3NJNA

Q118a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 18
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njnA00
4P5RA 1PMYA 1NIEA 4G7SB 1PNCA 2WO2B 3X1FA 2TSAA 3ABKB 2VMJA 3EH3B 3OMAB 3UADA 4N4YB 2YARA 4W9ZA 1B3IA 3QJVB 3FSVA 5TK4A 2CCWA 1GR7A 3NSCA 1EHKB 2XXFA 4KOCA 2VM3A 3NYKA 1IC0A 1OV8A 5I6NA 2IDFA 5B7FA 2FJSA 1TEGA 1E65A 4YSOA 2BW5A 2PPDA 4G72B 1RZPA 4BK5C 3CG8A 4G7QB 1E30A 4HAKA 3UAEA 3UGEA 2GC7C 1NTDA 5B1KA 2PPCA 4HCGA 3KW8A 4QKTA 4E9QA 2N0MA 1SDDA 2AVFA 3UABA 1PZCA 1PLAA 5B1BB 1JXDA 7PAZA 1XB6A 4KO6A 1AR1B 1SFDA 3L45A 3PCYA 3IE9A 4JKNA 2WO3B 3NP3A 3ZDWA 2HX9A 1JOIA 1GY1A 4CSZA 5I6PA 1XB8A 4GP4B 2CALA 4NB7A 4PAZA 4DP8X 4YSDA 1TEFA 2FQEA 1V10A 4YSEA 1KYAA 1QLEB 1NIAA 1WA0X 4G70B 4Q8BA 1ET7A 2W88A 3H4HA 3WKQA 1E5ZA 1KDIA 3ASOB 4KNSA 4A68A 2UXFA 4RH4A 2FTAA 4BDVA 3AZUA 1J5DA 4DP7X 2OJ1A 5AFAA 4NAJA 4E9YA 2YAFA 1BXAA 5I6OA 1IKOP 3S3CB 4MFHA 1X9RA 2OV0A 2XU9A 1L9SA 2VN3A 3NJGA 4KO7A 2DWTA 1W8EA 1KBVA 1AZRA 3PLYA 5I5IA 5I6LA 1AG0A 1MDAA 2ZOOA 1BAWA 4AI7A 1BXVA 1NWPA 2QDVA 2EIJB 3H4FA 2FWLB 1E5YA 3TBCA 2BW4A 2VW6A 1BEXA 1FWXA 3FPYA 3S3BB 1TKWA 2YAMA 2OCCB 1XMEB 1J9TA 2IDSA 2HRHA 1VLXA 3AG4B 3S8GB 5PAZA 1RKRA 4YSCA 1NIFA 5I28A 4W1TA 3CVCA 3T6ZA 4YSAA 2GSMB 3OM3B 4JHVA 2HXAA 3AW5A 3CVDA 3NJIA 3NJMA 2H47C 2UX6A 1BQRA 5I5JA 4DP6X 2PLTA 4AZUA 2IWFA 2QT6A 3NSFA 2XXGA 3FS9A 2PPFA 3TBBA 4CSPA 3ERXA 2YXVA 2HRGA 4AX3A 2BP0B 3FU7A 1NICA 5I26A 1RZQA 4A2GA 5D4JA 1JVLA 3C75A 2GHZA 4A66A 2VM4A 2Y69B 4HHGA 1AG6A 3X1EA 3QJTB 1MG3C 3QQXA 6PCYA 3NJFA 1JZJA 2PCYA 4L0PB 1ILUA 2YXWA 2FQGA 3FU9A 4A2EA 2JXMA 1URIA 2I7SA 1PCSA 3WNJA 2GI0A 4A2HA 4DP9X 3CDZA 1HAWA 3EHBB 2BP8A 1ZIAA 2VSMB 3FQYA 1OOWA 1AZNA 2VW7A 2YQBA 1SHXA 4HALA 1AIZA 5I6KA 3SBRA 3V9CA 3WIAA 4YVNA 3N55A 3AG2B 3FU8A 4DPAX 1IBYA 2XVBA 1KCWA 3H56A 1N68A 1OCRB 2AZAA 1ZDSA 5TK2A 4E9TA 2GC4C 2IDTA 1KDJA 3CVBA 3TA4D 1BQKA 1KCBA 3SQRA 1CYWA 1OE1A 4WKXA 4HCIA 1ZIBA 2QDWA 4BXVA 4DP2X 2LLNA 4A67A 2XV2A 1YLBB 1CYXA 1GW0A 5B1JC 4HCFA 1ASPA 3V9EA 2XV3A 3WKPA 2ZXWB 2J55A 5EHFA 3SBPA 4E9WA 3T6WA 3WNIA 2NRDA 1ETJA 2BHFA 2FT7A 3QJSB 4K9JA 3FPXA 2EIKB 1FFTB 2FQFA 1SFHA 1OE2A 3ZIYA 2CUAA 3FQ1A 1ILSA 2BZ7A 3ABLB 1J9QA 1AANA 4HIPA 2VSKB 4HZ1A 1QNIA 3PXLA 3ZX1A 1SF3A 2P80D 4KNUA 1M9WA 2Y1AA 4YSTA 3UAAA 2IWKA 9PCYA 2ZONA 5FC9A 1ASOA 3NJHA 4YSPA 5D4HA 4BWTA 2JKWA 2IH9A 4HHWA 4P5SA 5PCYA 1NPJA 1X9UA 4BDVB 2PP8A 1AZBA 2H5UA 8PAZA 2IH8A 1NWOA 4PCYA 3X1NA 1JZGA 1ZPUA 1BYPA 4KNTA 3T71A 3KW7A 2XWZA 4NERA 1E67A 2CJ3A 2ZWNA 5A7EA 1J5CA 3IEAA 3FYIB 4GYBA 3AG3B 1PLCA 2VW4A 1A65A 1BXUA 2YAQA 3QJRB 2R7EA 1AS6A 3RYMA 4EF3A 1ZV2A 2PP9A 2MTAA 3MX0B 3QPKA 4UANA 4ENZA 1PNDA 1JXGA 4BWUA 1RCYA 3X2QB 5B7MA 2IAAC 4F2FA 1JXFA 4DP0X 4GY4A 4UAHA 2W8CA 1AS7A 1L9QA 3DTUB 5IY5B 4JHUA 3WI9A 1DYZA 1MG2C 4UF7C 3PAVA 3GYRA 1AAJA 1V55B 1ASQA 2BWDA 1L9TA 4AKQA 1MZYA 1JERA 1NZRA 1WS7A 3CZUB 4DPCX 4M4RB 4ZK8A 3S8FB 3AG1B 2WSDA 2DYSB 3PAZA 2TSBA 3OQRA 1QHQA 2UXVA 1CC3A 2X87A 4G71B 1JZIA 1AZUA 1NIBA 2X88A 1F56A 3CDZB 2UXGA 7PCYA 2Q5BA 3OMIB 1W6LA 5B1JA 1HAUA 3QJUB 4DP4X 2XX1A 1W6WA 3BVDB 2A3TA 3PAUA 4BXSV 3IN0A 1PZAA 2DYRB 4YSUA 2HX7A 4BWWA 5D4IA 3NJNA 4YL4A 1OCCB 3NP4A 4YVUA 3FQ2A 1ET8A 3FSAA 2EIMB 4E9XA 1A3ZA 2AFNA 1AS8A 1KGYE 1WA2X 3FSZA 3MBWB 2B3IA 1WAEA 2IDUA 1TU2A 2IWEA 3DIVA 1ID2A 2H3XC 1SDDB 1L9PA 1J9RA 3T6VA 2AANA 2DV6A 2J57A 2XYBA 2FQDA 1ET5A 3GDCA 3PPSA 4GP8B 4Q89A 1FA4A 4DP1X 4M3HA 1A4CA 2XX0A 1M56B 2EILB 1NPNA 2YAOA 1GY2A 1ZDQA 1XB3A 2XUWA 2R7EB 4AKPA 1WS8A 2CAKA 2E86A 2QPDB 3HEIB 5I6MA 1JZFA 2DY2A 3NJLA 3JT2A 4DPBX 3EH4B 2EINB 4TXVB 3SBQA 2I7OA 4F7KA 1PZBA 1OCZB 5F7BA 3UACA 2UX7A 5B7EA 3NJJA 5E9NA 3FU7B 3G5WA 1A4BA 2BP0A 3FT0A 5I5MA 1BQ5A 2J5WA 1MZZA 1GS8A 4KOBA 4KO5A 4GXFA 2FNWA 5ANHA 2FT6A 4AKOA 5LDUA 3AY2A 4G7RB 1AZCA 3D12B 3T9WA 1IUZA 2PPEA 4YSQA 2Q9OA 1EZLA 1J9SA 3IBOA 1PF3A 3S3DB 3X1BA 4FAAB 1NIDA 3EF4A 1PAZA 2BZCA 2HX8A 1SHWA 3JTBA 1L9RA 1OCOB 1AOZA 1BYOA 1HFUA 3HB3B 4E9RA 4YSRA 1DZ0A 2JFCA 1JZEA 1GYCA 3FYEB 4YSSA 1SNRA 4A2DA 1NINA 3ABGA 1GSKA 1AQ8A 2QPEB 4X4KA 2BO0A 2YAPA 1JVOA 4GP5B 3U25A 2XLLA 1KV7A 1ADWA 1JZHA 4WTQA 1UATA 1N70A 2PPAA 1KBWA 1PLBA 3ABMB 2DWSA 3OD3A 2HLEB 4N8UA 3X1GA 1A4AA 1A8ZA 5F7AA 3ZBMA 4A2FA 3WG7B 1T5KA 2HZHA 5B1AB 1GS7A 3NSDA 1L9OA 1CURA 3TASA 2GB2A 2I85A 1PY0A 1NDTA 3OMNB 3IN2A 4E9VA 6PAZA 1AACA 1GS6X 2CBPA 4E9SA 3FSWA 1R1CA 3NT0A 2YAHA 3ASNB 4F2EA 3BQVA 2GBAA 2GIMA 4DP5X 1SF5A 5AZUA 2UXTA 3NSYA 3GXUB 3DKHA 2AZUA 1M57B 2MRYA 2PCFA 1SJMA 1V54B 1OE3A 4FA7B 1IBZA 2IDQA 3TU6A 5AKRA 2J56A 3T6XA 2FT8A 3NJKA 3N2JA 2BP8B 2RACA 3EH5B 2BWIA 1CUOA 4KO9A 1OF0A 2PP7A 1I53A 3QJQB 4QLWA 2P80A 1WA1X 2B08A 2XV0A 5B3SB 2YAEA
chains in the Genus database with same CATH superfamily
1AC0A 4AWJC 1ZS8A 1P7BA 5E03A 1TTBA 5F3FA 1DFBL 2YJLA 1LM8V 4URTB 4YQXH 1IBFA 2ZKHH 4NQXA 3ARBA 1TR7A 4HJIA 2FX8L 3QJVB 2E7LC 2APWA 2IH1A 2F18A 2XQYA 5ICUA 4KOCA 3WE6A 3NRFA 1RJCA 1Z9SB 4Z7NE 3HR5A 4WIQA 5GHWL 1FNFA 2DQDH 3I9GH 2J4WH 1UASA 3ZSTA 4JO1H 4QJ5B 1E30A 1T2JA 1K3IA 3GBNH 1FV1B 2P5PA 5FV2A 3GDBA 4HCGA 2V2XA 5HD8D 5IVXA 4EIGB 4N3UA 3ILPA 4OTXL 4QKTA 43C9A 5EO1A 2XC8A 1PBYA 2VR5A 3AS3A 1INDL 4YE4L 1PZCA 5ACMA 2ZCHL 3VI3E 4LXFA 3MREB 5E51A 5AALA 3S98A 1JXDA 4XCYB 3P73B 4AGQA 2HX9A 5D7LD 3O6LH 3WUWG 1D5BB 1MFBH 1B4TA 3RVXD 4AQ1A 4YDJB 5F1NB 3DBXA 1AKJD 5I6XC 5E5MA 3H7BB 4NWTH 3VDAA 2X6AA 4XNUL 3ZQ9A 1AI1H 5D1XC 1KFAH 2I32A 4OCLC 4P4RA 1E5ZA 2IAMB 2WVTA 4XZUB 4NRYA 4QXTB 4LB8A 3BIBX 2J6EA 5KYNA 4OTXH 1KT2B 4KK8C 4BDVA 4N6QA 3AZUA 1AQMA 4S0TD 4F92B 3IETB 5F7WC 4WK0B 3I6LD 3WY2A 4G9FA 2DW5A 4LQFL 2D7MA 4F80A 4CN6A 4JHZA 2F53D 3WKML 4YXLL 2QJDA 4GQQA 2OV0A 4BQ6A 2LE9A 3TZVB 2XXMB 4ZO6A 3ME0A 4KY2A 1NDGB 2ZUSA 3VFTA 4APQB 3VD2A 1JN6A 4PS3A 4JFSA 1PG7X 1VZIA 2WIMA 4MWFA 2Z8WC 1S5IH 4XPTL 1CBJA 3QEHA 4M6OH 3PRZA 5CWSB 2CCVA 1U42A 5HDQH 5C08B 5D1ZD 4X4YA 1QFWL 3D06A 3I3EA 1VCAA 1TKWA 3MNMA 3BSZH 4OJCA 2YPLB 5T3ZE 3GMPB 4L3FA 4EDXA 3FB5A 3O3UN 3WTYA 3DX8B 5TDNA 4F9LC 1IT9H 2V5SA 2ICES 3UYRH 3UYPB 1H0DB 4M6MH 5B8CC 1KELL 3MV7B 1NBQA 4PS4L 1BGXH 4UM9A 1DJZA 1KCRH 2PLTA 1U8NA 1HH6A 4J8QA 3F00A 3NSFA 1A66A 3CFKB 2Q2LA 1J05B 1TYRA 2CRIA 2A6KA 1CFVL 3SOTA 1T4KA 5I30L 2YXVA 5JO5B 1R19A 5CJQL 1QSFE 4K5MA 2Y22A 4GAJH 4HIIB 3VFSA 4XVUD 5F3HB 3LB6C 2WWKO 2X38A 3QQXA 3W3BA 4AYEC 3KYKH 4B5ZA 3O41A 5TTRA 6PCYA 3NJFA 4I5BB 1BOGA 1B2YA 2X9XA 4RAUB 3IAPA 2R1WB 1G9MC 1ONQA 1DBKH 5I18H 1EO7A 1AGCA 4W9LC 4FNRA 2ZF8A 1PCSA 4GW1A 5CP3A 5JQIB 4UQ3A 4DFIA 3MFFB 2WLMA 3UTTD 2YQ2A 2IWGA 5CUSL 5B39A 3GM0A 4CVWA 4ZT1A 3W5NA 1U2HA 4S1SH 4MNQA 2AK4D 5E1AA 1AIZA 4X4XA 4LPYA 1NMBH 2K7QA 5DK0A 1NAKL 3LKSA 1A3RH 4GBXB 1UZ6E 3VFGL 3O8XA 3VAEA 4BE6A 5KVMC 2JI1A 4ZZFA 1B4JL 1T2QH 3SDYL 4PR5B 1YQVH 3KD4A 4W9JC 2BVPB 1MJUL 4C54A 1ES0A 1XCQA 1ZPLA 4KV5E 3QXTA 2A0LD 5JIMA 3UXFA 4L4TD 1T22B 1U8IA 2LFEA 4G6KL 2WYTA 4B9YA 1J0KA 4FQIL 1GHFH 4YLCA 3GSOB 4FI6A 5I1JH 3RVXC 1JZ3A 1AIFB 5HYJE 2D31B 1JZ5A 3ZLQC 3U79A 2ZPKH 1IM9B 1YEIL 1P4LA 1KCVL 4WZ9A 5HHPB 4FQQA 1NJ9B 3A67L 4X98B 2ZUQB 4KRMB 4KH2A 4E9WA 5HD8C 2Z1PA 2PR9A 1MCWW 4HT1L 4J6RL 1DJXA 5A2JH 2YN3A 3M8OL 5MEPA 1R3IH 3RGVB 4ZX3A 2EIKB 1DTUA 3L3HB 4YHKH 4HEPG 4HS3B 2VQUA 1SFHA 3R4DA 3D2UB 4LL9A 3UL4A 1LYQA 2VH5H 4FLOA 4UV7H 4XB8A 3VWKD 4FJYA 1JSYA 3MGTB 1F4XL 1QD0A 4HIPA 1LWJA 3SKNB 3V0HA 4IMLA 3MLYH 4FNUA 5D7SH 2FRGP 2WOYA 2QL1A 3V4VH 2JLPA 3QHFL 4H8HA 5JHLH 1G4RA 3KMDA 3WLBB 4JRXE 4QJ4B 4FYQA 1AGEB 2ADJB 1LK2B 3ARUA 3FMGH 4WFHD 4R4ND 2OR9L 2I60H 2EEXA 3L5XL 2XDHA 4MNQB 5D4HA 3RTQD 2AQ3A 4N0UB 3F65A 4XXCA 4WHTB 3VA6A 4UDUB 4C56D 2NSQA 1FNSL 4JDEB 1DQML 1GYUA 5E2VL 4RFNC 1EK3A 2AXGA 4E41B 5KSAB 2CHXA 1BYPA 4O02B 1ZWIB 4A7UA 3K6OA 4JFTA 5E94A 2OPCA 5KVEL 3VSUA 5CGYC 1IGCL 2LLGA 4L8SB 5FYKH 5A7EA 5JHDB 4F5CE 5F0PB 5EU5A 4Q52A 1TTFA 3MRLB 3U46A 5AENA 4NQED 2WINB 1PLCA 1WICA 4UILL 4ZUUB 3TCTA 1F6AB 2WXJA 4HSCX 1CF8H 5A43C 1A65A 1TZIB 1OSZA 3LNFA 4NC1E 3RFZB 3W5MA 1ZV2A 2HT2D 1QP1A 5ESQA 1ROCA 4OZFB 3VRIB 3V4LA 1JXGA 1I8UA 4PJEB 4D9QD 3TVMD 4C4UA 4EXPX 3JTTA 5B4MD 5ABAA 2VMEA 4AQAA 3SE3A 3LEVL 1BOYA 4OVVA 1U58B 1QLEL 1TQBC 1MG2C 1R5WA 3WEMA 4XP1L 4GBXD 4IIQB 4D0DA 1JERA 3CFBA 3ML8A 2MCMA 5AVWB 5I0DA 1BBJB 3ESVF 4ZK8A 5D1QE 3VUAA 4KQ3H 3T4AA 2Y9RT 4KUCF 3SDCD 1MHPL 3IMTA 4KWUA 3GB7A 2EKJA 5T33L 4G42B 5ICZA 1T66D 1DDHB 4NWUH 2VOTA 3MNWA 3VXOA 1P9MA 1AZUA 2L4OA 3K8MA 3KBPA 4UIKH 3WHXA 4YDZA 3JWOL 7PCYA 1YYLL 4PBVC 1BBDH 2XZAL 3B9DA 4LPWA 1FGNH 1NEZG 4PJ9D 3RNKA 3VQ1C 3ARXA 1FI8C 3SDDA 4PGJA 1MXGA 1QPPA 4KQ4H 4MA8H 4RGND 1JFHA 4L23A 1T7ZA 1GGCH 3L2MA 3NK3A 4R8WH 4KI5F 5F72S 2D4FA 1RUPL 4ZO8A 1AYOA 1MRFL 3NG5A 3FQ2A 4IMLB 2H1PL 3CVHL 3JVGC 3MLZL 4GKNA 3SY0A 1MCBA 1I7UA 4I0PB 3ZZLA 3ECBA 3V5HA 3IJ8A 5GZNC 1OB1B 3F8UB 3DIVA 3RY5A 3WUWA 3WLWC 3LH2L 3VXQB 2UUDK 4GKZA 4KU1A 5L2KE 1MCDA 4RAVA 2H7WA 2JNZA 2BY2A 3KLKA 2IANA 4Q89A 5IW6B 2Z4QB 4HIHB 1N7MH 4N2IA 4YGAB 1E5AA 4YMPA 1S9VB 2AEQH 5DJ6A 4QRPB 5AVTB 4D9LL 5ISZD 5ICYA 4Z76A 4Y2NA 1F11B 2PW2A 3WIHH 1JZ8A 4DEPC 3HEIB 3T6QC 3US1A 3C87A 4LRIA 5IMKA 3IU3B 3IDXL 3EADA 3QUYA 2VB5A 5DRZB 3OLGA 1KEGL 1FFNA 1NQBA 4HKZA 3KWTA 1B4LA 1E28A 1PZBA 4MNQD 1MCSA 4PW3A 4K94L 5MERB 2BNRD 4BKSC 3GMNB 1R24B 2X89D 4P2QA 5CBEB 1G5GA 1O6SB 5BUPA 3T2NH 5JW4R 3U0TA 4YHNB 4TM9A 5I5MA 4CJ1A 1OAUH 1EFXD 2DLHA 4N87A 3DTXB 3WNOA 2X4PA 2J43A 3FTGA 5GRWA 3VYOA 4N1CA 4P23A 4Z95L 4BSWB 2A73B 4IS6B 1NBZB 4QO1A 4U05A 2QADC 2UWEB 3IFLL 4XN1A 2VKXA 2ITCB 2A1WL 3FCUB 1PQZB 4JY5H 1T5XA 5I82A 1PF3A 2XTSA 1XBDA 2IPTH 1HQRA 3D1MC 4HDIA 3RWGA 3MUUA 2Q7NA 4R7XA 4X80L 3NEOA 3E6HB 3WYRA 4HH9A 4N26A 3I6GB 1GYWA 3OR6A 2R4RH 3BGAA 4ZMYA 2K9UA 2JKRM 1O9ZA 1A21A 5E99H 3QEGH 1ZA6B 3LD8C 1FE8H 5CSZB 3G5ZA 3CLFH 1LTXA 3FZUD 3US0A 2XZCL 1FRGL 4U1SB 2A6DB 2FL5A 3FTVA 2BSBA 1IQWL 2BSTA 2B1AH 4LHUA 1ZLSL 3WG7B 5DUJA 5E9AA 3ZHLA 3QZOA 3P77A 5IW1B 4TRPL 3ILQC 4HK0A 1EH9A 2CKBH 3TVMC 4QWWD 2AJZB 4OF6A 2HTLD 2P8MB 1KCSL 1U95B 1NCCL 3BAXA 3ZDZE 1CLOL 2R0WL 2E6JA 2VDRB 4ZNEE 4YXKL 2ZWYA 1U3NA 2VDLH 4R97B 3AAZB 1N2RA 4KXBA 1UQSA 2VL4A 3QFJA 3CSBA 2WUBL 4IIQA 4D0DB 4XODA 1HVXA 4WRLA 3FT2B 2R39A 4RIRB 4OV5A 2ADGA 1OE3A 1SY6L 4HAFA 4WUUE 3BUPA 3QFDB 2VN7A 5AOMA 2YRLA 4YEFA 1UM6H 4GG6F 1CDYA 1REIA 3HG1A 3B3IA 3HG1E 4G6JH 2Z8RA 3E9UA 3M6DA 2OZ4L 2NOYA 1DQQA 3MLYL 3QJQB 1YEDB 1ZY9A 3LIZH 1A5FH 1OT1A 2CJTA 1NIEA 2RALA 5I23A 3SKJH 2ZF9A 3ABKB 2FIRT 2VMJA 2WXMA 4ZS7L 4ZMLA 4PBDA 4J6RH 3BAIA 1OLLA 3DVFA 4L05A 5DJ2A 1I9JH 4U1HA 5JA8B 1RUAL 2VZUA 3SSGA 1SOQA 2G2PA 3QUZC 4BSJA 3M46A 1HWGB 1MIEH 3G9VA 4TKWA 4NNPH 1UOKA 1WBXA 3CG8A 3ILQD 5EBLA 4X50A 2Z34A 1S8DA 3ETBJ 1GW6A 5L2KB 2RIKA 4HWEL 4N6RA 4NQCB 1GVIA 2AK4E 1SY6H 2D0FA 3PWJB 5EEXA 3FCSA 5EMYA 1UVQA 1DVFA 1ULVA 4GG6B 5I1LA 1B9KA 4O51A 2CUHA 2E5EA 7PAZA 1Y6KR 4L29A 2VR9A 1RFDH 3U0WH 4JKNA 2J6WA 3AWGA 2E8ZA 3ARPA 1SJHA 3TA3B 3FUJA 3DVNB 1LE9A 5I6PA 5A2AA 2CALA 5DQDH 4PAZA 1TEFA 3UDWC 1P6WA 4LHQB 3OKMA 5HHQA 1OPGL 5BNXD 2QMKA 1T89A 5I73B 5CU9A 2OTWB 4R0LB 1UZ6F 3OSKA 4IOFD 4X4XB 5ICXB 3RGHA 1QI4A 2VSDA 3IDGB 4QTIH 1DQJA 3ZKMC 5I8KH 1XH2A 4LO9A 4KQ0A 4TUJA 4LHUD 4JPIB 3RPIA 5J6GA 4M62L 1LP9A 3FW6A 1XGZA 1VFAB 2NT1A 5HHPA 2VZSA 1RK1A 4RWHA 2WQXA 1FRGH 4UT6H 3BZEB 2MOGA 4PJBE 4XBEL 3Q01A 3KL0A 3RIKA 4I48A 4R5VA 1M1XB 5DFWH 4HJTA 1BXVA 3Q2VA 1DVSA 2A6KB 4WUUA 3TBCA 2VJ8A 4D9QE 3S3BB 2BNUA 3C5ZA 1TQBB 4BZ2A 1OT2A 1A3LL 1FZMB 2ZIDA 3UTZB 1U2YA 3BESR 3CFCL 3OKEB 4YHYC 3MLVL 3PHQA 3OM3B 4U6XB 5FDWA 1DUZB 4W9EC 5TE4H 5DVLA 3RTLA 5EEWA 1CFNA 2VXUH 4WEUD 5DS2A 2XN9B 2WWMD 2CCLA 2I9LA 5B39B 3OGOE 4AEFA 4PY7A 3BSZL 4NHUB 4PD4J 3HI5L 4BKTC 5IOKA 2J73A 4UBDC 1HDMA 3MRIA 4L3CA 4ZTOH 1RULH 2PXYC 4JY5L 3MNWB 3BP4A 1K8IB 2VN4A 4CJ0A 1NSNH 2FLRT 2DS4A 4LAQL 3GB7B 1R5IB 2C3WA 3VXNB 1OOAA 3OKMB 4FQCH 3MV9E 2C9QA 2OAAA 1DZBA 4XWGH 2D7TH 5C9JA 2ZUTA 1URIA 4ZZKA 1U8OA 2LAAA 3NESA 2AJUH 2PTTB 4J39A 3ZTNH 1A1NB 2HP4A 1ZHBA 4LLDA 3GC3A 4DVRL 2ZAHA 3HMXL 3UP1A 2XCMC 2HT2C 1AGFB 3D69B 4FHKA 4UUJA 1BAGA 5I6KA 1GA2A 2X4NB 4W6XB 4M9OA 1ECZA 3G6AA 5C8JB 2BIMA 4LCCC 3DX9A 4DQOH 3CSPA 1JHTA 1WWBX 2WO4A 5FYKU 1PVHA 1V3KA 1TZIA 3UO1H 3WAJA 5ENWB 5F93C 4KX8A 1AO7D 3CK0H 2M26A 3ULUE 2DZEA 2GT9B 3PWPA 4Y4KD 5MEQB 3TA4D 3ZUCA 4MDJB 2OZ4A 4LCVA 1OE1A 3MOBL 3NSXA 1I8MB 5IKCA 3FO9A 3K6IA 1DLFL 1J8HB 1UWEL 4FN0A 5I1DB 4DCQB 1EZUA 4A67A 2C9VA 2OX5B 3BAJA 4OAWA 1HU8A 4L1SA 3BPCA 1GYVA 1J0HA 2XWBA 1FPTH 3HPJA 3IF1B 5LBSH 2QADB 4A6YA 2EACA 1I1YB 2CK0H 3CQPA 3GQFA 4V1DB 5MHSD 1U3JA 2F7QA 5EO0B 1F1GA 2YRZA 4TTGA 4XX5A 4Y1AE 5ID1B 4EKXA 4U6TA 5JTWA 5E1IA 4FTVE 3C09B 2CLZB 2XZAH 5K59E 3QDGE 2BHFA 3I6KB 5FHAL 4X9IA 1MWOA 4XO3A 4WHYH 3VXUA 1FHGA 2X53A 4M1GH 1G43A 1NMCC 4M5TA 4TPRL 4WNQB 1BLNB 5BZZA 1TCMA 2I27N 2AF2A 1ITBB 1QSVA 4XPBH 1INEL 5GGVH 5IQMA 1FG9C 4MKMA 4HPOL 5E2UL 2N1TE 2ZUYA 4Y1AD 4Z1PA 3K72A 3MCKB 2WBKA 3VGAB 3CXHJ 4JPWH 3FHQA 1WWCA 2WYZA 3QDJA 1FO0H 1CFQB 1EEZA 3QXDA 3S36H 4MAYB 4FL4C 4BFBD 4LEBA 4PV1C 5DUML 4OLWL 1CBVL 5AYQA 2JI2A 1LP9E 4K23L 4UILH 1IGTB 3VRLE 1K8DA 1JHLH 3ETBF 3CFTA 1IM9A 2A99A 4DETA 3VW3H 3QQ9D 3WDHA 2MCAA 4IRSB 1URLA 1QRNA 1NWOA 4DGUA 3L1EA 3BGFB 4Z3TA 3KBEA 4E41E 5BQ7A 3BUBA 3R18A 5J6HB 1TPXB 1S9YB 3BZEA 1ZA6A 3LZPA 4UCFA 3SGEH 4NQXB 3BI9X 3FB6A 1MF2L 2BY1A 1UWXK 4GYBA 1FSKB 3BW9A 3EGDA 1KMGA 3UOAB 1A7QL 5I0XA 2YR3A 2H41A 4XZ4A 5FYKL 5E5UB 4Z0BL 2IPUG 3QJRB 4M1DH 4YFLI 3TBWB 5K9JH 3RKPA 4DKEH 3KPMA 2BOCA 1IAKB 5E2WL 3QPKA 3H1ZA 1UD8A 4OZGA 1A2YA 4YNYB 3E8UH 3GBDA 1JFQL 1HNGA 1NGQL 2Q76A 1UKTA 5KAQG 1E9PB 1NKGA 1IIIA 1VFBA 3X11B 4Y16D 12E8H 1HHHB 3GSXB 2J8UF 2N7AA 2ZD0A 3AMKA 4I9XA 4I9WE 1C1EH 3C9NA 4HXAL 1X6NA 4GFTB 1I9RH 1X5IA 4EIBA 1M1SA 1X5XA 3OB8A 4L29B 2ESVB 3M8OH 3D0LB 2IFFH 4TQIA 4Y9BA 1UGKA 3AG1B 3U9UB 5I74B 5D1ZB 5AAWC 4F24A 2CKBL 3BPOC 3SGDH 2NY3C 1ZA3A 5F3HA 3ZL4L 1N64L 2XFXB 1JZIA 3A67H 2OS7A 4MQTB 3CX2A 4NCC2 5I17A 3VFUB 3TBYA 4GLRH 2D03L 3RFZC 2OL3A 3LXAA 1QG3A 4RFOL 4HT1H 4Y16A 2VXVL 4WI7A 3BP7A 4I2XB 5DHMC 1INQB 3F04A 1PZDA 3G04A 3VGEA 4BXSV 1LE9B 1FNGA 1V8HA 3OAUL 5LGYA 4KNQA 4Q9QL 1E7VA 2O93L 5IW6A 2ZPKL 4YBHA 3VXRB 4GKLA 4QR7A 1JPSH 4JDVB 3KVQA 5TDNB 2EIEA 3DBSA 1UURA 1PCXA 2Y5QA 3A22A 1J86A 5EZJB 4XN4A 3TNNA 4Q0XH 1EV2E 1W72H 3W57A 1DVXA 2IWEA 4XXCC 3MU3A 3RWHB 1J9RA 2DV6A 3HZYA 1T89C 3GDCA 2EDWA 4DP1X 3CBKB 1PYWB 5IHBA 2VWEC 2JIXA 2AI0L 1JTPA 2ZKYA 4Y19A 3O6FB 3QDJD 2XQYG 4UNUA 4PLKC 4V11A 3V0IA 3ULVH 1T2QL 2H2PD 3NDZE 4KJQC 5DQ9B 5C0AA 5JIKA 2MMXA 3U6XA 1A4KB 4DIXA 1XF5A 2QPDB 5L0QB 5KYXA 3NJLA 3BEVA 2A5UA 2AEOA 3RWDB 4PW9A 3FCTA 3V6OC 1CDJA 3BVUA 4MAYD 4WHCA 4Y88A 1TQCC 2QVMA 3C6LC 3RHWF 5K69A 3FAXA 4PBXA 5D1ZC 1ZKAA 2ATPB 5GGRA 3SYAA 3VD1A 2AJXL 5KBKA 2OTUB 2YD3A 4DAGL 1HXYA 1ODUA 1A7OL 4PRHE 1UWGH 1KB9K 4P57B 2R2EA 2VDQB 2Y1ZA 1NFIA 2EDQA 2AQNA 2C8NA 4F57L 3O4OC 4RMRA 1TVBB 4NOFA 4AVHA 2D3VA 3H7BA 3SPJA 2AEQL 3AM8C 1BQHA 2FNWA 4X6BA 2JIXD 2FT6A 2VISA 4XCEA 2NTFA 3KYKL 3FRUA 3NFPB 1MQ8A 1CL7I 4GAYB 3L5HA 3KG5A 3H53A 2AAVA 4U1LA 2QSQA 3QSKB 4JZNB 5I30H 1JZ4A 4OCXL 2J1WA 1JZ2A 4QY8B 4Q9RL 1A14H 1L9RA 2NUPB 4JX0A 4JGMA 2J1YA 3HB3B 1AOZA 1CE6A 3II1A 3N44F 3FRPA 1JZEA 3VTTA 25C8H 2B15A 4WCYH 4WTZA 3TO4C 4GUOA 1DVFB 4GP5B 1KB5B 3HBPA 4K7PX 3BZFB 4X6FB 2ESVD 2BNRE 1BZ9A 1AZZC 3LY6A 1O6SA 3MRPB 3X1GA 4Z7WB 2ZSWB 1N8OE 3CPUA 5BRPA 1XCTB 2YK1H 4JHWH 3V8OA 1K6QL 3MV9A 1NLDL 3NAAL 1QBLH 4FFZL 4C55A 4UI2A 3NTCL 3R4RA 2FJHB 1KGUA 4ZQKB 4AXWA 1T1WB 3NA4A 4OH2A 1IGYA 1LDPH 4E9VA 3GNML 5FLVA 3GMMA 1SXSA 4P2RD 3LKOB 1P84K 3LXUX 5EDSA 3GGWB 4Y9EA 2Y36L 3ARFD 2VAAB 2DQUH 4Y4HA 2F53B 3JUYA 4MAUH 5H35B 3T4AC 4PWEA 2XWTA 1L0PA 3RGBA 4IBVA 3TZVD 4JQIL 4W9CC 1BWMA 3PL6A 5IB2B 1LEIB 1GMEA 3PHSA 1PIFA 1BJ8A 2UXTA 3OR7B 1TETH 3AACA 5FYJE 4EI6A 4POZD 5F0MB 2O6CA 1KB9J 2BIPA 1QBMH 1EXUA 1OZTG 5AW7B 3D18A 2YKKA 5AKRA 1ZEAL 5KSVA 4U6HA 4BM7A 3U7AA 2QPFA 2XQBL 4KO9A 4I4WB 5SX5K 5KAQF 4R3SA 2PP7A 3KNBB 1RZ8A 3TVMB 2WWMC 1NC4A 2ZOLB 3N9GL 4M3JA 4OR1A 4QLWA 3OXRA 1GGBH 4QT5A 4K2UL 2VABB 3J2PA 4QHUB 5T5FL 4LAJH 3RNQB 3CNKA 4DKDC 4NFBA 2PTUA 4JZJA 4XBPA 5B39G 3GUFA 1VGEL 4UT7L 1T3FB 2CSPA 4IKIA 1VAHA 4L3AA 4EI5B 2J6EL 1E6OH 2WYIA 5IQLA 2DQDL 1VACB 3DIFB 2NY1C 4B6ZA 1SM3H 4HUXB 3OKDB 3QHFH 2IDFA 3IJEB 3FN3A 4BK5C 1AXTL 1SJHB 4DCQA 4KZDH 3Q5OA 4WO4A 5IROA 1ZT7A 2VH5L 3O81A 2M83A 2F7IA 3HZYB 4I3RL 4Q2ZB 1F3DH 4XN2A 3BVXA 1YYCA 5FGBC 4HMDA 1A64A 3EFDH 4FNSA 4MMXC 5D1XA 5B1BB 4O9HL 1BBJA 4IU2A 1ZANH 4N2BA 2VC2L 3IE9A 3MFFA 2GAZA 4U33A 1J0ZA 1X3DA 4HPYL 3PL6C 4IHOB 4BQCA 2LU4A 3HB3D 1KGJA 5AKSA 5DMGD 4ZX5A 1W8OA 4GPVA 5CEZD 4NUGH 4XB7A 4F27A 1UYWL 1S7TA 3IJYA 1DLHA 3BGFC 5I1GH 4ODWB 2VE6A 3G5YA 2IH3B 4X2UA 2YQ3A 3CDGB 1JWSA 4UOW1 5CIPB 4JPSA 1G1OA 4PRPE 2JJTA 2FWUA 2UWEA 4XT1C 1OPOA 4NAJA 3BEVB 2Z7UA 1FL3A 5CILL 2A9CA 5HGHB 5MEOA 1HOCB 1X9RA 3STLB 3X3FL 1XCXA 2C4FU 3MJ9A 3MNVB 3LTVA 1F97A 4XO8A 4F7CA 4UM9B 1W8EA 5FX3A 1HH9B 4QRPE 5I5IA 4DKAA 4Z7WF 1AG0A 3PXHA 1FZJB 2VQ4A 2PCXA 1OSYA 4JZJB 2Y7OA 5CSBA 5KBLA 2A9DA 4HIXL 3T8VA 2WCGA 3TH2T 4XP4H 4BFEA 3QQ3B 2BVYA 2ZOLA 3RU8H 1U9KA 2R29H 1MHHB 4BUQA 3K6NA 2J8HA 1MHEA 4K3HA 4CSTA 2ZXAA 5C3TA 4KFMA 1S78C 4QOKB 4S1QL 3VFTB 4APQA 3GMOB 4QRRD 5GGQH 4R5XA 3QFJE 4YHLH 3KJ4B 4X98A 4FA6A 2R2HA 1R5VB 3VNYA 4JO3L 4XMUA 5EULV 2R51A 1D5MB 1N8ZA 4JM4H 5DRNA 5IB1B 1E0OB 3MV8B 4FP8L 3V0AC 3TBBA 1KIUA 3ARGA 3ERXA 3AXLB 3V10A 2KLTA 2X4QA 4KKLC 4QTFA 2DLIA 1VFUA 2HWZL 2OTPA 5J1SC 1QWHA 3RE0A 4C56B 3IK2A 4HHGA 1MFEL 4CMMB 1AP2B 3L7FB 3CQQA 2JKXA 4K3GA 4L0PB 4NN5C 2UV3A 3N50A 4XNMB 2IAMC 2WQUA 1CXEA 4FQXA 4G6FD 3MV9B 1T04B 3GO1H 3WHXB 5IMMB 4MYWB 4PG9A 1ZLVK 3EXLA 5HYJD 4NKIL 1YEJL 2A9NH 5IHWA 2NCEA 5K39B 3X11A 4GQZA 1EEQA 4A37A 4C56E 5E8DL 3CC1A 4XPAH 3QAZB 5HDOA 3SGJA 1RH8A 5I1CH 4YVNA 1A6WL 2AJSH 3AG2B 4MTMA 3SDXE 4Q4IA 1SN0A 2WLNA 4MJIA 4L4JA 1L9MA 4H44C 4NZRL 2NUPA 1NBZA 2RH0A 3I3DA 1HTYA 4F7CB 1CVSC 1I7RA 2X2UA 4OZGE 1NUFA 2OJZL 2QGEA 3BQUB 4QXWA 5CGBA 2CWRA 5F0LB 4WI4A 5T3XH 1IVTA 4N1EA 3MX0A 3PGDB 4GW5A 2XY2A 4DP2X 5AG8A 3OZ9L 2GJZA 3UZQB 4NQDE 1BCIA 1BQHG 3KPSE 3N1QC 2TAAA 4XC3H 3M07A 1ONQB 3MQIA 3WXVH 1CK0L 4JFFB 5BRZB 4ZTPL 2KQNA 2VQ1B 2XWRA 1F11A 2DKSA 4TNEA 4ZPVA 5DR5H 3ARQA 4HUNB 5EHFA 2P47B 4ZOBA 3ILEA 4F8TA 1EIBA 2WTRA 1VRSA 3QJSB 1O7VA 3BEWA 4ZTEA 1NDMB 1TCRB 3SQOL 7FABL 4UM8B 3ZIYA 3NVQA 5I15H 1HH6B 4P4KC 1MCKA 4LLVA 1NGWB 1Q1JH 3EGXB 5FK9A 1OAQL 3UEQA 4IU3B 4RISH 2H26B 4OD1L 3ZX1A 1A6AB 1XBRA 3I9IA 2Y1AA 3BMWA 5E00A 3ZRSA 3ULUD 2DMCA 4LPTA 4OB5L 3LNDA 1Z3RA 2R56L 2J2ZB 4P5TB 1U8PB 2GK0B 5H37G 1NCBH 5E2WH 3MUHL 3T0AA 1MI5B 2F54D 2WZPD 2IFGA 3SGJC 2XWBB 1OF2A 4NCDA 3K80A 4HSAC 1C08A 1X9UA 2OL3L 4X0KB 1UUNA 5KBNC 3X13B 1MNNA 4Z3FA 2PNDA 2ZWKA 3CDGA 3EOYG 4PTTB 4MCZA 2EDYA 8PAZA 1BZ7A 2OMBA 2ZX9A 3BP4B 4GRMA 5KVFL 5DUBB 1X5GA 3ALXA 4WJKB 4CVZA 3I02A 4XHQA 2CGYA 5F1OB 1ZHKB 3ZKSD 5BXFA 1HT6A 2K3HA 4QXUH 1IBDA 2A9AA 1RU9H 4Z7NF 1EFXB 3VW3L 2KDYA 4Q9RH 3MRBB 4AQZA 1ZD6A 5C6TL 3GTVA 2BSTB 4LHUB 4LRNL 3MX0B 4FNLH 1G9NH 1PNDA 5ID0A 2XFXA 4LEEA 1NFDB 4YX2H 3MREA 3QWOB 5IB4A 3C6LD 3QORC 1PZSA 2Q2EB 2BY0A 1KC5L 2UVFA 1CIUA 1XZ0B 4FXKC 5HJ3A 4PWIA 5ANMB 3OR7A 4LHUG 1L9QA 4Z7IA 4JHUA 2CBTA 2AEPH 3T8XB 2TRHA 4NNXB 4UF7C 3CJJA 2Q7AA 2GPZA 4UB0L 4GG8A 4JKLA 2X40A 3CZUB 4ZUUA 3RL2B 4K8RC 2FR4B 1IAOB 2YIHA 2FLMA 4OIAA 4RAHA 2TSBA 3HW7A 4Y5YB 2W60A 3X3GL 3CZJA 3UCQA 5HHVL 1U41A 1BMZA 4PJAE 5IQNA 1T5XB 2WUCH 1XF2B 2BM3A 3WNLA 4XNXH 2WSPA 4U1IA 4G8FA 4GMSL 2NY6D 1HAUA 3CFUA 4HV8B 2YBGA 2XX1A 4C59B 1KY6A 4JVPA 2WQVA 2NW3A 4M1CD 2IQAB 4QT5B 5IOPB 4P23C 4X9HA 3PDOB 2Z92B 3W1ZA 5HHOA 1HOEA 3DWTA 5CBEA 3ARBB 3EZ8A 4BWWA 2R15A 4KK5D 4XR8C 5H2BB 2ZWLT 3GKZA 1W72L 4OFDA 4E9XA 1KCLA 4Y4FC 4LP8A 3QUZA 3MRMB 4L8DB 5LN8A 1WAEA 3REWB 4ZMNA 4OLVL 4ZFFB 1K5NA 1CDIA 4I1PA 2IBGA 1H3XA 4F20A 3O2DA 2XYBA 1NFDF 4TYUA 4FMKA 1B2WL 5K5YA 4J3TA 4NZ8A 1CDUA 4ZAKD 1ZDQA 1MHHA 3U7WH 1D7CA 4XVTH 4OLEA 4M1CC 3KH4A 1BQHB 2OBGA 2NNXA 4J3BA 3JV4B 3ROOB 2EINB 2OMVA 3AWFA 3SBQA 3LPOA 4AQEB 3QO1A 1MI5D 2F6AA 4X5WA 3V6FA 4CBPA 4H8PA 4Z7WA 1MVYA 1WFOA 5HI5C 1LO0H 4GAFB 4EJ1C 1M05B 2WWNA 5EOCJ 3D87B 2AJSL 1N4XL 3KVDD 4PRNB 2QQNL 4XPAL 4P5KA 4KO5A 3IDMB 3O3BA 4Y2LA 5DQ9A 4KHXL 3DV4B 3IXAB 4JQIA 4KK8D 1J8HD 3D12B 2XPYA 1IRAY 3NIGF 1XH3B 2Q9OA 2W1NA 4Y4FD 2DTML 1IAMA 5GJTL 1GJUA 2QPUA 1W2KT 1KTLB 3ATAA 3BE1H 2HX8A 3RVVC 1UZ8B 3TFBA 3CSGA 4XOCA 2AEIT 3JTBA 3AY4A 1TQCB 3C6LB 4OKVA 3K0YA 1UQSB 4G5ZL 5EOCL 3AXIA 4A2DA 3DO3A 3UCRA 4JUSA 3BT2L 5DJYB 4R26H 4X4KA 3U25A 1AKJA 4PJAB 5A3IC 3FONA 3IFOA 2A0LC 4WTQA 2BSRB 4O58H 1TT6A 3AITA 3RVUD 3GSRA 3Q0HA 4YDIL 5EPMB 1MEXH 3FAWA 4Z7OF 4WW1B 4G6AD 2J20A 2JJSC 2CA3A 3KPSB 1QLRB 4OZ4B 4PLJD 5DC9B 2EYTB 1G9HA 2OL3B 4UTAA 4K3DH 5B1AB 1KXTA 3ZE2E 2X4SA 1WGVA 4GW5B 4A7QA 2ENPA 4JFQB 4JRXA 3MO1B 1U8NB 3PP3K 3BISA 2EH8L 4LOUC 3B2MA 2ITDB 1P7QA 3QORD 4YDVA 3IDYB 4ODSL 1B6DA 1R3KA 1WAAF 4JFEA 1UA3A 4NSKA 4K7PY 5L7XL 2O26U 3QI9D 1L3WA 5F70A 2JMRA 3H3BC 4AMKL 4LCUB 3VU2A 3ZDXF 1DVFC 3RVWC 2R0ZH 2OYMA 3FT4B 2EJ1A 2X3CA 3UYOD 3L3GA 4HUVB 4Y8DC 5F7LB 2PYED 3N3EA 4PB0L 1S7WB 4OI7A 2H3NB 1XGRB 3KPOA 1YQ2A 2FH6A 3TU6A 2R0ZL 1SOSA 1NCJA 2FT8A 3NJKA 4FOMA 2N01B 1YMHB 4JRXD 1J0YA 1CUOA 1U2CA 2OSXA 3ZKMD 3BQUC 4F8QA 1F4WH 3EYOA 4I9WD 5F7YC 4Y5VA 1UXSB 1KZYA 4XCFL 1TQUA 5BOPA 4P5RA 4NNPL 4EUPA 3X1FA 5DA4A 2DH2A 4TUKH 1NOLA 5FFGA 1A25A 2FATH 3E6FA 5IQ7H 2JKNA 2P43B 4GAAA 2VC2H 4OZFG 1FHNA 2CDFA 5EN2B 2X0WA 4Q56A 4FQQB 4XP5L 5T1LA 4FJ6A 2WV3A 1BVNP 4YSOA 4YFEA 4LGSB 4NGHL 1WBYA 1Z9PA 2A6IB 1J1OH 2B59A 4MLIA 4OJFH 5C97A 4G6JL 4G8IB 4GKZB 4UAOC 1OSPL 3BZFA 3U0PB 1MCOL 1PLAA 2AJUL 3BMVA 1W91A 4XHJC 1A2YB 3SQBA 4I3GA 2C9RA 2WO3B 1GY1A 4HJ0D 3NUKA 1EAPA 2CRYA 3CFIC 3HKFA 1VIWA 2B0SH 4TVPE 1C7TA 2OXHA 3M1CA 2K9FB 2RQEA 4NO3A 4Q8BA 4KUCD 3RJDA 3OJDA 3FFCA 1QSFA 4ALAH 4YPJA 3RB5A 1AO7B 2YPLD 1II4E 5HHXL 2XKSA 2GEEA 2RCSH 2C3GA 3WEAA 1WO2A 2FAUA 5F9OL 4TULH 1Q38A 1VPOH 1HESA 3D25B 2YKLH 1L9NA 5EV7A 1EHNA 1K72A 3F6IA 5FA3A 3QZWB 2D3JA 4PGZA 3LCYA 1DBBH 4NM4L 4WENB 4AQOA 5KSUA 1CGUA 3L2NA 1KBVA 3K2UH 5I6LA 2X4TA 3MUY1 1FYTD 4GLRI 1BAWA 1J8RA 3GRGA 3QR0A 4ONHA 4WW2C 5E4EB 1CMOA 2JELL 3S35L 1E4KA 2C4XA 3L3OA 3QZMA 4RSYA 5A1AA 1ZGLB 5SWZE 5JXAL 1FWXA 3HMXA 1NKRA 2N0KA 2LU5A 5DRWB 4YC2B 1VLXA 1WAAE 2APVA 2AC0A 3SCMB 3B83A 4Z7QE 1GRWA 1P6FA 4UAOB 3CVCA 4FQ1L 3NAAH 1QPKA 1BLIA 4KTGA 3NJMA 4OBRA 1BQRA 5EO0A 1Q0EA 1NC4D 5DQJB 5LDSA 4Z7VE 1T0PB 2IWFA 2WC7A 1KV3A 5E4IA 2XBDA 1UACH 2K4WA 2ZYRA 1XVSA 2E7BA 3BVNB 4WCYL 2EE2A 5B38G 4L4TA 2B39A 3X1EA 1I8MA 4PEEA 4JFHD 4IBLT 3BCFA 1OF2B 4J12A 3UTSB 2X1OA 1MVUA 1AJ7L 1FGVL 2DQIH 1G6RH 2DQGL 3WTUA 1KYOK 3MBEA 1DQDL 1HILA 4DOHB 1RZKH 1S46A 4KKAD 4AV4A 5ITFA 1N6QH 2J21A 5DEZA 3STZB 1WWAX 2B7DT 2X6UA 3TVMA 4FQJL 4UB0H 3VFVB 2L3BA 4F7EA 4LASH 4YL9A 4B0MM 3HMXH 3BRFA 3LN4A 1KSRA 3BGMB 4IM8A 3WIAA 3ESOA 4FTVD 4UMSA 2WLLB 2D7TL 1TQVA 4WW2A 4JFOB 4W6YB 4BQBA 3A24A 3UTPE 1A1MA 3WAKA 1YJDC 2GC4C 1QMUA 3MC0A 4PIRF 1KDJA 1V7NL 4BUGA 1BQKA 3SDCA 1NSNL 4MS8C 1CYWA 1JF1B 2J71A 4NN5B 5BOZG 3HG0A 5TQ0H 1BZOA 1WZ1H 3GRBA 4OZGB 4YNYA 4JFFA 5KJRH 5CGMA 5ACZA 1UKQA 1DN2A 1GGCL 3IB4A 3HAEG 3GBMH 4AUJA 3V6OE 3QDMA 1KIRB 4KKCC 1Q94A 2CRZA 5TPWH 4W9DC 6TAAA 4EZMA 2HJFA 3SB3A 2MPAL 1U6AL 1Z9SA 2QV2A 4Y9CA 2VLRD 1MAJA 2N7SA 1BREA 5IMOA 1MWAL 2J55A 3VFOA 3ZT6A 1S9KC 1KCKA 4U1IB 4HK3N 2D2OA 1D5XA 3ARDD 3FSOA 4NENB 4LPCA 3LMJH 4IKKA 1IARB 3RWFB 4E41D 1IC5L 1QW9A 4B95C 3MFGB 4M5YL 4NQEA 3ESPA 4LVHC 1Q9WB 1RJLB 4V2CB 2DM3A 1RK7A 5J06A 3F7VB 2CNZA 1QBAA 3T77B 3TJEH 3BFOA 4CN4A 4OW6A 3B5HA 1F4YL 5JPNC 5C08D 3VYNA 1OD7A 2NX5E 4XVSH 1AANA 4HZ1A 3ARGC 3VB9A 2YEVB 3DXAB 1XZ0A 5HJ3B 3UAAA 5KANI 1CDBA 2FO4A 2WN2A 4XHJD 1R3JB 2F5AH 4IOIB 3L5WA 1EFXA 3M88A 3MBXH 5BOJA 4HC1L 4RRPA 2AXFB 5J8OA 3O6FD 1CR9H 2GJ6E 4HHWA 4TMPA 2CDGA 1OP3K 1ZSDB 3OHXB 1ZHKA 4PUBH 5C07D 1WD8A 2YZ8A 4PCYA 5CEXA 4G5ZH 1MFUA 2A9BA 5DZOA 4MXQD 2YMOA 4YAQA 1F58L 3H9SB 3UTSE 3QRGL 5ICXA 2CH8A 2DRUA 2P44B 1SOKA 1JYNA 3FQ4A 2ZG2A 3FCTB 2VGLM 1YPZE 4JKPL 2I9TB 4PJGB 1DL7L 1VENA 3RWEA 3FRPG 4IRZA 4K9EH 3H6JA 3AREC 4Y2DA 1KTDA 2NCMA 3FBQA 3HS0C 4NRXB 2JIXB 4BQ8A 4F3FA 4YZWA 4LESA 1KY7A 4P9MH 4U31A 1CLZH 4O51B 2GTZB 1A6AA 3IXTA 3LV3B 1ESOA 1ND0A 3DX8A 1R17A 1HYSD 3ZDYB 4L5FE 4X5XA 5AAPA 5H4ZA 3P4OA 3FCBA 4WK2B 4XB3A 2GYSA 2WJ5A 1FFPB 3HE7A 1JCKA 5EZJA 1MIEL 1UJ3C 2FJFA 5JPNB 4OT1H 1EHLH 4LPVA 1RUAH 4K8RH 1FFOB 1WS7A 5LAXB 1TJXA 2IALB 4Z7WE 1UUSA 2VLJA 3RTQC 4RBPK 3UMNA 3PJNA 3D8MA 1N0LA 3I75B 4NLAA 4XMPL 1WC7B 1KXTB 2AV7B 4JLRB 3WIHL 4DP4X 3BVTA 5FM4A 1W6WA 2Z4TA 3B2UD 3H6AA 4YDLC 5DJ8B 3JQOB 5EZPA 3ECWA 5ISZB 1G4MA 2VE6B 3CFKA 2OZ4H 5CZVL 5DJZB 1PZAA 2Y5EA 3QXUA 3K46A 2A6JA 3IFOB 1MOEA 3ZHNA 5C0IA 5AWNL 1B2WH 2W9EL 2YQGA 4J3SA 1E4WL 1KIQB 4DK6A 1QEWA 1IGIL 1O6VA 3HRPA 5FO9B 4ORGB 1XSJA 1HCVA 4U3XA 4AIXA 3TBTB 3UBXI 3DHJA 5F9AC 3EYVB 3C12A 1YEKL 2AQTA 1K3ZA 1WK0A 1A7NH 5TDOB 1A9EA 5FCSH 5EIQA 2IV8A 4DGVL 1ADQH 5C08A 1EBPA 4M7ZB 4R8WL 5SWSE 5EUOA 4M3HA 2XX0A 3IDIA 3WO3B 5KVEE 5KBPA 1JRHI 3EHBD 1NMBL 4KJYB 2EICA 1J5HA 4FTVA 2R7EB 1DUYB 1EMTH 1NEZB 1UT9A 4PJGA 2DIAA 3PNWB 4JB9H 3K6SA 2OP4H 2OR7A 2WY3B 2K45A 1KTDB 4N2NA 2AJVL 4NM8H 1X44A 1IBBA 6CGTA 3RTQB 4XN5A 1Z9LA 1ZLVH 5CILH 3WEXB 5B7EA 5BV7B 2WXGA 4WFED 5E24E 1JMZA 3QEGL 1KB5L 2BWQA 3G5WA 1V05A 4PQXA 1WTLA 1P4BH 4FULA 3FJTA 4EI5D 1S9WA 1VFMA 3A0OA 3T2PA 3BQUD 3MJWA 1LO4L 2YMXL 3AY2A 1EJOH 5DRNB 5EN3A 4U6HB 4WFEE 1KACB 5F6HI 1Q9LB 3RVTC 4X8CA 1NIDA 3NA9L 4QYAA 4HUKB 2J88L 3WY3A 1BQSA 4NZTL 1KIPA 3CGTA 3HZKB 1JGVL 4CU7A 1RZIB 1C9SA 1OAKH 1T0NA 3IFLH 1CICD 3KDMB 2YD6A 4IHBA 3V6ZA 3VXUB 1Q9WA 5A40E 5E6SB 2G75B 4R97C 2ZKWA 4M5ZL 3PUUA 4JM2B 3WFDH 2KH2B 5IJKA 3VTAA 4M6OL 2KMWA 4EIUA 3P2DA 1KV7A 3EGSB 4A39A 2PPAA 1N70A 2Q3ZA 2Y1VA 3G5XB 3O3EB 3PNRB 5CINL 3RZCA 43CAA 4B9IA 2OMYB 4YDVB 4OB5H 1AD0B 4QUOA 2FNBA 5CJOH 3IF1A 5C0IB 3MRFB 3KL3A 4PFEA 5IEHB 1HL8A 4W4OA 1LP9F 1F42A 1FJ1B 3N1PC 4JRYD 2IOOA 1L9OA 2YA1A 4N2HA 3RVUC 4YIQA 1J8HA 4NP4L 5BV7C 2HLFC 1DLHB 4UOW0 2HVJA 4XGZA 4GXVL 2R56H 1HYRC 2CA4A 4U1MB 4MJID 5KS9B 3GSNA 2X0UA 4R6UA 5HHMB 3VGBA 4ABWA 4GJTB 2OYKA 3ASNB 3FQNA 1YNTF 3N9GH 1NGXB 5EA0H 4K5PA 4A2MA 4YHOL 4J1UB 2MNWA 2VDKH 4FQPA 1NCAL 2DQHH 1SF5A 4U6YB 4V2BA 4XP5H 5ALBL 1JBJA 1UA6H 4HIEA 4K3JH 3DKHA 4ZTPH 3PABB 1DQQB 3GSVB 3QK0A 4JHBA 2OW6A 3FOMA 2WD0A 2ZG1A 4KH9A 4X6EB 1GKOA 4G8GE 2ZCHH 5LQBH 2AXJA 5JZ7C 4PB0H 1GXEA 5DO8A 4ANVA 2VDML 3DX6B 1WA1X 3HAEA 4IIQC 3VO0A 3VGGA 3A6BH 3BRGC 5B3SB 5K9OB 4LCYB 1RZKC 3FQRB 1MDTA 3IDYC 5SWZD 1E3FA 3HPLA 2R1XB 3U36B 3BFQG 3OMAB 2ORBH 1FORL 1O5PA 4DGWC 3VSTA 1MJUH 4MJ2A 3WIFB 5TK4A 3U9PL 1ICTA 3NSCA 2XXFA 5IJDC 3OG6B 5BJTA 2VABA 1OV8A 5TDPA 3MLRH 4FRWA 1RZ8B 3PQYE 1RZPA 3CXFA 3QCTH 3P4MA 4QHUA 5DHYB 2IGTA 3FT9A 2XN9A 4ANWA 4Z18A 2NYYC 1TENA 3D18B 2WYHA 3EO1A 3G5ZB 5C92A 2GKIA 3BZ4B 4N68A 5AEAA 4AVJA 4PJEA 3ZDZB 5AVZB 4FGMA 1I8KB 3GTTA 4HKXB 3MUGB 3NP3A 4CNIA 1JOIA 2CPUA 3HS9A 5IBLD 4NAQA 2B1HL 2AMUA 4HJGA 2IPUK 5SWQB 3O4LE 4TSCH 1CICB 3W0WE 2XVLA 4HP5A 2G5BB 2ZE0A 5FAAA 3U2JA 2B1HH 4B97A 1WITA 5GGRY 1BVLB 3ZOAA 3AGVA 2E3VA 3ZDZF 3D4CA 3ARTA 3LHPL 5C0CE 4WI2A 3HE6A 1VFAA 3S4SB 5HHOB 5HVWA 1EVTC 3NCMA 4G1MB 3WFCH 3V55A 3BE1L 3NK4A 2WKGA 2DAVA 1EO8L 4HS8H 3F5WB 2WBWB 3MLWL 1L9SA 2B1OA 2ZX5A 3HN8A 1ANUA 3BUIA 4BH7B 4H26B 3AUWB 4S1QH 5LKNA 2E47A 2ZXQA 4OUOA 3CFEA 5FO7A 1F4XH 4KK5C 1NWPA 3LS5L 3NCJH 3DRTA 4MJIB 3ULVL 5H37A 2G2NA 4GUPA 1ZHNA 3MRCA 3QNXA 4F2MB 3O6KL 4X7SH 3T4YA 2ITEA 1RZIA 2G75A 5JW3H 3DOIA 5I16A 3VSQA 3DVNA 4HIXH 5FOBA 1Z2KA 1LO5B 1T0NB 5DHXB 3RX9A 1F6LL 1NEPA 2ZWSA 2NYKA 3UAJC 2A83B 3WKMH 5D7IA 1BF2A 1G7LB 2BJMH 1P2CA 1WHOA 1FNHA 1TZHA 5LGKA 3VX1A 1WDAA 1U92A 2W0FA 5I5JA 3C60B 4G7YL 4RMVA 2M1KA 1JGUL 4DKFH 3QWOA 2BOLA 1T0MB 3CN2A 1XX9C 1S7QA 3HG5A 2H0JA 4I0PA 5EBLB 3L4ZA 4FCHA 4YDLB 4AX3A 2EDDA 1A6UH 2CUMA 1SVZA 2XPGA 1Z3GL 5I26A 3SJVA 4ZSOA 4A2GA 3R06A 3UG4A 1U8LA 2YXFA 3QJTB 5DJDA 3HN5A 1FYTA 1D9KC 2EAEA 5EF2A 2ZSVB 4NNYB 3HN3A 3L4WA 1CICA 2YXWA 3FU9A 4P2RA 2OMZA 1MCIA 4A1RA 3QZNA 3EDDA 3GLZA 4NEHB 3KPSD 4U0QB 3PV6B 4KHTL 4NUMA 5C6WH 5E8NA 5I75C 2ED8A 3KHQA 1KNOA 3CWGA 2VLKD 4HUVA 1GGIH 1IQDA 2DL9A 4EDXB 2J4WL 1FFRA 4TLKA 4LF3B 3SOBL 4ODTH 3KH3A 3BAEH 4CC1A 5CINH 4HKBB 3VXSB 4KKBD 1FVDA 1NCGA 3BD5A 3HC3L 4M9PA 5E6IB 4J3OC 1MFCH 5HYSB 1SEBA 2EC9U 2C3VB 1SYVA 4DZ8A 4DUWA 5F88B 3LQZA 1NL0H 3OBAA 4S2SB 1PIGA 2EIZA 2PYEB 5ESQB 2R1XA 3U36A 4BXVA 1M6UA 4LRNH 2ODHA 4NKDA 4PJHE 3S5ZA 5J12C 1JGVH 4PJCE 1S3KL 1XL4A 2CIIA 2CK2A 4K2UH 3V9EA 1O9VA 3GS7A 2HKHH 2XV3A 1KC5H 1Z6JT 5KYYA 2CLRA 2AQQA 3P77B 3SBPA 4LLMA 4I87A 1MSPA 1FBIL 1ZEAH 2JCCA 3D0LA 1CO1A 4N90E 2H9GB 3S36L 4Z77A 2C5DC 5IIEA 1IEBB 2YD1A 1CGTA 5BCAA 3VVWA 1OAZH 1EAPB 4PY8I 4N2GA 3D50A 4LSUL 4F93B 3IXTB 1QNIA 5HP5A 4ES8A 4K7PL 3POHA 3H9YA 4MQXC 3BN9D 4JN2A 9PCYA 3B2XA 4X6CE 5H8DA 4EDWH 1DVQA 4AY0A 3DX1A 1MH5A 4XN7A 3ZT7A 5F7NC 4CADA 4BSWA 1HK6A 2JKWA 4HLJA 5CP7B 3LKRA 2QKIB 5GS0L 2C1PA 1R5IA 2E8YA 1IBHA 4N0UE 4H1LA 4BDVB 1I8LC 2FWOB 3MLTA 5D7LB 3FOLB 4FKHA 2CHZA 3KW7A 4NWTL 1DQLH 2C1OA 1OAQH 2XWZA 3IDJA 4TN9A 1E67A 4PMEA 1XDTT 3C6SA 1EHXA 1MFBL 4KKNA 3JV4A 3ROOA 3ZE0E 3WELA 5IT2H 2VW4A 1ECYA 4WWID 4AW4A 3MRQB 4QIRA 1QSEA 1TNMA 1LILA 2DQCL 1BVZA 3V4VA 1I7TB 2JKJA 2EDKA 4JPVH 4RMSA 2J8OA 2P5WE 2Z1KA 3RURA 4K71C 4GI8A 4MMYB 3ZUNC 5HDBB 4MRCA 5K1VA 4ZMOA 1KIPB 3FK3A 3HZKA 5DZ9A 4AYFA 5IESH 4OZHB 3OKOA 2VL5A 2FO4B 1YHPA 2ZNWA 1U8QA 2HH0L 3WL9B 5B3JE 5IVXB 1G6RB 4QOKA 3HCVB 3MBWA 5KVEH 3OHMB 2VLKB 4DAGH 1E3XA 5CR8A 3VU1A 4K3EH 1XD0A 2JB6B 2R0LH 3CZGA 1I8KA 2PUQT 3S97C 3HR5B 4POZC 2WXLA 3V4PL 4YHYB 1H5BC 2HSIA 5EZOH 2WAHA 1FNSH 4QTHA 3II3A 2HUHA 3K91A 2XJLA 3T0EE 5D6DC 3VYPA 4OLXL 3QS3A 4Z3HA 1VEMA 1IKFL 4YQXL 4O5LH 3VFOB 5IMOB 3OKYA 3LRLA 3EAKA 1E2ZA 1D6EA 3QJFB 4AGOA 3L3DB 2J1ZA 2YFNA 2ATKB 1FO0B 3GMQB 4O2CB 4LLWB 3VQ2C 2NXZC 1YPZA 1R0AH 2RGSA 2OX5A 4HGKC 4KKAC 3ZZSA 2OKMA 4FC3E 4U7MA 5DZNA 4Y2DD 4UQ2A 2VR6A 2VUOA 4G1MA 5C3LD 3WIFA 3LEYL 1NGYA 3MRGA 3N40F 4PGBB 2AI0H 4MNGB 4L8SC 2ZXBA 4MD4A 1VEOA 4OLXH 4KK9D 5GRXG 1OCCB 2OYLA 3B9KA 3HPLB 3TJPA 3UIYA 3KPQB 1UD6A 4PJFE 4XVTL 4ZUWB 4Z7AA 3KE0A 4XMLL 1LL1A 1WA2X 1Z3GH 1OKEA 4HBCH 5F7EH 4PS7A 4YN3A 3QI9B 4POYA 3QRLA 4GG8B 4BE5A 3CLWA 4XX1G 2NY5C 5K59F 1SUHA 5DEFB 2V3EA 4YHLL 1W0WB 1U58A 2VDRL 3I3BA 5HDBF 3SEPA 1MCJA 3OMZA 1M56B 4WY7H 3RY6A 3STBA 5CJ5A 4HK3J 2X4NA 2O61B 4AC2A 5FKAB 3NABL 4S10A 2DI9A 4OFVA 4PJ9C 4KRPB 4L9LA 3NPSC 2CAKA 4QNPF 4X6DA 1XH3A 1RZJC 2WGNB 4HOXA 1R3LB 1TTUA 3QEHB 5CWSA 3O9WB 3RRQA 4L3EE 3BN9C 4F7KA 4TNWF 2E7HA 3MKGA 2IG2L 5D7HA 1UT2A 2N4IA 5F7BA 3RWJB 3TFKD 4ZW6A 1SYSA 4X9FA 1BZ7B 4HXBL 4DPRA 1U8CA 1ZT4A 1T5WB 1SYVB 4UT6A 3I02B 4HIJB 3NN8A 2NXZB 1A3RL 3SZKC 3VFGH 4WLCA 1OAYH 3UDWA 4L4TB 3F83A 2LW3A 4LARL 4O4YH 5ANHA 2APTA 4NP4H 2DM4A 2EEAA 3W2DH 2H2SC 3WIIH 5K9OA 4POUB 2O4EA 4X9YA 2WVUA 3FKUS 4DVBA 4TSAH 2J7LA 43CAB 3S3DB 5FUZL 1MF2H 3ZW3A 2V9TA 1ND0B 4RGOL 2GABA 2NY7H 3TF7C 4ZFGL 4JM2A 5B8CB 1BYOA 1C12B 2GI7A 3WEBA 1G0YR 2SEBB 1XGUA 2P7TA 3N0PB 1T1XA 4ATWA 3LYRA 3GSVA 3VXRE 1SQ2N 1R75A 4BZ1A 1NINA 1F00I 2ALAA 5IVNA 4FE9A 3D52A 3TT3H 3CTTA 1PJ9A 2BMKA 1OAKL 3OAYH 2L7QA 4WEEA 4H20H 3HMWH 4U7SA 4YHMH 3N1FC 4DNLA 3EIFA 2B2XH 3H9SA 3OD3A 3DTDA 4TLTA 1LWHA 1TNNA 1M3JA 1FV1A 1RV6X 4N8UA 4OSUL 4P06A 4PW4A 4AL8H 2Z9TA 2HTKC 2W65B 2HZHA 4EMZA 5DD6A 4ZPVB 2ZOKA 3NSDA 5E2UH 1IGYB 2A74B 3WHE1 3QC6X 5DSCB 1HSAB 2YMXH 4PVBA 1U3ZA 3IDGA 2VRAA 1ACYH 2DQ6A 1AO7A 1UJ3A 5G4NA 3VXTA 2CBPA 4TUJB 1SOXA 1AR1C 4ZMZA 5D7LA 1NGZB 4ZFZA 3UC2A 4RDBA 2VIRB 3RJOA 2FGWH 1UB6B 4JL2A 4XWOD 5ERWA 5B38B 4NT6A 4GRLD 3VFRB 2WXQA 5GGVL 1OEZW 4UZSA 1SM3L 4F7MB 5T1KA 5AZUA 2JV6A 1NEZA 3O45B 2JB6A 4PLJC 2QVFB 1E6OL 4AUYA 3ALWA 4I85A 2ZAIA 3E38A 2WBXA 1ZTXL 1Q9OB 5I15L 5IB3A 5GGSY 1UACL 4CW1A 5KSBB 1V7ML 2EXWC 4H26A 4LOFA 5I73C 5JHBA 4I18C 1XTLA 3CSYB 4AYFB 3B5TA 1BW8A 4GOSA 4CRPA 2HFGL 1W16A 1RUKH 1YEGH 3FB8B 5T1LB 2C3HA 4M56A 5KTEL 3VWJC 4MD0B 4G7SB 2ROXA 5HSFA 3G6DL 4XRCB 2WO2B 5L8KB 1UA6L 3LD8B 1S9XA 3VDBA 2VISB 4Y9GA 1KCSH 5DJ0A 5IQOA 2PWEA 3UGXA 1QNZH 3GMLB 4OUUA 4PJDE 1Y18B 4R7DB 1W72B 3THMH 3ARWA 4ERSH 5CEZH 5KVDL 1UENA 2R2EB 3SDCB 2DWEA 1EGJL 3CX5J 2VDMB 3NYKA 2Y6TE 3CFMA 4A7SA 3CSFA 2CO7A 3FFOA 2X2JA 1P5UA 4G72B 4ONFL 5DD5H 4NKDB 5TGBB 3UTSD 1YJDL 2OFQA 4JHWL 1DBBL 2FSEB 4NM4H 2OK0H 5J1AA 2X4RB 2P42B 4GW4B 3QNYA 1S7WA 1TJHL 2VLME 1NBVH 4GFXA 2YKLL 3GMPA 2AK4B 3FQXB 1VPOL 1VFOA 1U4FA 3HNSL 1WE5A 4W93A 1F18A 1ACZA 1I8LA 4CSZA 5J9PB 3QIUA 1VADB 3HLAA 1DFBH 3RKDC 4L4VA 1YNLL 3ETSA 3EBHA 1DN0B 1KYUA 3L9RB 4ZUSA 4H1LG 3SY6A 3GI9H 1DVTA 2Z31A 5AVRB 5KSAC 1I85C 4ZW3A 1ZT4B 4GO8A 2GG1A 1Q0YL 2HCZX 5IBLC 3TXAA 1CGSH 2VDNH 2EXWD 2IDCA 3TBVA 1WV7T 3OG4B 3BH8B 1JPTH 4PJDA 2HYMA 4H8QA 4MQSB 1G87A 2IF7A 4QRRB 1CTMA 3KYAA 1W0VA 5FKPA 3VXOB 1VCBC 3I84A 3ESNA 4K9EL 3HZ3A 3TNMB 3C8KB 2PETA 4QYOB 4LCWB 4XNZB 3IPFA 2WKOA 2O5XL 3CU1A 5I1HL 2VZOA 2EC8A 1CQYA 4H7VA 1WUZA 4M43H 3T0BA 4A55A 3UPRB 2VXTL 3HFMH 5IHZA 2PABA 1AZRA 1HEJC 2DN7A 1LDSA 1ETA1 4MZIA 1ZA3B 4LDEB 1U33A 4FDWA 1PL3A 4P23D 3D39E 2WAQA 1XR9A 3KAAA 4NQTA 5HDRA 5TF1H 3ECQA 2OCCB 3KS0H 4Y4KC 1C5DA 2AJVH 2HRHA 1U92B 3I6GA 5SWSA 1CLCA 4LLYB 3F7RA 2BERA 1EMTL 3G5VA 2HTKD 3W38A 2ZXGA 3VRIA 3AW5A 4Y19E 1ZTXE 2IBZY 2DEXX 5HPOA 3D05A 4QTIL 5D7LE 2JKLA 1DSFH 3AQDA 4YHIB 1ZGLM 1U3HA 3A21A 3EJUA 4GIAA 4OD2A 2PPFA 1Z5HA 5E4OA 4EQ2A 5GSRB 4QRFA 3WY1A 5IEHA 1JPFB 3IJEA 1F8TH 1LLAA 3TONA 1BF5A 4NENA 4J3VA 4LSQL 1T3FA 3WNNA 4GAGL 3S37H 2YZ1A 4LT7A 1WZAA 2AHIA 4OF8A 5KSAD 4CAGA 1E4WH 2OSLA 3SPCA 5GS0D 4X5WB 5KVDE 4M7KH 2XG5A 4A2EA 4OLUL 3VI3B 2VZTA 2I7SA 1VADA 2GI0A 3NCYS 3BKJL 3S34L 2BVTA 4XNYL 4Z7UA 2EVJA 1SEQL 2WMPA 4OGQC 4JVUA 4O02H 1BXXA 4W9GC 1ZIAA 2ZCLL 3GSQB 3TIEB 4FFTA 4OV6F 4IOIA 3SKNA 2VL5B 5E5RB 5KJRL 4JQVC 4PJAF 4JFFD 2MIZA 1BFVL 1TZHB 5ETUB 1FZMA 1VJSA 5GGTL 1EJ6A 5T1MB 1BDYA 3MGAA 5D2NB 2ICWA 4LVNB 2WZAA 5HHMD 1KCWA 2RQ8A 4ES9A 1N68A 4CNIB 1NCAH 2DQHL 3GJEA 4GKNB 4DEPB 4E9TA 1HSBB 1RK0B 1XT5A 2BHUA 2K6WA 1SJEA 4MYPA 1I7UB 1R33A 4IOFC 3VD7A 3EOTL 5I1KL 3WTTA 3GMRB 5ALCH 2YO3A 1BAFH 1A9BB 4PGDA 1D5XB 1QWUA 5CR1A 1U8JA 2QDWA 5DJ0B 1XGQA 3P4MB 1I4FA 2LLNA 3U1SH 1FAIL 3RBSA 5I76B 1CLZL 2BX5A 1HCFX 1RZKL 4ZW8A 3FO1A 3KR3L 1N6VA 1SMDA 3ZE2F 2EP6A 1VGEH 4UT7H 1SBSH 5FEBA 4YHIA 2XTJC 3CE1A 5GJTH 3RHWK 1BZ8A 3D08A 1JGDB 2MOQA 2PN5A 1JHKH 1SGKA 2NY1B 5FHBL 3RWJA 1F13A 3RL2A 1BZ9B 3MRPA 3BO8B 4LLYA 3RA7H 4A7VA 3U1SL 3K2KA 2R0WH 1HXKA 2CU9A 2I07A 5CHNA 3L3GB 3QUZD 4U0RB 2YMTA 3RB7A 4NAMA 2R27A 1X5LA 1PEZA 1RD6A 1SY6A 2VR8A 4AQAB 4JFOA 2N59A 3EOTH 1J9QA 1BQLH 5EUOF 15C8H 1A22B 1SF3A 5FO9A 4KVPA 1X5ZA 2X4OA 5A6LA 2IBZX 3VXMA 4LCCB 5JOPD 3FOMB 2NY3B 4JZNA 4YSPA 2KS0A 5F89A 5DS8B 2DQUL 4AC4A 1A7RL 5T3XE 1BFVH 2CIIB 4TRPH 3Q6FA 3HRZB 1I1FB 3BH8A 4PJDB 4Y5XA 1FZKB 5EOTA 1YY8A 3MJ8B 3TJEL 5E9DE 4WW1A 2WINA 5BJTB 1DQIA 5HHOE 3RDJA 1BWWA 5DVNA 3C5JB 4RLDA 5I8OL 4EN3A 2ZWNA 3SIKA 1J5CA 3GHBL 3FO0L 4KBPA 3WUZA 4OF0A 4NM8L 1CU4L 5D7KD 5HJDA 3LEXB 3WXWH 5KWYC 1I3UA 2CR0A 3MR9A 4RGMC 3PY9A 4KKCD 3TS8A 3BRDA 2IAND 4FXTA 4M7ZC 3MSPA 3O4LB 4LLUB 2K70A 4GAGH 3S37L 3MRFA 5AQ0A 1CCZA 1U8JB 3K8KA 4G59C 4MNHB 5HHOD 1XF5B 4G6FB 4E0RA 5B7MA 5I66B 5C2UB 1WFUA 3QPXH 4F2FA 4IU3A 5LXGL 1KNOB 3QIWB 4U6XA 5FDWB 4J2QA 2CO3A 4OZGF 4G11A 1JNJA 4I18B 3TV3H 3PHQB 5GRZA 4WWPA 3ARBD 5ABDE 3X14B 4FD0A 3FU3A 2XZQH 5FFOA 1AHWC 3MV8E 4G1EA 2IOMA 4AKQA 1MAML 1MZYA 3UIZA 3G6JA 1HEHC 2HFEB 1U8HB 4U6YA 5D9SB 4NNYA 5AWNH 1VF5C 4JBSA 5T3ZL 2WLZA 5DO2D 3Q5TA 2E9IA 4XP6H 3OQRA 2Y7LA 3Q48A 5DHVA 2NR6D 4G71B 3QORA 5DEJA 1INQA 3UO1L 1JZ6A 3RL1B 5CJ8A 2QPSA 2XFGB 2UXGA 3NIFF 3QJUB 1UFUA 1MXDA 1D2PA 4HWUA 4IRSC 4ZUVB 1AR2A 4XMPH 4QXTA 5D4QA 1RSFA 3DVGA 2CDEB 3R0MA 1HIMH 3GJFH 1MFAL 2ZUXA 1I3RB 4OIBA 2FJGA 1U8MA 3HUJB 4PCKA 1YY9C 5KYUB 2WZ0A 1DJIA 2MCG1 3DBXB 1PY9A 3B1TA 5BMFH 3O3EA 3FZUC 5FOBB 2Z65C 3AS1A 4JFWA 4PGCB 1I85A 4YBLB 1EHLL 4K4KA 2QVTA 3UGUA 3UYRL 3T77A 3GSXA 4WAFA 3QA3B 4ANUA 4Y4FA 4PI2A 5GIRB 4DQAA 3QDAA 3T6VA 1HHGA 4BFKA 4KKPA 1YNLH 3P9LA 4DW2L 1HHHA 5JOPE 4P2YA 2XUWA 1AD9B 1WIPA 2CGZA 3OKLA 3CLEH 3BSZA 1AGCB 4YPGA 5C0FA 4M8VA 5TDOA 5DZAA 4F7MA 4KTDH 3TT1H 5TE4L 3EYVA 1YN7A 3OAUH 3IGKA 1IGJB 1UKSA 2RMNA 2UX7A 3MLVH 1HHIA 2PYFB 4LIQL 4LSVH 3REVB 1X4XA 2Z0BA 3DGDA 4PJHA 4OGYL 4Z3GA 2GBVA 2COVD 4XBEH 5CSGA 3OF6D 4NRZA 4Z5RA 3U2SB 3H9HB 2FX9H 2WIIA 3AROA 3EYFA 3LVTA 3LDBB 4AIOA 4G7RB 1AZCA 5J12B 4HJEA 5DLML 4JRYE 3T8XA 2ADYA 2XTLA 3IBOA 5B8CA 3EYOB 3BGMA 4JQVA 3ORJA 4RQQB 3EF4A 1YEHL 3NPSB 4Q6YA 5ITBH 1OPGH 3IDIB 1FVDB 3STZA 3MRKB 4U4BA 4WI0A 4XAWH 1GKEA 2Q87A 2L7UA 5J9PA 1OM3L 4DTGL 3FNKA 1R3HA 3L4UA 4Q4EA 1LWRA 2FB4L 1SBSL 1CI3M 1LVEA 3CQFA 5FYKD 1VEPA 4ODHH 5TDPB 4B3EA 2YD7A 4PJIB 1MREH 2NX5D 4UOQA 4AZ8A 2ATAA 3QNYB 2DWDB 3ABMB 5L4IA 3IDJB 4PTUB 2D3LA 5E8NB 3JZ7A 3NZ8A 5EZIH 3TN0B 3B9VA 2BH0A 2LLLA 5GSRA 1FVEB 4RMBA 4XOEA 1IE5A 2FX7H 3MO1A 4MCYA 3O3BB 4KJWC 2GB2A 1KBGL 4I2XA 1OTSC 4G9DB 5CLZA 1YC7A 5D6CB 1BEYH 3M1OA 5B4MC 3ARFC 2ICEA 4PJ8D 5I17B 3LXCA 4XVJH 4YZFF 5DUMH 2XPGB 1T7XA 5G4MA 3GHEH 1A02N 4NQQA 1T66C 1UD3A 1CL7H 4AL8L 1QATA 2HLAB 1ZLUH 4HOWA 1HE7A 1GZQA 2X28A 2XJKA 4OIIL 4JMXA 4D9RD 2O6DA 4QRBA 3BEWB 5CGYD 5F1KC 5JPNA 3AT8A 1UGNA 3QUKA 5FA4B 2YUZA 2DM7A 4XE0A 3T6XA 2Q8BH 1WUNT 3EH5B 1RHFA 1A5FL 4LEXL 1CT8B 2DD8L 3PGCA 3QUXC 4MDIA 4W9IC 4ZO7A 4RA0C 3B4NA 3TO4D 5K9QI 2FX7L 2ZAGA 4J7RA 1NKOA 2H0EA 4IQHA 1RERA 4JFEE 1PMYA 3ZMRA 1EBAA 1CD1A 1FJ1A 2HFTA 5AOZA 2XN9D 1S3RA 4M7KL 1OTTD 2CR6A 1GC1C 3MYJB 3L9EA 2CK0L 3CFEB 4JJOA 4Y5YC 3EH3B 2QHLA 3OKDA 4PJHF 3SDYH 4AEIH 3S9DB 4BHUA 2XTJB 4N8VG 3HNTH 1CLOH 5L7XH 4YHNA 3U0TB 4I2XE 2AXWA 4ODHL 3GXFA 1XGYH 4ODSH 4UZGA 2QQLH 1J87A 5AOKA 5CM1A 4EXKA 2CGRL 3MXVH 2NTSP 5GGSB 3MXWH 3TO4A 2F54A 3S3PA 1I1RA 2V2TA 2B1AL 4L1TA 1ZLSH 3SQBB 1IO4C 3BPNB 2V5TA 4C4BA 3FFDB 4KZCA 1O7DE 2QVKA 3MRDA 4QAMB 4XNXL 3TOPA 4AGPA 3OKEA 3L1GA 3RY6C 3AQYA 4Y4FB 4WKZB 5HHVH 3N42B 3D0VA 1F90H 3OZLA 3DURA 4GI6A 5CUSH 3UX9B 2XACC 4MAYC 3GJEB 1S7SA 4JG0L 2Z93B 4APQD 4FXGB 2O5YH 4GP4B 4NB7A 3HCVA 3ZXAC 4IBTA 4X6CF 4AJVA 2PR4H 3EYUL 1V27A 3P11H 2NLJB 3QR1A 3CMOH 1Z5LB 2SODB 5J89A 1S7VA 3ES6A 5GRVK 4MMYA 1IGFL 3IU4H 3MROA 4OCNC 2YD0A 4KNSA 2GY5A 2NNFA 1ZANL 4GS7C 3D34A 2O5XH 4UQDA 2OJ1A 4E9YA 3RL1A 2YGVA 3MACL 1RULL 3ARZA 2W5PA 4MHHI 5EU4A 4ALAL 5BW7A 5B3JF 4NI6A 4ABVA 2MKLC 2ZOOA 3QHTC 4OF7A 3QQ4A 4XPGH 4B53A 4MDJA 3LRMA 1E5YA 1HWWA 2VW6A 1CXLA 3IDXH 1P7KA 2X9ZA 4YDKL 3BPNC 3PUCA 4R0LC 5BMFL 2RJMA 1S5IL 5HDQL 1X6LA 5LBVA 4XVUC 3OJVC 4D9LH 3AVEA 3KYNA 5FGRA 5C07A 5E08L 3ELAT 2ARWA 1MFAH 2NW2A 1F4AA 2CBQA 4L1LA 3KLDA 5D71L 4WEMB 3WFHA 1WPCA 2KT6A 4ZMXA 4JFDD 2K78A 2D0GA 4MMZC 5C08E 3P3SA 2XXGA 4N9OB 1PU0A 2A74A 5H37H 4HFWB 1E42A 4Z77B 1GJWA 2ZP8A 2EYTA 2BP0B 3POCA 5EU7E 2JCCB 5KS9F 2WP3O 2OMUB 2AP2A 2Y69B 2HFGH 3LQZB 3TV8A 2HVJB 2BSRA 4ONOA 1KTRL 1DVFD 4QRSA 3RVWD 3UZEC 2F08A 1ILUA 2ED7A 3ZE1F 2V7NB 1X7QA 2FQGA 1ZLEA 4JG1L 2WCPA 3GBEA 3FQUB 1CK0H 5C0AB 4HOMA 4PVMA 1DQLL 4IMKA 3KXFE 4JQXC 3MUGA 3TBSB 2NNAB 5EWIH 4UIKL 3RWDA 3FB7A 3OLDA 3CHRA 3MGOA 2YQBA 1WFTA 1CD8A 5IFJA 2QFRA 1AGEA 1RLWA 3QIWA 4PV8B 2OMTB 1SEBB 2CKBB 4JGJA 4PRBA 3BZ4A 3QIUC 1PEWA 3BPLC 4QAWA 3HC2A 4X6CB 1CLVA 3QRFM 1B90A 1TVHA 2JKIS 3QQ9C 5FFLA 2WZ6A 2V2WB 3AAZA 1ZDSA 4J3OH 3UJIH 1EAOA 4OFYD 1TU2B 2Q10A 1EX0A 2Y72A 3MRKA 2OMZB 3MLXL 4N9GA 3FO0H 4DOHE 1DJSA 2UZPA 4LRIC 1XXDC 4ISVA 4LSUH 5F3BA 2FDBP 2KI6A 4ETQB 25C8L 1FNGB 5E8DH 4LFHG 1MRCH 3WTXA 1B0IA 4NKIH 1B88A 1LO3H 4LPXA 5ESAB 1CDCA 1A14L 1LHZA 3NZHH 1NJ9A 5D72L 3DHUA 1KN2L 1FBIH 4JE4B 2A6DA 2FL5B 5AW3B 2VDOH 3MA9L 4U2ZA 4L9LB 3BWAB 2YBRA 5ANME 2D31A 3ESMA 4M5SA 5SWSD 3ZT5A 2C4FT 2HKHL 1XXFC 5I1EH 3VX0A 3KCWA 2X4OB 4R26L 1IGJA 4H0LC 2A83A 3WEXA 5C07B 5CSZA 4K9JA 2JB5H 1FCCA 2FJUB 3H9SD 2UZXA 1ZRUA 1M42A 4PYHA 3MRJA 3VA2C 4CADB 4F7PA 2OMNA 2CUAA 4WV1A 1MFCL 1LQSR 4KMTH 1Z9MA 3OXSB 1M9WA 3SKMA 1I8IB 2Z7YA 4FABL 4YSTA 3II2A 3VFNA 1E3ZA 3Q9QA 1OZUA 1NGYB 2X1WL 5FM8A 3AT9A 2VNCA 3SE8L 1JCVA 2R29L 4HGWA 4NCC1 2H6OA 4G6ML 4UQ2B 2XWJB 3PWLA 4B41A 1IAKA 4D94A 1FAIH 4HJJH 4A63A 4G82A 4YHKL 5PCYA 1Q1JL 3WCYA 1KIRA 1MJJA 3ZDXE 2DJ4A 2VO5A 2CJUH 2IH8A 3IJSB 2VLJD 1S5HB 7FABH 5L88L 1ZPUA 3B3BA 5AKVA 4IBYA 1TDQA 3OPZL 5D2LE 1RPQA 4HKJB 4N0YL 1XF4A 3DROA 3T5WA 3D2TA 3QARA 1Z5LA 4EIZC 1KB5A 3E6FB 2Z91B 4XCCH 3E3QC 3JV5A 3NFSL 2HN7A 1XGPB 3CLFL 5CS7A 2BIHA 1DHKA 3QWRA 3R7QA 5KG9A 5ICYB 3KGUA 2D2CC 3U7WL 3E9TA 4N2MA 3LAFA 4P5MA 4URKA