5HYEA 3N9GH 1ITBB 1I9JH 4LIQH 5J6HB 3QNZA 2VW4A 4K7PX 4LAQH 5KYWB 2GSIA 1X9LA 3T4YA 5DI8A 4G6KH 1NBVL 3V6OA 2WUCH 32C2B 5HPMA 2DTML 3BQUA 5H4YA 4Q58C 12E8L 5BUAA 1VEMA 1JXFA 4FHKA 3FF8A 4X4YA 3ZE2E 3QUMH 2WAHA 3K7UA 2CCLA 1PLGH 1V3JA 3QDGE 2J4WH 3RWGA 4FFYA 4AG4L 3D06A 5DRZA 4PRPB 4XZ4A 1M56B 4GS7C 1CYXA 2Y7OA 3B9DA 3FSOA 4I18B 4RMSA 3LVTA 2RD0A 2VXSH 4H0GA 5CLWA 1N4XH 2DAVA 5EIVA 1T0NB 2HT3C 3FN0H 2APXA 1IC1A 5IMLB 2CCWA 3ZQ9A 5CAYB 2OXGB 5B3NA 1OCWH 3ESUF 3S3CB 1JZEA 4DO4A 5IWLA 3EGSA 2Q8BH 2Q3XA 5GQBA 2BXZA 2VN3A 4N1EA 1CGUA 2HKHH 1CLVA 1ZLUH 4UB0H 2HX7A 5ANME 1QZNA 5DD3H 2DM4A 4GXUM 3V0FA 2BSRB 1AKPA 4HSAC 2XWJB 4X7CC 3LXCA 1ACYL 4XHQA 5LAPA 4K7FA 4AL8L 4YSQA 2W0FB 3GKZA 4JJ5A 4YHIB 3WJMB 1QLFB 4MD4B 4ZTPL 5C7XH 2WQ8A 2WMPA 1RPKA 1YEWA 1S6NA 4KTEH 2RFXB 4UTBL 5DLLA 3VM5A 4PJEB 1QEWB 1YUHB 2GG1A 2CGZA 5FA4A 1NPNA 3BH4A 4LARL 3NEOA 4OAWB 5G55A 4PGCA 5TE7H 3WKYA 1H0DA 1F4AA 4HUKB 2PR4L 5CGYD 1DJYA 1KIUA 2BH0A 1DBAL 4MMXA 4U1IB 3HBQA 2EYTA 2EVFA 2I07B 3QW9A 5G4MA 2EILB 3MRPB 1REIA 3TWCH 5C0CA 3V9EA 1UA7A 2BC4A 5AVUB 4D8PA 4AMKL 1KJMB 1W8OA 5M95B 2DYPB 3DI2B 1HEHC 3QK0A 5DFTA 2WTOA 4FXTA 5HY9A 2ICEB 3GK8H 3WG7B 4M5ZH 5IM7B 3HG1B 2NY3B 3V5HA 2P8LA 5EEUA 4M93B 3IJSB 4G1EB 4L9LC 2QHRL 2JELL 4C4KT 3ESNA 4FEMA 1IGJB 4G80A 4R83A 4UYPA 5SWSB 1NCGA 2EXWC 4HQQH 1ZMYA 1OD7A 3EHBD 4OLUH 5IGXH 3RZCB 1MFAL 4S1RH 5ADOH 1JRHL 4RMBA 4B0MM 4DQOH 4H88L 1R3KA 2WLNA 3H9YA 4KI5F 1G9NC 4F7KA 1OAUH 3QJFA 3E3QC 3MRRB 4OZFA 1I75A 1MW3A 3L3DB 4XX1G 2H3KA 3FQYA 4N85A 2ZP0T 4HW6A 3FQ4A 1TJGL 3IU4H 4AK1A 3PWNA 1XF5A 4M4PA 3P2DA 3QORB 4LSPH 3QUYD 4DKTA 3AS1A 2VR7A 2A6IA 3B2PA 4JFHD 4LB8A 5CCKH 3P11L 3NSFA 4LMQI 3BN9C 3BFQG 2RH0A 4AYGA 4XCNB 1IILE 3EDEA 3DROA 2Z91A 5KANI 2GJJA 1BVLB 4CBPA 2EDJA 3U0PA 3HI6L 3QO1A 2ZYHA 2B39A 4PH8A 4YL4A 4OU3A 3HI5H 3KWWB 3VG0L 5IW3A 3TXAA 1AY1H 5GGUB 1YLBB 3NK4A 4FFWC 2Y7MA 3OJMB 3CXDL 3I6GB 1CTMA 3BKMH 4XVJH 2H0EA 2VDPL 4AMWA 1EMTL 2DB8A 3KBFA 4X6DA 4A2GA 3UERA 4FLOA 3CXHJ 2GK2A 4GG8A 3OZ9H 2VLRE 3ZDZB 4GRMA 2R69A 1NFAA 2YXFA 3L48A 3ARXA 2A0LD 1PJWA 2ADIA 4F15C 5IJDC 3EYUL 1NGQH 2FNWA 4LLUA 5D7JD 2FO1A 1LK2A 2ZYIA 2G3ZA 2GT9B 3PUUA 4IDJH 2OKMA 3VG9C 1UD4A 3TIEA 1DN0B 2H0PA 4Q7DA 2K8QA 3QZLA 1MW1A 2BNRB 3FB8A 3VQLA 4IGBB 1ZS8B 4L4TA 1HXYB 1U8QA 4QT5A 1WFOA 1MLCA 3BISA 5EEZA 4BZYA 3L3HA 5DS2A 4FQPA 1U42A 4Z7IA 3VW3L 2X42A 3CCHA 2KUTA 5ADPL 1T0MA 4I9WD 3VVVA 4L3EE 1CD9B 2L8AA 1NBYA 3FTYA 2R0ZL 4WWKA 3CMGA 4PJ5B 2Y22A 1S4IA 4NQXA 3VA2C 1GYAA 4C56E 3MBXL 1CXFA 2I25N 3RWIA 4HPYL 3LHAA 3W11D 3BUYA 3WS3B 3AAZB 2F58L 4X7SH 3NZSA 4KRLB 5B4MD 1F6AA 5KN5B 2ZIDA 3KYKL 1NCWL 3GPEA 1RSFA 2YA1A 3KVDD 3QEQB 3NIDE 3V6OC 4AYMC 4TSCH 1YNTF 3BQUC 4Y9CA 5GRVK 4UIMB 1HOEA 2EO7A 2H1LM 1GR7A 2WANA 4K94L 4QXVA 3RX5A 3X2QB 3C8KB 5KOMC 1P1ZA 3G6DL 4MLSA 3ZKXC 5KYXB 1U8OA 3HPLA 2LU3A 1J5OL 4FLRA 3T2PA 2DM3A 4Z7QF 3D52A 3MNZA 4KI5E 5FAAA 5FUOL 1EHLL 3FRPB 4TNFA 1M6OB 2WTPA 3S5LG 4Z1PA 4F33B 1W6LA 3MRMB 1F1GA 3GMQB 2FCBA 3QAZC 1NEUA 3DVNB 3QQDB 3DGGA 3IFNH 4YHPB 2R4SL 2YPKB 5A2CA 1HNFA 1RJZA 1HJBC 4KO6A 3G08B 1T0PB 1EHNA 5E2WH 3M1BA 3QH3B 3ZHLA 4IBUA 4L4VA 4ZRGA 1S7WB 2Z4TA 5GGSY 4EVNB 1MFMA 3D3VD 2DICA 4K07A 4MS8C 4R26H 1F0LA 2WO4A 5ICZA 5HJBA 1EJFA 1GGIH 3KYAA 4UQDA 1IMHC 3L7EB 5J7CC 3O6FB 3QWRA 4BSJA 3MUGA 3ARRA 3GBDA 2UV3A 4M5YL 2C4XA 4F93B 3VRIA 3CH8A 1FP5A 4JO4L 1WWAX 3L16A 2JIXD 3IJYA 1JCKA 4HSQA 2NSQA 1DQDH 1N3NB 4PV9A 2E27L 5KSBB 1R0AL 5A2AA 3BHBB 3QI9A 4N8VG 3GMOB 5CBAB 3IK2A 2L7EA 1N2RA 3FTSA 4GIPD 4GKZB 1IE5A 5I75B 4QRTA 1OSEA 1HZHH 1PZ5B 1TEFA 3VXRD 5ID1B 5KTEH 3LH2L 4MJJA 4MMXC 2GVYA 4HALA 4F37F 1HHKA 3I9PA 2G2RB 3II3A 2F54E 3DPDA 4RVBA 3TZVA 4GSUA 4CKQA 2ZTBA 2AQRA 3ULVL 2UX6A 3NPSC 3WIIH 2K6WA 4HUMB 1I8AA 3UBXA 1IBBA 3VE0A 5EDXA 3DOIA 2J25A 4HS3B 1HHGA 4RGOL 5AW3B 2ARWA 3AWGA 3QIWB 4IU3A 3UEQA 2HA1A 4NKIL 4NZUH 4FQHB 1RZQA 4KVNL 4NDMB 5IOPB 5DEZA 2JLLA 4OCNC 4GQPH 3B7TA 4JFSA 4YDVA 2R51A 2PW1A 1FL6B 4LOFA 3WTYA 1U3HA 3S34L 3VFMB 4Q9RH 1FAKT 3ZGIA 2J5LB 4X6CB 2ZAHA 2R29L 4U05A 5AYUL 3P4OB 4PJGF 1P5UB 2EAEA 4D8OA 2VR6A 2IDUA 2FX9L 3OMAB 3GMMA 3GMLB 3N1FC 2ESVB 2JB5L 4P2OA 4FA6A 3RUGA 1A4CA 4A2EA 5AG9A 1FNGA 3FQNA 4KK6D 1D9KA 4LRNL 1MWOA 1PX8A 3IJ8A 3CZFA 2BSTB 2CK2A 2JXMB 4PR5B 4HUWA 5CSZA 5IF0B 2CBMA 2EYSB 3FSWA 3MLWL 5FR3A 1F8TH 1XGUA 4Z7QE 3P30L 3CVHH 3BN3B 3JSSA 5A40E 1IKFH 1CFVH 3CJJA 4KFZC 2QTVA 4CDGC 4X50A 4X5RA 1V05A 3QJZA 3EOAB 4JFDB 4RFNC 1LD9B 4WKZA 1B9KA 3AABA 2WYHA 5BZXA 4CAGA 1VACB 4TUOA 2ZPKL 2XN9D 4QTHA 1OT1A 3U2SB 1NLBH 5E00B 5EO9A 4ZPTB 1NLDL 2B4CL 4YLQT 4PJCA 4PRAB 4W9LC 5D7SL 2AEOA 3TNMB 3VJ6B 1FZMB 3ECWA 3NZUA 4RFEA 4KVPA 1QWUA 2COVD 1A1OA 4FQJH 4KJWD 3OF6A 5E6RB 1FNSL 2ZP8A 1YMHA 5L0QB 1X5HA 1BLIA 3G5YA 4OB5L 4LVOB 2V9UA 4LF3B 3BWAB 4G8FB 4UZSA 3ULUF 4YVUA 5I6MA 4Z7VA 2DJSA 4AX3A 4EEEA 4K23H 4ZX5A 4PY8I 1DDTA 5CIPB 3TFKD 1FHNA 2V7HB 4OLZL 1G6VK 1G7HA 2FEJA 1XAUA 2VIRA 4QDGA 4WW2F 2Q2EB 2OL3H 3AM8A 4TQPA 3WKNA 1FFPA 1AGDB 1AGCB 1FFNA 2V3FA 4L8DA 1HU8A 1RZ7H 2AK1H 3U9WA 3M88A 5C08B 5DJ6A 3GTNA 1NICA 1AE6H 4QY8A 1V3KA 3NK3A 3MXVH 4WWKC 1V8HA 4JY6B 3T65B 1C16A 4ZUVA 5T1MB 4KAQL 4WVRA 5FLVA 3L3OB 3D05A 5C71A 4WWPA 4LCIH 3LXUX 5T3ZD 5FX3A 1JTTA 2APFA 4D0BB 2GC4C 3VYOA 1LNUB 4MNGE 1F2XK 4XVSL 2YD0A 1LXMA 2VERA 3L54A 4HP5A 5HTSA 4K3DL 4E68A 2Y2WA 2H3NB 35C8H 4WEUD 1WFUA 3THML 2WW8A 4Q89A 1U93B 1DLFL 2XQBH 1RIUH 5HHOA 1R46A 4N0FA 4R4BA 2IXQB 5T33L 3LZNA 4OIBA 4PJGE 3VX1A 4Z7OF 3DDFA 4N9GA 4N68A 1SHMA 3V6FA 2NZ1A 1PKOA 3TTSA 1Z5LA 4E9RA 1PYWA 1K5WA 4H0HB 4DAGL 4YVNA 4RMRA 1EFQA 2F19L 5F1NB 3GF8A 4ZS6C 2DPKA 3KXFB 5F8RC 1Z2KA 5CGMA 1NANI 2JJTA 1A7NL 5KJ7E 3NTCH 3H9SB 1WAAA 4L05A 2N7SA 3G6AA 2JJSA 1G7PA 5DU7A 3FTGB 1J0IA 4JRXD 5BRZA 3K4AA 4BUQA 1KGCE 4G6JH 3DK2A 1J9RA 2NY6B 2PCYA 5CHNA 1WEJL 1OB1A 3RGVD 3ELQA 1JCVA 4IRZH 4H1LG 3WNPA 3G6JA 3QIUD 2BP0B 2H9GA 4PJFA 3AGVA 3PDDA 3DJ9A 4Y19E 4CSPA 1CGVA 1PG7L 3O2VH 1FGVL 4K15A 4X98B 5AB2A 5DQ9B 5F0JB 1OVZA 5L2KD 4CMHC 2E9WA 3O2DL 4J8RB 2F7PA 3LPPA 3REWB 4ABVA 2XWRA 3FO1A 3QI9C 4JDTL 5ID0B 1R3LB 3IBEA 3IE4A 5F44A 1AO7B 1BEYH 3PIQA 3IMWA 1BREA 4PGEA 1QTSA 2CDEB 2VXUL 2OL3A 4DZBB 4OFVA 1BD2E 3DDGA 4TTDD 1UG9A 1OF2B 3V0GA 4NQSB 4TUJB 4UIKH 1AAJA 4MA8H 3S35L 5BZWB 2O26U 3SDXB 3FFDA 3VD4A 3DBSA 2XJLA 4RGNB 5L6YH 3TZVC 4DIXA 2DBLL 2LT9A 3AGWA 3QJVB 4L1DA 1GC1H 1THCA 3AU1B 2YPLB 4GT7A 4ZYKA 3O8XA 3J7HA 3WNNA 3NABH 5F7KC 2DTSA 2IALB 4RZKA 4QXTB 4FNUA 3VXMB 5D7IB 1BF8A 4KMQA 2FX8H 5E8EA 2CGRH 1DQLH 3HC3L 3PP3H 4OJAA 5I1HL 3MLVH 2NDFA 1BQLL 4L3AA 3FRUB 1YMMB 5A16B 2RIKA 3MJ9A 2LVEA 2Z93B 1U3HC 1CXHA 1TQTA 4HWZB 2VDKH 3LHPL 4ZO7A 4Z7UF 2FATH 5HBBA 3CHSA 2F7OA 4AH2A 4KJPC 4PWEA 1D5MA 4GKLA 4JCLA 3RWHA 3CDCA 3SQBB 3SOBH 4P2OC 1OP4A 2FWOA 1KC5L 1MJUH 5EF1A 3MVSA 2ZOKB 1NJ9B 4POUB 2X9YA 1XGPA 1D9KC 1R5WB 4DGYH 4JFVA 5A6IA 1AXIB 3ZR5A 2D2CC 5JXAL 2VDML 2XPGB 1EIBA 2VZ3A 3VMNA 1M71B 4U6YB 4QLWA 1OCZB 1RZJH 1YEIL 4LKCB 1T1WA 4Z7OE 2JTDA 2BZCA 1XAKA 1SJEA 1DQML 4I2XA 4K5PA 2K3HA 3G7TA 2QLYA 3DARA 4CMMB 1NAKL 5B3SB 3FO0H 5ACZA 4BE6A 5IQ7L 2MCPL 1VERA 4JANA 3EO0A 3Q0HA 1R24B 5I1KL 2XKUA 1UH2A 4GRWE 2P5EA 1R3HA 1SM3L 1MG2C 1U30A 1MPAH 3QEUA 3SDDB 4HBCH 2JJVA 5F1IB 5LVEA 4PRNA 4HWBA 1ZVSB 4UQCA 3EYQC 3QUMB 4QRRB 3TX4A 1N0XL 1X3DA 2MPAL 5CD3B 3D09A 3VXTA 3VFTB 4BFIB 4KRPC 1BMWA 5DVMA 3EJJX 1M1XA 1TNNA 2YRZA 4ZAKD 3BWZA 2ZKWA 2JLPA 3X3GH 1E4WL 4G9DB 4YE4H 4BKLB 3C5SB 1UZ8B 3L3KB 2R23A 4HCRA 4JO8A 3EYFA 4NJAH 5BVPL 2LU4A 4NGHH 1RK0A 1A0QL 3BLPX 3SPIA 2XNAA 1KNOA 1EQWA 1BZ8A 1WZ1L 3INOA 3K8LA 2HLFD 4NHCH 4PJXA 5DJDA 5CR1A 4AT6B 5MI0C 1MAML 2X6MA 5I17A 4MYPA 1IAKB 6TAAA 2XWDA 1Q9LA 1CVRA 1FZJB 1QSFD 4PJDA 3AM8C 2VUKA 4PRDB 1NGYB 1IGCL 4JRYE 4J4PC 4EUPG 1IKOP 2Y23A 3IWVA 2ICWJ 2JKRM 5CINL 3NJFA 3SO3B 4G1MA 5C0GA 3SKNA 2FX7L 2IDQA 3DHUA 3NSXA 3HI1A 2N01B 4HJ0C 1CK0H 5IMOA 15C8H 4XI5C 3ZDYF 5K9QI 3MROB 4UUJB 3SQOL 3QQ3B 3U36B 3KPSA 1E27A 1E30A 4QCIA 3FF7A 1AXSA 5HI5C 4FMFA 3EJSA 3WJLA 4N5UA 4JCWA 2WZ0A 1Y18B 2ZYRA 2C8NA 2F74A 1BPVA 4AQOA 3NJIA 4JM2A 5GRUH 1UB6B 3L3IA 1MCPL 1BCIA 2X9ZA 5I1EH 3HFML 1E4JA 3CNKA 4ZMTA 3S88L 1HJCA 2P1YA 2P80D 3B5GA 1AR2A 3OLGA 4I77H 3HBZA 4GSXA 3TBCA 5DSCB 5T1DL 3T8MA 5ICYB 4OZHB 5HI3C 1OAZL 2O6DA 6FABH 3KPOB 4HAFA 4OGXL 4F3FA 1B88A 1OTSC 4ZFQA 4AYID 2AK4B 3R0MA 4MCNA 2E0PA 2JJTC 5HD8D 1AR1D 3EH4B 5L7XH 2VLME 2WVVA 5E6SB 2JJSC 4HD9A 4JFZH 1ZVNA 1IFHL 1KJVB 3BDXA 4KH9A 3ZYOA 1E42A 4Y5VB 5EB9A 2XXMB 3QQ4B 3ET9F 1XZ0A 5BV7L 1VFOA 3HAEA 8PAZA 1UM4L 4X9HA 3FOLA 1HX0A 1W80A 3BP6B 8FABB 1RVFH 3P3RA 1UZ6F 5FUCE 5C0EA 3T3PF 1DVFA 4DP7X 4JNXA 2YRBA 2D7TL 3RA7H 3MYJB 4LHUG 1O5DT 5KYWA 3GGWB 4TQIA 2EABA 1F3DH 4UM8B 4F2MB 4BV1A 2V9TA 4PS4L 4L8CB 2XZQL 3LDBB 4HJGB 4YGVA 4NAQA 5CCGE 2D3NA 2I32A 5C0IB 3SHSA 3QRGL 4YNYA 4NQCB 1Z0MA 1D6VH 1YJDH 1OL0A 3L8QA 4BWUA 3BIAX 2I60L 5FGBA 2BRQA 2EIEA 3M1OA 3MBEB 4ONGL 2C1PA 4FXLA 2DQTL 4E5XB 3LPWA 3NCYS 2X4NB 2CD0A 5LNDA 1JZ2A 2B77A 3B7YA 4ALAC 3UZVA 3MRJB 1FFQA 3A0OA 4D9RD 5LCVA 1NCAL 3QRBA 5JHDD 5GS2H 3FB6A 3CFEA 4KKRA 3MA9H 1A5FH 1BBDL 1KCLA 1E8ZA 2XLLA 4I3RH 4OFDA 2RB8A 3WMQA 1SFHA 1OSPH 3ZMEA 5IMLA 4N6RB 3MC0A 3O8XC 5D8JH 1LQSR 5F7EH 2OXGA 2JVUA 2NX5B 2CJUH 2VH5H 4IBSA 1JWSB 2HT3D 5L2JA 5DHVB 4BH7A 2GFBA 1CBVH 3ROOB 1M9SA 2Y36H 3M7FB 1KN2L 3I6KB 2BSRA 2R2HB 1IQDA 2XWJA 1QP1A 4WHYH 2X44D 3SBPA 5DZ9A 1QLFA 4LFHG 1I1FB 3FU6A 3K1DA 4DGVH 4NZTH 3FQ2A 2RFXA 1QEWA 1JZDC 3UIYA 1T83A 2XOTA 3PY9A 4ZK8A 2BP3A 3APDA 3QG7H 4X7TB 4XN1A 5DK3A 5FLUA 3RRQA 4OZ4A 4LSUH 2W0PA 5C86A 4GI9A 1MHCA 3IS0X 1NPJA 5FOBB 1PY9A 1S9XB 1T21B 2XSKA 1HDMB 4X9GA 4FABL 2I07A 3MRPA 4LSDA 4QD2E 1QFUH 1F4WH 4MFHA 2I9LA 3WBDA 1OAXL 5JOPD 4AY0A 5LLIC 3Q6GL 3AXLA 4E41D 1AMYA 3IXTB 1CD1A 4Y4FB 3LNFA 4G8EA 3V4PH 2PKDA 3DRQB 5AYTA 1TQCB 4BHUA 1U8LA 1OGPA 2MQGA 5F7NC 4HS6A 4G1EA 1K72A 2NNRA 4OCXH 1YN6A 4KHTH 5EWIH 4ELKB 3ZRFC 4FA7B 5SWSA 4NM8L 4N86A 1H6TA 4XODA 4AI7A 3UYOD 5I74C 3Q1SL 3KZ8A 1WK0A 4R4NC 3ZKQD 5F7LB 3NCFB 4GEIA 4IEFB 4A38A 1UZ6E 5A2IH 2R0LH 4I3SH 4ZNEE 3VI4F 5JR1H 4G7QB 2EXWD 1VGEH 3DXAA 2WWKT 2PYEE 3TJEH 5BOPA 3VMPA 3MV8B 2JKXA 3GSVB 3PWPB 4BWWA 2NOYA 3Q2NA 3UABA 2FO8A 2QDVA 3WOVA 3AUVA 3QORA 3WIHL 4FYSA 4H5SB 4KVCL 2O30A 3K2KA 5ESQA 3W0WE 2UY6A 4DGIH 2DY2A 1NBCA 3N85H 4UINH 4RFOH 4PW3A 4XH2B 3QZBA 3IMVA 1E6OH 4XCNA 4AOFA 1E3ZA 3NAAH 4M9OA 4OCWH 1WWBX 2VDNL 1N5YL 4PV8B 2OW7A 4MXVE 4QTFA 5I1IH 1KCBA 4DKEH 3BN9D 2MQ0A 1F45A 1VGKA 1GZHC 2NY1C 1TTRA 1XH0A 5EOCL 4XO4A 5ICXB 1J0YA 1FORH 1S3KH 1L9QA 2VERN 3UMNA 3APNA 3TNNA 3KWWA 4YSEA 5L4MA 1TDQA 3FFCB 2YGOA 5D4IA 5GGUA 1OM3L 3ZE2B 5I1LB 5K39B 4JFXB 3I6GA 3CQQA 2AHIA 5IB1A 2A9BA 1NGXB 1GYWA 3WJLC 4APQA 1RJLA 4OJEH 3TA4D 1YYMH 2H32H 3ARSA 2UVFA 3D87B 3HE7B 4FFWD 4JM2C 2IAAC 1LE5A 1BQSA 1WFMA 4G6FD 1QRKA 4LPYA 5CD5C 3HMWL 3ZDXF 5BJTB 3WS6A 2Y1AA 1OIOA 1RUPH 1H5BB 1SLUA 1NTDA 3WEOA 4KUCD 2WWNA 1AS6A 5D6CB 1NGPH 1I7UB 4TV3A 3VWJB 1DN0A 3HB3C 5I6PA 3HIZA 1KTKE 1IBZA 2BNRA 5IVXF 1E5BA 1ZS8A 4H25B 1HXYA 4JZJB 5JPMA 3MLSH 3GI8L 3UC0H 4L0PB 1KTJA 1YNLL 3U4AA 1CDGA 4OI8A 2GBAA 3R7QA 1BBJB 4U31A 1ZLUK 3UADA 3V95A 3FMGH 1WVZA 4UQEA 1NCIA 4UNIA 1EO8L 2CHXA 3W1ZA 3ZN6A 2WJ5A 2JKLA 3A6BH 2BOBB 4BFBD 1PZAA 4J3OH 2FB4H 5C0JB 3LH8A 1DVFC 1QTPA 4PJHA 3TO4A 3Q9PA 3WFEL 4FL4B 4AEEA 4PJ9A 5IW6A 2FQDA 2YAQA 5KN5A 3T0VA 7FABL 3FU8A 2QADC 1A21A 3E8UH 4K8RC 3QEQA 3U1QA 2YIHA 1RZGB 2KZBA 4XC3L 5C2UB 4UIMA 3IPBA 4HUUB 1EGJL 4KRMB 5AVTB 5GPRA 4FZEL 4X9FA 1OM9A 5KOVC 3C8KA 4Z7NF 4NKMB 3W3BA 1N26A 5FGBC 5FFGA 5EUOA 5CJOL 3SJVA 3BQUD 3CVHB 4DHLA 4KNSA 4AGOA 4NC1C 4PJBB 4XNUL 4F33A 3MRMA 1CCZA 1W72B 2B0SL 3GMQA 3IGKA 3BSHA 4ABWA 3NSDA 3RIAF 3DVNA 3QQDA 3CUPA 4M43H 4YHPA 3JWNC 1KZYA 1BIHA 3RB5A 4PY8J 4OM1H 3MRIB 5D2NE 4NBXB 3G08A 2BLFA 3HC0B 3QH3A 1HI6A 3EJCA 4DN4L 5IJBC 3NGBB 4YXKH 3T1FB 1Z3RA 1E5UI 2ROYA 3UTQB 5IROA 7CGTA 1NUFA 1EVUA 1N5AB 4W70A 3IDXH 3L7EA 4XP5H 4ZFZB 5IHZB 5LGKA 4P46B 1KCUL 3O6FA 1TVHB 2MMXA 1N70A 4MS8D 5H37G 1OARH 4P5MA 2L4OA 3HRZC 5B1AB 5AKTA 4JDEB 1N3NA 5CLXA 4X6FB 2GIYA 3MV01 1RKRA 5E9DA 4YWGH 3S5ZA 2QSCL 4XPAH 4Z3FA 3BHBA 5CBAA 4ZSOB 3RY4A 1T83C 1KUMA 2PLTA 3VSQA 5F3FA 3U4KA 4HHAA 2XN2A 5DT1L 3M07A 3IXAB 2H6OA 3KYMA 4LCUB 1JWMB 3HN3A 5AOLA 3A22A 2DWDB 2G2RA 4UT7L 1DQIA 2XTJC 3BDYL 3FH7A 3ZDXE 1MIML 4JVPA 2F08A 3MODL 1BA9A 2XXGA 1S78C 3K6DA 4GOSA 3F58H 3KE0A 3BZ5A 3D25B 3EO1A 2KL6A 3DC0A 4BZ2L 1OAKH 1S7UB 1JK8B 2IFFH 1H8NA 1MF2H 1K9TA 1TEGA 4JN2B 5K9JL 5IVXE 5C0CD 2NY3C 3QG6B 4PRIA 3CFUA 4NDMA 5IOPA 4OTXL 4M93C 1GKEA 2KYIA 3KNBA 2YHGA 4FQLL 4CNIB 5ABZA 2Q2LA 1IGFL 2P26A 1Z0NA 1FL6A 2QQKL 2ITCA 1L9MA 5J56B 2HVJB 1YECH 5KBPA 2VLRB 2IAMC 1ZDQA 3VFMA 1WRFA 1C1EH 3PGDB 2CLZB 2HRHA 3BAKA 3T71A 1YYLL 1LO3H 3P4OA 4BZ1A 1GOHA 4LPVA 4NLAA 3V52L 3GMLA 2WIIA 3ULVF 3ZL2A 2DD8H 3BZ4A 1JFHA 1TSHA 5EA0H 1YN7B 5E8OA 2XA8H 1Q9KB 3EJTA 1G7MB 2FJFA 2WBWB 3NIFF 1XR8B 2JXMA 3QORC 4PR5A 5T1LB 3UTOA 2WYZA 4Z7NE 5IF0A 3HN5A 1ZWIB 5FO8B 1QFWL 4FA8A 2IPKB 4CSZA 4F1SA 1PNCA 2J1YA 1BZ9B 1B4RA 4FULA 4XAKD 5J11C 4AUUA 4PGDB 3T6WA 3B8YA 2VDOH 4FQ1H 1LLAA 2ATPB 4R7NA 3EH5B 1SUJA 4MA3B 3C6SB 4FFZH 4WTZG 4YHLH 2YEVB 2IWGA 1MREL 3L5IA 1PKQB 3N1PC 2OXHB 5JW4Q 3U0TB 1NDMB 4L1TA 1HOCB 4ODBD 5TQ2L 5E00A 3U2SA 4ZPTA 1E8WA 1FG2B 4JY4B 4GQ9L 1SDDB 4PRAA 5F3BB 3EJZC 1JGVH 2CHDA 3MR9B 4GP5B 1LM8V 2ZWSA 3MNDA 3TNMA 1FZMA 4WWID 1HS6A 5AOKA 1HH9B 1KYDA 2HRPH 2YAEA 3UTSE 4APQC 4KZDH 5EFIB 4Z0BL 4YE0A 5I8CA 1JI1A 1UM5L 1ZSDB 1SJVA 2GK0A 3FT9A 4BK8A 1QPPA 5T1KB 5KVFL 1P4LB 4IBWA 3P73A 4HEPG 4LLVA 1KCRH 5GXBB 5JYMA 1CO1A 1PF3A 1WIOA 3WS6C 3BWAA 4G8FA 2A9MH 4JS7A 4R2GC 3SYCA 1ROCA 3IKCB 2NUPB 3DSFH 1CIDA 4ODTH 3RL2B 2ALWA 1HWHB 4JPWL 3VXUA 5I23A 5IFJA 5HJGA 5JIPA 1I4FA 1FFOB 1SXSA 2F15A 3KHQA 4RQQA 1XCWA 4Q9CA 5JPMC 1SHWA 2N56A 2YBGA 3NN8B 1FVEA 1AGDA 2P4AB 3GB7B 2R1XB 2IG2H 5BMFH 4LSTL 1J87A 5C08A 2SEBA 4PJAA 4L4TD 2N1TE 3BT2L 4R4FH 2VJXA 5TTRA 1PZUB 4KXAA 1ODAA 4ZUWA 4LEXL 5EEYA 5E08H 1J0ZA 3T65A 1BFVL 5T1MA 3TTYA 2Q20A 3L3OA 4JM0A 1YRKA 5I0YA 5AVRB 4G6AC 4X6EB 3TO4C 4KROB 3IVKB 4BQCA 1YAIA 4JFPB 2CXGA 3DX6B 4PJ9C 4G7YL 4XC1L 2J88L 4P59L 4D0BA 3CDGB 4M6AA 4WWKD 1JGUL 1GA2A 1WQVT 4NP4H 3GSNB 4ELMA 1DUZA 4HK0B 1U3NA 2WHVA 2AXJA 3IJHB 4O02L 1TEYA 4M1GL 3WXVH 2Y1YA 3LPOA 3VGAB 1RZKH 5IJCC 2F54B 1JK9B 1QKZL 1DLHA 2IXQA 1ZVYA 4XNDA 5I19H 4OCYH 5EUKA 4K5LA 5LBSL 5DHEA 1BV8A 2R1WB 4XCFL 3ULVE 3CX5J 3CDFA 5F1NA 1ZT7A 5F89B 3KXFA 1A1MA 4LSQH 2UXGA 1YEGL 2C3VA 2VXVL 3GSXA 3TYGL 2QELA 5BRQA 1KJ2H 2EH7H 3HS8A 3NIFE 1T66C 4LCCA 3IBOA 1E4KA 2WSKA 3ZOAA 1UTDA 1CFSB 1HINH 5LXVA 1JGLH 3FT4A 4P5TA 5TGBB 4ZS6D 3IETA 5SWQB 4BSVB 1JMZA 3T8XB 3HZVB 4UOQA 1U2HA 2B2XH 3D8MA 5IROC 2GCYB 3RP1A 4Z3IA 3C6LB 2IQ9H 3O41B 4L4VD 3O6FC 1BWMA 2WN3A 3FSZA 3LRMA 1U8KB 2CBTA 1NCHA 1UKSA 3O6ML 4OQTH 3UDWA 4WEBH 4ZT1A 1U8PA 3WFBL 2WZ6A 1UM6L 5DJXA 1T20B 1E90A 4ILDA 4J8RA 4OJYA 3QWRD 5GZOA 1NFIA 5FB8A 2RJMA 5FGCE 1ZGLA 3HS0A 2C9QA 1G9MC 3MRFB 3REWA 1PZDA 1FNEB 2ICES 1R3LA 2XPZA 4X8JA 1CL7L 3GD1C 4N1HB 1XBRA 1VFAA 2CDEA 2XY2A 3OWRA 4DZBA 3UBFA 5DD0H 4MJ5B 5F96H 1BJ8A 2FGWH 3VWKB 1OF2A 3SY0B 3QI9D 1NMAL 3CSYA 4KUZH 3SDXA 3QDJE 5DMKA 2GITB 1DEDA 3BAYA 4TQEL 4ZMQA 3SGKA 4WIQA 2XKNB 1WHPA 3OGCA 4Z76B 1JF1A 2ZJSH 4NO0B 3JV4A 3TPUA 3AU1A 3W5MA 3QJUB 2H8PB 3HE6B 2VITA 4FFVC 3QQ9C 2BVUA 2IALA 5C8JB 3VXMA 5D7IA 1Y0LB 3TZVD 2W65B 3WFDH 1ONQA 5C0AB 3BFOA 3S48A 5EZIH 4ODWB 2ED7A 3GXIA 1IQWH 1MFDL 3V0HA 2CO7B 1HHHB 2Z93A 3LKRB 4L37B 1DDHA 4HWZA 4YMPA 3DTXB 1WV7T 2EVHA 1AGEB 4JVWA 1MDTA 2J5LC 4H13C 4UQIM 1JI2A 3X3FL 1BGXH 4WI4A 1U3HD 2V17L 5IBLC 1R6VA 3OKLB 1LP9F 3TVMB 1BF5A 4Y2OA 5DURD 1Q90A 3P69A 4B9KC 5HYJE 1QD0A 4KJPD 3B7SA 1QUNB 2RAMA 3EG9B 2QJDA 1IGIH 5F9OH 4JB9L 5GRVL 2AEIT 1CIUA 4P2OD 2XPGA 4GSDH 5T3XD 3HHMA 3ZZLA 3I3DA 4TSAL 4J3UA 1V54B 2XZAL 4LKCA 1D9KD 4CVUA 4HKBB 4DQAA 4A6YH 3TESA 3FPYA 1W0YT 3SE8L 1SNRA 2CJ3A 1FNLA 4NCDA 1BYPA 4CMMA 2H3XC 3K6FA 4JFEE 1R24A 1JTOA 1ZTXH 5HDQH 4EN3C 3EOTH 2YN3A 4H20L 3WKMH 4HOXA 4MNGB 4J5VA 3T2NL 4PLNC 4FE9A 4I4WA 1NKOA 5F1IA 2KQNA 3QIBB 1OE2A 5TDPA 5C0RL 3BPNB 3QGVA 3ABMB 1HCFX 4Z3JA 1CF8L 5CD3A 4ZQTA 1TZIB 2EH8H 5IHUH 4BFIA 5H94B 5JIMA 2VGLM 3CC1A 3MMEA 5FM8A 4NUGH 5E8DH 2IOIA 5AAWA 2ZXEB 3U7YL 5IMKB 4G9FE 4OJCA 3U2JA 3C5SA 1MVUB 1UGNA 1UZ8A 3EYQD 3Q8CA 3U0WH 1KBKA 3L3KA 2P43B 1VEPA 2WIMA 1Z9SA 2BSBA 4KRPD 5GGVY 1I9IH 1UH4A 2HXAA 4CVZB 3ENEA 1SBSH 1HL9A 3OF6D 3TN0B 3ZMNA 1S7RB 4PTTA 2TSBA 4OGYH 4AT6A 3KS0J 1D5XB 3BD5A 1IAKA 5JIKA 1R5VB 5HHXH 4FNPA 3DBXB 1FZJA 4V33A 4WWOA 5FDYA 4TPRH 5T5FL 2OSWA 5KBDA 4WUKL 4PRDA 4LSRH 3FUHA 3CVBA 1BJMA 3NP3A 3X14B 1SY6L 1YO4A 1YPZE 2NY5H 1MCBA 4HUCA 4Y19B 1X5XA 3UX9B 3N2JA 1R3IL 3A23A 4ONHB 4Q74A 5D5MF 1H9DA 2Q1EA 4J4PD 1QLEL 3L3OC 3MROA 1CFNB 2PPAA 1GRWA 4UUJA 5EO0B 2E4TA 2ZOLA 1UFUA 1MJJB 3PG2A 1VCBC 3EFDH 4AM0Q 3VFOA 4N0RA 1JGEB 2P8PB 4HJ0D 4YHYB 4GMTL 1NBQA 5DD5L 1CDHA 1I8MB 4G8GE 4XI5D 1Y18A 4N2AA 3VDAA 4X9IA 5AW5B 1R75A 2CKBA 2VABA 2IGFH 1UB6A 1QYGH 3S5LA 2BS71 2X6AA 2OZ4L 5HI5D 4WGWB 2V5YA 1TCRB 3BVVA 4URTB 5DSCA 3P1VA 4M7ZC 2R4RL 4UV4H 1LP9E 1UWXH 3KPOA 4P57A 4OKDA 1T7ZA 2CGYA 4JLRB 3RKDC 2HVBA 3FTZA 3MCLH 3V4PB 2ZSWB 5HHOD 5I8KH 5EBLA 5EBMB 2IGLA 1MCEA 2VWEC 1FRGL 2CNZA 1QBBA 3PP3K 4LCCC 5HI3D 2IPUK 1KJVA 2W94A 1FF5A 3FUIA 4PRHB 3GJEB 1HYRC 3CN3A 1OTSD 4P5TC 4A7GA 4S1DC 3QQ4A 4KY1H 4TQHA 5JO5B 5BOJA 3R06B 3FUMA 5G4OA 4MJIA 4DUVA 1KGJA 3GRWA 4DTGH 5BRZD 1BVKB 2DLHA 2J3SA 3VQMA 2DQUL 1J1XL 1XGRB 3MRLB 4P2QA 3MYJA 4ZXBB 4O51B 4TNWF 2OMNA 4L8CA 4D0DB 4N8VA 4ZW5A 1HH6B 2X4RB 4XAWL 1B0RA 1JXDA 2XWBA 4HJGA 3UDWC 3L9EA 1HHIB 2BS9A 3CFBA 2ED9A 5D93B 5C0IA 4KC3B 4XBMA 5GZOC 2GSGB 1TXKA 3B9KA 4KKNA 3HS0C 5GGTL 2UY7B 3LNIA 2WZ5A 1NAMA 1E43A 4DP8X 2AQ3A 2XQYK 1TLKA 3MBEA 4EXKA 1YG9A 5HGHB 1WCBB 4E5XA 2X4NA 4TLTA 2CIKA 4KQ3H 5D2LE 5B38B 1EFXB 2AERT 4AVHA 1UGKA 4L2YA 4XBPA 4GRWB 3FQUB 3MXWL 3SGKC 1TZ8A 1X5YA 4GFTB 3EYSH 1TO4A 4RRPG 4OCRH 2NYZA 1JZ7A 2R39A 1RD6A 2Q6WA 2WBJB 5F21B 3SDYL 4QJ5B 2ODHA 5KAQF 4HIQA 1H3XA 2NX5A 3A4AA 2WLHA 4NPJA 1JWSA 3OMNB 5DHVA 2VJ8A 1AOZA 1HKFA 1MFEH 4MZRA 5A2BA 3O8XD 4MNQE 2X1XR 3FCTB 4CU6A 4WUUE 4XP6H 3NCWA 4DWHA 4U6VH 1W9XA 4UAOB 1D5RA 4N20A 3VSUA 3WIAA 5G2NA 2VXQA 3LS5L 4TVUA 5HHMB 3SE9L 3P0VL 1ZV9A 1I1FA 1M05B 1E9OA 2J12B 3L4VA 3IDYC 5D70H 4JQIA 1AGBB 4Z23A 3SDCB 3EJRA 2FLBT 1EEZA 1ZS2A 4X7TA 3VI3F 3N43F 1RV6X 3MLYH 1JG9A 5F7DB 3V6OE 4WLCA 1DJIA 4M61B 5KEZA 1Z5HA 2HG0A 3IE9A 4JM4H 5FOBA 1T21A 2VW6A 3AREB 1EDQA 3D69B 3BIBX 5HGAB 3OLIA 5IVZB 1G7IB 1RI8A 2Y72A 1IM9A 1ZLWH 2CAKA 2QGDA 4YBLB 2IADB 4I3GA 4FTVE 4YFLF 3IMTA 4Y4FA 1AJ7H 3WHXB 4A37A 3G04B 4AKQA 5D9SA 3FB7A 1QAWA 3HBGA 1BQHG 3EDFA 1FBIH 2JCWA 3B43A 2F0CA 4NUJB 4WI7A 4A39A 1J5CA 2EDFA 4AIZB 4GUCA 4N8PA 2PP8A 5AOMA 4H1LH 2P5ED 5HHVH 4GBXB 1DL7H 1MCSA 1ZHNB 4X6DF 1ZHLB 1L6PA 4XO5A 2IWKA 2AJYL 3Q01A 4X5WA 3JWDH 1CR9L 1KB5H 2LTQC 4P4KB 5AAWC 4KRNA 1ECYA 3IDGB 1WUZA 2X88A 4FI7A 4QO1A 3TV8A 4PM1A 3R1GL 2ZUXA 4HF5H 3GSVA 3QZPA 3PWPA 4R4ND 4KXDA 1CDIA 5FO2A 3GBNL 1FDLL 3PNWB 3WCYA 5I30H 3GSOB 4F7PB 4KKZA 3WFHA 3TH4T 2TRYA 3V4VA 3ZE1B 1VAHA 4TLKA 3BP7B 3QEHB 2GUOA 3PQYE 4LMQE 1IEHA 4J3WA 1WGVA 1PLBA 4XH2A 2OFQA 4DN3L 5DJ2B 2QV4A 5F1OB 4KXZI 3NH7L 1MNUL 3U4EB 2V2TB 3GZOA 4PCKA 4PV8A 4GMSL 5J1SC 2W9EH 4JFFE 4K3EL 4NNYB 2OMWB 4P3DA 4M6NL 4TSBH 5F0PB 5E0QA 3F64A 3TBWB 4M1DL 5HDWA 3ZL4H 3WE1A 5ICXA 1A6PA 3W39A 1KWGA 3D50A 2FLMA 4L1SA 5IZ7A 5K39A 5EOTA 1UWGH 4QRBA 1HWWA 3MCKB 4JFXA 4U7KA 3F84A 3QDGA 1MIEL 2NY1D 3BDBA 5FF6A 2WBKA 1Q1JH 3D2UB 4J3VA 4ONFH 1WF5A 3U9UA 4M6OL 1S7XB 1G9EA 3KPSD 4PGZA 4R96A 4ZPVB 3CH1A 3FT3B 1H9VA 2CXKA 3ILPB 5BJTA 4UANA 4MDJB 3G9AB 1Q8MA 6CGTA 1ZV5A 5TK2A 1QHOA 1WTGT 4JM2D 3ZZSA 5DR5H 1I7UA 1ACZA 3GM8A 3S96B 3VWJA 5D1ZA 4F5CE 3VI3E 5JYLA 3MLRL 1VDGA 2X87A 3E38A 5CD5D 4M48H 1I3RA 1NBZB 2EC8A 2MEJB 2NPLX 4H25A 4TNGA 1DEEB 1A9VA 4UILH 5AKSA 5AKVA 3CLEH 3NA9L 5CKGA 3SKJH 4NQUA 1BBJA 3HB3D 4KXBA 4QRSA 3WYRA 3UYRH 5IBTH 3EYVB 1N59A 2XUWA 3OHXB 2BOBA 2HLAA 3LRLA 3ZIYA 1RPQA 2DMHA 4XOEA 5CKAA 2AJUL 1I7RB 3LQZB 3KJ4B 2FTAA 1H8SA 3KGSA 1BVNP 3O4OB 1SPDA 2O4EA 3M8OL 1NM9A 3BWSA 4ICWA 5EULV 2QSQA 1RZGA 4P9HH 3HMXA 4RMVA 1DVFD 3OWEA 2RHEA 3JT2A 2DKUA 5AL0A 4QEGA 5GGRB 3B9KC 3HNSL 3UJIL 3VGBA 3L4XA 3MKKA 4NKMA 5EF0A 3G9VA 2QADD 5LGHH 2AZAA 4K8RD 4X6DE 4A2LA 1W0WB 2ZNWA 2OSLA 4H8WC 3TT3H 1EHXA 3MBEC 4TVPD 4R8WL 3UPRA 4GRLA 3X1BA 3QS2A 4I85A 1W72A 2NY5C 5C09E 3U30B 1AC0A 1T2QL 2BZDA 5FEBA 1T5WB 3WAJA 1GS8A 1TVDA 4HLZG 3H56A 4HX1B 7PAZA 4AVIA 1QR1B 2A9DA 5DDHA 1X5GA 3QXTA 3HC0A 1PZSA 3H3BC 2HFFB 2YC1B 3ARGB 4GFXA 4LKXB 5E0FA 1KACB 4MB4A 3K2IA 1A3QA 4KK9C 1D5BB 1HNYA 1ORQB 2DLTA 3I74A 3UO1L 4LGPB 4NAJA 5IVOA 4EUPH 3ATAA 1RIVH 4PIRF 3CZJA 3KYOA 3KPPB 2HFGL 3DECA 4ZFZA 5A2LH 3RTQA 4P46A 3WHE1 1A47A 2PYEB 2W95A 1SOXA 1XD1A 3O45B 4K9EL 2GJ6B 4WSGA 5H2BB 1OP5H 4X4XB 4NWTL 5AWNH 3U1PA 3DSNB 4X6FA 2CHNA 5IV2B 3O81A 4N8CL 2DIAA 1F11B 2PW2A 3F7VA 2A77L 1P7KA 2GPZA 3W0WB 1BOGA 1BZEA 2AGJL 5DC9B 1CFTB 2PF6A 1MCKA 2YZ8A 2C1OA 4NM4H 3CFKA 3MTRA 5AW2B 2DWDA 1MCOH 3ZK0A 1L3NA 3P9MB 3RIKA 2ENQA 5CEZH 3CU7A 4UT6A 4K7PL 5FYJH 4UV7H 1GSKA 1KLFA 3DGDA 4XE5B 1JK8A 5IEKA 3D85B 2CRYA 1KB9K 2XTJD 2NUTB 1PY0A 1AQKL 4Y4FC 3TGXA 4DW2L 3ZR6A 4MWFB 4R97B 2F5BH 1DJSA 1S78D 1TQCC 1MFCL 3MV11 3RX7A 1PZBA 1XXFC 1JJUA 4CNIA 4YHML 2JKSA 4XB8A 2L7UA 4YQXH 5T1JA 4HC1L 4ZX3A 5JA8B 1CU4H 5DEGB 3DO3A 4GUPA 4ADIA 4LL9A 1TPXC 4PJCF 2VLRA 3EFOA 2NY3D 5HDRA 1KEMH 4OIIL 1TU2B 2UUDH 3HFFA 4Y7OC 1SOKA 1X4XA 1NGZB 2W81C 3L1EA 5MP6H 4XO8A 5SWSD 1MH5A 2P5WE 4NCC2 2A3TA 2F1EA 2YLHA 2IAMD 3UPAA 5GS0H 5K93A 4G82A 4D0CA 1UKTA 1A25A 2J6EA 3AROA 1WTLA 5D1XB 5H35B 3VGDA 1B4TA 1OT4A 1ES0A 1QX1A 2YSSB 4K3HA 4DPBX 4U3HA 3H9ZA 5TDOB 4Z7VF 4C8XA 3PV6A 3NJXA 2IDTA 1G7MA 4HS8L 3DXAD 3KR3L 3AU0A 1WJ3A 5ALBH 2R27A 1A1NA 1ZWIA 1CLZL 1G6RL 4L3EA 4GW4B 2J8UB 4H4NA 1A8ZA 4LASH 5D1QE 2LW3A 3MOAH 1ZY9A 1CI3M 1RU9L 2Z0UA 1LE9A 2EDDA 1BZ9A 2P28B 2OK0L 3CPUA 4HGWB 5K9OB 3QORD 4C56A 5CS7A 3PABA 1H19A 3DYMA 2G60H 2ATPA 4OFQA 5LAXB 4TULL 1OXYA 1ZIAA 4MA3A 2CWRA 2E7HA 4M3KB 1WHOA 3C6SA 2BWIA 2FR4B 5G4NA 4NSKA 1PKQA 5I1AB 1BHGA 1GAFL 1N9PA 2HG5B 4ZMXA 1J9TA 3T6QC 1NDMA 5A7EA 1VZHA 1HOCA 2CK0H 2OA9A 3D34A 1FG2A 2DQDH 4JY4A 3CDYA 3U7WH 1S2EA 1FCCA 3MR9A 1U41A 3W9DB 1P2CB 4D7BA 1JF6A 4LRIA 1QA9B 3GTTA 3LRGA 2Y7QB 5EFIA 4BFGA 1F4YH 5FYKL 1FO0H 2N59A 1MQKH 3EJZD 3LN4B 4JQXA 1QASA 2ZUUA 1DVZA 1EA9C 4APQD 3U9PH 2QR0A 2A1WH 4DO6A 5FGRA 2FIRT 3IKCA 3ESMA 3O4LE 4YIQB 3S37H 1YEJH 2NUPA 3LZFL 3PAUA 3WO4B 3RL2A 1EZSA 3VWJC 5D1ZC 1G7JB 1P7HL 4B97A 1JV5B 1QMUA 3SKOA 2VN4A 1WAAF 4R2GD 4FNLL 4ZD3H 1MFBH 3JVGA 1Y1UA 1TKWB 2PNDA 4EJ1C 3D39B 3GB7A 2X2YA 2R1XA 4HPOH 3F5WA 4KGLA 5EV7A 4JFYA 1OZTG 2ZG2A 2BNRD 3KPRB 4UM9A 2Y5TB 1PX3A 1TZGH 2WXNA 1R5IB 3QDMB 4NC2B 1JXGA 4KU1A 1G7QB 1OGAE 1LO0L 2X41A 3HR5A 3KWVA 4MHHG 4P5KB 4XOAA 4AJWA 4WO0A 3DJZA 3RFRA 3DX6A 1N12A 1BM3L 2YPVH 4LVNC 3CFNA 3QDHA 3RL1B 2CRZA 3CC5A 2XYBA 2WXFA 3BAEH 4NZRH 1CUOA 4G6AD 2Z31A 5L4IA 3TO4D 3S8GB 3MGOB 1MRDH 4PJ9D 3VGFA 4FQIH 3KG5A 4MCZA 4XMTA 2F54A 4KOBA 4U6HB 1JK9A 3QR2A 4GAYB 5CUSH 3L4ZA 5EOQL 3QCVL 3QEQD 1ZE3C 1A7PL 4WK4B 4A6YB 2GB2A 3DX7A 3FQWB 2G9KA 4XPTL 1N7ML 5L4FA 4W9GC 2R1WA 4DFIA 1CURA 4GRLC 4JRWA 3F7PC 1B2WL 3O9WB 2GTZB 2B3IA 4J1UB 1K8DA 4YZFF 5LBGA 4YDKH 3SJVD 1I1AB 4BRJA 4JPQA 5C0BE 1PW3A 1L9TA 1CFSA 2WO2B 5HYSG 1AZZC 2VDPB 3R4DA 5TGBA 1ERNA 3VFPA 1JHTB 1TTUA 4BSVA 1Z7JA 2MSPA 3NGBC 3T8XA 3K72A 2OMZA 3F7KA 4V2BA 3H0TB 2YAPA 5EIIG 4BWTA 5EORL 3RTQC 4ZUUA 3MNVB 3O41A 4P46C 4O2CB 5C9JA 3IMRA 1FZKB 3N9GL 1OHQA 1I9JL 4LIQL 4G83A 4LAQL 5IROD 1BF2A 4UMSA 1YNTA 5DJZB 4FKHA 3MV7B 1VPOH 3ZT7A 4GNKB 3F2LA 1RH8A 1T20A 4G6KL 2MQ3A 3O6FD 1MRCH 3UAFA 2WUCL 5DMGC 2K9FB 1X4ZA 3MRFA 3G5ZA 4HCIA 1JZ5A 1EZUA 1FNEA 4A2FA 2N7BA 1I7TB 2FWLB 4AQAB 2L3BA 4DVBB 4EZKA 3QUML 1PSKH 2NR6A 3EGDB 4MJ5A 5A2KH 1OAQH 1XF3A 3VWKA 5E9DD 2YBRB 1PLGL 4H2CA 3SY0A 3EBHA 2B1HL 4MD0A 4WNSA 3ZL1A 5JPNB 5I73B 3PWJB 2VT0A 3DX2A 3UL4A 5EU6E 5HHOE 2VLJE 2FH6A 2XKNA 1Z9LA 4Z76A 1WA2X 4DP0X 1VA9A 3C12A 2QMKA 5CN2A 4NO0A 1CXEA 2VXSL 4NZJA 2I26N 4OF8A 2PXYA 3FN0L 4RAVB 1QSVA 1X5MA 1CB4A 2HJKB 1Y0LA 3P77A 5D7LB 1QNIA 4WI5A 1JV2A 2XPYA 1OCWL 2L7JA 4FFVD 1HHHA 4L37A 3R8BB 2DEWX 2HKHL 3ARTA 1ZTMA 3DTXA 4LQFH 4PRID 4UB0L 3DOHA 4B0MB 2FUTA 5DD3L 2A9NH 4K73A 4Y1TA 4HIXH 2CO2A 3MREB 5DS8B 3QA3B 5FWRA 2QSVA 5C2BH 3OC8A 5C7XL 4HYTB 3TVMA 4KTEL 4ZW7A 4OUUB 2BZ7A 4OZGB 4PU2A 5IHLB 1YUKB 2ZCKH 4G11A 1QUNA 3EG9A 5FFLA 5IBLD 5TE7L 2IBBA 3ZZ1A 2CMRH 3OJ2C 4D94A 1BXAA 4IIZA 1NL0H 1WZLA 4X83A 5TE4H 4GW1B 3ULUH 5KANG 3TWCL 2OTUB 2VN5A 2Y24A 2XBDA 3QNYB 4DKAA 1IAIM 2DV6A 1S7QB 3FQ1A 1ASQA 4YZFE 5FKAA 1V10A 1ZA3B 3I6LE 5KSAB 3WD5H 5JOFB 3GK8L 4MNGA 4M5ZL 5FA3B 3S37X 3ARYA 5DVLA 3WEXB 2FL5B 3QIBA 3BIKA 4IHOB 2IO5A 1L6ZA 2E6PA 4EN3D 1CDJA 2CO3A 1UJTA 1GGUA 2C7UB 4JO2H 1LWHA 2ZSVA 4HQQL 5H94A 4PJGA 4LRIC 4OLUL 3EZJB 4GJTB 1KFAH 4KI5C 4B60A 5IMKA 4L8SB 5IGXL 3QEGH 1TQUA 4JM2F 4S1RL 5ADOL 4DJMA 1FN4B 3S5YA 4DQOL 4GQQA 4JQXC 4Y1AB 4KV5F 1D2PA 3V8CA 1KBPA 4C83B 1OAUL 2AF2A 3FAWA 3VFUB 2J43A 3DX9A 1I7ZB 2E9JA 1AG0A 5GSVA 2IBGA 5JQHC 1XGTA 3IU4L 5DTFA 5ITFB 1BYNA 4NX0A 2N0KA 4LSPL 1MUJB 3DIDA 4N2KA 1R5VA 2IDSA 3NT0A 3JVGC 2IDCA 3CN2A 4CBZA 5CCKL 1UOVA 2FT8A 4JFQB 4N2IA 1S9WB 4ZX4A 3X14A 2WNWA 5FXCH 2IPTH 3VXUD 1X5IA 1NQBA 4Y19A 1TYJA 3SPHA 4JR9H 1GGCH 2XWTA 5HP5A 3ZDWA 2JCCB 3MA7B 1JYXA 4FGMA 1CFNA 5I16B 5EO0A 2VSCA 4KROC 1E7VA 3ZE0E 3HI5L 5AD0A 3WFZA 4IRSA 4FLHA 5C7ZA 1AY1L 5FYLD 3QJQB 3KW8A 2CG9X 2D3JA 2NCEA 1I8MA 5F7HA 4I87A 1BD2A 4U3SB 5F88A 3BKML 1KGYE 2OR9H 4XVJL 4M62H 5KYUB 1WFJA 2Z31C 3VD0A 1KCSH 4U4BA 2RBLA 2M2DA 1KY7A 5SX4H 3H2PA 3SYOA 1EJ6A 2EDMA 2ITFA 3VGAC 4JPIA 2ZONA 1MI5B 1TCRA 3OZ9L 3QXUA 3IFLH 4JO5A 3RZWA 4W9HC 4FLSA 5EU4B 5INCA 4PFEA 1T04B 3WTVA 3QC5X 1NGQL 4S2SB 3LMJH 1A7RH 1MY5A 2WGXA 4IDJL 2ZSWA 5FO8A 2LHAA 3WTTA 2XCMC 3NJJA 4WHDA 3GJFH 4IRJB 5BNXD 4I9XA 2WP3O 3FQRB 3GJEA 3BVNB 3RKDD 4A66A 4MCMA 1M7XA 3KXFD 5JO5A 1NCTA 1LO2H 1DQQB 4ENZA 5LO7A 5J12B 2F7IA 3WN6A 1JE6A 2VSMB 5H37A 1L0QA 2VQ4A 2BY0A 2YD5A 1KB5B 1NC4B 3PWUB 4P5TD 1A6VH 4NIYE 5E1AA 1XGRA 3MRLA 4S1DD 4ZXBA 2K8MA 2BW4A 1JYVA 3MO1B 1HH6A 2X4RA 4QXGH 3RKPA 4QHMB 4X7SL 5TDNB 2XDHA 4ZQKA 2FZ3B 3MJ6A 3GDCA 4LCWB 4PJEF 4FP8H 2GSGA 4TSCL 2UY7A 1TVBA 2ZKXA 1ET8A 2NR6C 3ZQWA 2J1ZA 5HGHA 2DF3A 2AFNA 2LAAA 3VWKC 4HGMA 1QWNA 2O5NA 5B38A 5GZOD 4XXWA 1EHAA 3WIFA 2A83A 4WFHD 4TMPA 2APBA 4M6MH 4XMUA 1CLOH 1LVEA 3QJRB 2VDLH 3IDNB 3OXRB 3FZUC 2PP9A 3IMUA 3O6KH 3O3EA 3PXLA 4XXCA 5HVGB 3IFNL 3BPCB 3FC8A 2PXYC 1HXMA 3DTUB 3F3HA 3T6VA 3OTTA 3CXHK 1USQA 5E2WL 4TYUA 3FL7A 2YJQA 4UT9H 2BNQE 5CZVL 2BHZA 4KBPA 3JTBA 4R26L 3P02A 3ZVVA 3UJTH 3CVIH 3FSAA 5EC1B 2OX5B 1GGIL 2XTSA 3VXMD 1FYTE 5DZJA 1UB5B 3O2WH 4HZLA 3T2LA 5F6IB 5TE6H 1MQ8A 4NRXA 4ODHL 3QFDB 2H4EA 5LDUA 3RJOA 5JW5A 1JZ4A 4XRCB 2Z7ZA 3GXNA 3GMRA 4A68A 3TVMC 2ZOWA 2Y5QA 4W4NA 4EZJA 5JDSB 3OXSB 2CU9A 4ZMPA 5DCCA 3WNJA 3T0AA 3HZMB 1WWCA 3VRLF 1CWVA 4HKXB 3T6ZA 3AREA 4JRYA 4NZFA 3BEWB 1YPZB 2DWEB 5F2FA 1HZHL 1VFUA 3ES6B 2VISB 5E5UB 3VFVA 1G7IA 4UU9B 4RIRA 1LL1A 3H42H 4FCHA 3B1UA 1NGWA 3DA0A 4PRPE 3SQRA 3WNMA 1XQ4A 4WTZA 2IADA 1R1CA 1N67A 3WIIL 2VLKE 3H6JA 3G04A 2DQMA 4U1MA 3KLDA 4L29B 2IH1A 5KVDE 5DHMC 3MNWB 4EDXB 4X8GA 4NZUL 2ZF8A 1QNZH 4NUJA 3QIBC 2ZP9A 2B59B 2CPCA 4XPHH 4YXLH 3BPNC 1A6WH 3GHPA 3JWOH 4KK8C 4N2NA 4DK3A 4LLWB 2P45B 4J3XA 5F3HB 1J12A 4BSWB 1UFGA 4HEPA 4N2CA 4XMKH 4Q9RL 5DO2C 4P4KA 3V6ZB 3IDGA 4N2LA 2AC0A 2NNAA 1KXVA 4Z5RB 5AVYB 4YK4C 4JAMA 2H0FA 1EAOA 1UWXK 3ILDA 2BVPB 4RNRB 1WLHA 3SD2A 2Y9RT 2GJZB 1TETH 3PNWA 2DQIH 4MAYB 3GSOA 4LBEB 4U1NA 1Q1PA 4PJEE 1KBGH 4QYOA 1GMIA 3BP7A 3JTSB 1QATA 4UT9A 3VUAA 2F5AH 3O3AA 5J9PB 4OM0H 1F8TL 4WV1A 4PGJA 3M17A 2LLNA 3CVHL 5E4EC 1CFVL 1H6UA 1G0XA 3AG3B 3WSQH 2GJRA 2OMWA 4PLJC 2XZCH 3PJNA 5ALCH 5IJVB 4WO4B 4LEEA 4OSUH 1URIA 5L4JA 1ITCA 2XVLA 1GGTA 3HG1E 2C9UA 5AVSB 5CGBA 1NLBL 5CMAA 1SGKA 1O75A 3E80A 1HIMH 4IRSC 5D96B 3ZT6A 2VDMB 2ADGA 3D2UA 5AOJA 3LY6A 3L4WA 3JVFC 3T09A 1S7XA 1PPIA 1D7CA 4NPYA 4RBPH 4FG0A 5LGJB 4FQJL 5CJQH 1K2DB 3DRTB 1BZ7B 1VIWA 1A66A 5EUOF 1PDKA 4FXKA 2CRIA 3TPKA 2NQ3A 3VDBA 2OI9C 4DP6X 5IFHH 5E8NA 3VXOB 1Q0XH 2EKSB 4Y7MA 3QCUH 2MOQA 2SODB 4NYLB 4H26A 3S96A 3AW5A 3TH2T 4A2HA 1T0OA 3QUXB 3KH4A 5EDSA 1NBZA 4GAGH 4K23L 2Q76A 4KTYA 1P69B 5D7KE 3TEYA 4HMDA 3VRLE 1OK0A 4XPBH 5FFOA 1U4EA 1M7DB 4QRPE 1XSJA 4MNQB 3RVUC 4U7SA 3SY6A 4MYWB 2EE9A 2NLJA 4JHAH 4ZTEA 3UC2A 4WUUB 5EIIB 1XCQB 3TA3B 4AUJA 3S98A 3EYVA 1RZ7L 2AK1L 4Z95H 1AIFB 4M02A 3RJQB 4CN4A 1AE6L 3OHXA 1MCRA 2KS0A 1AIZA 3ZSSA 3MXVL 3FUJA 2EIJB 1I7RA 3G5VB 3LQZA 4G7RB 2O93L 3I50H 4ZXBC 1B3JA 2WXHA 5DVPA 4D3CH 4MJID 1F02I 2F53B 4OLVH 3I84A 3E6FA 2E59A 5KSBF 2WXPA 3COOA 2VZ1A 3NZ8A 2Z64C 2IIJA 5D93C 2WLIA 3W56A 4P2QD 3V5KB 1MAKA 4J6IA 5GGRA 2B8OT 4EPSA 2I85A 4WJ5B 2HCZX 3I9GH 1R34A 3QWOB 4GKSB 35C8L 4KK5C 4TM9A 5GIRB 4S11A 2YQBA 5CEXA 1E5CA 3VXQB 2XQBL 1RIUL 2CNYA 4FTVB 3TASA 1U92A 2O1AA 1RZIB 1A3LH 3B9KD 4PI2A 4XXWC 3ZDZE 1L9PA 4ZFOA 3V0VB 2R2CA 2WUBL 4X5LA 3MBED 1EPFA 2MH4A 1L7TH 3EJPA 4BRVA 3NTCL 4HSCX 2NY4B 1WC7B 3NCJH 2D0GA 2HFFA 2VC2H 2OMTA 3QT2A 4G6JL 1AS8A 4N26A 4YPGA 3CFDB 1L0YA 4ZNEA 1HZKA 3LPFA 3RPIA 4HKZB 3KPPA 4IQHA 5AZEH 3WKQA 2XV3A 2PYEA 3O45A 4KK9D 1J8HD 2NX5D 4IRZL 5H2BA 4JY5H 3ALXA 4UAOC 2H45A 4PJ5E 4X4XA 3VFGH 1JN6B 4X6CF 2IQAB 2XN1A 3DSNA 2JNZA 4AMXA 4NQTA 5IV2A 3O2VL 1T03H 5T8IA 4F7EB 1NUDA 1O7VA 2BIPA 1QTYT 4ELDA 4OD2B 2ZT9C 2XVBA 2HJFB 2PR4H 3PQYB 3W0WA 2EDEA 2F8XC 1NCBH 1CFTA 1XGZA 3V79C 1BEYL 5BV7B 1ZEAH 1S5IH 3IAPA 4PEEA 5KYNA 1ORSB 4FI8A 3AREC 3GINA 4JK0D 3AY2A 1C5BH 3OC5A 4UIKL 2VQTA 3PCYA 2YAMA 4MA8L 2MCMA 4PWHA 1V55B 3X13B 1NINA 2IWFA 1T7VA 4DP2X 3NSJA 4XN7A 5L6YL 3NUKA 4TNVK 4APXB 4Y4KB 1LYQA 3N91A 4PJIB 4S0TD 1H8LA 5M7QA 3BXNA 1SYVB 1GC1L 3UMTA 1TLMA 2JELH 4QHLB 4MWFA 3F04A 4G6MH 3C08H 3NABL 1IM9D 2QV2A 4WY7H 2RA1A 5JXEA 3KVPA 4KTGA 4X8CA 2FX8L 2CGRL 1ZT1B 4JDVA 3A4EA 3MLVL 1NSNH 4JZOA 4Y4FD 5T3ZH 1ZPLA 3LQAH 4NN5B 4OW6A 5E4OA 3G5XB 3UZQB 3NQIA 1JPEA 2VDKL 3GUTA 5IREA 4OVUA 1IEBA 2FATL 2VW7A 4XE0A 2H7WA 4P4KC 2Z8VC 3PF2A 4PQXA 4KQ0A 1KXVC 4BFNA 2NY7H 4NBZB 5H35A 1GS7A 5DMYA 2DS4A 3SOBL 3KS0H 2YSSA 2C9RA 5KSBE 3FNKA 2H6UA 4HFWB 1MJUL 5TDOA 2MFNA 4HISA 1MLBA 5FHBH 4DGYL 3NP4A 1HL8A 2LAGB 2G3MA 4GW4A 4XB7A 1SN2A 3Q44A 1TZHA 3PWPD 5IQ9B 1HILB 1XSKA 3TF7C 1QUPA 1NFDE 3TO2B 4N28A 1AQMA 1RZJL 2OMYA 2UXVA 2DJMA 3BJLA 1VSCA 5FUCC 4PG2A 3ASWA 4WV1C 4P3CH 4WEEA 5JORB 2EIBA 3US0A 5LAXA 4Y4HA 3BO8B 2E46A 1MDAA 4UTBA 2FR4A 4UTAH 3FO0L 5K9QG 2MJWA 1JP5A 2M1KA 2R1YB 3PWVA 5I1AA 1K3IA 2HG5A 1J5IA 1CPUA 3FO9B 3WTSA 1Q9WB 1ID5I 2YEQA 5B21A 5KSUB 4JPSA 1EAPB 1MPAL 2HKFH 2ZWZA 3OGOE 4WRLA 4HBCL 2VDQH 4DK6A 3FTWA 2YEZA 3SDAB 1QA9A 4ELMF 1EHKB 2IDFA 2Y7QA 4N25A 5L88L 4GG6B 1ZK5A 4AGMA 5CLYA 4MJHA 2N0MA 2A9CA 2AQ1A 2YRPA 3LN4A 4LDOB 3X3GL 5I1GH 4YE4L 1JWUB 2ZD0A 3QDGD 3T8VA 4X6CE 2OYPA 3QNFA 4FXKC 5IQLA 1HZLA 4LSVH 2PYFB 4NJAL 2YJLA 4YIQA 4EI0A 4NGHL 1W0VB 3FT0A 2ESVE 1CLYH 1G1KA 3F00A 3MGTB 1ETJA 1G7JA 3I9AA 3PWLB 4NHCL 1JV5A 1U95A 3VW3H 3JZYA 4IJTA 2W60B 1K5NB 1TKWA 2EXSA 4A63A 3QARA 5ETUA 3Q8EA 4WEMB 2QVKA 4R3SA 4NBYB 3VWJD 4E9XA 5D1ZD 1BOYA