3NJNA

Q118a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 18
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njnA00
1NICA 1KCBA 2VW6A 1KBWA 5B7EA 3TBBA 1AS8A 1AG6A 4GYBA 2VSKB 4E9RA 2TSBA 3FQ1A 2FQGA 2YARA 2TSAA 3GYRA 1XB6A 1SFHA 4WTQA 4A2GA 1AS6A 2H5UA 3FSVA 4AZUA 2FT8A 2Q5BA 2PPFA 2FQDA 4P5RA 1MG2C 4BDVB 2XU9A 3NSFA 1SDDA 2XLLA 1AAJA 2HX8A 2EIMB 3CDZB 3UGEA 1E67A 1YLBB 1PNCA 5I5IA 1L9OA 5I6LA 5F7AA 5B7FA 1BYOA 3G5WA 2PP7A 3NJLA 1AZCA 1CURA 3NJHA 3ZBMA 4UF7C 2VSMB 2HRGA 1KCWA 3KW8A 3JTBA 1AQ8A 2ZONA 1NWOA 2JXMA 6PCYA 1BXAA 1OOWA 2ZWNA 4DP0X 3WKQA 5I6OA 3FPYA 3OMAB 5B7MA 4YSSA 1J5CA 1TEFA 3UAAA 1IUZA 4ENZA 1R1CA 4F2EA 1PZCA 2BWDA 3S8FB 2BP8A 1TU2A 1ETJA 2BZ7A 1J5DA 1SNRA 1WA2X 1EHKB 4DP2X 2FJSA 4AI7A 3NP3A 1OV8A 4DP8X 4G7QB 3S3CB 4BWUA 1AOZA 2CCWA 4A68A 2BP8B 4HCFA 4YL4A 4YSTA 5TK4A 1JXGA 2JFCA 3X1NA 2FNWA 1EZLA 2BZCA 1FFTB 4KNTA 4YVNA 6PAZA 4KNUA 3AG3B 3CG8A 4A2EA 5B1BB 5LDUA 1X9RA 1AZBA 2LLNA 3T6WA 4HAKA 4DP4X 2DWSA 2DYRB 3FSZA 1PLAA 1L9TA 3AG1B 1ILUA 5I26A 4AX3A 1PF3A 3X2QB 4HIPA 3RYMA 1GS6X 3FT0A 2PLTA 1E65A 2XV3A 1PAZA 2GSMB 3WI9A 5B1AB 4DP1X 4X4KA 1BQRA 2XXFA 2FT6A 2UXFA 1J9SA 2MRYA 2HLEB 1A3ZA 4YVUA 3CVDA 5I28A 3ABKB 1F56A 2IDTA 1HFUA 2PPAA 2Q9OA 2XX0A 3TASA 1ZPUA 3WNIA 2P80A 4JKNA 4YSQA 1ZIBA 1BQ5A 5B1JC 1ID2A 3OM3B 4DPBX 1OCZB 4DP6X 3FU7B 3ZDWA 2XV2A 2PP9A 2FT7A 3FYEB 4KO5A 1BAWA 1SF3A 1OE3A 2PCFA 2J5WA 3ERXA 3PAVA 1JXFA 4YSRA 3NJNA 2QT6A 2ZXWB 4F2FA 2DWTA 1I53A 3QJRB 1NTDA 1QNIA 3OD3A 3PXLA 1AANA 3IN0A 1WS8A 4E9VA 3H56A 4A2FA 3ASNB 3N2JA 1NIEA 1L9QA 1W6LA 8PAZA 3NSYA 1A4CA 1JZJA 1V54B 2XUWA 3AG4B 4HALA 2YXWA 4E9SA 1FA4A 3PAUA 4EF3A 2VW4A 3JT2A 1ILSA 3NJJA 4AKPA 2GI0A 1UATA 1A65A 4ZK8A 3U25A 3ABLB 2GIMA 4TXVB 4NAJA 1OCRB 1J9RA 3WG7B 4E9QA 2UX6A 3AW5A 2YAQA 1GSKA 1JVOA 2ZOOA 3T6XA 2YAMA 4QKTA 2BP0A 3TU6A 1AS7A 1RCYA 3MBWB 2IDQA 3PCYA 2AANA 1GW0A 1OE1A 1E5ZA 4MFHA 1AZUA 3UADA 1KBVA 1MZZA 4GXFA 2CALA 3BVDB 1GR7A 5E9NA 2HX9A 3ASOB 4QLWA 4K9JA 4CSPA 1ZIAA 2WSDA 2BWIA 4BWTA 3PAZA 2JKWA 3UACA 5I5JA 1NPJA 3WNJA 4E9XA 1B3IA 2CJ3A 4BK5C 2B3IA 1DZ0A 4JHUA 3T6VA 1L9SA 3QPKA 3EH3B 5PAZA 4NB7A 2OV0A 1PY0A 1MZYA 1SFDA 2QPEB 2XVBA 3EH5B 5TK2A 1KDJA 2EIJB 3IE9A 1AZNA 3MX0B 2BW5A 2MTAA 5AKRA 2HXAA 2NRDA 4PCYA 3IN2A 1ET7A 2QPDB 4N4YB 2RACA 4KO9A 2IWFA 1ZDSA 1ZV2A 1AZRA 2DYSB 3NT0A 2VM4A 2PPCA 3SBRA 3ZIYA 3NJIA 4G71B 7PCYA 4W9ZA 4FA7B 3H4FA 1PNDA 1W6WA 2GHZA 4A2DA 1NIAA 2UXTA 3SBPA 4DP9X 1NIDA 2FWLB 2QDWA 1URIA 4UAHA 4YSOA 2UXVA 3FU9A 1NZRA 5I6KA 3ABGA 3PLYA 1NDTA 5FC9A 1N70A 4CSZA 3OMNB 1WS7A 3X1EA 1PZBA 4A66A 1JZFA 1OCCB 3EH4B 3QJSB 2IDFA 1GY1A 4HCIA 3UABA 4YSUA 1RZQA 1V55B 3DTUB 1VLXA 1V10A 1XB8A 4E9TA 2OJ1A 2CBPA 3QJUB 3WIAA 2GB2A 4HHWA 3GXUB 1A8ZA 3ABMB 2YAPA 3FQYA 4HZ1A 3CDZA 2Y1AA 3QQXA 1SHWA 5I6MA 3IBOA 1IBYA 1IBZA 1N68A 3H4HA 2H3XC 3OQRA 5I6PA 3X1FA 1BXVA 3NSDA 9PCYA 1HAWA 2EIKB 4YSAA 2J57A 2XV0A 1J9QA 1A4AA 1M9WA 2X88A 2E86A 1RKRA 3V9CA 2P80D 1ET8A 2R7EB 4KO6A 4A67A 1PMYA 4DP5X 2CUAA 2VMJA 3CZUB 1MG3C 4BWWA 2AZUA 1GY2A 4E9WA 3BQVA 2WO3B 3C75A 1W8EA 1CYXA 1ASOA 1XMEB 1JZEA 3AY2A 2CAKA 3PPSA 3DIVA 1WA0X 2VW7A 5AZUA 1KV7A 1SF5A 5PCYA 1QLEB 1JZHA 3T71A 2DY2A 2FQEA 3V9EA 4G7SB 3SBQA 1GYCA 3KW7A 1E30A 4GP5B 2IDUA 2VN3A 3FQ2A 2YAOA 1GS7A 1NWPA 2AFNA 3T6ZA 1JERA 3GDCA 5A7EA 5IY5B 2HZHA 3QJQB 4W1TA 1OF0A 2DV6A 1JXDA 4G7RB 5I6NA 1L9RA 1NIBA 1JVLA 2W8CA 2GC4C 3S3BB 1JZGA 2IAAC 4KO7A 2IH9A 1OCOB 3HB3B 2VM3A 4RH4A 4BXVA 2I7OA 1M56B 3SQRA 4AKQA 1NIFA 1SDDB 1BEXA 2PPDA 3ZX1A 1PLBA 4F7KA 2BHFA 1GS8A 4M3HA 1AACA 1J9TA 1AR1B 1RZPA 2IWKA 1DYZA 2XWZA 2HRHA 3NP4A 5EHFA 5D4HA 5D4JA 1ADWA 4GY4A 3FU7A 4A2HA 4GP4B 2IDSA 1SJMA 2UX7A 4HHGA 4YSEA 4M4RB 1ET5A 2YAFA 2YQBA 1BXUA 4DPCX 3EHBB 1X9UA 2W88A 3NJMA 5B1JA 3FSWA 3QJVB 2XX1A 1WA1X 3OMIB 1ZDQA 4UANA 2QDVA 2UXGA 3L45A 1M57B 2HX7A 2I85A 1A4BA 2GC7C 2A3TA 4GP8B 4PAZA 1WAEA 5F7BA 4P5SA 5B3SB 4DP7X 1SHXA 3S3DB 1PCSA 1JOIA 1T5KA 3S8GB 3WKPA 1AIZA 3EF4A 3TBCA 1QHQA 2XXGA 3NJGA 3FYIB 2XYBA 2I7SA 4YSCA 1CYWA 2FTAA 2Y69B 1XB3A 3NYKA 3X1GA 4NERA 4BDVA 2X87A 2R7EA 1AG0A 5ANHA 2YAHA 2IH8A 1KYAA 2N0MA 1PLCA 4FAAB 1JZIA 7PAZA 1CC3A 3NJKA 3NSCA 4Q89A 1IC0A 1L9PA 3FS9A 4YSPA 2GBAA 1KGYE 1PZAA 3HEIB 1BQKA 3NJFA 2J55A 1NINA 2J56A 1BYPA 2WO2B 3AG2B 2AZAA 2IWEA 2AVFA 2BP0B 4Q8BA 1KDIA 3CVCA 1HAUA 3FSAA 1CUOA 3QJTB 3X1BA 4E9YA 2EINB 4WKXA 1OE2A 2BO0A 2PCYA 3DKHA 3FU8A 3N55A 2EILB 3TA4D 5AFAA 1ASPA 1TKWA 1MDAA 1FWXA 4KOBA 4KOCA 5I5MA 3IEAA 2H47C 2FQFA 1ASQA 4G72B 3T9WA 3D12B 4N8UA 1TEGA 4AKOA 4L0PB 1NPNA 4G70B 4YSDA 3FPXA 3UAEA 2BW4A 4BXSV 1IKOP 2YAEA 2OCCB 5B1KA 2PPEA 2PP8A 2B08A 1E5YA 3AZUA 4HCGA 4KNSA 4JHVA 5D4IA 3CVBA 2YXVA 4DPAX
chains in the Genus database with same CATH superfamily
3CAFA 4NPYA 4ZMVA 2AW2A 2GITB 4APQA 4UTAA 4HD9A 3C2AL 4QO1B 4JM2F 2VXUL 2J1XA 4DETA 4PJEA 4X7CC 3QXAB 5DEFB 2YD4A 4R4FH 1CD1B 1QFWI 2TSAA 2VR6A 3T3MF 5I17A 3BGMB 3I6LE 4XPTH 1BWWA 4AYID 3K71B 4L18A 1PFOA 3DTXA 1DR9A 3BFOA 2ORBL 1W72H 3FSVA 5GRYA 4G6AD 5IUCA 5DSCA 1N18A 2B7DT 1U4EA 1KTCA 3EBHA 1OAUH 4JJOA 4ZMWA 4OR1A 3SPIA 5IREA 4YS4A 4OZIF 2R2BB 3S37L 4D9LL 2EEXA 2XLLA 2HX8A 1DEDA 2YRLA 4NQCE 4WRLA 4FZ8H 4JY4A 1QO3A 3WLWC 1XSKA 2NXYD 1EXGA 1WFMA 4HPYH 1KFAH 5CIPB 3QXTA 1IIKA 3MBXH 4UZSA 2Y4SA 3AB0C 4FLRA 3G5WA 1PEWA 4GUPB 2BJML 1NMBH 2VZTA 4KTYA 5AB9A 3MJ7B 1BFVL 4BZ1H 4YNYA 4KI5D 3PWUA 1F8TL 3QGVA 1TQUA 2RCSH 2CIKB 4QYOB 2D3LA 1F3DH 1AQKL 1W72L 4K3JL 3DROB 1J10A 1FGVH 3GMRA 2E6PA 4R90H 5C6TL 1UWGL 4FFZA 1MCDA 4R83A 4YFLF 3C8KA 2WIIA 4EMZA 2LAGB 1XBDA 5CHNA 3ZTNL 2XWJA 2G3XA 2VDNB 5GGQL 1NFDF 2XN9E 1ORQA 4JFDA 1G84A 4OD3H 3KLAA 4U1SA 3HAEA 5I0ZA 3L8QA 1XSJA 1YNLH 4NO2B 2ICCA 2GJZA 4OFQA 5JDJA 4X7FC 4X5WB 1UOLA 2Z64C 2JFCA 1A6ZB 1UJTA 2FNWA 4NKMA 2VKWA 1F2QA 5EIVA 3BIAX 2GK2A 1T5WA 4HISA 5E6IC 6PAZA 2Z8VC 4LARH 4AQ1A 4YE4L 1LO5A 1G7HA 1LEKB 4CC4A 5DJDB 3KPSE 2VLRB 1N4XL 4BCZA 3MNDA 1JPEA 4MXVF 2GTWB 2J1WA 32C2A 2MIZA 1J12A 1S2EA 3H3KA 7FABH 1EFXA 3CFCL 1U8IB 2IPKB 4G6KL 5DHEA 2XTJE 1GOFA 2VDPB 5IZ7A 2ZF8A 2X4TA 3KYOA 3QCTH 3PIQB 1A7OL 3T3MB 3RE0A 2ZT9C 3BWAB 4FERA 2EDQA 4XMTA 4PGCA 1FZJB 2MRYA 1IL1A 1BF5A 5C0ND 3ZKQD 1YEWA 4KAQL 3V6FB 1UTDA 3ABKB 4EUPA 3MRFB 4Y19B 3LKQA 3PWLA 4FQQA 3VXMA 3ZDYB 3D50A 3AY4A 4AQZA 4YFDB 4OIIL 2WIMA 3ZE1F 2MKWA 2J5LC 1UZGA 3INUH 2NY0D 2WXRA 1RUAL 2HLFD 2PP9A 4EAEA 2WSPA 4M6OH 2AQ2A 2EZ0D 3I75A 4HIEA 2O5XH 3UBXB 4YBHA 5SWZB 4L3CB 4PN6A 1RP9A 1KPVA 2F74B 2Z0BA 3FFDB 3VFOB 1G43A 1AHMA 4ODHH 5HI3C 5I1HL 4QY8B 1ZGLP 1RUMH 3FBKA 5E7FA 2QV4A 1WRFA 4UI2A 5C0AB 1A7PH 2C9VA 5EOTA 4OLZH 1YN7B 1XIWC 3GXTA 4NKDB 4P46B 2WKOA 2CO7A 1HXYA 3QO1A 3V52H 1NKGA 5AW0B 2GI0A 4PJ8A 4PRDA 4PIBA 4MD4B 2OYKA 3DX7A 4JO8A 4JQIA 2WZPD 1VFAB 3MRJA 4XP4L 3QNYB 4OF5A 5JHDD 1HNYA 3GWJA 1BQHA 2ZXBA 2JI1A 1KELH 3D9AL 4TYUA 3VFGH 1C16A 1DFXA 1MY7A 4TUJA 3WY3A 2FATH 4HWEH 1JFQH 4GKSA 2BP0A 2IH3B 4HZLA 4L4TA 7CGTA 3UTPD 2DTMH 4RA0C 5D7JC 3FOLA 3WFDL 2VRKA 2V7NB 4AW4A 3HE6C 1CXKA 1ODUA 3DOSA 3BXNB 3IETA 3NIFE 4R4BA 3LRMA 3U7WH 3N9GH 4J3OD 3BZ5A 2O5ZL 3IJYB 2V3DA 3QYMA 3L5IA 5J12B 2IAND 3CU1A 4HK3N 4I77L 1DZ0A 2XRAL 3FCGA 3TBVB 4BK5C 4TVUA 2R0WH 4A7UA 3T6VA 1DQIA 4Y16C 3G04A 5FGCB 5JQ6H 1X5GA 2IGTA 3VMNA 2BNQD 4NB7A 4R8WL 3ULAB 4LLVA 2LABA 2GSGB 3CVHA 1CFTB 1WO2A 4FP8L 4BUHA 2QPEB 5DVMA 1R34A 1X3DA 2EIJB 3F7YA 1AZNA 3VA2C 1FZMA 3ULUH 2MTAA 1UG9A 4B7LA 5E94B 5KBLA 4N4YB 2QPDB 4QO1A 4Z0BL 1AFVL 3T3PE 1ZT7A 1QHOA 3ZMEA 4IQHA 1P9MC 2IAMC 1U6AH 3D87B 1NGXB 4X5WA 5E1IA 4ELKB 3IBEA 1HU8A 2AXGB 1HXMB 3TEZA 3SDCC 4JFWA 5E2VH 3QR2A 1X5HA 4WW2F 4XO9A 4IW4C 1D7CA 2GI7A 3A22A 1U8HA 4WUKH 3O45B 2YPKA 3V0EA 5JIPA 1SLXA 3P1VA 3V8OA 5FC9A 3VDAA 3CWGA 4LSRH 1NC2D 5LGJB 4X80H 2YLHA 4QXGL 3WJMA 3DJTA 4YSUA 2Y1ZA 3NH7L 4KVCH 1KPRB 4M62L 4FQIL 3IDNA 3UP1A 5SWSA 5EUOE 4IDJL 5DTFB 1O5PA 5JLZA 1LE5A 2HH0H 1IM3D 4DGVH 4WY7H 2FDBP 1YN6B 3H42H 4MJ5A 4WTZG 1KYOJ 5E56A 4YHML 4DK6A 1SXNA 4FQHA 4P5KA 5CN2A 3ARRA 5CU5A 3MLSH 3VYPA 5TD4A 2NUTB 4ISVA 1YNTF 4UCFA 1TTAA 3D30A 3DX1A 3MODH 1OGAB 1O7DC 1IBYA 2MCAA 4APQC 1BXVA 2OZ4A 4MCZB 5E00B 2XV0A 1RUKL 1JZ6A 5FOJA 1A02N 2PMZA 1I1FA 1BHGA 1IFGA 2CHNA 3L5XL 2P43B 5EOCH 5HSFA 3OZLA 3HR6A 2P8MB 3VE0B 1CDGA 3GHBL 1XGPB 2ARJQ 2R7EB 4PJEE 4NNXB 3UIZA 3P11L 3K6OA 1MI5D 4OF6A 2UUDK 3D4ZA 2X4RA 4XN7A 4LSVL 2ROXA 2XHNA 3GI8L 1MAJA 3ABZA 2DQFA 3FRPA 3P4MB 5K39B 1JF6A 3ATDA 1BCIA 5JO5B 3WKML 2VGLM 3P77A 4GUQA 4WI4A 5BO0D 2PUQT 4M93C 3SKOA 1LM8V 1C08B 1ND0A 2WQVA 4DCQA 2MJWA 2PR4H 3SCMA 3WDHA 4Z7IA 1SHSA 4KMLB 3WL9B 3LEYL 4YDLB 1O7DE 2HCZX 4MZRA 5H37G 1VZGA 3AB0B 3I9AA 2OMWA 4MA1C 4B60A 3OF6D 1CICA 5DJAA 4BH8B 4JPWH 1IV8A 3MA7A 1EXHA 4FEIA 1OXYA 3W9EA 3IPFA 4KJYB 1BV8A 3FB7B 4L1LA 4I0CC 2ENPA 1I1AB 2XN9D 3BMVA 3GO1H 4L4VE 1U2YA 1AACA 4S0HA 1UXWA 1H15A 4BCYA 2AK4A 2XA8H 5TE6H 1CFSB 3MDJA 2QQLL 4ZUVA 2HUHA 5JDSA 3V0AC 1TQCC 3GXMA 3H9SB 4DTGH 4NUPA 2R69L 1JV2A 2KQNA 1G9ML 1MLBA 2YQBA 3EJZC 3LKNB 4LIQE 5DC2A 3ARWA 3B3IB 1OTSC 4XCNB 2YWZA 1TZAA 4ZPTB 3MLRH 5LGHH 2GITA 5B1JA 1FVCB 1ZDQA 5D7IA 3HZYB 4HCRH 1H3GA 1QTSA 2HVKB 4GP8B 2GC7C 1D5BA 3M1BB 2BIPA 5GZNC 1UB6B 5HHOD 4KQ4L 4AC2A 2RTTA 2XZQH 3F5WA 3BZDA 1WAEA 3SPVB 8CGTA 5LB1A 3SE9H 4LEEA 4LESA 3FO2B 5D70L 4I2XB 4JM2D 1MVUB 2HN7A 5JW3L 3FMGL 3GMQA 2XXGA 1UB5B 5EU6B 1R3HB 4CC0A 5HBBA 3PP3H 4LBEA 1G5GA 4YHOH 1K4CB 2HKFL 2Y69B 2PXYD 4WSJA 3P0YL 4FL4C 1OP5K 1S9YB 4G6MH 3OAYH 3GJFH 3BX7C 4MXWL 4QY8A 3VRLE 4I0PA 5J11C 2R7EA 3HKZA 4FS0A 4YZFF 5BS0B 5IBLC 5KVMC 4FTVE 5IKCA 3DV4B 1GVIA 3HC3L 4PJXE 2C1OB 2BVQA 3T0EA 1IAKB 3W11C 1NPUA 2ZX9A 1XCQB 3ZHLA 3T2OA 3EJPA 4RAVA 4FLOA 3D0AA 4L8CA 4K7PH 1F4HA 2OL3B 5E6YA 1B6DA 1F90H 1NINA 2OTUA 3S34H 3AG2B 1UZ8A 2EO7A 2AZAA 5I19H 2P28B 5I6XB 4Z7WA 3QJFA 5B38A 1ORSA 2VAAB 1LP9B 2NY2B 1SVCP 3CFKA 1OE2A 1KBGL 4PS4H 4JE4B 4W9LC 3IFLL 4TLUA 1IGMH 4P2QD 4AWJC 4Z7VA 1CE6B 5I2IB 4NXKA 5JHDB 2ZXCA 3D4YA 3TIDB 5JXED 1A0QL 1S9KC 5D7JD 1IGJB 1QFWL 4YHPA 1FH5H 4XVSL 4RAUB 3MVSA 1FL6B 1MIMH 2H2SD 3ARBC 4PVNA 2OXGA 3PP4H 4Y16B 3VNYA 4X9HA 4MLIA 5DLLA 5ID1B 2EE6A 1IKOP 3FB5A 4HJSA 4M1GL 1MWAA 3MOBL 4PWKA 1BJ1H 2PP8A 2FNBA 4R7VA 1E5YA 3RA7H 5IMLA 4JKWA 2F5AH 1P7BA 5EBLB 3NFSL 3ZIMA 5I16B 4BZYA 4XCNA 1SRDA 4P8QA 3MQIA 4XODA 4ZUWB 3U1SL 1B6UA 1KCBA 2VW6A 2AJYL 4KXAA 2ADIA 5D7IE 5DJYB 5H37H 2ADJB 1T22A 3MYJB 3QI9B 2W9DL 3NG5A 3ESMA 2YARA 3W56A 4D7BA 3ZDZF 3LRLA 3NSXA 3QI9C 4OFVA 4JW3A 1RUPH 2DF3A 2ATKB 3X17A 2F7PA 3TO4B 2FYVA 4H40A 5HYSA 1UWFA 1UXMA 2QSCH 1R5IA 2A6DA 2C7FA 4PY7B 5D1XC 4EI5D 3LRGA 4P5RA 5G4MA 2OMNA 3CIQA 3QORD 4OGQC 2GCYB 1UCTA 1RIVH 5FDWB 3DBXA 3PFQA 4Y0GA 2JE8A 2FHBA 4R97B 4V1DB 1YLBB 1EEZB 2PTTB 4J7RA 3DOSB 5AKSA 1VACA 2QLVB 4PY8J 2BP3A 4M7KL 2WMPB 2VDPH 2CD0A 2CA4A 3DTDA 1BYOA 3MRDB 1J7VR 1LK2A 3CVHH 3BQUC 4BFOA 4HJTA 1X5ZA 2HH0L 4JY4B 4LCWD 3T5WA 1BMGA 1PAMA 2BCKB 3J7HA 4XVUC 4NUJB 2VLRD 5EBWB 2DBLH 1NFDE 3DHMA 4OZHA 2IWGA 4I1RA 3EGXB 4Y19E 3OMAB 2FJHB 3B43A 4JNXA 1NANI 2AITA 3D4GA 4X9FA 3E3QE 1J8RA 4M8QB 2BWDA 1FNAA 1XZWA 2BP8A 4P46A 5EN2B 4NFCA 1FF5A 1RK1A 1OGTA 3VTMA 4HP5A 5IQMA 4A39A 4ZFOL 5DWPA 3BVXA 1JHKL 1T0MB 4NAQA 1QAWA 2G4GA 3SHSA 3JWOC 5BQ7B 2NW2B 2DN7A 3A0OA 1JZ3A 2EICA 2IBGA 2EEDA 4IK6A 4YL4A 4YDKH 5EZIH 2AK1H 4ANKA 3DUSA 1DBAH 5DZOA 1A1NB 1DBAL 1RPKA 1BD2B 4GAYA 5HHNA 3GSNB 5AG9A 2XKSA 5B1BB 4F33A 4UOW0 1MJUL 3VQLA 3D34A 1MAKA 5CP3H 5M94B 3NIDB 4G6KH 4MMZB 5C07E 4YXLL 2K8QA 3BAEL 2R15A 3EIFA 3PDOB 1QNZL 1KYFA 3A4EA 5DVNA 3KR3H 5CWSA 1JZ8A 1IGTB 1DVXA 2GJ6D 3ZT6A 3MA7B 3ESPA 3P0VH 3MOQA 4B41A 3MRKA 1HQRB 1MELA 3BD5A 3BN3B 3HE7A 3TA3B 2BNRA 4XBMA 5GZOD 1O6SB 5SV4A 4QRUA 1P7QA 2OQJA 3VYOA 1CR9H 3MNVB 32C2B 5GZOC 4XI5C 5BS0D 3X3GL 3QYNA 1ERNA 4AQEB 4MWFA 4BBWA 1UXLA 2JI3A 3K72A 4Z7WB 2NY6D 3ARGC 4PR5A 3GXFA 1ITCA 1IBDA 1K8DA 5C09A 2OL3L 3DJRA 1XH0A 4J3UA 1W72B 3PWPD 5I28A 1S9VA 4N2IA 5M7QA 3A21A 1TUPA 4G6FD 4OJYA 5EO9A 4JDZB 3A67H 1WCBB 5D93B 1XQ4A 1ZIBA 5C6TH 1TQVA 1T7ZA 4WEMB 4NFBA 4EKJA 3QFJA 1P4LB 4NYLB 3WNPA 5FYKU 1BAWA 1EGJH 3J07A 1XGUB 4O2EB 4L1TA 3KNBA 3LCYA 4OCYH 1HNGA 1QVOB 1YEIH 3V52L 2Y7OA 1HVXA 3QIWD 3RU8L 4IHOB 4IMKC 5H94A 4AMKL 3DPBB 4UNUA 4U1KB 3GSRB 3R0NA 2Y36H 4E9VA 5D1ZD 2KT6A 1XF3A 4Y8AA 3WEXA 3KNBB 2F1BA 3FU5A 3AG4B 3OSVA 4L23A 4Y5VA 1KPVB 2YXWA 1UJ3A 4HBQA 3HNVH 3TNMA 2X0WA 3BZEB 1HHGA 1QI4A 5EOQL 5L2JA 2IADB 3HC0B 3C6LC 2D0GA 4AKPA 2XTJD 2ADGA 2ZOKA 4MCYA 4O2CB 2CDFB 4MQ7A 4AQ8C 1AYOA 2GIMA 3W0WA 2YMTA 5DEZA 4P9HC 1GYVA 3R8QA 1X5XA 3R7RA 1NEUA 3D39D 4N24A 4WWID 3SDAA 2K45A 1FBIH 1GJUA 5EO0B 3RWIA 4WJ5A 3MBWB 3FO1A 4NHUB 3DI2B 5E5RB 1N7MH 3U7YL 2H1PL 1T03L 3AWEA 3KYNA 4U3CA 2YN3A 3QWRD 1QMUA 3QSKB 2HX9A 4U1HA 5I1AA 2BY0A 3HZKB 1SJEB 1MQ8A 1ZIAA 3O4OC 1ZAGA 2A9NH 4KITB 2ZX8A 2XXCB 2WXGA 3Q43A 3KPOB 1NGPL 4JZJB 1NBYA 3H9SE 4JN2B 2B3IA 1S5IL 4YZWA 4UIKH 4PJ6A 3ZHKA 4D2NA 1KLUB 5ID1A 1H3VA 2ZKHL 4M9OA 1DEEB 1K3IA 4KKAD 3V7AG 3V6OC 5ISZE 2FO1A 4LL9A 4RMBA 2G2RB 1ZS2A 2MMXA 4M9PA 4NZUH 3FO9A 3QI9D 1QSEE 2X3AA 3VFRB 3RL2B 3TH2T 1ZXQA 2E8YA 1IGCL 1G5AA 5IIEB 4IJTA 2GSGA 2EC8A 4CVUA 1QR4A 3B9KC 5FYKE 4QCIB 1MJ7H 4GSQA 4HUUA 2ZOLA 3MO1B 4I5BB 4PRIB 4GO8A 3D69A 1GTFA 3IXTB 3QG6A 1AQHA 4PJDE 2WB1A 2WAQA 3MGAA 1S5HA 3SBPA 3GUFA 3BUDA 5F7EH 4BQBA 1QR1A 5JOFA 4JFYA 1OZTG 3DYOA 4DN3H 2FATL 3QS3A 4Z78A 2HG5B 5HVFB 4L5FH 4QRPB 1JN6A 3ABGA 43CAB 1NDTA 4X5QA 1R75A 4A66A 5D9SA 2GJRA 4BIKA 4XOCA 3L95A 3PAYA 1NJ9B 2LVEA 3G5ZB 3VXME 3LY6A 4B9PA 4F57L 4A2MA 3DTUB 1VACB 2GY5A 5AOIA 4PJDB 1XB8A 1S7XA 5IF0B 5J12C 4E41D 4XP1H 1F3RB 1TJGH 2JKJA 4FQJL 4XNZC 4R7DB 4XPAH 12E8L 3PL6A 4XB8A 4F15C 12E8H 1XSIA 5EORL 3ABMB 1FJ1A 1AHWA 1E43A 2EO1A 3NN8B 4FXGC 2OMVB 2HLAB 2HWZH 3GPSA 1TCRB 3QXDB 1J1PL 5L4IA 2HSIA 3HI5H 2HRPL 5HP5A 3AC0A 1I8LC 3R4DA 2WV3A 1NSNH 3QQDB 3TJEH 1NDMB 2VLMD 1X5JA 5HYIA 1A4JB 3GRBA 1SY6A 5FHAH 4PD4K 4TM9A 3CQFA 2CU9A 5ES4B 2I9LA 2ESVE 4WI5A 2AERT 1JNHB 2P80D 4P23B 4KKCD 3VXSE 1G0YR 2VMJA 3EGXA 3SKMA 1HOEA 2AZUA 3VVWA 5FR3A 1HJBC 3KXFE 5FS5A 3ZKMD 1CLZH 5D1QD 4KKAC 3TPUA 1JYWA 1ZY9A 4RGMC 4LF3A 1KNOA 5EDXA 3HBQA 3P2DA 4OZ4B 3BISA 2AJSL 2X53A 1NGYA 1XMEB 2WBJD 3F7LA 4QKXB 1MFEH 3MNWA 2EEFA 4PRPE 4XB7A 2H1LM 3POCA 2O61A 5PCYA 1WZ1H 4KZEL 4XMUA 3ZRFC 3MV11 4Y2OB 4QJ4B 3DVNB 1VCBC 5M95B 3QHFH 4AJWA 1FNSH 3AU1A 3SY6A 4G8GA 3MRHB 3Q3GA 2H3NA 2WKGA 4I89A 4LE8A 1E30A 3BGFC 1OIOA 3GTTA 2XG5A 1GGIL 4DH2A 5A7EA 2R0LH 5TE4H 1R3LA 4WVRA 4X7EC 1XT5A 4HIXH 1A7NL 1NIBA 1MXGA 1AFVH 1L5GB 1FORH 4LGSB 1T83A 2YA0A 2KUTA 4QRPE 4PJAE 1NIFA 3P3RA 3WHE1 2E6JA 4FTVA 2WK2A 5FM4A 4F7KA 1RU9L 1BX2A 1J9TA 2Z31D 4RX4D 1Q94A 2V5SA 4HPHA 2GK0A 1JWMA 2IWKA 2Q8BH 1QTYT 5JXAL 2UWEA 3QJXA 2WBKA 3TH4T 2GIXA 3QZLA 3LRKA 1I9JL 1IEBB 4MDJA 5E6IB 3JBG7 5ALCL 1ZT4B 4WF7A 4F3FB 4HPOL 1EVTC 2ISDA 1BSIA 4ONOA 4UNTA 1EJOL 1NKRA 1IBHA 1OTTD 1JTPA 5HDLA 1PS3A 3RVTD 3CFDA 4NPYB 1WZKA 2LAAA 2ITDA 4MDIB 3CSPA 1IGYB 2DWEB 4A7GA 3NESA 3LHAA 2OS7A 4HLEA 1VSCA 4KVNL 2A3TA 4AZ8A 4I18B 3PJSB 4TS6A 4JUSA 2QSVA 5DI8B 3L3JA 3RWHB 4N0CD 1JMZA 3WTUA 2Y25A 4DP7X 1I85C 4U3XA 1SHXA 4NSKB 2O6FA 1KJ2A 4HXBL 5HVHB 4KZDL 1JFQL 1IBBA 4EI0A 3MV9B 3VD4A 1Q0XH 2CO1A 5CJ5A 3OXSA 1I8MA 3RWHA 1QFOA 4ZMLA 1LILA 3D3VB 2DQEL 1JIBA 1RL1A 2BVOB 4R7NB 1XAUA 3DBXB 5DD5L 3WJLC 3HOGA 5F0LB 5F8RC 5GRWA 3K46A 5AAWC 1SQ2N 4NJAL 1LE9B 3VXQB 1WD8A 2C4FT 3EBGA 2V2TA 3BO8A 3US1A 1IJ9A 1N8ZB 1IQWH 2AQNA 2RHEA 4LPXA 3IMWA 4BELD 5ITBL 1KIRB 2V2WB 5DD6B 4U1HB 4YDZA 3U46B 4FI7A 4PBDA 5F7HA 2ZG3A 1J87A 5E5MA 1W8OA 4OFDA 5C1MB 3U1SH 2EE3A 4NHUA 3VO0A 2CWRA 2X41A 1DSFH 4PJIF 4W81A 5FA3A 2F2HA 5DK0B 3EUDA 5IW6B 2F58L 3D3VD 1G9HA 5C0BD 5EU5A 3VFUB 2V9UA 1U0QA 2BVTA 2XOTA 3A6BH 3LNFA 4XNMB 3A6OA 4P9ML 3OKEB 4LU5H 1S3RA 4R2GC 1DJSA 1CO1A 2MNWA 3RNQB 2YD9A 4JZJC 4LVNB 4YH6A 5AWNH 3BIKB 4BFKA 4DN4L 4EUPG 3DHJA 3VFRA 1IAOA 3GSXB 4NQUA 3P9MB 3QUYB 1TVDA 5BUPA 1JPST 1MWOA 4C83A 2DTML 4RGOL 2ZG2A 2AV1A 4K8RH 3KGSA 4N0UE 2SODB 2HJFA 3TIDA 4M02A 2H2PD 4N3TA 4HAFA 3S96B 5DC0A 4YHPB 1C12B 3UXFA 5FB8B 5E2WL 4LVEA 4ZNCD 3VI3A 4JEGB 1XCWA 4IBLT 2YPLE 1NMAL 5E8NA 4ZSOE 2H0EA 2UV3A 4PJ8D 2VZSA 3AM8C 5JYLA 1UM5H 3CLWA 4JQIL 5KVDH 3DPDA 3GPEA 2NY5C 4FFYA 4NQSB 5FEBA 1GGCH 2I07A 1F1DA 1U3HD 3LIUA 2OMZA 3STZA 2MCG1 1R46A 1V3KA 5G5DB 2J8UB 4AGQA 2ICWB 1MRCL 2DKSA 4JANA 3VFMB 2AJSH 1NUFA 1QX1A 1XFPA 3FDWA 3PXHA 5DS2A 2FT8A 5KJ4A 2PPFA 4MJ5B 5I5RA 3QNZA 3AREC 3U2IA 2IPUK 5GS1B 3VX1A 2F19L 3PJNA 5FUOH 1OHZA 1CI3M 1AAJA 4M7LH 3NCBB 3HE6A 3LPPA 4D8PB 1LYQA 4XO8A 5C0GB 4WY7L 1UEMA 4X6EA 2H9GB 2MHAB 3KM1A 4GJTB 5KW9L 1YO4A 1CZ8H 1AZCA 5IOKA 3NJHA 3FAXA 2X1XR 1CGSH 4TV3A 3QS2A 4NWTH 1A6VH 2HRGA 5FO8B 1AH1A 1ZV9A 2NCEA 1CMOA 2E7DA 2BIHA 3S37X 6PCYA 3MLRL 2GW5A 2ITDB 4MDIA 4MTMA 5GGRY 3ZVVA 3DK0A 1A7OH 2CO6B 4XN4A 4GEIA 5T5FH 4Q6IC 1T3FA 3NIDF 5CBEA 5CD5D 3S8FB 2XZCH 1TU2A 3NFPB 2YD0A 5E4IA 4U7KA 3L4CA 5CZVH 1DVZA 1IFHL 2LVCA 3EYFB 3GSVA 4JRXB 1BPVA 3CFCH 4H1LA 1Z3GH 1ZTMA 1WZAA 3DURB 4FMFA 1FH2A 3QDAA 1GPOH 2OMUB 2BP8B 3F7RA 3ORJA 4HCFA 5DZJA 2X4UB 1JGIA 1IAOB 4YXHL 1JPTH 5I66A 5C70A 3RPIA 4EJ1C 3IVKB 2JKSA 3FUHA 1OGAD 4LCWB 2YRZA 1F4XH 4JRYE 1KTDB 4TUOA 4YLQT 4FKHA 1MW2A 1P5UC 4KK9D 4OU3A 4F58L 4A04A 3CJJA 1LDPH 2F7IA 4JUTA 4LNVA 3ILDA 3KS0H 4OCWH 5GRUH 3L17A 1EHAA 3HE6D 3KXFB 4LVOB 3U6RA 5JOEA 3SDYH 5A7BA 3IDXL 2CG9X 2J1YA 4NEHB 5IFJB 1H6EA 2H3KA 1EDHA 4P9MH 4HIPA 4F80A 1U8OB 3BAIA 3F83A 5CJOL 3C6SB 5E51A 4ETQB 3U46A 5IP4A 2AJUL 2BNUA 1WFOA 4I0KA 3ZTCC 1ES0B 3DX4A 4HOXA 5B1AB 1BQRA 4NO5B 1TYJA 1WBYB 3JVGA 2HKHL 5JNYA 1NFAA 3QORC 4C58B 2FB4H 3P2TA 2VLRE 1J1XL 4F7TB 3W5NA 4HUVA 4KC3B 2CKBH 3O3BB 5F9AC 1ECYA 1Y18A 3DIDA 1X7QA 4I88A 1LQBC 4PB9L 5D2NC 5GS2H 3K6SA 1NEZG 1ODAA 1BQ5A 5MEPA 2WWMC 1F6FB 4QCIA 1QASA 4AUJA 2EYSA 3ES6B 4K94C 4OF8A 3VXUA 3ZDWA 4NM4L 1JPFA 3R8BB 1JGUL 3EJUA 4M43L 4GFTB 3Q2VA 1DQDH 4R7LA 4G1EA 3VE0A 2Z31C 4OBSA 4YDJB 3HB3D 3QFDB 2J5WA 3ZT7A 3U30B 3WFBH 4J3TA 3WTWA 4S2SA 4FXKC 3S96A 1C7SA 1QZNA 2CM6A 4TULL 3OD3A 1MVYA 1B88A 3Q6FA 4FQCL 1CI5A 1INEH 1B4JL 2Y7SA 4EZMA 1Z9OA 4W93A 2FX9H 1K8IB 3MLVH 4N2AA 1JPGA 3QNXA 2WXIA 4PJCA 4PWIA 4U6VL 3VXRD 3BP5B 3RVTC 3STBA 3W38A 2ZJSL 2LHAA 4XXDA 1U9KA 2NZ1A 3RDTA 5L7XL 3O2WH 1C5BL 4D9RD 4YDIL 5E0QA 2DQTL 1SEQL 2GSIA 3EYUL 3QQ3B 4U6TA 3RIFK 1JUFA 3F7PC 4I87A 4M43H 4XVUD 3ISYA 2VDQH 4KFMA 1OHQA 1FQ9C 2F61A 4Z3TA 3ARUA 2Y7MA 4PJBE 2Z4QB 2LGNA 1AGFB 1I1YB 2E59A 3PCYA 4FTDA 4NZ8A 5IT2L 4JAMA 2D03H 2EYTB 2OX5A 4N8VB 3BVDB 4NN6B 5ILTL 3MHZA 3TBTB 3VSTA 3MGOA 5GGSY 1CD8A 4P3CH 4YBLC 4KHTH 4AEHL 1GZQA 1S5IH 1TKWB 1MCIA 2HJKB 4OAWB 3QE5A 4MB3A 4JG1H 1KZYA 3QUXB 3RFZB 1JK8A 1QFHA 3MRKB 1B3IA 3MLWL 2J21A 4Y1AE 4JM2B 5EWIL 2YLKA 3AT0A 1EX0A 2EDEA 1WJ3A 2AQTA 4UTBL 3ARVA 4HLZG 4U7SA 1RIHH 5KANI 3L4VA 3SJVD 4OCXH 1YMHB 4V2BA 2E75C 1VGEL 3G04B 1G1CA 3F3HA 2QHRH 4IRSD 3L3JB 3TT1L 2V6HA 1Y0LA 2DLTA 3FNKA 3TT1H 4H1LB 4TSAH 1M7DB 3KMDA 4JGMA 5DR5L 4YXHH 2XWXA 4FFYH 2WTRB 4LNRA 4QF1A 4JG5A 4IS6A 1T0NB 3UL4A 3T0ED 5BVPL 4G71B 3DXAD 4LCUA 1LMKA 4PJCF 4ENED 4HWEL 4KTEH 1O7VA 2FECL 4F8QA 3EOYG 3L4TA 1N64L 1UWXK 3MGTA 5ADOH 2AK4B 3OMNB 1JZFA 5T3XL 3K6FA 2UZIH 3ML8A 2QFPA 1RZQA 5HGHA 1HHGB 3BKCH 5CIPA 1F58H 2R4SH 4M1CC 2WMPA 4QLRA 2H41A 3UZEC 4FJZA 1V10A 4ZMAT 3GF8A 4JFXA 1KT2B 3CH1B 4HWUA 3THML 1KPRA 4OV5A 1I82A 2PWFA 4I9WE 4FLSA 1KJ3L 3CMGA 4LEBA 3VCLA 1HZHL 4FULA 1NC4D 4NNYB 5I6MA 1JPSL 1IBGL 5AYTA 4F1SA 1I75A 1FFNB 2E0PA 5JHLA 2NMSA 4I2XA 4M62H 2YGPA 4PRNB 3I6KB 3B6SA 3BH8B 5CFHA 3OGOE 3WO4B 4PRHE 1JZ7A 2FK9A 3NABL 3O3DA 3V4VA 2J6WA 4QHKI 4FJYA 1D6VH 3G5XB 4B5EA 5BOPA 4A67A 1PMYA 1RK0B 3T0WA 1S9WA 2Z1PA 3LKSB 4Q6YA 5DYOB 5IOPB 4PG9B 3DX8B 5E2VL 5FUZL 4PV9A 4KK8C 3CDGB 1KTBA 1JXKA 3QEHA 1YG9A 3WENA 3QA3B 5F0JB 4X9IA 1TZHA 1HDMA 2O93L 2D7OA 4L1SA 4P5TB 5SWQA 1FORL 1SF5A 3C87A 5HHXL 5G55A 4IIZA 4CVXA 3MA9L 3NPSC 3T8XB 1G7JA 3UCQA 4YDKL 3V9EA 3IRPX 5EEWA 2XN0A 2KZBA 3H3PL 1GJIA 4G82A 4X4XB 2F8XC 1X5MA 3W0WB 4U1LA 1U8OA 3H9HA 4X9BA 2OYPA 3T6ZA 4E68A 4WI9A 4Y89A 1CK0L 1KYUA 1K5NB 1U8LA 3PDOA 3Q3GB 4BSVA 1VRSA 3MXWL 1EFXB 4RH4A 4FI8A 4XE5B 1JHLH 1XTMA 5CCGE 3MBEA 3U30C 3UG4A 4M48H 1FVEA 3BLBA 3ZX1A 5A3ID 3GHPA 1CXHA 1XO8A 4NO3A 1W91A 4R97C 2G5UA 4OLXL 4TQEL 1AR1B 1R17A 1MFNA 4TVPE 1RZPA 5MERB 3DECA 43CAA 5D96C 4K5LA 3T0XA 2M83A 3WOVA 4LSPH 3QUXC 4N0YL 4PD4J 3RFZC 1FE8H 3KVQA 2OSXA 5T1KB 3UROR 3OR6A 4KH9A 5BZDB 5MI0C 1SJMA 4PJGF 4HHGA 2O5YL 5E1HB 1ET5A 2VOTA 4TSBL 2DAVA 3TEWA 3KWWB 1SN5A 2F68X 1KBGH 5ACZB 3O3BA 4P2RA 3ZKSD 5CLYA 3ZMRA 5DVPA 4U6XB 4JM4H 4ZO8A 5HHPB 3IE4A 4PAZA 1UM6H 1T6VN 1U93A 5C0NC 1QRND 3OHXC 2D7PA 1T80A 5IK3B 3ECUA 3I9PA 5HJ3A 3K0YA 1KCVH 5TQ0H 5HI5D 2UY6A 1PCSA 5J1AB 5SWZA 1RZJH 4OZGF 2B3RA 4G80B 4ZG1A 2ZYHA 1OAQH 4QHNA 1CYWA 4UAOC 4HSCX 2N7BA 4FQXA 4CGUB 2GCYA 1AG0A 1I8AA 4WFHD 2WVVA 3KYMA 2N0MA 3APNA 5T1JA 3VI3F 2O5XL 4XRCB 4Y5YB 1E27A 4QRAA 3B1UA 1CC3A 5DJCA 1BGXH 3T4YB 3IU3B 4CDHA 2F8OA 2R4RL 3CD4A 4GS7C 4EIGB 1BM3L 3SYCA 2CPUA 3PL6C 3ZYJA 3FH8A 5D1QB 3WNOA 1FG2B 4ALAH 2O5NA 4ANWA 1QBML 3RGVB 1DSYA 1N5AA 2NY2C 3P9LB 1N2RA 3I9GL 3KLDA 4A7SA 3IRZA 3IU3A 2LU3A 4N28A 1X5FA 4P05A 2VLLB 3KAAA 1A3RL 4HC1L 3SDAB 4AGMA 3MJ8A 2BSCA 1HAUA 1EXUB 5ABDE 1D7FA 5TPWL 1KIRA 1JZ4A 1NCIA 2AEPH 5F7YC 1SVZA 3S36X 3TP4A 2XFXB 3MLPA 2OCFD 1OGTB 4HXAH 1WV7T 3UTSE 3C8HA 3I02B 4U3SB 3FRUB 4A6YA 5C7ZA 1E8YA 1T0OA 5KJ7E 3X12B 3HG2A 5CGMA 4BFBD 5EV7A 4HIXL 1R6VA 2OMUA 2GQHA 3UH8A 1MQKH 1BAFL 3ARYA 5C0AD 4D9RE 3EO9H 3AT8A 1E4XH 3SE8H 3NZSA 2B77A 2P3YA 2B59B 2B9BA 2CO3A 2Y24A 3BAEH 3Q8FA 4U1JA 3SE6A 5E8DH 4R0LA 1X5LA 5C2BH 3WXVH 1ZK5A 2X7LB 1TOXA 3MBEC 4TN9A 5F1IB 1GZPA 1L3WA 3LH2H 4FQXD 1FSKB 2PYEE 3ZO0A 3WE6B 4FKEA 4DPAX 2MPAH 4Q9QH 2GJPA 4OH2A 4TNEA 5EU4A 2WD0A 4XXCC 2VLJD 3ZDXB 1CGSL 5FYKD 1KB9J 4AE1A 3P40A 3W0WD 4X4YA 5IJBC 1AG6A 2VITA 4GYBA 2CGZA 4WWKC 1BQUA 2JIXD 4DEPB 4J3BA 2YD5A 2VDKL 2A77L 1YAIA 2WUBL 4WHYH 1PX8A 3HN3A 2IOOA 1MREH 5EC2B 4JGUA 2IFFH 1MDTA 3IDIB 1HK6A 2H5UA 4P4KD 1HCFX 4RCAA 5CGYD 3D18B 5CO1A 3JV5A 4P2AA 2ERJC 4A7GF 4R7DA 3OQ3B 3AADB 3HLAB 5DS1A 3P11H 5I5IA 3QQ4A 3ZTJH 4K5NA 3QDMD 3SQBA 2QPUA 3FW6A 1LE5B 4RIRB 4NOFA 5DZNA 4ABQA 4ZOCA 1BLIA 2Z7YA 4JDTL 1RUKH 3EYQC 4LOFA 4DT2A 5BVJB 43C9B 1CURA 2K9UA 2GJ6E 1ZHKB 1NAMB 2WLYA 4HS6B 4JKKA 4YHKH 3N3EA 4KK6D 15C8H 3BP6B 4WU7B 3STLB 5DUJA 1OOWA 5IMMB 3UBXG 5HTSA 2QADC 3K8LA 3P4LA 5IOPA 1U58B 1F11A 1ETA1 4R5VA 5KBKA 2XNAA 3QZMA 1PZCA 1D7BA 2GJZB 1PGRB 5BO1L 5AVTB 3U6XS 1SNRA 1A4JA 4AY0A 3LS4H 2J88L 2CO6A 4MKMA 5GIRA 5SWSD 3G5XA 5I18L 3RP1A 4TSCH 4LDOB 2YC1B 2E9WA 4KQ3L 3VW3H 1R5WA 5SWSE 4X98B 4H26A 2YBRA 4XMXA 2FZ3B 2WP3O 1ZLEA 4KNTA 2B4CC 4NKIL 3MZGB 4JKLA 4MAUH 3JWDC 3QCVH 3O3AB 1IGIH 3HS0C 4LLMA 4G6FB 2YK1L 3TA3A 1VGKB 2BCMA 5I8OH 1PLAA 1Z9LA 2G9HB 5IW1B 3H9ZA 1F3DJ 3AG1B 1PDKB 4GINA 3VXPB 2P42B 5I74C 1A47A 1U3HB 1BBJA 3BZFB 4IBZA 4XN9A 3U0WL 1CN4A 3L95B 3QJOA 3G5YB 1C08A 5LBSH 1BVLA 3DO7B 2IANA 2GTWA 4ZDHA 5IROA 5T1DH 1OP5H 4MZ2A 5K9OA 3GJFK 4X4KA 1J5OL 1ZHLA 1MHCB 1TVHA 1A7NH 5EC1A 5F1NA 2FT6A 2AV7B 3CMOL 5F96H 1WTLA 5IMKA 3KPLA 4L48A 1NLBL 1ML0A 3KWWA 4LMQI 2HFTA 4HOMA 5HI5C 1ETZA 5K59F 1IGIL 5J13B 3G6JF 1OP9A 2XQYA 2XX0A 2IV8A 4YSQA 5AW1B 3QEGH 5B1JC 3ZE2F 5DURD 1KIPB 2OBGA 5T1KA 3O11B 3VXSB 2VZ3A 3FU7B 1NCDH 2EADA 2IQ9H 3BVWA 5DDHB 4Y9EA 3U9UB 4I5BA 3LYRA 4LHUD 1E4JA 1MVUA 4D3CH 2JQAA 1XF3B 4AJ0A 3IMSA 2QVIA 3HI6H 1L3NA 2CKBA 4B50A 2XT1B 2X2JA 2DWTA 3CUPB 3O6FD 3QDGA 2IAMB 1PEZA 5K69A 1LDSA 1OWRM 4Z7UB 3H56A 1ZE3H 4JRYD 1JZJA 1TMQA 2WW8A 3MLTB 4IKLA 5CKGA 5ICXA 4F9PC 4CGTA 3RVXD 3L3HA 1LP9F 2CK0L 4UOZA 2VW4A 4NO0A 3BEWB 3JT2A 4P2OB 2BMKB 3BVNB 4LSDA 5DLMH 4YHKL 2WXKA 3RWDB 1H8SA 1EK3A 1G7JB 3ZKND 2MOGA 2H3NB 1HESA 2NQDA 1KJVB 3FUIA 2DQEH 4EN3A 1ND0B 5I1JL 3C2SA 3TZVC 2H8PB 1N5AB 4UU9A 1HEHC 1QHPA 2V7NA 3NFNA 3D48R 4XCEA 1S7VB 4DQAA 3UP6A 3TU6A 1L7TL 1OB1B 1PLGL 1WFIA 2R0KL 4HX1A 5HHVH 3CZLA 3E0GA 3ZLQC 3GSNA 1D5IH 4NM8H 5T33L 1E5ZA 1UQSA 4PJ5B 3TIEB 2X6VA 2GBVA 1MZZA 4GXFA 3C8DA 1NGZA 3QZOA 5F0PB 5BXFA 1LK3H 3T77A 3GO1L 3RWIB 1MI5B 2BK8A 1DQML 2F5AL 1J1OH 1IKFL 2CHXA 2VDOH 1WT5C 3INUL 4RZCA 4W4OA 5CJOH 4Q6IA 2EEBA 1EAJA 1IE4A 1IC7L 1RV6X 2XN2A 3DX8A 2F58H 2C4XA 5EUOF 3FQUB 4FNSA 1RMFL 1NLDL 3IWUA 3I3BA 3TCLA 1A6WH 4ODSH 3FRUA 2R56L 4A6YB 3K6DA 1NBYB 5TF1L 3L48A 2LU7A 5DMKB 1N67A 1YEKL 4P4KB 3X11A 3B9AA 4G9DB 4GAFB 4PGDA 3F04A 2K70A 3K4AA 4ZYKA 2HLFC 1ZA6A 3DOHA 4N6QA 3B83A 5AW7B 3L13A 4U6HA 1UT9A 5MEPB 1U4FA 3Q5TA 2QJDA 3QWOA 3V5KB 1HHHA 1SYVA 3KVDD 3QUXD 2B15A 4H20L 1Z0MA 4OBRA 5FV2A 1H5BA 2ZKHH 4F15B 2EVJA 4TQ8A 2VLME 4HIIB 5CJXC 2GHZA 4JE0A 2UXTA 4DP9X 3WJMB 1QLRB 5ALBH 4NO3B 3WTVA 1D5ZA 3VWJB 4F8LA 2R1YB 2M1KA 3HHSB 3L3OA 1E9QB 3WLBA 5EF0A 1S7XB 5H4YA 3DI3B 1BBJB 3EH4B 3HCVB 5I1LA 1DDTA 1II4E 2H7WA 5HYQB 5IFJA 3I50H 2LU5A 2ZUQC 1FVDB 3OLIA 3K6NA 1HXYB 3CVHL 4G43B 2ADGB 2ZOKB 1MHEA 3EYSL 4G3YL 4MCYB 4O2CA 5EPMB 4WFHE 4KMTL 5J3HC 5I30H 4R84A 5EU7E 5ISZA 1A8ZA 1ZHBA 4BA0A 3DDGA 3LPGA 4JLRB 5IUSA 4B0MB 1GIGH 4FE9A 1IC4L 2FJGB 3FTGA 3V4PA 3B9KB 2PWGA 4V1DE 2JJSA 3H4HA 4N5UA 1OO2A 4BE5A 1OAXL 4QRSB 3D1MC 3PRZA 1HNFA 2XV6B 3QEQD 1VEOA 5DYOA 5F7MC 1Z3RA 3SB3A 2X88A 2R29H 4JREC 3RVUD 5KSAA 1NEZA 4W9GC 5IEKA 1LJMA 4JPIA 4RMSA 3V9CA 3QQNA 2ZOTA 4HIHA 4KRPD 3WSQL 4Q2ZB 1WAAE 3I6KA 1MG3C 1KPUB 3S36H 5J8OA 3U83A 4PGEB 1R0AH 3FOMB 2DQHL 5IVOA 4JJHA 4RESB 1TZGL 1G1YA 4IJ3B 4G8IB 2WXJA 2NT0A 2CAKA 1CFNB 1RLBA 2VW7A 3PWPB 4UMSA 1ZVHA 2OXHB 1UZ8B 4I0PC 3CXDH 2O5YH 3T71A 2NY6C 1FYTA 3ZZSA 3GJFB 2E9JA 3SBQA 1M71B 4HJGB 2HPOA 4GP5B 1AJ7H 2X4TB 4YX2H 1WC7A 2ATPA 1O6SA 5AVQB 5HGAA 3VSQA 3ROLA 4EVNA 2W94A 5IY5B 3GDCA 3HLKA 1FFRA 5J57B 5AW9B 1P84J 4LCYB 2FLRT 3FO1B 2G9HA 5FDYA 2IH9A 4CKQA 2W9EH 1KLGA 1MJJB 1QSZA 1TQCB 3DVIA 5AOMA 3X14B 1UH3A 4LLUB 5I1DA 5F7DA 5SWZE 1PZSA 3ISWA 4Z78B 5AB2A 2K6WA 4M4RA 4HULB 1I8IA 4XPFL 2WXPA 1RFDH 2A0LD 2XWBB 4FYSA 1FNGA 4GSXA 1K4DA 1JYNA 3FU7A 1WFUA 1NCGA 2UX7A 4RWYL 1QEWA 4HUNB 1MFCH 1OTSD 1UWEH 4GAJH 1ZTXL 5GSRB 3BWZA 3P3TA 2VR9A 4P2RE 4U1NB 3TYGH 1KBKA 3EHBB 1TTCA 4LASH 4WUUA 5KSBA 3I6LD 1WA1X 1EAPA 4YDLC 1MFAL 1UB5A 3FO9B 5EU6A 1DUZB 1GGBL 3H53A 1G7LA 4D0DA 2HLAA 1UT1A 4PBVC 4K4KA 1YQVH 1MCKA 3RUGE 2QFRA 3MRPB 3UJTH 4MQSB 5KSVB 2OTPA 1HKLH 3W2DH 4DZ8B 1THAA 1JOIA 5ABZA 3WKPA 4AYMC 1C5DA 1UB6A 3GFUA 3NJGA 3P30L 4ZD3L 1JYVA 3JWDH 4PTUA 1U8MB 2UWEE 4NT6B 2F53A 1INEL 3M1OA 2X1WL 1WE5A 1FGNH 4H8WL 3CU7A 1UH2A 4BYHA 1D5XB 4LEXL 2IXQB 1CD0A 1GGBH 4FA6A 3ARED 4CSTA 3BT2H 3JVFC 4WU5A 3LB6D 1HJCA 3GSUA 2Q1EA 3LEVL 3NSCA 4N6RA 4Z1PA 1ACXA 1AGFA 1I1YA 1GGYA 5E5MB 3APFA 5LGHL 4M7KH 3HNSL 5FYJD 5CINH 1DJIA 3TZVA 1EJOH 2GBAA 3Q2NA 4Z7QE 3QA3A 2VAAA 2JCWA 4N2EA 4DEPC 4JVUA 5HHMB 3OB8A 3KLSA 3RVXC 3LZFH 2BVQB 3T0EB 5C9KA 1UM5L 4O4YL 2WUCL 3WTTA 5AW8B 1DUYB 4N1HB 3SO3C 1OEZW 4LXFA 3MKKA 2VAJA 3AXLA 3CFBA 3OWEA 4HKXB 2YKLH 5DHDA 4WQOA 2YD1A 4PGBB 2DQUH 4Z7VF 4DVRL 2NYZA 3ZRCC 3T1FB 2Q0ZX 3D2UB 1YA5A 3K7UA 4F9PA 5HJDA 1XH2A 1CF1A 5BOZG 5F7KC 3CFUA 3FTGB 3GSQA 1HILA 4OKVA 5E99H 3UJIH 1HQ4B 4BH7B 3GM8A 1ASPA 2G2RA 2GJ6B 4OCLC 5TGBB 2XXMB 5F1IA 2YJLA 5BVPH 3VXSA 1SY6H 2D7TH 2EDDA 3MNZA 5F8QC 4KY1H 1XZ0A 3SO5A 3G3LA 5TQ2L 1DO6A 2E7CA 1DCLA 4HH8A 5C8JA 1J05A 2VABB 1DANU 2RFXA 5DFVD 3OZ9L 3JTSB 4G5ZL 4MZ3A 2XQBH 4XHQA 1JHTA 4GAGL 5KS9A 4LBAA 3KDMA 1MFDH 1BG9A 3UPAA 3FU3A 3RGBA 1RH8A 4GRWB 2FHFA 3HNTH 5IVNA 5ACMA 3LNIA 2ICES 1JWSB 1ZK9A 4HSQA 5D7IB 3TBBA 3M7FB 1U8QA 2VIRB 2R1YA 1FFQA 1D5IL 4NM8L 1T4KB 3VXMD 1JXJA 1P7QD 2AMUA 1A14L 1AHKA 1HH9A 2XZCL 4JFOB 1XB6A 2WQSA 1USQA 1BVOA 2CDEB 1UM4H 1A6UL 1YPZB 3W81A 3MV8D 4PPTA 3IK2A 1SXZA 2APTA 3HG4A 4NN5C 2N4IA 2NT1A 3O8XB 4M5ZH 2OMYA 3PNRB 5IQ7L 2WXMA 1AVAA 1DL7H 2ZYRA 3V9FA 4UTBA 1DE4B 4M6NH 2BLFA 2F9BT 1DBKH 4N8PA 1Q0XL 4HHAB 5CUSL 3VX0A 5F7AA 4G42B 5CLTA 1AZVA 1IAMA 2NTFA 1P7KA 4LRNL 1R5VA 4FG6D 3BUPA 4TKWA 1UKSA 1TQBB 2WANA 3RX7A 3ULVH 4OLWH 3OHXA 4G8GE 1AQ8A 3JTBA 3LKNA 2CK2A 2FWOB 1BOGB 2ZYIA 1XGYL 5FX3A 3KPQB 1HYSD 1CDHA 1J5CA 1HS6A 1GOHA 1FAKT 4F2EA 3QIUD 5FKPB 4N9GA 1B4JH 3GMMA 1BZEA 1WA2X 4S1DD 4UQEA 1BOGA 5I75B 2WQXA 4MNHB 3QZBA 1OV8A 2WZ0A 3AITA 4HH9B 4FX5A 3W57A 4Q97A 2BRQA 1JNHA 4FLHA 4GQ9L 3NCXA 2H8PA 3RL1A 2WLIB 1AOZA 4LL4A 5D2NE 2MKLC 4P59H 1A6AA 1QSEB 5IFHL 1M1SA 3S3PA 3FQNB 3MV8A 3WTYA 3K8MA 4HJ0D 3ETBF 2YPLA 5GISH 5CGBA 4NUMA 1X9RA 4W68A 4TRPL 2R0LL 5TE4L 4ODWB 4D0CB 4AQ8A 4HLJA 4X4ME 2ILLA 4LAQH 2C9UA 3UZQA 2D4DA 4IRJA 5L4FA 2YUXA 3ELAT 2DLEA 5DHMC 1HINH 1P5UB 3G5ZA 3ZE2B 1YY9C 4DF9A 3FCSA 4KGJA 3MFGB 1M53A 2QVFB 3EG9A 2H2PC 5ESQB 2B2XL 4HS8L 4L3EA 3LEVH 2OMZB 3WY2A 1O9VA 3FZUC 1Y07A 4YWGH 2ATKA 1J9SA 2X89D 3DTXB 3SDCD 4EUPH 3ULVF 1YNTA 2ADFL 2HLEB 2ZPKL 3JWOH 1S7UA 4PJ8C 3WEAA 1BQLH 4WW1A 1FL3B 2XWCA 2IDTA 4NLAA 1MCPL 1UKQA 4TL4A 5ACZA 1F6AA 4BH7A 4AMWA 1XR8A 1A6PA 1M7DA 4MMXA 1S3KH 3OM3B 4W9KC 1FNGB 3VFWA 5B3JF 5E6IA 4KRNA 3CFEB 4ZNEA 3TJEL 4J3OF 4TPRH 3FQ4A 4XAWL 2Q8AL 1HXMA 4EDXB 3V4VB 3ZK0A 3BPOB 3EF7A 3RTQA 3T04D 1GPOL 2AV1B 1NOFA 4TUKH 1JZ2A 4ZFQA 1MHHA 1HEZB 4G9FA 5T3XH 4GRMA 1DQQB 4DOHB 2O6CA 2V3EA 4LASL 4YPJA 1UM4L 1KFAL 1BZ9B 3NEEA 1CS6A 2Z7WA 4WW2A 3UBXA 4HWNA 4LSUL 1KCVL 4OJCA 3L5XH 1PZUB 4YMPA 4ZW6A 2ARJB 4HALA 3RJDA 4RFEB 2K78A 2CJUH 4MMYA 1OAUL 2X4SA 1WWBX 3KYAA 1Z5HA 4UV4H 5IJKA 3EZJB 1CXEA 2XKNB 1IQDB 1YN6A 1B2WL 1S46A 1LD9B 5SX4H 5KOMC 5G5DA 2N3JA 4NLHA 4PCSA 5EUOB 4HH9A 5E9DE 3TO4A 3KYNB 3JV6A 4X83A 4E9QA 2ZP8A 4H26B 2XKNA 2O6PA 2YD8A 3MLVL 5TH2B 2HFGL 2RALA 4OJFL 1KCLA 4HU2A 4N6RB 1N8ZA 3VD3A 3VGAC 2BVEA 1OE1A 1I7UB 5J9PB 3FO0L 4QNPF 4JRWA 4C4KT 3GRWH 3GGWB 2ZOWA 4D9QE 5CJQH 1KMGA 1E4HA 1AY1H 3JSSA 3Q8EA 2DQ6A 1XGPA 4PWGA 2YUWA 3AAZB 5KBNC 1ACYH 1CICC 3CVHB 1E5AA 1XZ0B 4UINL 3EOAA 4XCYB 3WFEL 1IAII 3KYKH 1CWVA 1S4IA 3TBWB 1FL6A 3ZDZE 4QRRB 2YKLL 3CSYB 3K74B 3JZ7A 4Y4FB 3EH3B 3N40P 4LQFL 4U4IA 3VRIB 2GBUA 5EIIA 4UOW1 4OZFB 3HZMB 1TEYA 4H20H 4KJWC 1V7NL 2DQIH 2VDRH 2XACC 3PQYD 5TK2A 1WZMA 5HDRA 3KG5A 1LO0L 1SXSA 5AVUB 5L88L 1I1RA 1SHMA 1ETZB 2R29L 3L5WA 3Q05A 4LKCB 1XEUA 4N3UA 3GLAA 4JO2L 1HKFA 1M05A 1U8PB 3CXHJ 5KS9F 2WKOF 3TA3C 1O5DT 4HKBA 4XC1H 3TV3L 2PPCA 2W0FB 4WCYL 5GZNA 4AVJA 2KZWA 1BAGA 4XVOA 3NA9L 2Q6WA 3WHXA 5HVGB 4XX1G 3JXAA 2HKFH 5LBSA 3WMPA 4JANB 2R0WL 4U31A 2GIYA 3ECBB 2FWLB 3SN6N 4B9GA 5E6RB 3VD9A 1XF1A 1YJDH 3TPKA 3VWKC 3HPLA 2C1OA 2I25N 3D69B 4FFVC 1JD7A 2WKLA 1RAMA 3RTLA 4XNXL 3TT3L 3VMPA 4CSZA 1TTRA 4FCHA 2KLSA 3KXFA 2EDLA 3QJSB 3HUJE 5BRZE 1DQLH 2VB5A 5EOTB 4JFYB 3QHZH 1ZKAA 2N1KA 5LGKA 2G5BB 4K3DH 1L0XA 2WZAA 4GO9A 5GJSL 4N1CA 4FEMA 1CLCA 2DOCA 4ZX5A 4YHYB 5FWRA 1QYGL 2LFGA 2XICA 3OJ2C 4HHWA 3HG1A 4NP4L 4PW3A 3OG6B 5EH1A 4FKKA 1PFCA 3K1KC 3NCEB 4RFOL 4Q56A 4RFNB 5T1LA 2V5MA 2C3GA 5A2AA 2WN2A 1J9CT 5D1ZB 4OI9A 3NCYP 3EW3B 2IC2A 3V6OA 5C0JA 5MEND 3ZE2E 1F4YH 1KC5L 2DH3A 1P4IH 3WJJC 4OJDH 1HAWA 3QUMA 4JM4L 4Y2DC 3CFEA 4XVJH 4A6YH 3SKMB 3BUBA 3PABB 3DMMB 3PGDA 1JS4A 4AJVA 5CCJA 2NLJB 3IF1A 1OM9A 1A14H 2X6UA 5EEYA 2N56A 5F6HJ 2ZUYA 5CN1A 4XPTL 2X1PA 1OANA 1QZ1A 3TFKD 1U2HA 4ZODA 3GMOB 4PJCE 3K3QA 4BFGA 4C56D 5BJTB 4K5OA 4LIQH 3LZPA 3IAGC 4XAKD 4FZEH 3T4YA 2OK0H 4G5AA 5CHNB 2IG2H 1KXVA 2DQJH 2QQNL 3KS0J 5I75C 2J6EL 2HJLB 4HV8B 1A9BB 1F18A 1PG7L 3IGAA 3PWNB 4JZOB 4MVBD 4N2FA 1G9NH 4M1GH 1A6TA 2B4CL 4MXQD 5KSBF 3OAUL 2VC2H 2W9LA 1KWKA 4M6ML 5GGTL 4UTCA 4X6FB 4WEUD 2P47B 5JHDE 1LNUA 3RBSA 1NFDA 3NRFA 5KSUA 1TPXC 1MEXL 2YAOA 1IVLA 3QWOB 3V5KA 5BRQA 5GS0C 1MQKL 1BIHA 2NQCA 1L7TH 2R0KH 5HHVL 1PQZA 2FGWL 2I24N 4P0DA 4L2LA 2VXVH 4BXVA 1NMCB 3MRGA 4FFVD 5TDOA 1P1ZA 4FXGA 5F9DC 3ARDC 4MNQA 1QEWB 1FRGH 1F1GA 1F2XK 3RQ3A 5IJDC 2LQRA 3IS1X 4J2XA 1GC1C 1SBBA 2XG4B 1HTYA 4R4ND 3QBTB 3RI5F 4JRXD 4X7SL 5KSBB 4TTDD 4BHUA 2DEWX 4NXSA 2EIZA 3ZU8A 3L3DB 3D09A 2IBZY 3A6BL 4JX0A 4OZIA 3Q06A 2GAZA 1NCAL 3BHBB 1TYEB 2NCMA 3HC3H 2ZKXA 5CEZL 1HSBB 5CSZB 3FFDA 1T3FB 3QB7C 3VFOA 1F4WH 1B2YA 1NBZB 1AHWB 3L9BA 1KTKE 1FGNL 4H8WH 1ZLUK 4HJJL 3FBQA 1MUJB 1DN0A 2YXFA 3C60C 3I75B 3D5OF 1WBXB 3KCPA 2OYMA 3WIHH 2V9TA 3I6GA 4DKTA 4JHAL 1B0RB 5IM7A 1EO8L 4MYPA 3LHPL 3OHMB 1R24A 2XJLA 3FHAA 3QUYD 2F5BL 4NZTH 3VMOA 4XP9L 4HWBH 4Y7OC 2B5IC 3TZVB 1H3UA 5G4OA 4AXWB 2VLRA 4ZZKA 2VYRE 1SJHA 2HKAA 2YSSA 5CWSB 4CU7A 3FOLB 4K23L 4NP4H 3CDGA 1ED3A 2VUYA 2ZNWA 2ZD0A 3LS5H 4Y19D 4OB5H 2CUMA 2V2TB 3CBKB 4D9LH 2WO2B 2XKUA 1A1MA 4PJHB 3IMBA 3NBNA 2BY2A 4KUZL 5JPMB 4AQOA 3CK0L 5LDSA 3H6JA 3UDWC 5AKVA 2BO0A 4N85A 3VXRA 2YGOA 2ZAIA 3O4LA 1OLLA 1QEXA 1BFOB 2F08A 2VDOL 3W37A 3HZMA 3SDYL 5IJKC 1AR1D 3TXAA 5DMGC 5K93A 4KOCA 5AW2B 3RWCA 1MPAH 1MJJA 2PR4L 1FH5L 2ITCA 4XVSH 4FZEL 1JCKA 1Z32X 3KR3L 5LAXB 1TEGA 2EDMA 1G9EA 2JI2A 4R2GB 3QFDA 3ZW3A 4DO4A 2C1PB 5D5MA 3BIKA 1I1AC 3QDME 3ZE1B 3WS6A 4X6BB 3PWVA 4N2NA 2KDYA 2MNJB 3PGCA 5IHWA 3FCTB 2PYFA 5L2KA 4LSSH 3P4NA 1LHZA 5E4EB 4P59L 3FQWA 2X4PA 2R27A 4PB0L 2JELL 3WNNA 3ZY7A 6CGTA 4W9IC 1EHLH 4F2ME 4F7CB 3GMPB 4ZMQA 2VSKB 5ESAB 1O0VA 1ZGLM 3D33A 4WTWA 1W0WA 5K9OB 5LGJA 3SIKA 5JOPE 5HYJE 4JHWL 2Q6WB 1FZJA 5EUOA 2DQCL 4ZXBC 5DJYA 5EUKA 1GHFL 1S5HB 4WTQA 3JV6B 3QUYC 5GSVB 4LEOA 2E4TA 4ORZC 1S7VA 4JFPA 3C6LA 1E3FA 4JRYB 4YHZL 1F0LA 2JMRA 4LEXH 4KX9A 5CD3B 3LB6C 2B20A 4DW2H 4BRVA 4KRLB 2HTLC 4HS3A 2VDPL 3L81A 3TEYA 4K71B 5A6IA 5CKAA 3BP6A 1FV1B 3GS0A 3STLA 4HGMA 1TJIH 1JYXA 5C0EB 4NBYB 5DQ9A 2W80C 2XZQL 1I9JH 1N9PA 2XTJC 3ZDYF 4GRMB 5F3FA 1XMWA 4HS3B 2J1KA 2UZXB 2A9BA 3IJEB 3PY9A 5FKPA 3FT3B 5T1LB 1XXFC 3UJJL 4ERSL 5I6OA 4MAYB 4IBVA 3FPYA 3EYFA 3GSVB 3IMUA 4JM0A 1E8WA 3D39A 1LP9A 1TEFA 3NDYE 2AS5M 2EVHA 1WPCA 5EZOL 2EACA 4B9FA 3DBSA 1NDMA 4PMFA 5FCUH 4WU7A 1IM3B 4RZKA 4DP2X 3MACH 4AEFA 1KJVA 3F12B 3CFMA 3P3SA 4N0UA 3F85A 2W91A 3DLQR 3CCHA 4TUKL 5HDQH 5IB3A 4F92B 1VEPA 2CCWA 1NBQA 4CN1A 4N2KA 4PJHF 5JW5A 4MA8L 3UC0H 1KY6A 4FFYL 1ZANH 3BAJA 4YC2B 1MLCB 4FQ1H 2R2HA 3AS0A 1H5BB 3S9DB 2B1HL 4MMZC 3KVPA 3VXPA 3B4NA 4ZW3A 2IMNA 5HDOA 5KSUB 3N1QC 1E2VA 4BD4A 2NYYC 2V37A 4KPHH 2MFNA 3OKNA 1K5NA 3PGCB 3FSZA 3GEWB 3G6JA 1O9WA 1L5GA 3HHSA 3L3OB 2GUOA 4G59C 3V4PH 1W0VB 1RMFH 1TCMA 3ARFC 4JFSA 3V4PL 1N6QL 2XVKA 3E9TA 1LDPL 4YX2L 1D6EA 5C2UB 3F7VB 4OZHE 3RURA 2E27H 3E1F1 4GIOA 4NQED 5SWSB 5JLZB 2EKJA 3KE0A 4M61A 1GW6A 1CR9L 1KGUA 3ARGA 3DGCR 3EH2A 5LG1A 2XZZA 1FDLL 2FVNA 4FQXC 3HS8A 5LNEA 2WNKA 5ICUA 2YMXH 1QSVA 1ACZA 4ADJA 4BINA 4JKMA 4DEWA 2DICA 4LKXB 3WFDH 4YVUA 1AQDA 4U1IA 3CX2A 4CA4A 1YYMH 3KBFA 3DSFL 3KPRE 3ZR6A 1Q0EA 5ITBH 2Q9OA 4JFDE 2VXQL 3P69A 4GRWE 4TNWK 3TASA 3WNIA 1I8IB 4ZAKC 1KELL 3VFGL 4OM0H 1PJ9A 4ZUVB 3B7YA 2OP4L 4O5LH 1E2WA 1IAIL 1QSFA 3SYAA 4JFEB 5AALA 2VDLL 1OE3A 1ZRUA 2HJFB 2MTPA 3CHPA 4FYTA 3NJNA 4DKEL 3MRNA 4WTXA 1TJXA 4E41A 3GMNB 1WUNT 1FLTX 2WBWB 1AP2A 1QBMH 1AANA 3E8UL 3MUJA 3P4OA 1ZHNB 3PJLA 4FCAA 3QCUH 5GGVY 3TBSA 5IHHA 1U3JA 2ICWI 3PL6D 3GSOB 5GGUA 4IU3A 3WFZA 1TSRA 1V54B 4X0KA 1VKXA 4DKFL 3NRQA 2WNXA 5T3ZE 3MV7E 4AL8L 2IBZX 1SBSL 5IF0A 4EI5B 3K91A 5D2LE 1UATA 2Z4QA 5EDSA 2Y7QB 3HRPA 3BRFA 1T0PB 2DQGH 4B95C 4G1MA 5MEOA 4P2OC 3DURA 4NAJA 4O02H 4AIXA 1VFUA 1PBYA 3WG7B 4NM4H 3UMTA 2X4UA 5DCCA 2YAQA 1CVSC 1AR1C 3PHOB 5IFAH 1G9MH 2R69H 4NKMB 1IAKA 4J3OG 1NLBH 1SPDA 2ZX6A 5KG9B 4JQIH 4TNGA 2BVPB 3O9WC 4LAQL 1U6AL 2EE0A 4M7LT 2A83A 3BRDA 3ZE0B 2FX7L 3O9WD 5D1QE 5CN3A 3HAEH 3RAJL 5IHUL 4JKPL 3G08A 3EYVA 3WNJA 3ILQD 4OZFA 4J8QA 2B39A 2EDNA 5BZDA 3HBZA 5ENWA 3GD1C 2RFXB 3VG9B 1T1YA 4JPSA 1J48A 4A7TA 2GABA 4U3SA 5MI0B 4NENB 2XIBA 1YECL 3LN9A 3FHQA 1E0OB 3G5VA 2IQAB 1PVHA 2Q7AA 3K8KA 2JQMA 3LZLA 2MQGA 4JN1H 3IYLW 5J11B 3NEOA 3UTTD 3KPRA 3AUWB 1CDCA 5K1NA 3IN2A 5A6LA 3LQMA 1IGFL 2AJXL 3C9NB 3MC0A 2DBLL 3TTSA 1YNLL 5BZZA 3LMJL 4ETYA 3OB0K 1D5ZB 1QSEA 1XTLA 3SDDC 3VWKB 3AS3A 4OLYH 3RWJB 1VESA 1CG9A 1WT5A 3OC5A 4M8VA 4MASA 1W6WA 4JCWA 2E9GA 3CN4A 1Z2KA 4X8XA 3HZ3A 3D0VB 3R1GH 4IRZL 1PLGH 3FB7A 2EUVA 2JH2A 5A6MA 3DV4A 5BZWB 1SJHB 4PS4L 2DLFH 2WBXA 1G0DA 3Q9PA 4ELDA 1I1CA 1L6ZA 4OCYL 5F7FA 3SDXF 2ARJA 2OULB 4F37F 2VERN 4K7FB 3NAAL 2BSED 4AE0A 4LHUB 3SYPA 3KHOA 3Q8AA 1QRNB 4UQDA 3WIAA 1TJGL 2GB2A 4MZIA 4L4TE 1IM9D 3J27A 1J11A 4F7MB 5FPIA 1QOKA 2DDQH 1M7IB 4PUBH 4Y4FC 4C8XA 4DNLA 4GG6A 2R23B 2XFXA 1RVFH 1SHWA 5C0IA 1DLHB 4X8JA 1HQ4A 3LH8A 3GK8L 2EIDA 1PKOA 4RDQG 2ORBH 5CBEB 3CHSA 4XPHL 3ELQA 3LKSA 4X6CA 4Z18A 1E4XI 1E6JL 1ORQB 5ECJE 4CU6A 1NAMA 1T6WA 2H0PA 4QRTB 3TYFB 1P2CA 4HUKB 2UY7B 1VGEH 4OZHB 5INDB 4OZGA 3ARDA 1A21A 4I85A 3D3VE 3GMRB 4RBPK 3V4LA 1I7TB 2KI6A 1F58L 2AJ3B 3IJHA 5E70A 2VDLB 3QRFM 4WHDA 2H32B 3M8OH 4N2HA 5HHMD 2VDLH 4X6DA 1YEEH 1AD9A 5C0BA 4ZUUB 4PJGB 3BH4A 1JP5A 1ZT1A 2HFEB 1KV7A 1LO0H 2AP2A 1KCRL 1VCAA 3O6LH 2E3VA 4LCCC 1JZHA 1U8NB 4PJ8B 4PRDB 5F7WC 1ADQH 1V7NH 2DQIL 3MJWA 4MQ7B 2OMTB 4UT9A 2Z7UA 4GUOA 1AO7A 1YYCA 4PJGA 5FUZH 2AJVL 3WIIL 2BNRB 3HC4L 3BCFA 2DJ4A 2HZHA 1A7BA 3LZFL 1R5IB 2A6DB 4PY7A 2AEIT 1AXSB 2BERA 5GGVH 1HL9A 1D6VL 3IXTA 4HXAL 4YDVA 1KJ2H 3DRTB 4Q9RH 4PRIE 3SQRA 1DLFH 3GMLA 3EKCA 5CEZD 3M8OL 1WFTA 3WDJA 2QMJA 1RP8A 1F6AB 1R3IH 4P23D 2APSA 5JXEC 2HRHA 5FYJE 3DX0A 4KUZH 4IOSD 2HB0A 1B4TA 5KVDE 1P4LA 2Z4TA 4PRHB 4Y1AB 3TM6A 2G60L 4YBLB 3KPLB 3MRRB 1FFOB 2YAFA 3VG9C 2BP5M 5GGSA 3ARSA 1U3YA 5JDSB 1NCJA 1Y7VA 4ZFOA 2X6MA 5KTEH 2PO6D 4F37K 1KEGL 4K3EL 3KBPA 1CE1L 3FK3A 1QACA 3DC0A 5LJYH 1RZJC 4K5MA 3PNWA 3BPLC 3U4AA 5AD0A 1QRNE 4JL2A 1T7VA 2BHYA 4PJBB 4RFOH 4E5XA 2EXSA 2JQZA 2KL6A 4WEBL 3RGVC 3ZDXE 4XWOD 2WPGA 2WVVB 4P2QE 4WEBH 3SD2A 3TBCA 5A1AA 1KACB 3HPJA 4LP8A 4N2CA 4ZW5A 5JORB 2E46A 4AXWA 1OVZA 1WSST 3O8XA 4N86A 3CHXA 2ZCHH 2W9DH 4ODHL 1YEIL 3TBSB 3NAAH 2X87A 2NXYB 1CE1H 3G6AB 3MLXH 2D0FA 2ESVB 5C07B 1KYAA 4K7PX 4N68A 1AKJD 4IU2B 1K6QL 2YFNA 3FTVA 2K9FB 3KGRA 1A3LH 1ZS8B 4GOSA 4UDTA 5C3LD 3CSBA 3EDEA 5D6CA 2H32A 2XBZA 1ONQA 3KYMB 3Q8CA 3BN9C 5E6ZA 1WITA 2Z35A 2ALAA 3N1FC 1LE9A 2H32H 3FTSA 2VJXA 1BQHB 3OB0H 1WK0A 2J56A 2NW3A 2E4FA 4JDVB 2FWOA 1KGJA 2WJ5A 4J1UB 2AVFA 4NNPH 3FF7A 3CVCA 3O41B 2GKIA 1D2OA 5AZ2H 4Y2DA 1NBVL 2F54B 2XQ0A 4NS0A 4M8QA 4GKZA 4GT7A 3CXDL 4J1UA 3N55A 3K5RA 5KVGL 2W0KA 4JFDB 1DLHA 4LLVB 4N1EA 3TA4D 5CCKH 3FULA 3DARA 3QIUC 2NSMA 4G9FD 4ZXBA 1KF9B 4L8BB 2FJUB 3DJSA 3KLLA 2UYLA 4L0PB 4HIEB 2FEEL 4ZS7L 3O6LL 4X5XB 1QUPA 3O8XD 4WWOA 3TJHD 3OL2A 4MAUL 3VXUE 4F3FA 1IZKA 2K7PA 2DQDL 4JFQB 4KX8A 4CBPA 2XPZA 3CVBA 1NGQL 2XWTB 4X4ZA 3LIZA 1FUNA 2X70B 2DQJL 1GA2A 4L3AA 1XF5A 1K72A 3C6EA 4Q4EA 5FA4B 1KIUA 4HD5A 2QKIC 4C55A 2ICWA 1TZHB 2XTLA 1Z0NA 2QHLA 2HG5A 5HYSB 2ZCKH 3MMEB 3HPLB 1MCSA 3B7TA 3BSHA 3WUWG 2WTRA 3U2SA 2E47A 2CGRH 3L3OC 1CQKA 2GSIB 2LW3A 5HGBA 3EFDL 5FW8A 2NNXA 4DQOH 3QG6B 5I8CA 4DO6A 4G6AC 4MCMA 4UU9B 4FD0A 3L3GA 3SE9L 2OYLA 1KEMH 3MRMA 2W65B 1FCCA 1EUTA 1U8MA 2OJZH 3VG0H 1F8TH 1V27A 3SDDA 5EF1A 3BVTA 1J88A 1OGSA 3BP4A 1CBVH 4X80L 4WK0B 2E9IA 5AL0A 1OAYL 4R96A 5HD8D 4QRBA 3ARFB 2A9CA 2FUQA 5I0VA 3S97C 2OR8A 5IHBA 3K2KA 3GS7A 4G8FA 2Y07L 1X9LA 1P6FA 1M3JA 3UZVA 2F7QA 4KHXH 4UV7L 2I9TA 1XAKA 4HDIB 4QRSA 5HGDB 3AXIA 4QTFA 3EYOB 4DZBB 2JSFA 4KI5C 3VFSB 1A6VL 3OX8B 3PHSA 2RB8A 3MR9A 4A7VA 3O3DB 1V8HA 1F86A 2HMIC 3BVUA 3K4DA 2OLDA 2YFOA 1IAIH 5EEVA 4YO0A 1ZA3A 2DWEA 4RWHA 4CSSA 3PV6B 4Z7NB 3QP3A 2HVKA 3REVB 5KYYA 2F54A 2YD2A 4ENZA 4MB1A 2BZ7A 5I1HH 3IDXH 5AUMB 4WFFD 4XMZA 1AI1H 2K8MA 1QW9A 3IKCA 5DWUH 5E1QA 3VFVB 1QG3A 1UHVA 1JUFB 3CBJB 2VO8A 4URTB 4FLQA 1YY8A 2X1OA 3GXIA 3CVIL 2WVUA 2IH3A 4HZLB 5TJWK 4LL1A 1Q90A 3IJHB 4HUXB 2BZCA 4WK4B 4YVNA 1NOLA 1KCUL 1U8IA 3ALWA 5DD3H 2ZTBA 1J1OL 1AE6L 3F8UB 4P57B 3WEOA 4KRPC 3C08L 5EU3B 5IBUG 5TQ2H 3FXIC 3NCJL 5DC4B 1UT2A 2R2HB 4BQ8A 4HFWB 3RDJA 2F7RA 3O4LE 4NQXB 2D3VA 2YPLB 3Q0HA 4RETB 3MXVL 4OB5L 5CILH 4OVUA 4IRSA 1SOKA 2PTUA 1KGCE 2YEZB 3KD4A 2ADJA 3MYJA 3QI9A 4MJIA 3WD5L 1T1XB 1G9NC 3IKKA 1I9IH 1FIGH 4L4VA 1CGTA 4QRRA 3FUFA 1GYAA 5D71H 4XVTH 5J13C 3KPSD 5H35B 2JIXB 1JV5A 3LDBC 1AD0A 4ESKA 4CMMB 3MV9D 4LSQL 4I4WA 3O11A 1YSOA 3E9UA 3QFJB 3BJ91 1YVLA 3BFWA 3FO0H 1P6AB 5B3NA 4CBZA 5FYJH 3QJHB 3CZKA 1KLFB 3S5YA 2G5RA 1IU1A 4PWFA 4AGNA 2DYPB 3MTRA 1IEBA 4MDJB 4B96A 1GGUA 2O5ZH 1GL4B 1E6JH 2QLYA 2YUZA 2ZX5A 4B9YA 2ZUWA 3LD8C 4PU2A 4K3GA 1CTOA 2MHAA 4PJAF 1B2WH 3PAVA 5K1VA 3D0VA 4QXGH 1BVKA 3HPJB 4ODXB 4KKLD 3D2TA 1NTDA 1QNIA 3OKKA 1BQSA 2C8NA 1Y6NR 2NZ9C 4ZD3H 1QI5A 1W0YT 2BMKA 3BVNA 3IN0A 3O2DH 4FFWD 2AAVA 4GBXA 3ZPDA 1IFRA 1L9QA 1SOXA 2JXMB 2ZKMX 3MUGB 4OIAA 3HZVB 1LD9A 5D70H 4FOMA 4NX0A 2VL4A 3THMH 1RJZB 4E9SA 2XVLA 4NZFA 3VXQA 1AP2B 2J8HA 1JG9A 3MMEA 4I9WD 5FO9B 2IO5A 2UVFA 3N0AA 3DVNA 1ZLWH 4P4RB 4WJ5B 5LCVL 1MIEL 1YPZA 4TXVB 5BQ7A 1OCRB 3IDIA 4BZ2A 3AGWA 1MKFA 3DUHA 1R5WB 1MJ8L 3KPSA 3WN5B 4YAQA 1A6AB 4MNQD 1AS7A 4XPGL 3GJEB 5E8PB