3NJNA

Q118a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 18
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njnA00
1KYAA 4G71B 2BHFA 2HX7A 2HXAA 4W1TA 1EHKB 1WA1X 3NJGA 1AQ8A 1SJMA 1GR7A 3ZBMA 4M3HA 1JZEA 3UGEA 4G7SB 2Y1AA 1AZNA 5AZUA 3C75A 4HZ1A 3WG7B 4KO5A 1PNDA 1MZYA 3NJIA 4BDVB 4EF3A 2JFCA 1XB3A 2YQBA 1PY0A 1J5DA 3N55A 4PAZA 5I5JA 1CUOA 1SHWA 7PCYA 5B1JC 1OF0A 2WO2B 2YAMA 4NB7A 1DYZA 4Q89A 4N8UA 3FU7A 1OE2A 1URIA 3T6VA 2XV2A 1ETJA 1JZJA 1A4AA 3ASOB 4F2FA 2J5WA 3OMNB 1PF3A 3FYIB 5B7MA 1GSKA 1CYWA 2IH8A 2EINB 3KW7A 1OOWA 3L45A 2JKWA 3AW5A 2GC4C 1AAJA 3FSZA 3EF4A 1NZRA 1V55B 2YAOA 5AKRA 1ILSA 4JHUA 5EHFA 4HHWA 2ZWNA 1SNRA 1V10A 1RCYA 1ET8A 1A3ZA 2VMJA 3SBRA 1KV7A 2HX9A 1GS8A 4DP0X 3WNJA 4AKPA 1HAUA 3NJMA 2FT7A 3PLYA 5F7AA 4YSPA 3WNIA 2P80A 2WSDA 1XMEB 2DWTA 2JXMA 2UXFA 4M4RB 2CAKA 5B7EA 3IE9A 3NT0A 1ASPA 1BAWA 1NWOA 2NRDA 4P5RA 3QJSB 4YSRA 3NSCA 4BWWA 2FQDA 2OV0A 4A2EA 1AANA 4HCFA 3V9CA 2GIMA 1RKRA 1ID2A 2XU9A 5B1BB 5B1JA 3CG8A 1ET7A 3FSAA 4NAJA 1ZV2A 3NJHA 2MRYA 3GYRA 1W6WA 4YSUA 4K9JA 3T6XA 4DP4X 4N4YB 2BZ7A 2FNWA 4BDVA 4KNUA 1TKWA 4A2HA 4A66A 4AX3A 3OD3A 3X1GA 5F7BA 3H4HA 4YVUA 5I6MA 2IWFA 3DTUB 2IDFA 1OCZB 5PCYA 1BXVA 3PAVA 4YSQA 2VSKB 1PLBA 3S8GB 1I53A 2PPEA 5AFAA 2FT8A 1R1CA 2GBAA 2EIMB 2YXWA 1AOZA 1WA2X 2RACA 2YAFA 1JZFA 1JXFA 3NJJA 2DYRB 2MTAA 1X9UA 2PPDA 3PAUA 4KO6A 1KCWA 4ENZA 3PPSA 4GP5B 1BYPA 4FAAB 5I6PA 1QHQA 1NIEA 1WS7A 3DIVA 1SF3A 2CUAA 3UABA 4BK5C 2GI0A 3QPKA 1IC0A 1E30A 3QJQB 3FQ1A 4F7KA 1VLXA 1NDTA 1OE1A 1ADWA 5B1KA 1JVLA 1JOIA 1ILUA 3OMIB 3PAZA 1BQ5A 2BP0B 4QKTA 5IY5B 3OQRA 3SBQA 1J9SA 4GP4B 4P5SA 4E9QA 3AZUA 1KBVA 3FSWA 4BWUA 2H47C 3CZUB 2DYSB 4L0PB 1ZPUA 2A3TA 5I6NA 3CDZA 3BVDB 4YVNA 4GYBA 2VW6A 3PCYA 4DP5X 4WKXA 2H3XC 3UACA 5TK2A 3X2QB 3ASNB 3FT0A 3GDCA 3CVBA 5E9NA 1M56B 1L9SA 3TA4D 4KOCA 2UXTA 5I6KA 1JVOA 1B3IA 2QDVA 3QJUB 2EILB 3ABGA 3X1BA 2FTAA 1JXDA 2FQEA 3WKPA 1IUZA 2OCCB 4YL4A 4KNSA 2YAPA 3NJNA 3IBOA 1OCRB 2IDTA 2VN3A 3S3CB 4BXSV 3EH5B 2VM4A 4GY4A 3QQXA 1AZUA 3FYEB 4AKQA 1BQRA 2IDUA 1AS7A 1JZIA 1ZIAA 2TSAA 2QPEB 1AG6A 1HAWA 2FQFA 2FQGA 2XXGA 4G72B 2HX8A 2LLNA 1OE3A 2EIJB 3AG3B 4GP8B 1A8ZA 3WIAA 9PCYA 2IWKA 2HRGA 1KCBA 1AACA 1T5KA 1IBZA 3RYMA 1ZDSA 2UXGA 2GC7C 2IH9A 2I7OA 4NERA 3AG2B 4CSPA 2B08A 3HEIB 2XX1A 2PCYA 1A65A 4DP1X 3FPXA 1BEXA 1KBWA 1OV8A 2YAEA 5PAZA 5B3SB 4AZUA 4KNTA 2CBPA 5D4IA 2VW7A 2IDSA 3U25A 3T9WA 1J5CA 2XLLA 3AY2A 2IDQA 8PAZA 3NP3A 4A2GA 2J57A 3OMAB 4JKNA 4CSZA 1J9QA 2EIKB 4UANA 7PAZA 2Y69B 3TBBA 5B7FA 2GB2A 4Q8BA 4DP2X 1JXGA 1UATA 2PPAA 3IN2A 5D4JA 1AZBA 2GHZA 3S3DB 2W8CA 3H56A 3SQRA 1OCOB 1SDDB 1L9OA 1NICA 2FT6A 2OJ1A 1GS7A 1ZIBA 2UXVA 4RH4A 2CCWA 1NWPA 2UX6A 2BP0A 4HALA 4A2FA 4MFHA 3WKQA 1GY1A 4DP9X 3T6ZA 1CC3A 4KOBA 3NJFA 2I7SA 1YLBB 2J55A 3NJKA 1CURA 1N68A 4G7QB 1MZZA 4G70B 3DKHA 4DPCX 2PP9A 2UX7A 2PLTA 4HCIA 1IBYA 3H4FA 2QDWA 5I26A 2XV0A 3QJTB 1PMYA 3FPYA 1SFHA 5TK4A 1EZLA 1RZQA 3FS9A 4DP8X 3ABKB 1AR1B 1OCCB 1WS8A 1NTDA 4DPAX 1W6LA 2TSBA 2VW4A 1ET5A 3V9EA 3BQVA 1E65A 2BZCA 1XB6A 2XX0A 3TU6A 2IAAC 2PCFA 3QJVB 3FQ2A 2W88A 1BXUA 2HZHA 2BP8B 2BW4A 3AG1B 2Q5BA 4A2DA 1QNIA 1IKOP 1NIFA 3NSYA 1W8EA 1V54B 1RZPA 2BO0A 4YSSA 3UAEA 1TEGA 1L9TA 2XWZA 3FQYA 3G5WA 5B1AB 3QJRB 2WO3B 1DZ0A 1PZAA 2Q9OA 4E9TA 1KDIA 3KW8A 2E86A 4E9XA 2HRHA 3S3BB 4UF7C 1PZBA 4KO9A 3CVDA 2R7EB 3T71A 3ZX1A 1FFTB 2FWLB 4HHGA 1A4CA 1GS6X 3UADA 5I5IA 4G7RB 1J9TA 4YSTA 1KGYE 1PLCA 1E5YA 3IEAA 4X4KA 4A68A 3MBWB 4E9VA 2DV6A 2I85A 2PPCA 2CALA 4FA7B 1PLAA 2HLEB 3JTBA 6PCYA 1PNCA 3ABLB 1SDDA 3UAAA 1E67A 4F2EA 1SHXA 2YAQA 3NJLA 1M9WA 2CJ3A 5D4HA 4QLWA 4GXFA 4YSOA 1FA4A 2GSMB 1MDAA 1L9QA 4E9RA 3D12B 4ZK8A 2QPDB 4TXVB 1MG2C 1ASOA 2N0MA 4UAHA 2PP7A 2XUWA 4HCGA 2XVBA 5ANHA 2XYBA 1J9RA 3ABMB 3T6WA 3NSDA 1PCSA 2AZUA 4BWTA 4BXVA 4KO7A 1KDJA 1M57B 1GW0A 2BWIA 4E9YA 4HIPA 3OM3B 1AZRA 1JZHA 1ZDQA 2AANA 1QLEB 2PP8A 2YAHA 3SBPA 3ZDWA 5I6OA 3S8FB 1JERA 4DPBX 2QT6A 2X88A 1CYXA 2ZXWB 4DP6X 5A7EA 3TASA 3WI9A 1AS8A 2B3IA 1AG0A 4YSEA 2ZOOA 3CDZB 1GY2A 1PZCA 2X87A 3NYKA 1XB8A 1GYCA 3JT2A 5I6LA 4AKOA 2VM3A 1NIAA 3X1FA 3MX0B 1N70A 2XV3A 2DY2A 1A4BA 3FU7B 2YARA 2BP8A 1NPJA 2XXFA 3FU8A 2VSMB 3IN0A 1NIBA 1SF5A 1HFUA 1AIZA 5I28A 1JZGA 1SFDA 4DP7X 2DWSA 2AVFA 3X1EA 4YSDA 3EHBB 1X9RA 3ZIYA 3NP4A 1ASQA 1AS6A 1NPNA 1TEFA 4W9ZA 1FWXA 3FU9A 5LDUA 3EH4B 1TU2A 2ZONA 1BYOA 3FSVA 2R7EA 2P80D 2H5UA 4HAKA 3PXLA 1F56A 4JHVA 1NINA 4E9WA 2AZAA 3ERXA 4PCYA 1E5ZA 1MG3C 3N2JA 1WA0X 2PPFA 4A67A 1WAEA 5FC9A 2BW5A 2YXVA 3NSFA 2AFNA 2BWDA 3CVCA 3X1NA 5I5MA 3HB3B 4YSCA 3GXUB 3EH3B 1BQKA 1AZCA 2IWEA 1NIDA 4AI7A 4WTQA 1BXAA 3TBCA 2J56A 1L9PA 6PAZA 1L9RA 4YSAA 2FJSA 3AG4B 1PAZA 4E9SA
chains in the Genus database with same CATH superfamily
2D31A 2VGLM 5I1KH 5FB8A 4I77L 3B7UX 4DCQB 1OTTD 3APCA 1WA1X 3O2VL 4P9ML 5BVPH 1ZTXE 3HRPA 4ZO8A 5C0EB 1ZJAA 1WV7T 2YD0A 4HJTA 1WZAA 4N5EC 5EO9A 3BPLB 3C9NA 4YDLB 4N6RA 4Y2DB 2IMMA 4QRAA 3AAZA 1MJ8L 1T89A 1MRFH 2Z7YA 3KPRB 4U7KA 3NH7H 4EZJA 2CA4A 2WSPA 3I6SA 1SHWA 4MCZB 4LVOC 7PCYA 1EXGA 3GIZL 4OY9A 2OMYA 1P6FA 2OMVB 3ULUF 1ZT7A 1CICC 3RGVB 4D9RE 4FTVE 1KXHA 1TTBA 4P99A 2HJFA 2ZX6A 5CKGA 1NGXA 3MRJA 2CUHA 3CLWA 3V4PL 3KWVA 4MBOA 4ZNEE 4I77H 3O2VH 2ERJC 2Q1EA 4P9MH 2AXFB 3MLXH 3AXLA 3U6XS 5CLTA 4TLTA 4MAYA 2HN7A 1Q94B 1TTFA 3CSFA 3B3IA 1TITA 4NDMB 3SO3B 4EE2A 1ZLEA 3U4BL 3M88A 1LE9B 3BT2L 2UV3A 3GSXA 1MJ8H 3FFCD 4RWYH 5C70A 2HFFB 3NGBC 2EDKA 1KJMB 3L45A 2VZSA 1VSCA 1AAJA 4HUCA 4QDGA 3UJJL 4AUYA 2D7PA 3QIWD 4F9LA 1AGDA 3KWWB 2WLKA 5EFIB 1ET8A 3P11L 4WFEE 3UZEA 1ZA6A 2MNUA 5GS0C 4AUJA 2V2XB 3V4PH 5JHLA 4R8WH 3O4LE 1A6TA 1QFWM 1OXYA 3OAYH 4LSUL 1FYTE 2X4SB 3PLYA 3U1PA 4CC4A 5HGGS 4F8OA 3HE7C 3IFPA 5F89B 5K33A 3TN0A 1BZEA 2D0GA 15C8H 4LXFA 3U4BH 3WHXB 4DQOL 4GB9A 5FX3A 1T3FB 5G4MA 1DQML 2WK2A 1F6LL 4DIXA 1PZ2A 5D2NE 2OMWB 3SN6N 2QZQA 4G6AD 4K5NA 2X2UA 1WFOA 4X6DF 3DECA 4B96A 4ZDHA 5AUMB 3VXMA 4JFED 2XWRA 3DGDA 3UJJH 4CGTA 5BOJA 2DRUA 1FZOB 1KIRB 2X5PA 2ICWA 1XTMA 3FBQA 4XNAA 1TZ8A 3P11H 4Q7DA 3BE1H 2FEDD 4KJYA 1J5HA 1ET7A 4QT5A 3U9UB 5KBPA 2DIAA 3QCTL 1CO1A 2NYYD 2HP4A 1BAFL 2FZ3A 4AGNA 4KZEL 4ZW7A 4LSUH 1ACYL 4YN3A 1FNEA 2VLRB 5FO7A 4N4YB 5BZDB 1SM3H 2BZ7A 4AX3A 3AY4A 3E80A 2VXSL 3B6SA 5F7BA 4DQOH 3ZUCA 1VZHA 3N50A 3DTUB 2DQFB 5DI8A 1Z0MA 1ZVYA 3CAFA 4MASA 4MNQE 5EUOB 3PAVA 3R7RA 1DDHA 3GSNA 5KN5B 4JR9L 4WWKC 4CBZA 2FNBA 4MJ6A 1UYWL 3N85L 2EIMB 4F7EA 1XCWA 3L6FB 1LTXA 3VVWA 1G9NH 1TQUA 2VRAA 2LR4A 1SYSA 4DOHB 5TF1L 3QS2A 2HKFL 4WW2F 1VACA 2YUZA 4JLRA 4MHHG 3DK2A 5DFAA 3T0EA 2WOBA 3QZLA 2H41A 1H0DA 5CEXA 1KPVB 1M7DA 5CN2A 4UTBA 4KZEH 4G9FB 2WXNA 1FQ9C 1DJHA 1Q9KA 1R3LB 2W9LA 4U31A 3B8YA 4QRSB 2DQ6A 1TQTA 3QIUB 1NKOA 4NQVB 4X4ZA 3QJQB 1QRND 4YDVA 3DOSA 3WGUB 2ZWSA 4AEFA 3LKPB 1HEHC 4ZYKA 2FD6L 4E0RB 5GPRA 3RWFA 4BINA 1L3WA 4L3CB 5I75B 4JR9H 1FZJB 2VXVL 3VG9B 4Z3EA 3GJFK 4CSTA 5CO1A 3ULVF 5IY5B 1T80A 1TNNA 1M42A 2CUMA 1UYWH 1R0AL 3L1GA 4JAMB 3JUYA 3W11D 1SDYA 4LGPB 2AXJA 4X8XA 1U8KA 3KL3A 4JFDD 4Z0BL 2HPTA 4XXCC 1DBJL 4M9PA 4ETQA 1QI5A 3AS2A 3L48A 1BAGA 1DVQA 1NGWA 5ANMA 3HUJE 3ZYJA 1MI5D 5F3BB 2YK1L 5K93A 2IPTL 2WXGA 4XP4L 2JH2A 3PDDA 4XH2B 4PJDF 3KGSA 3STLB 4M7JL 2MKWA 3ZDZB 3ENEA 5C9KA 3DX7A 3FTYA 5FEBA 2FECI 4HV8A 1PY4A 4OIIL 5HBBA 4JPKH 4KDTA 4V1DE 3FFOA 1R0AH 4GSUA 2CCLA 5EEWA 2BSSB 1I8KA 1T5WA 4WTZG 4QI3A 1IGIH 1YNKH 1CJYA 2W59A 3FB8B 1CE1L 3WO3B 4XO3A 2UZXA 2YPKA 1XF2A 4NRYA 2WAQA 4XX1E 3T04D 2MSPA 1ZDSA 3RBGA 3ZKMD 2W5PA 5AEAA 2NY4B 1OHQA 3VFRB 4N2GA 5C0GA 3H7BB 3RG1C 4PRIE 3ZHDA 1KIPB 3UBHA 3APNA 3WTUA 4M7JH 1CF1A 4GRLB 4N2NA 1BOGA 2ZT9C 1P4IL 3VDAA 3N43F 4IOSA 4X98B 4OIIH 4PW4A 2LT9A 1JMZA 2E4FA 3PYCA 5F6HJ 3M8OL 2XZCL 4BFIB 1CE1H 1QUNA 4Y4KD 1XIWA 4AXWB 5B39G 1U8HB 3QWQB 2DQJL 2PPAA 3ZIMA 3TGXA 3T8MA 3TYFA 3ZE0F 3SQRA 3DGGB 2HVKA 1SDDB 3DNKA 3IF1B 3F62A 5MI0B 1J48A 3GO1H 3QZWG 4PWIA 5B3JF 4QKXB 5K9JH 1B4JH 1IGFH 3B34A 5KBNC 1QHPA 3K0WA 3SBWA 3SYCA 3TBWB 5I71B 3QISA 2CDGB 5GRWA 3DUHA 4YHYB 2QADD 4PP2B 1O5DT 3VFSB 1OTSD 2I7SA 3SZKC 1RI8A 3LKSB 8CGTA 4NO0D 3D3VB 4GG8A 3HVNA 2VUOA 3P73B 1TOXA 2PYEB 5DFVD 4KJQD 1IIIA 1JTTA 1JF1A 2IXQA 3MRDA 5I26A 3WNOA 3PV6B 5I17B 1S7TA 1XGQB 5CZVL 3CVIL 1YEDA 2DQJH 3MV7E 4QO1B 3RIKA 4ZOAA 2PW2B 3JV4A 1NKGA 2B77A 4KRPC 4ZTOL 4YC2B 3DOIA 5FIEA 4N0FB 5SWZB 4HBQA 4WNSA 5JNYA 4Z3FA 1NSNL 1OF2A 3EYOB 1F3DJ 3T65A 4A7TA 3ARBC 2P8MA 4GBXB 2X4NA 2BZCA 1UUNA 2Y5TA 4OFVA 1A6PA 5IWLA 4AT6B 3SGDH 4NRXA 1NDGB 4ABVA 1UH4A 3C09C 4GUPA 4A63A 1H6UA 1NC4B 3INOA 3QNZA 2GSGA 3AG1B 4EZLA 4M8QA 3W56A 1X6LA 4K7PX 4YXKH 1DVFB 1R17A 1O75A 4RESB 1PG7X 1RZPA 3IU3B 3HZYA 1BJ8A 5EOTB 5DXWA 2E27L 1L0PA 2KS0A 2DQDL 2WO3B 4JHAL 3TIEA 3CVIH 4V2CB 2W07B 4ZMVA 3CFJA 1XFPA 4ZTOH 1ED3A 2Y1ZA 3PAYA 1RUKH 1YQVH 1AD0A 2EVHA 3C5XA 3QCUL 4JRYA 4P5MA 1NSNH 3IM1A 4WNQA 4FXKA 1BZQK 4N0UB 1H3PL 3Q3GA 1KSRA 3BO8B 2C3WA 1CFTB 3WFDL 1A21A 4HEMA 1N18A 4P5KB 2WWOA 1E5YA 2XTJB 4OAWA 4OCSH 4X4KA 4GRWB 4E9VA 3CVHA 1TIUA 4LNRA 5T1KA 5KVDH 4C59B 2R69A 1MAMH 1ONQA 2CALA 4K23L 1UZGA 3EGDB 3VXQB 3JTBA 2BERA 3CXHK 2E27H 2DQDH 3O9WC 4JHAH 4ZPTA 2J2ZA 4XAWL 4HDIA 1OT4A 3NJLA 4UZSA 2WLYA 4M1CD 4JO8A 3HFML 2F58H 1JGUL 1OPGH 1L9QA 4LLDB 4WTZA 5TGBA 1BIHA 5ITFA 5C07A 3GBDA 4E9RA 4KROB 1QASA 1H3PH 2QPDB 2IMNA 4OFDA 4CKQA 3BW9B 2X9YA 3FOMA 4WY7L 5AKSA 2NTFB 5I1IL 3OXRB 4QHUA 2X1PA 5ISZE 1QFPA 3GT6A 4JFHD 5K9QI 3MACL 2AZUA 2HJKA 2ISDA 1E6OL 3D06A 1CVSC 3CFMA 4ADJA 1GL4B 4AITA 5A2FA 3HOGA 4K23H 4X9IA 4KV5E 5FA4A 5IB2B 1LE5B 2QT6A 1IM9B 3HG1D 3A21A 1SBSL 1G5GA 3HTLX 4HT1L 4XAWH 3JQOB 4ZT1A 2DKUA 3TASA 2F53A 3ALPA 4P3DB 5CU5A 1GY2A 1TYRA 1MCQA 4MJJA 5EBWA 2L04A 1HHKA 1VGKA 1YEKL 2JIXA 2K7PA 3N6YA 2YR3A 3EFFB 2AF2A 4AKOA 4FABL 3RY6A 3S0PA 4PY7B 3EOAA 5CLZA 3MHZA 2VXTL 2IAMB 2D03L 1UC6A 4PGDB 1N4XL 3IJ7A 4YO0B 4IKKA 4WY7H 5I1IH 4M9OA 1TMCB 4IDLA 3QA3B 1QR1B 4TVPH 1QI4A 1X5FA 3MACH 3IU4H 5EU5A 3QZWA 4BZ2A 5ES4B 1C8QA 2H9GB 3V4PB 4AY0A 3VXRA 4UMGA 1I9RL 4Z3IA 2EDXA 2EEXA 3BGAA 1IQDA 4GIAA 4AL8C 5D72H 1G4MA 5E0FA 4MQXD 4DUWA 1AE6H 3VXSA 5GRUH 4FABH 1JJUA 4R2GD 5GIRA 3LEVL 3O8XA 5B3NA 4TNGA 1BM3L 3POCA 4K5MA 4FYRA 2AABH 1WA0X 4G80B 1UA6L 1RURH 4KKAD 1I1YB 3HZKA 3F5WB 1WAEA 3IJ9A 5HHMD 4AM0Q 4OCMC 3F58H 3L5XL 4QY8A 5DHVB 1AZCA 4HZLB 2PO6D 1NAKL 3IGAB 4W9EC 5E1GA 2IWEA 1ZE3C 4NAQA 1C5DA 2GT9A 1GZQB 2YJQA 4PB0L 2J56A 3BXNB 2FB4L 2MMXA 1MREH 2G0LA 4BA8A 3U0WH 5JHDE 1QACA 3FB5B 4OLUL 5AQ0A 1R3HA 3WU1A 2RHEA 1IFGA 3CFDA 3DROA 5IFHH 5AVWB 4E9SA 1WTLA 4B9YA 3FT3A 3MNWB 1QLEL 1WAPA 3WS3A 2HXAA 1QOKA 1OSPL 5EIVA 2GI7A 2IV9A 1RIVL 1SUJA 5AVUB 1QBML 1AO7B 1FL5A 3UEZA 4RMRA 1L5GB 3X13B 4JJHA 3WG7B 3V0VA 5E7FA 3L5WA 5KAQG 3AQYA 2YWZA 1W0VB 4O58H 4A55A 1FFPA 2H32H 4PJ8A 5CLXA 4M7ZB 3HE6A 4HPYH 1NEUA 3OKOA 1HESA 4PB0H 4CC1A 2FB4H 2UZIL 2GBUA 1WICA 5IQ9A 5DZJA 4ZAKA 1P5VB 2YAMA 3L08A 4D9QE 4OZHB 5CGTA 5AW7B 2O4EA 5FFLA 4N9GA 4UM8A 1FC1A 4IGBA 4OZGB 4S1RH 1M6OB 2GFBA 2WLNA 3VFVA 5FK9B 4LVHC 1LQSR 2NY7L 3AQDA 1P7QD 3EADA 4L4TB 2QEJA 4AVIA 3LZOA 1CBVL 2LV4A 1QBMH 3JWNC 1PW3A 3EJUA 4NNPL 1WEJL 5T3ZH 4P2OC 4R0LA 4L29A 1FBIL 4ALAC 3TL5A 1S7UB 1IKNC 2BVPA 3HZVA 3J07A 1U8IB 1XD0A 1UJ3B 1JF6A 2XVGA 3G5VB 3QZPA 3TO4C 5I66A 3RX7A 1MEXL 1DBBH 2W9DL 4LGSB 1YY9C 3BFOA 4H5SB 4PV9A 2VAJA 4DEPB 3VNYA 3FQUA 3GJFA 4Q58C 4YHIA 2XFGB 3AB0B 2IADB 4UDTA 4UM9D 3MTRA 2NLJB 4AQ1B 2APVA 3UZQB 1TLKA 2CO1A 2XKNB 2IG2L 4B95C 3MN8A 4AC2A 5T3XH 4LSRL 1CBVH 2SODB 5GZND 2PR4H 4L5FE 5A7BA 2F68X 3RX8A 3WNKA 2DYPD 3NIGE 3UTSA 4ZO7A 2UXFA 1WEJH 2YLKA 5ADPL 4J3SA 1IGJB 3ALXA 1ZEAL 2K7QA 3MJ7A 2V5SA 2VB5A 5DO2D 4HLEA 4KKLC 1ZHBB 3C5SB 1MEXH 4LFHG 4PCSA 4UOW1 4YSRA 5ERWB 4OV5A 2W9DH 4M6MH 2FQDA 4LVNB 3VWJB 2ZNXA 1RKRA 4FHJA 2AV1B 4WDIA 2A99A 4PLKD 3PS6A 1KTCA 1MCIA 2B15A 2AKRA 3OVUB 4J3OF 4OZIA 3U36A 4FQHA 1BQLL 1XL6A 3P9MA 3AU1A 1DBAL 1W72H 1X9QA 3LS5L 4PS7A 4YH6A 2JKLA 4YHZL 1ZGLB 2OYPA 3KR3H 1BGXH 1QTPA 2WQSA 4LLVA 1ZEAH 3RUGE 5IVXB 4ODSH 1JCKA 1CYGA 1KJ3H 1ZHLA 2VSKB 4U7MA 3WFZA 4APXB 4H8WL 4MJ2A 4Y19E 1A3RL 1AI1L 3GM8A 2X41A 2YXWA 4IS6A 2KQMA 4ODHL 5IM7A 5LNEA 5D1ZA 3RB5A 1AGEA 3DUSA 1WCQA 4K3DH 5E99H 5DD6A 5I1AA 5I73B 5MHSE 3GRWL 2DYRB 4HGKC 1IZKA 4HIXL 3GSQA 4J6RH 3B9KC 4IU3A 3DGCR 4WUUD 5GJSH 4GP5B 4NM8H 1X5IA 4G1MB 4NZTL 4LF3A 1P5UB 2DH2A 4J5VA 1BQLH 2QSTA 3MCYA 3RVTC 4BK5C 4P57A 5CILL 4XXWA 3LS5H 2AV7B 2LW3A 3QI9A 4WLCA 2GUOB 1NCJA 3EOBA 1MLCB 2C3XA 4YHZH 5JUEL 2ESVD 4HIQA 1JOIA 4KXAA 5DJ2B 1VIWA 3GKZA 4M7LT 5FKAA 5AW6B 2AEIT 2BP0B 4B27A 5LAXA 4KK8C 4LASL 2Z31A 4ODHH 1I7ZB 2DYSB 4AC4A 3DETC 3ATFA 2PN5A 3MXWL 4HIXH 5DK0A 4ELKA 3NIDB 4BBWA 1RZGA 4AEEA 3AVEA 2NY3B 5LBSA 5F7EL 4I5BA 5D96C 5INCA 1W80A 2KUTA 1KZYA 2XY1A 5JQ6L 2EACA 3NPSB 2F7OA 4MD4A 2R0WL 1OKEA 5AYUH 3CFCH 2GABA 4L4VA 3NIFB 4H8HA 1KCVL 1MFDH 5CP3H 3HUJF 3EH5B 4Q9QL 3RAJL 1T0NB 4JCLA 3T4AC 3MREA 3FYEB 4YX2H 5GGQL 5MERB 3SD5A 4XPBH 4RSVA 3F00A 3IKCA 2NUTA 4OM1L 5I1GH 5IESL 2QPEB 4NYLA 4RAVA 4D3CL 4FKEA 2LFGA 4OVUA 5I6XB 3LRGA 2RBLA 2NW3B 5MP6L 1H8NA 5CSZB 5M7QA 3TZVD 3LQAC 3MXWH 9PCYA 4NQSA 3FRPB 3V8OA 3D39E 4ZO9A 4B9JA 2C3VA 3QEHB 3THML 3QNYB 5JQ6H 3RL2B 4P4KD 3HG5A 2L4OA 2ED8A 1H3TA 2G3XA 3G08B 3O45B 3UERA 3IGFA 3KG5A 1BHGA 2R23B 2Z1KA 4K5LA 2IDSA 1XX9C 3IFNL 3QUYA 5BPPA 3LRLA 4A6YA 2YGVA 1PQZB 4Q9QH 1FVCB 1KBPA 4FLSA 3JWNE 3GSOB 3LSOA 5GGQH 4A2GA 3OMAB 4M5TA 4PJ7A 2DB8A 8FABA 5IESH 1XCTA 3HN8A 4D3CH 2HTLC 1DQDL 1I1AD 2Y69B 1HOEA 3P0YL 3L17A 4Z7OB 4LQ1A 4X0NA 5MP6H 4WGKA 3EGSA 4EI6B 2AEQH 4I3SH 4PRNB 2GTZA 1AZBA 1QHOA 4WO4C 3DXAE 2RD0A 4AGLA 4ZMAT 5D1QA 3THMH 3WKNA 2OMTB 2QV2A 4OBSA 4QXTB 2XZZA 4KQ3H 1RZ7H 5FCSH 3VMNA 3P02A 1G5AA 1L7TL 2OR7A 1N2RB 2WWKO 2XRAL 4N2BA 4R4BA 3UTTA 2PXYA 3ZKSD 1Z5LA 1CC3A 1MCOH 4Y5XA 1AKPA 4JZNB 4F1ZA 5HJ3A 4QRPB 2VR3A 2MJWA 1N68A 2V2WB 4HP5A 1MQKL 1PSKH 3MLYH 3PIQB 3L4TA 5D7IE 3QUZA 1YAIA 3P0YH 4RMVA 2VDRH 3RVWC 5KSAC 1KTDB 3OB0H 1P53A 4QIRA 4DW2L 3MXVH 2CMRL 4U1SA 4LARL 3N91A 4HISA 4NJ9H 4P3CH 2I60H 1F45A 4JN2A 4XNXL 4DP8X 3UP1A 2OMUA 5CGYD 4Y5VB 3MUZ1 2XV6B 4NZUL 2GK2A 1L7TH 3ES6A 2EUZA 2AJYH 1WAAA 2R2CA 3VSVA 2DPKA 3V0IA 5F1IA 3DPBA 4GQPH 1MRDL 1EUUA 3HI5H 5C0NC 1KXTA 4FQLH 4AOFA 1RY7B 2JKRM 3BQUA 3CZJA 3EYVA 3O11A 5DJ8A 1KTBA 1LDSA 1MQKH 2WQWA 2NW2B 2MFNA 3HVDA 5C0BB 3GMMB 3T0VA 4APQD 4XN9A 4ZSOA 2YPLD 4X6EA 2E5EA 4WEUD 2EAEA 3J27A 5B1AB 1VJSA 4PD4K 3ZMRA 3CQPA 5I74B 1Z0NA 4DW2H 2FHFA 3KW8A 2CMRH 4OCWL 4PJCE 4F37K 5FGBC 3S3BB 1U95A 3IDGA 1WG3A 1N10A 4XNXH 1E3ZA 1ZLDA 5LAPA 3MNDA 2Y7NA 4F2MA 4NZUH 1BVNP 2VLLA 5FDYA 4R7DA 3GNMH 1INEL 2X53A 4LAJH 4EI5A 3UJTL 2IIJA 4GRMA 2EH7L 1A7QH 4YSTA 4AVKA 3K5SA 1ROCA 2YRPA 4UQ9A 2O72A 2ZYRA 3GI8H 4M3KB 2NUPB 1FO0L 2LTQC 1VHPA 1AGBA 3L3GB 1IQWL 2WXQA 4OKVB 3BN3B 1FNGB 3AU0A 1OZUA 3T3MB 4AG4H 1PNCA 2O5YL 1PBYA 1UGNA 4TQ8A 5HHOD 2BOBB 2CJ3A 4OCWH 2QELA 4QLWA 3WJMB 1IGYA 2BY0A 3FF8A 3ESNA 2X4QA 3R0NA 4FG6D 1G6RH 4XNBA 2HKHL 3RILA 3FUIA 3LIUA 4P23C 1RK1B 2YEVB 1FP5A 1F6FB 2N0MA 2H32B 2HG5A 3UJTH 5FA3B 4N5UA 3CFEA 2F1BA 3Q6GL 4QWWC 4KX7A 1CFQB 1FO0H 2QMKA 4PRHD 1JHKH 1M2VA 3JTTB 2HFEB 1UWGL 4PRBB 2ZJSL 1EEYA 1FZKA 2N01B 3MRBB 4P5TA 1JZHA 1CF8L 1QLEB 3E6HA 1KGUA 3H9YA 3RJQB 3X11B 2XIIA 3KYMB 1LEKB 4IOFC 4NHCH 4BCZA 4Y8AA 2X3BA 5DK2A 5CD3B 5TE7H 1QLRB 3OSKA 2OP4L 4IJ3B 3WLWD 2YN3A 3V9FA 2NY6D 4KV5F 4S1SL 2IQAA 4WI6A 4ZS7H 4U3SB 2X2JA 2A9CA 4X8CA 1IV8A 1GOFA 5AW4B 3WMPA 2FJUB 5KSVA 1BPVA 1I7UA 5CBEA 3PHQA 3PGDA 3Q6GH 1OAYH 1KIUA 4GKSA 4IRJC 2X4RA 5EUKB 3A4EA 5HDLA 3RWEB 1BD2B 1UWGH 2GTWB 4MA3A 5DTFA 1BMGA 4EN3D 1AYRA 2O6CA 2QQNH 2VC2L 2ZXEB 3QYMA 3V4UL 3IGLA 1OQOA 5I0WA 4QF1A 4ZOCA 1J5OL 1IC5H 3TT3L 4WU7B 4H1LH 4WHYH 3L2MA 4JHVA 4S1SH 4R26H 5LUMA 3BHBB 4GFTB 4AM0A 4PJ5E 3MBWA 4I1NB 4C56D 1WUNT 1XGYH 3SGJA 1HH6B 4XOEA 2ZP9A 3C2SA 4YSCA 4TQEL 4HUKB 2VE6A 3D2UA 5JMOC 3GRBA 1TTAA 4XNMB 1RZKL 1T6BX 2J88L 3V6ZB 3AT0A 1BXAA 4X5RA 4OT1L 4IEFB 5EC1A 5C0CE 2DMBA 1GC1L 2FYYA 2Z93A 4HJIA 4PBVC 4MJ5B 3FO2A 4H0IA 4TNEA 1IAKB 2BNRA 3QDGA 1I3RA 1HDMA 1F4XH 3OPZL 3KJ4B 4ZUVB 2HX7A 3V5DB 3ZYIA 4DGIL 2DL2A 2BJML 2YMXL 2Y3NA 32C2A 4JCWA 1ITBB 3SDCD 4JQIL 1TFPA 1XH0A 4ZBJA 1KYOJ 4HZ1A 3CK0H 4LLQB 3UAJA 2WCSA 3NJIA 4DKFL 5T1LB 3ILQD 2ZNWA 3MUY1 3WE1A 1II4E 3QAZB 1IFHH 1RZKH 1G7MA 4BV1A 3TM6A 1DVZA 3WUZA 2F0CA 3PQYA 3MRKA 1GZHA 4OT1H 4X83A 4JG9A 4PJAE 4Y1TA 3S88L 5IB5B 3IAQA 5D7LD 5EF3A 1K8DB 3QPQD 3U48A 2ZUQC 5ECJE 4YDLC 4Y2DC 4JO3H 1MRCL 3ARZA 2NY1B 4DGIH 2EP6A 5IHWA 1MIML 2YPVA 4JQIH 2Q7YA 1T21B 2X9XA 4DK6A 2VKWA 1YEIH 1I8LA 2WBJC 4FKKA 4ISVB 1MQ8A 4L3EA 5AOKA 4XI5C 3D0VA 1WIUA 1FJ1B 2JKIS 4UNIA 1RPUA 3RGVC 4RETB 5E94B 1BG1A 3MJ6A 4PWGA 5CJOL 2EUWA 4UV4L 3KD4A 1LO5A 4TTDD 3VU2A 2GJ6B 2WXFA 3OZKA 2DBJA 3BZ4B 4OIBA 3S88H 3ARDA 5BW7A 5GZOA 2OW7A 2XN0A 1AKJD 3SO3C 3BWUC 3FB6B 1Z9LA 4KKNA 5EC2B 1U8NA 2C3GA 3M17B 5JR1H 1SJVA 4KJWC 3GSRA 4GUCA 3MRNA 1S7WB 1GJIA 3ATAA 5JIKA 4YSPA 2DI9A 3GZOA 2AK1L 1JPEA 4U1LB 1C7SA 1TMQA 4OCRH 3C8KA 5J56B 1E5AA 1KMGA 2B4CC 1KG0A 4XC1L 4IRSA 5HDBB 3LKNA 5IROD 2ICES 4XX1G 5KVEH 2APTA 1T1YB 1IBHA 1GPOL 4MB3A 5CJOH 1I8IB 4QHMB 4MSWA 1RK0B 1TLMA 2BVEA 4HCFA 3NIGF 2ZCLL 3I02B 5FAAA 2BIOA 2EIZA 4A2MA 4YHNB 4NBYB 3NSJA 2DTMH 2J1XA 2QKIA 4Y7OC 1OGTB 1UM5L 4YDZA 3CZGA 4MNGE 3CFQA 4XPTL 1MFMA 3VQ1C 3AREB 3SGEI 3ARGD 5E8DL 1YUHB 4PTTB 5E4EB 1UENA 1C12B 1N5YH 2XZAL 2JB5L 2Q3ZA 4XC1H 3B2UD 1OCZB 1DLFL 1BXVA 1V27A 3A6CH 3LZNA 2BNQD 3L4YA 2BCKB 3LHPL 3P3TA 4H8VA 5DSCA 3VD1A 4KMLB 2J43A 5JZ7D 3HZMA 4RIRA 4BH8B 2K6WA 1GGCH 2VZVA 5T5FA 4HK3N 2GBAA 5EOCJ 1C5CL 3HPJA 4R4ND 2IGFH 1UXWA 1K6QL 2EYSB 4XWGH 3RUGF 1NGZB 3VTTA 3SDDB 2I9TB 3HCVB 1F3JB 3UPRB 5DVKA 1H15B 3SE9H 1NAMA 1OAQH 4PHZA 3BRFA 4PJGE 4U7SA 2V17H 4XPTH 1J0IA 3RTQC 1C08B 4QXWA 1D6VL 4HWNA 5DK3A 3KBHE 4RMQA 5DUBB 1ACXA 4M5YL 2YS4A 1NDTA 2F7RA 2XZAH 1MFCL 4OD2A 5MENA 1S7RA 2VZ1A 1JPTL 4UT7L 3PDOA 1AY1H 3N3EA 5A2LH 4QOKB 3RPBA 4D9LL 3LHPH 5DDHB 1E9PA 3QUKA 1XD1A 4LLWA 3TPUA 1ZKAA 2G2RA 1IM3B 4P2RA 1GHFL 1HXMA 4ODXB 4DVRH 1C5CH 3C12A 3KPTA 5HP5A 1JXJA 4PRDB 3QIUC 4XOCA 2Q76B 4BFRA 2ZXAA 4WI5A 1UH3A 3VI4B 5TK2A 1N6QL 4KI5D 3VH8B 1KC5H 3D18B 3HPLB 4QHKI 4N8PA 3VG9C 4KOCA 4ICWA 1JVOA 3OGCA 4GFXA 5DRWA 5CEZE 1IBFA 1ADQL 1XT5A 4NZ8A 4HJ0D 4XO4A 3FSOA 4BSVB 3FQ4A 4M5YH 5H35A 4D0DB 3KYOB 4MAZA 1FLRL 1JPTH 4UT7H 2B59B 2BRQA 5LXGL 4D9LH 1J8KA 5AAWA 1WBZB 4RFOL 1SBBA 4GY4A 3WN5A 4NPKA 2XN9B 3QXDB 1P6AB 5C7XL 2Y6SD 1U8LB 2CDEB 3PL6B 3WENA 3ULUL 2FQFA 3CV5A 4NQEA 4OLVL 2Q86B 2LLNA 1DJZA 2GEEA 3SKNB 1TCMA 3IDMB 4C47A 1N6QH 4TTGA 4WQOA 3ZQ9A 2G9HB 1TVHB 3B2XA 5E9DA 4BQ9A 4E5XG 4CSPA 1WD8A 2WMPB 4UNVA 1A6ZB 1I8MB 3FQWA 1UURA 4FQXA 4U6XB 4OLEA 2N4IA 4KH9A 4QNPE 3AXIA 4G43B 5JW5B 4M1GH 1LEIA 1FLRH 3C6EA 5LXGH 2CHZA 3T9WA 3KPRE 4RFOH 3P3SA 3W0WA 4WHTB 4P46A 2V5MA 3RFZB 4CSZA 5I18L 5C7XH 5ACZA 4U1IA 3QEUA 1G6RB 2VN6A 3ULUH 1CVRA 2BP3A 2NY4C 4KXZH 4OLVH 3CH8A 5FO9A 1MNNA 2WLIA 2ADGA 2HTKD 4JREC 1PZ5A 1UATA 2C7UB 3NABL 2R2EB 3GGWA 4GRLC 3RPKA 1MOEA 1TR7A 4IRZA 4KTYA 3RIFF 1QBLH 4POYA 1N8OE 1FO0B 2C1PB 1ZANH 1N0XL 1NC2D 3L3JA 4J4PA 4A39A 3E7JA 2CHNA 4LOUD 5L2JA 4NKDB 5HD8D 5FF6B 1J0YA 2F1AA 3CZFA 4XCYB 2PTUA 4S10A 4IIZA 4YZFE 5F1SA 1LEGA 3HI6L 1R19A 4HLZG 3VWKC 1RLBA 4FG4A 4L2YA 5HGHB 1JWSB 5I18H 1UT1A 4KUZL 4N28A 4KVNL 2ZCHL 4NO5B 4B97A 5MI0C 5LKNA 3MRRA 2VXQA 1Z1WA 1A7NL 2G5BA 2O61A 3BUYB 5I71C 3GHPA 2AQTA 4YDMA 3R0MA 5D1XA 5TH2B 4MKMA 4YHYC 3D69B 1IX2A 1INQA 4JO2H 2HT2C 3ABKB 4JZJB 3DJSA 1S7XA 5D7IF 1K5NB 3HNTL 4ZQKB 1D9KA 1N0XH 4HK0A 1ZK9A 3U0PB 1E65A 3MFFB 2FR4B 1F02I 2IAAC 1OT1A 4Z0XA 1WC7B 1NDMA 5FO2A 3O6FB 1GAFL 1MHHB 3P4MA 1HCVA 1KB5L 4ANUA 2BP8B 3X3GL 1HZHL 4LCVA 4U49A 2FHBA 4Y4HA 2VR6A 5DEGB 4R96A 5TTRA 5C0FA 3RX5A 3UAEA 4YC2C 2CE6A 2ZCHH 4H1LB 2MPAL 3RHWK 4ZMNA 3QUMA 5DURB 1G7JB 3QFDB 4PRPB 1A7NH 3KS0J 2WGNB 2DBLL 4KTEL 4HBCL 4HKJA 2H3KA 2OZ4A 5DHXB 4GBXC 4UT9H 4RMTA 3P0GB 3KWXA 1FYHB 2H2PC 1T7XA 1ZHKB 4LDEB 1IO4C 4GMTL 5IK3B 1U0QA 4OLYL 3S6CA 1HE7A 2XQBL 4L8DA 4BQ8A 2E8YA 3FRUA 4WI2A 2NX5B 3CVDA 3NSXA 1QSFA 5KSBA 4YK4C 1PKQB 4KKPA 1G84A 4HC1H 5I82A 5EUOE 4PJCF 4GIOA 3SPVB 5SX5K 2Y6TE 3E1F1 1MVFA 3FUDA 3O3EB 1OQXA 1IC4L 3US9A 4O51B 3IEAA 1I75A 1FN4B 5K39B 5MEQA 4ACPA 1EA9C 2MPAH 4OH2A 4M6OL 3CN2A 1ORSA 5JO5B 3AROA 4UIMB 5FHAL 7TAAA 5LN8A 2W60B 4HBCH 3MCG1 4G42B 5D4HA 3TVMA 3EJZD 3W57A 1IAOB 4ZMXA 3PHSA 3H9HB 1LWJA 3CIAA 2K8MA 1OGAD 2MH4A 3GFUA 3FTVA 4GMTH 4OLYH 5INDA 5HYQA 2GSMB 2XQBH 3P9LA 1PYWB 4XMTA 2J72A 4WWPA 2ARJB 5DZVA 4TXVB 4I48A 5HGAA 4KHTH 4LCYA 3H55A 1SEQL 5C0AA 3ULVH 5E4IA 2NY2D 4DGYH 3GRGA 2XSKA 4YHOL 2K1MA 4J23A 1AZRA 2R4RL 5BS0D 3WAJA 3L95B 3ZZLA 3ZMEA 4YDIL 3UJIL 1KLUA 3VSTA 4NUGL 3TF7C 1ID5I 4KROC 1KPRA 5HYEA 1CDUA 2WWKT 1OK0A 2V8LA 5BRZA 4M1DL 4HOWA 1R24A 3CU7A 5HYJA 5LHDA 1U8PA 4WSGA 2YKLL 3PWPD 3LN4B 2VTFA 2PNDA 2X7LA 2WQVA 4NUPA 4UV7H 1U8QB 3AWFA 1D6EB 3CX5J 2C7FA 4LOFA 1XO8A 4X5LA 5I76A 4MS8D 5KW9H 5L2KD 5JXAL 2ENYA 2WNXA 4HCRA 3FTZA 1OM9A 3ZQWA 4L37A 1NPJA 4KKRA 3Q9PA 1U58B 5AWNL 3EXLA 2CA3A 3DI3B 3PV7A 4OTXL 1CLYH 1AIZA 1TPXB 2DM3A 3F84A 4GKZA 4Y1SA 4YHOH 5FW8A 1CD0A 2FO4A 3C87A 4JDZA 4EQ3A 2R4RH 4F9PC 4F1SA 4TVPD 2MNJB 3IJEB 3QORB 3OR7A 4K8RL 4YDIH 1NPNA 2IAMC 4MD0A 4RGOL 5D7JD 3TCXA 4N1CA 3VFWA 1XH3B 3V0DA 4M1DH 1JV2B 4CUCA 3AMKA 4F57L 4Y4FA 2BM3A 3UBXI 3W2DH 4LRIA 1F56A 1Q1PA 1S7VA 3UTOA 3ZL4H 5C08D 2AC0A 2IF7A 3BUBA 3I2CH 1S9XA 1EJFA 3SCMB 1NINA 5D5MA 5LGJA 5M94B 5JXAH 1M7IA 3TFKC 3WEBA 4D0CB 4NOBA 5AWNH 5EG6C 3CCHB 5AYTA 4GAAA 1IL1B 4OTXH 1TZGH 3WIHA 3HB3B 3BCDA 2BRRH 3SPCA 3CFUA 2FUTA 2BDNL 3BIKA 3WJJC 1Z5YD 5CCKH 2BMKA 3DJTA 1P7KB 4LRNL 1YCSA 3H2PA 4K8RH 1KTLA 2R8SH 1AR1C 2ZUWA 1JZ2A 2FBJL 4JCMA 1L7IH 4WV1B 4PWFA 4QRRB 4ZFOL 4JM2B 1EGJA 1OPOA 2AQ2A 4K5OA 2BHFA 4QXGH 4NQEE 1AC6A 1BF2A 3E8VA 4JDEB 1OB1B 3PXJA 5DJCB 1D5MB 4G8IB 2ZSVA 1K4CB 3LKQB 5DRZA 3HHSA 2IJ0C 4RDBA 3LQMA 2KPWA 4ADGA 5H4YA 1O7VA 5DU7A 3M45A 4ZX6A 4BZ1A 1HXKA 4QRUB 2VLJA 3KPSA 4LPTA 3GEFA 1T1XA 5AALA 1JPFA 1PY0A 2FYVA 4RNRA 1HU8A 4HS6A 4LRNH 2DI7A 4MXWL 3O2DL 2RALA 3MV9D 3P4NA 3ROLA 2WQRA 4BH7B 4JZOA 1ETZB 2FLBT 3WNPA 2ODIA 1YDPA 3T4YA 2ATKB 4HIIB 3F7LA 3IMUA 2JJVA 2F1EA 2UUDH 2I32A 2XXMB 3ARYA 3BP6B 4M6NH 4N8UA 1F13A 3BSGA 1T1ZB 4I87A 1YC8A 4JMXA 1LP9B 5KVGE 3S5ZA 5F2FA 3U4EB 5BUGA 4U1KB 1ETJA 3WUWB 4PJAF 4M7ZC 1C5BL 4NUJB 3FYIB 5SWQB 4D94A 4MWFB 1T20A 5IBLC 3C6LA 2O93L 1ZS8B 5F70A 3KW7A 5AOMA 1FH2A 1EAJA 1Q0XL 1TQWA 4LCWB 3WD5L 1AJ7L 4N24A 4UDUA 4NBZB 2GC4C 2BVUA 2XBDA 1BEYL 1HNGA 4URKA 3O2DH 4WJ5A 2DD8L 3I6KB 1ILSA 5A3IC 4TV3A 4YNYA 5JIHA 1LO3L 5DJYA 4H8PA 3OKLB 1B2WH 1I4FB 3PPEA 4Q9RL 2AEOA 5EA0L 1YY8B 5L4IA 2OMXB 1H19A 3SGEH 3UZVB 3QG6A 4AMKL 4X4MA 4MDIB 2DS4A 2W65B 1XVSA 3WNIA 1NCOA 2KLSA 1JN6B 3U7AA 3G5XB 4EUPG 5IB1B 3VJ6B 2EJ1A 2DLTA 4WKZB 1A66A 2WZAA 4AQEB 5I0DA 3BZEA 3T0XA 3B37A 2MQCA 5H94B 5B7EA 5T3XD 4D2NA 1ASPA 5C0RL 5FUCC 4AQ1C 3WD5H 3QRFM 2KL6A 3WFCH 2QQLL 1EVTC 4JFSA 4CL7A 3QUXA 2OX5B 2F08A 1EHAA 2MOQA 1SYVA 2YSSA 4KKZA 3HAEH 3LRKA 2KYIA 3MBED 5GGTL 2ZXCA 4KBPA 5CP7A 2GIMA 4WU5A 1HI6A 1YPZB 1BQUA 2K8QA 5ID0A 4FFZL 2WLJA 4GSQA 3W38A 5EA0H 4YL9A 5DCCA 3QHZH 5AVSB 4KVCL 4EEEA 2DJ4A 1WZ1L 3KM2A 5AZEH 1NMCC 3EW3B 2CRZA 2MCG1 1KN4L 5HHQB 5TDNA 2DLGA 3C60B 3AADB 5JPNB 4Z6AT 3O41B 4YVUA 4HPOL 4F7PA 4EIUA 3VWJC 4S11A 3EHBC 2VNCA 2BIPA 3LRHA 4XVUD 2NNAA 4MDJA 2CZNA 4DGUA 2QQLH 4HQQL 2EXYD 3I50H 5C2BL 2UY6A 4ZG1A 1AOZA 3FT2A 4NUQA 4KXBA 4KZCA 4UUJA 1FRGL 3ARFD 4EDXB 2K6ZA 5B8CB 5KBDA 1SGKA 4FFZH 2NZIA 5T33L 2VQTA 1S9KC 4ENZA 5J6SA 3N1FC 1WZ1H 3WEAA 1WS7A 1TZOA 2E9WA 3DTXB 4HIEA 3TBYA 1WE5A 1D5IL 1KFAL 3MSPA 2XPZA 3QDJE 1KN4H 1OT2A 3VXTA 3VFOB 1QEXA 1E30A 3SGKC 1LM8V 4LB8A 4W9DC 4HPOH 3WFHB 4NIYE 4DTGL 5I73C 1JVLA 2FEEI 3LEYL 1HIMH 1DN2A 5CSGA 3PAZA 3ECBB 3RWDB 4CAGA 4UOZA 4U1MA 5ESQA 4PJGF 4HQQH 3OQRA 3QDMB 2F74B 3FTWA 4BYHA 1EBAA 4E9QA 2XN2A 4K7PH 1P5UC 1XZ0A 2ADIB 3FFCA 4W9KC 5LG6A 2QSCL 3QO0A 1CQYA 1FRGH 1Q9LB 4YVNA 1DVSA 2VW6A 4MJIE 5T33H 1J1PL 1U8MB 2FSEA 4YHPA 1KCUH 3X2QB 1YMMB 2A6KA 4EBQL 4JN1L 1BBDL 3QIWA 1U92A 1KJ2L 2JJTC 3N0AA 3PWUA 5I8CB 1HCYA 1D5IH 3ECWA 3LQZB 4MTMA 3LXBA 4OJYA 4X6DB 4O5LH 5C6PB 4P3WA 5ADOL 3BVTA 1FUNA 2IBZX 1M71A 3D85B 2NXYD 5IJVB 7FABL 4ELDA 1DE4B 2VO5A 4HX1A 5JLZA 4BK4A 1ITCA 3KVDD 3LEYH 4XZUA 4WFGE 4FFYA 4EVNB 5J8OA 3UYPA 4G6ML 3FTGB 1MWAH 2XWTA 4ESKA 1KELH 2W9EL 3HR5A 3PWLA 2RGSA 1EMTL 5FYKL 3VI3A 3DMMD 2QSCH 2R2BA 4YPGA 2Z4QB 3QFGA 1JIBA 4OFQA 4GP8B 4IBTA 1U21A 1NBYA 3BIBX 4NKOB 5E6YA 4PN6A 1JNNH 4EBQH 4JFEA 2Y07L 1AVAA 5TDOB 6CGTA 3VXUD 5BCAA 4JVWA 2B08A 3EIFA 1U8CB 4H20H 3OR6B 2V0AA 4LQFH 1Z9SB 1AO7E 4Y2LA 2BVQB 3GC3A 4E41E 4G6FB 1H3VA 2UWEA 3N5AA 1EERB 7FABH 2G2PA 3ESUF 4WW2B 4OUUB 5HXMA 2WINA 2ZICA 3ME0B 2GY7B 5I6XC 4IW4C 2LU7A 2V5TA 4LSSH 3F7VB 4JPSA 1DTUA 3Q2LA 5FM8A 2BSRB 2YD6A 3ZDXE 3ZTDC 4G6MH 2G4EA 2OSLB 3EO9H 5LCVH 2W9EH 3IE4A 3HHMA 4EUPA 5FYKH 3RVVD 3E1ZA 3NVQA 1NOLA 3OHXB 4LDLB 5T1JA 5CU9A 4QNPF 3C5ZB 1JZ3A 3BSZA 4MAYD 1JXGA 4OZHE 1XBDA 4X99B 5J11C 2Y1YA 4JY6A 4OZGE 4WI8A 3RVXD 2A77L 2P52A 3S3DB 1X7QA 1UB6B 1YQ2A 3KXFA 1HKFA 1OCOB 1L9OA 4L4TE 1YEHL 2HWZH 4B9ZA 1W0WA 4KWUA 1OARL 3CDGB 5GISL 5FOBA 2HLAA 5L4MA 4F24A 5E6IB 3T0AA 3II3A 4HIHB 4MX7A 2OJZH 2OFQA 2YIHA 1ZA3A 1VPOL 4KOBA 1GZPA 3MQIA 4KKBD 3VFMB 5EZOL 1QRNA 3GXTA 4I13B 3SQBA 1CURA 5H2BB 1QBBA 3LHAA 1ND0B 3BAJA 4ANXA 2ZYIA 2B39A 2WVVA 5DJXB 3NJXA 3MJWA 3ATDA 4PI0A 4PJDB 4YWGH 1F1DA 1ZT1B 2KZKA 4YZFF 4G9DB 2A77H 3GMQB 5DUPL 2V9UA 3F12B 1SFHA 4JFDA 4TM9A 4DUVA 1TVBA 1BWWA 2C4FU 1YEHH 2EEDA 4XBGB 1NTDA 1JE6A 4PGBA 3ORJA 1X5LA 2EABA 2GAZB 2NYYC 2XWBA 1MI5A 1NCWH 4H44C 2PCFA 2R1XB 5IEHA 1M1XB 1VPOH 5E2WL 1OP9A 2XPGA 3PWNB 2BHYA 5FKPB 2KLTA 4BJLA 2WVUA 5EZOH 1A9BA 5HVWA 2Z7ZA 4M5ZH 4GW5B 3TH4T 2ZAHA 1MVUB 1L9TA 1UD2A 3CHRA 3UTZA 2XWCA 4Y5VC 4BKSC 4X9FA 3CZEA 2A6IA 3DYMA 4J3OH 1I7TA 4XXDB 2XWEA 4WFHD 1ES0A 4X7FC 3ESVF 4U1JB 5DUPH 3VMOA 1BLIA 1T1WA 4X4XA 1FL3A 2ZUSA 3MROB 3GHBH 3PGCB 3S35X 2BPBA 3KLSA 3T09A 1RHHB 4Z78A 5EU6D 1GS6X 3OKEB 1J9TA 2HLFD 5IVXE 1QX1A 5J3HD 3HS0A 5I74C 4XPAL 3ZE0B 5C2UB 3T0ED 1H8LA 1AXSB 1J7VR 5EU4B 3V4VL 4I85A 2HLEB 3BPCB 2QTVA 3RNKA 1U3HB 1SLXA 4FDWA 4NKMA 5EUOF 5F7NC 1OAZH 5B22A 2WWNA 2W94A 4EDWH 1A64A 2D7OA 4N8CL 1FAKT 1T6VN 2CNYA 2IOIA 2VZUA 3TCLA 1DANU 5GS2H 3QC5X 1WDAA 1AXTH 3AWEA 1FE8L 4G7YH 1EQWA 2X9WA 3W9EB 2X3AA 4Y4KA 4PJEA 2PR9A 3JTSB 1KXQA 1G7IB 3UIYA 5TQ0H 4TPRL 1T04A 3WXVL 4WHDA 3TA3D 4XP5H 3NQKA 1EJOH 1SEBA 5SX4I 4AYMC 3JVGA 3TV8A 1KWKA 4KFMA 3GIVA 2Z7UA 4XPAH 4OSUL 3NZUA 3ZE2E 2BWIA 4E9YA 3IETA 1SHMA 4ZFOB 1KZQA 2GJZA 1ZDQA 4TSBL 3V4VH 4JUTA 2X88A 5ESVA 3Q8BA 4I0PD 2EDFA 4LSVL 3UDWA 3NIDE 5HDRA 4N8CH 1NBQA 3NYKA 3K2KA 3QJFA 2Y7LA 2ALAA 3KBEA 1A1NB 1CPUA 3V6BR 4D8PB 1GH7A 1BIIA 5FUZL 1ZLSL 4DGVH 1KGCE 4RFNC 3VFNA 3NIFE 1WIPA 1M3IA 4B9KC 1NMBL 4A7QA 1CLCA 4NNXB 5GRVL 3BWZA 4L8SB 3KPNB 4I4WA 3CUPA 2WOYA 3LEXB 2DQHH 1CL7I 4IJ3C 1UGKA 4FF9A 4TSBH 1S5HB 4Z7WB 4LKCA 1TZHB 3PFUA 4FNRA 3LH8A 4LSVH 3VGFA 3D7PA 1AQHA 1OSEA 1JGEB 4I3RH 3FSVA 4I9WE 2R7EA 2P80D 4Q9CA 3KE0A 5AVQB 3PXLA 2CLZA 1KCRL 4LAQL 1JYWA 3FCSB 4PJBA 4N26A 5FUZH 3UXFA 3W82A 4N2CA 2VABB 3FT1A 4XHJD 2ITEA 3KZ8A 3HAEB 3QEQD 2SEBB 4NUMA 4NN6B 1XIWD 1ZLUK 1NBZA 1BREA 3DIFB 2E9GA 2QGEA 4L1LA 5GGSA 1PCXA 4C58B 5DVLA 3DX6A 3SE3A 4ZUWB 4L18A 1MCWW 4XWOC 2FX7H 5JPMB 3UG4A 5DC9B 1CN4A 2ZWZA 4JRXB 4IDJL 2F54D 4N2EA 5F3FA 4OCYL 3SDAD 2HPOA 3ARQA 3H2QA 1P4UA 3SE8H 4OGAD 4KJQC 3VXPB 4ATTA 1S8DA 1FVEA 4O2CB 3DPDA 3PP3H 1KCRH 3QWOB 4BFKA 4LAQH 3L9BA 5T1MA 3O3AA 4BUGA 1CFSB 4ZODA 3GZPA 2QVKA 2H3NA 4XVJH 5B38G 4QRTA 4NQCB 2DQGL 1KN2H 4QRPE 4O02H 2IH3A 4CNIA 1BFOB 1H8OA 3HC0B 2WBKA 4BHUA 4PJIA 3LZRA 2YQBA 1JZ8A 4NI6A 1FORL 4PBWD 3WSQL 1GKOA 3TJHC 4JFQA 1CUOA 3KJ4C 4Z23A 5IMLA 3RWJB 3L4WA 2ROXA 3E6FA 3L7FB 3NCEB 1IJNA 4PJXE 1VFAA 3D2TA 1NFDB 1QSEB 1W91A 3HG1A 3CFTA 5TE4L 4XBPB 2BIIA 1C16A 1MHPL 1JZJA 1MUJB 2PABA 3BDYL 3K72A 3KPPB 4YIQA 5C6WH 5FWRA 5CN3A 2ZCKH 4XCCH 1E5BA 2EDWA 1J0JA 2R0ZL 1AXIB 5F97E 3IK2A 3JWOL 4FMKA 3BLBA 5FUOH 1FORH 3E8UL 5C0BE 3WSQH 3UTQA 5JHLL 2CLRA 2NY1C 1XGTA 2DLEA 2OSWA 4LHQB 4NQDD 4CN4A 4JHUA 4H8WC 1JHTA 3P3RA 5D8JL 2R1YB 3PJSB 3WJLA 3MCLL 1OVZA 3OXSB 4G1EB 4DPRA 3B5GA 1A6AB 1YN7A 2OR9H 2CIIB 4B50A 1H5BB 5CD5D 4HWEL 3CSYB 3VRIB 4YGVA 5HPMB 5DQJA 3T2NH 3BDYH 4S2SA 1MWAB 2ZX5A 2WUCL 2XXCB 4RGNB 3QORD 1FH5L 5EZJB 3IYLW 2QLYA 3S2CA 1QUPA 4G8GD 3RWIA 3NT0A 2R0ZH 3HN3A 4OR1A 3VG0H 3QO1A 1B4TA 3JWOH 2W0LA 1MI5E 5A16B 3T3ME 5JHLH 5TFSH 4A2EA 4ZMTA 4TNFA 3KM1A 3IAPA 2OQJA 5IFJB 2I69A 1YYCA 5DD5L 3R8QA 2D0HA 2PO6A 5D8JH 3H9SA 5C09D 3MCLH 5EF2A 5C6TL 4M3JA 3ZTJG 1MAJA 3NJHA 2MRYA 3GSNL 1W6WA 5IMMA 2Q6WA 2AK4B 2E7CA 4PLJC 4OZFA 4KJPD 2D7TL 4BDVA 3A23A 5AOJA 4GAGH 1KB3A 2WUCH 4A66A 3DVNA 1CGSL 3GXMA 4S1QL 1FH5H 1WQVT 1GYVA 1OSZA 3VNZA 2X89D 1CCZA 1WO2A 1JZ5A 1VA9A 5M95B 5DEFA 3GUTA 1DZBA 3ULSB 3VFGL 2FT8A 3L8QA 4MVBC 2HVJA 2JIXD 4UTBL 3NTCL 1UUSA 4XNQB 2HUHA 1DLHB 3BPOC 3AREC 3VFUA 4F27A 5DD5H 1JXFA 5F7DA 3BKMH 5C8JA 1BVNT 4FTVB 4JBSA 1P4LA 5F1NB 3OPUA 5KYNA 3V7AG 4FAAB 5I6PA 4W9IC 1KPUB 1SF3A 1GCYA 1S46A 2YUXA 2D7TH 2J73A 3V6FA 2G2NA 3FQ1A 3HG4A 4HKBB 5F93C 4R2GC 4YFEA 4FLOA 2UZYA 1OLLA 3VXRD 1CFNB 1JP5A 1OE1A 3LNEA 1K9TA 1BD2E 2YGQA 3PWJA 5SWSE 2JJSA 1UKQA 1OEZW 3VFGH 1J9SA 3BDXA 4MS6A 3VXSD 2P5WD 3QNFA 1HL9A 2E3VA 4UTBH 5B38A 2R29H 3NTCH 5H4ZA 4HUNB 1CZ8H 4X5XB 5ICZB 4N0RA 1MF2L 3MRQA 1SUHA 4JHBA 4KY1L 4GYBA 4Y1AA 4YE4L 3BJLA 3IDNA 2H0JA 1P1ZA 3T8XB 1F4AA 3TWYA 4MMZC 1SOQA 1M56B 4ZMWA 1DHKA 3ZZQA 2XZQH 1XH2A 3KYAA 5DO8A 4HSAC 5JW3H 1HHGA 3VO0A 4X6CE 2D7QA 3GJEA 4HS3B 2N56A 2VN3A 2XQ0A 4BXSV 5D2NB 2EKSB 2GY5A 3KLAA 3ZZ1A 2DYPA 2BP5M 1LXMA 2AJVL 1Y18B 4RMBA 2OXHA 1ESOA 1HAWA 1SLVA 2FQGA 1EUTA 3CFBA 2VZTA 3AG3B 1UM4L 3KYNA 5F7YC 4PJ9D 4O2FA 3MMEA 5BMFH 2DKMA 4F8PA 1KLFB 3GUFA 4LIQE 3LNFA 1WWAX 3HBPA 3ZZSA 2UXGA 2VJ0A 3TONA 3BEVB 3L2NA 3DX1A 5ENWA 2XX1A 2PCYA 4DP1X 3LX9A 3O3BB 2P5EB 4I88A 4M8VA 5BJTA 2F61A 2ITDA 5PAZA 3RU8L 2JB6A 3HE6D 3PL6C 3QPXL 1A4KB 2DWDB 4DGWC 5KG9B 2NYKA 4MNQB 3B2DC 4OB5H 3QWRD 3SQOH 1Y6NR 4H4NA 5DUJA 1QZ1A 3WNMA 1UWXH 5DLML 2QGBA 3DDFA 4IGBD 1DUYB 1JWMB 1EEQA 1ZVSA 4QRQA 4QHPA 2WO4A 3DHUA 4Z77A 1UZ6E 1VFMA 3DRTA 3N42F 3NAAL 4GIPD 3CZKA 2QSVA 2HFGL 4F8NA 1HX0A 5L7XL 5CCGE 1YEWA 3ZDXF 2X42A 2D3NA 4JRLA 3BVWA 4P4RA 2XTSA 4HMEA 5C0EA 5JYLA 4TYUA 2P8LA 4FQQB 4RH4A 3RFZC 1XCQA 3G5YB 1NWPA 5CEYB 3RRQA 4MNHA 3UROR 3V4VB 3RU8H 1EH9A 5GRXG 4OZHF 3QPXH 1GY1A 3GKWL 3T6ZA 1USQA 4OZGF 3TIDB 3ZO9A 5GZNC 2GJJA 4FQ1L 4MCZA 2AXHA 3CZLA 3MGTB 2B8OT 2GJ6E 2ESVA 5FYKU 1DEDA 4HCIA 4AIZB 1RPKA 2QDWA 4A7GF 5KYXB 3NCBB 3SODB 5F44A 2VLKD 5L7XH 5DJ6B 5GSVA 4JFHE 3UTSD 1UA7A 4CDHA 3HUJB 2VXUH 4QJ4B 1QO3B 1F0LA 2QHLA 4LU5L 2H6UA 4Y2NA 5CBAB 5EEXA 1F1GA 1KTJA 4PLKC 1XV8A 4NDMA 5DEJA 2ZQKA 3BQVA 3K91A 1BV8A 4LLYA 4Y16C 1CIUA 2RB8A 1LE9A 4LE8A 3HG1E 3OAYK 1FFNB 2QHRL 4M48L 2CBTA 3GKWH 4MA8L 2GHWB 2HFFA 1OZTG 2ZUUA 3H8NA 1K2DA 4GAJH 3RDTB 2VL5B 4FQ1H 3C6SB 5MEOA 3N06B 4JFYB 4V1DB 1A4JA 4L5FH 2BVOB 4HIJA 4JZJC 1BPLB 43CAA 5DYOA 4JFOA 4ZXBD 4W70A 3D0AA 2ZWKA 1R34A 2BIHA 2XG4B 2B3RA 2Q9OA 1X44A 2C3HA 4GOSA 1MFAH 1HSAA 1YNTA 3C8HA 1F3DH 2XFXB 1HEZA 3ZT6A 5AB9A 5F7HA 1Y1DA 3IMRA 2O1AA 1EAPB 3CVHL 4UZUA 1EWHA 2FGWL 5E03A 3BGFB 2R69L 2IBZY 4L1SA 1T3FA 2B2XH 3EG9B 4ZMZA 1MFUA 2KZWA 4ORGB 5D4QA 4RQQB 2ADFL 1WGOA 3Q5TA 2QHRH 4N2FA 4M48H 3S96B 4XBEL 4MA8H 1KGYE 4P4KA 1G7PA 4PCKA 2D4FA 4WNJA 2ZOWA 4DHLA 2BXZA 1VENA 4N2LA 1S4IA 1BVOA 4FZEL 3HMWL 2Y7SA 3FT4A 5DRXB 5IVXF 4YLQT 1MJJB 1SHXA 2AEPL 3JYCA 4R5TA 3CLFL 3QI9D 1GGBL 3KPMB 3GSVB 1SJEB 2VLRA 3VX0A 1DJXA 3DURB 1J12A 1CI5A 3B43A 1OP3H 3CVHH 2FGWH 1FGVL 1RHFA 2D31B 2XIDA 5FB8B 5I30L 2X4OA 4QOKE 4NM4H 4XBEH 5ANHA 1TSHA 2EEFA 3I9GH 5E00A 3WOVA 4JX0A 4PRAA 3NSDA 3S98A 3HE7B 1OD7A 4FLHA 3LAFA 4FI6A 1M57B 4RRPM 3C9NB 4OLZL 4N6RB 1VZIA 2LQRA 3AAZB 1WZMA 3IKKA 3ZDWA 5JHAA 3ULVD 1TSRA 4FZEH 3HMWH 2X70A 3L5IA 3L7EA 1A9EB 4HGWA 5A7EA 2BSBA 3J2PA 3O0LA 3VI4E 2X6UA 4BRVA 3APFA 5E1AA 3WI9A 2QVFB 1RZKC 1AG0A 5E6ID 1KPVA 3RKDD 3CSTA 3UX9B 4UTAH 4G9FA 3ZE2F 1GC1C 3TZVC 1ZT7B 4LMQE 1YYML 3FQRA 4NQVA 4FYTA 1C8PA 2ZE0A 3MX0B 4BZ2L 2HJFB 2VMDA 3LKPA 1NGXB 3MRJB 1M1SA 2XHNA 2IVFC 1ZE3H 2Z91B 5I30H 3NIDF 2XXFA 4L3CA 1YVLA 3AXLB 4ZFGH 1DFBH 2E7BA 2HN7B 1FNSL 3HKZA 1KACB 3B3IB 2FEJA 2Z65C 4IBQA 2X6VA 4ZMLA 4FN0A 1NGYA 3L3OA 4OLZH 3BESR 2EDBA 1KCSL 5CUSL 2CIKA 2JKXA 1VF5C 4JB9H 4WWKB 3NIFF 4W9ZA 5DS1A 5ABDE 4HUWB 1I1AC 4APQA 1IKFL 4FQ2H 1BJ1J 4OGYH 1AGDB 5ESAB 1TPXC 1YYMH 3B5TA 4N90E 5EBGA 4DZBB 1PTZA 3PWVA 3TJEL 1S6NA 1ZA6B 5A6IA 3UTPE 5J13C 1UD6A 2A5UA 3WIFA 2V7HB 1A6TB 3DDGA 3FCTA 3EDFA 4NP4L 2G9KA 4FXLA 1R3KA 3X1NA 1FNSH 3IFPB 3TN0B 3HFFA 1SY6A 1A7BA 3EXJA 2E7LC 2CGZA 4LFHD 1M3JA 1E4JA 3FB8A 2CBOA 2V2TA 3DVIA 1KCSH 5F9OL 1KF9B 2MQGA 5CUSH 1JI2A 3MR9B 4H26A 3SCMC 1AHWA 3NCMA 5K9KB 1JXKA 1L9RA 4P2QD 2EC9T 1KYFA 3DVGA 3ZE1E 1A7PH 1LO4H 4XMPH 2B0SL 4ZDHB 2HT4D 1JSYA 1X5HA 1D7CA 2ICWB 4F58L 3HB3C 1GR7A 4M3HA 5EH1A 4IOIA 1NJ9A 4QT5B 4UYPA 3RE0A 3UGEA 5DLLA 1UD4A 2FZ3B 5DJAB 4NP4H 1FNEB 4X98A 3FBKA 1DDTA 3EAKA 4WV1C 3ZT7A 3Q05A 4D7PA 2E6PA 3FCUB 4JM2C 3TNNA 5DI8B 2X4TA 3QRGL 4BFIA 2JNZA 1DDHB 3GSNB 5E1IA 5EU7C 2DJSA 1OO2A 4AMXA 3MRPB 4PRHA 4MJ6B 1OF0A 4HJGA 4BELD 5HHVL 4F7EB 4TUKL 4NLAA 1SYSB 3EBGA 4DFHA 2K4AA 1VACB 3T6VA 4F58H 1IGMH 2GBVA 5C7ZA 3CE1A 4HFUL 5F7WC 1H0DB 1J8HD 1NEZB 1M7DB 5CEXB 2J5WA 1PF3A 1IC7H 4PJXF 4WUUE 1MDTA 3D3VA 2CPCA 4YDVB 3P73A 3ROOA 1OTUD 2I5YL 4ZYKB 1OOWA 2E46A 3QRGH 3RWFB 3SE4A 3PV6A 3RJOA 2D73A 4TUOA 2WM0A 3VM7A 4PRPE 3L4ZA 1ROWA 4CDGC 2CH8A 5I0ZA 5E5MA 1V10A 1UOWA 3LY6A 5HHVH 1BSIA 4TUKH 4EI5D 2ESVE 1QFWI 2C34A 1U8OA 1A3ZA 5SWZA 2VERA 4WIQA 1U8KB 3EYOA 4ONHA 1BFVL 1HAUA 2NX5E 2FT7A 2AMUA 2B9AA 4GKOA 1NCDL 3V6OA 1XSKA 4AGMA 4ETQB 1SXBA 1NGWB 3A22A 1NCCH 1PKQE 4FS0A 5ANMB 4GPVA 1TUPA 2ENSA 1XMEB 2WSDA 3D4ZA 1GYAA 3QEGL 4Q6IA 4W9LC 3SZ6A 3VGEA 1L4IA 1RUQH 5E4AA 5C0IA 3IE9A 1DVFA 3L9RA 3SKOB 3T8VA 5JW4M 1U2HA 2I5YH 2J4WL 2LGNA 3QJSB 4C56A 3D34A 4PS4L 2YLHA 4NP9A 5C0DA 1L9NA 1HTYA 4UBDD 1XSOA 2OI9B 2W07A 4HV8B 5JHDB 5E8EA 4OZ4B 4ZFFA 1T66C 1I8KB 2DIJA 1T5WB 4NZRH 3QFJD 3BUQA 3ZRSA 4N0UA 1FFOA 2YPKB 1BFVH 5I8KL 3T3MF 1XF2B 4NRYB 1NCDH 3K6NA 2DWYA 1CFTA 2KMWA 3PHOA 3Q5YA 1U6AL 3EZ8A 1D5RA 4TL4A 4YEEA 1IVTA 4P5KA 2VDQH 2NY6C 2O30A 3EH1A 5CGMA 5C0GB 3UGUA 3SDCA 4YSQA 3HG0A 3MBXL 2E6QA 3ARBB 3F04A 5AL8A 3LQAL 1N0LA 1MPAL 3GLEA 4PS4H 3NEEA 4A7VA 2MCPH 1BOGB 5D71L 2EYRA 3TXAA 1WA2X 1YAZA 1RUPL 4JPIB 5KUKA 5J12B 4ONOA 4MCNA 2H1LM 3NJJA 2NQDA 1PVHA 3MRHA 3GXFA 3PAUA 5L8KB 4YBHA 1I85A 5IQNA 2Y9RT 3VXOB 3GSUA 4EN3C 1GGIH 3BD3A 5I8KH 1F5WA 5E08H 4FFWD 1USZA 1RULL 2AERT 1G0XA 1SLUA 4B41A 2HVKB 4FQPA 4ZPVB 3S3JA 1I9JL 4ZMPA 1P4BL 4MB1A 3UG3A 4ABWA 3FQTA 5B8CC 1ILUA 3MBXH 4PUBH 4AEHL 3LQAH 4DN4L 5I8OH 1MPAH 4FNTA 3N40F 5LBSL 5D71H 5KYWA 3A47A 2O6PA 3GPSA 1ZV9A 3BI9X 3I9PA 4AIOA 2IXQB 3MRDB 3FT0A 2K3TA 4X5PA 5JORA 2CGRH 1S7TB 3O9WB 4LVEA 3WMQA 1XGPA 2G0KA 1RJLA 3MV11 3VQMA 1JI1A 4PG2C 4J3XA 1E8WA 1RULH 3JV4B 3U2SA 3U4AA 3LKRA 3QIBD 5HSFA 3FO1A 3ETTA 3NIGB 1LL1A 1ETB1 4W4OC 4FMVA 5JNYB 3T65B 1CGWA 1P4BH 3S3CB 3SDYL 3U1SL 5F7MC 4AEHH 4BKLA 3ZHKA 4DN4H 2BNRD 2Y5TB 3OJDA 3V4PA 5C71A 3EJCA 1LWHA 3QDGD 4AKQA 3RWHA 4IMKC 4NRXB 2FX8L 1JZIA 5LBSH 4GUPB 5EB9A 3QNZB 5IROA 3V0EA 2GSGB 4X6CF 5BXFA 2DLFH 1QEWB 1A8ZA 3WY3A 4QRRE 1N6VA 2VN7A 4AYID 1CE6A 4KK6D 1OCWL 2VR4A 4CILA 3F3HA 5EU7E 3TIEB 1SJXA 1U2YA 2GC7C 4A6YL 1LK3H 2B9BA 1A65A 3NRQA 5I2IA 5E2JA 2E76C 2YPLE 2FVNA 1ED3B 3B56A 1AD0B 4AZUA 4JRYB 3HC4L 4P5MB 5D7HA 3OAWA 2CBPA 4FXKB 4WNQB 3ARGA 5E6UB 3WKMH 4HZLA 3U1SH 3VTMA 2YO3A 2ED7A 4HH9B 3U2JA 2UYLA 4JKNA 2FX8H 2NZ9C 4O4YL 2BNQA 4OAWB 2GB2A 4PQXA 3CVHB 4LNRB 5T1KB 3WNLA 3MV8D 2DKSA 3U0TB 1ONQB 2CBQA 5E2TL 5J89A 1SXCA 2H8PB 3D4CA 4B0MB 3WS6C 3EYQD 1LP9E 3C2AL 4ZPTB 1KEGL 2J2ZB 4A6YH 4HDIB 3CGTA 3DRQA 5IF0A 1T83A 2O5XL 4G59C 1L5GA 1U30A 1UZ6F 3X13A 4FLQA 5IB3A 5MEPA 2Q87A 4A2FA 3EDKA 4FYQA 3IS0X 3T2OA 2VZOA 3OHXC 4OD1L 5TGBB 3ZRFC 5HHOE 2V3FA 3C5ZC 1DUZA 5FYLL 1W0VA 4LCWE 4FTVD 3ZRCC 4B0MM 3FOMB 3G6JA 2FIKA 2HT3C 1KOAA 3JWDL 4K9EL 4KDWA 4FFVC 3DUUB 4O4YH 3QDAA 2HJKB 2WIIB 2WP3O 3IRZA 4DKAA 4BQCA 5E2TH 3ET9F 5FA4B 2QBWA 5FK9A 1SN5A 3C2AH 1KEGH 1FNLA 4EIZC 4OF3A 3Q6FA 2F53B 3LZFL 4JL2A 3G7TA 3GMPB 2O5XH 5L4JA 4H88L 5EBWB 2ARWA 1VGKB 4WW1A 5DFWH 4KGJA 2NY0B 3TU6A 3EOAB 1UOKA 1GKEA 1UJ3A 2AAVA 3FRPG 5FYLH 4QCIA 1NBVH 4WFED 3FOLA 4GXUM 2K70A 4EIBA 5J6HA 4U1GB 4H5SA 3HNSL 3MJ9H 4ONGH 3KCWA 4K9EH 3O4LD 4MBRA 2WNGA 1M9SA 5EU5B 1FYTD 4HJJH 1YPZE 1TCRA 2CKBA 2IADA 3QJRB 3QVAA 2NLJA 3QZWB 1QW8A 5JZ7C 1ZSHA 3MOBL 1PX4A 4DAGH 2WLLA 2O6EA 2ZOUA 4R4NC 2A1WL 3GB7A 3ZHNA 1IQDB 3B2PA 1MKFA 3TBTA 5L6YL 4KNQA 4A2LA 4J3OD 3IJHB 4OBRA 4OJFL 3NMEA 3QDHA 1JYXA 2KH2B 4S0HA 4MCMA 4HHGA 1AP2B 1V3JA 3EO1A 3TBVA 5LGHH 1NLBH 5GIRB 3O8XB 3EO0B 2IPKA 1ZXQA 2Z8SA 4DUXA 2OL3H 3C5SA 5ERWA 3MRGA 1F4HA 2EH8L 3HBGA 1E6JL 4ZUTA 3FO0H 4R97C 3HNSH 4UQ2A 2CGYA 1JFQH 4P2OB 1QVOA 5KS9A 1PLAA 2XVLA 4QY8B 2CPUA 4DO5A 4G3YL 1I1CA 3SYPA 4MA1B 2H4EA 1UJTA 3WTTA 3S4SB 4F2EA 3VAEA 1E3FA 5IVZA 1C5DB 2X6MA 4K8RC 3DJZA 3F2LA 3QC6X 2CO7A 3R4DA 4JY5L 2FLMA 4BFBD 1E4KA 1CD1B 4KUCF 1XF5A 2G4GA 1MCHA 3SKUD 1GIGL 3CFDB 5TQ2L 3DROB 4OJFH 2XG5B 3FT3B 5GS2D 3SDXA 4XC3L 1ZGLA 1ANUA 1Y6MR 3K6IA 3WHE1 2DICA 3WS3B 4PJFA 2XVBA 3T0BA 4PS3A 1UKSA 4HJ0C 1NC2A 3QDME 4BXVA 3MKGA 1FL5B 1KDJA 2ZOTA 3V0VB 4L05A 3DO3A 2XBTA 2CNZA 3M46A 2Q10A 2EZ0C 3MI6A 3L5WB 4MQTB 2A2QT 3V8CA 4G3YH 1Z6JT 3GMLA 4TSCL 4XMVA 4GG6E 5F6IC 4G1MA 1YMME 3OZ9L 1JZDC 4PJ8B 2ZOOA 3C5JB 1FSKB 1B90A 5TPWL 3OKOB 2YD1A 4OD3H 1P9MC 1BF8A 4JY5H 1G0DA 4AJVA 3ZKND 1LJMA 5EEVA 2L7JA 4PY8J 1BJMA 1L0XA 4X6DE 4ZAKB 5EBLA 5IQ9B 2AV7A 2CLVB 4NKIL 3BZ5A 2GUOA 4N9GB 4UM8B 2F5AL 1ERNA 4HD5A 5IJKA 1E7VA 3VI4F 3VFVB 2MCAA 5D7LE 5DJ2A 5L9DL 1A6UL 3CFIC 1DCLA 1MJ7L 4IHOA 3V0HA 2E75C 2FATH 4K3JL 5CEZH 4DKDC 3AJ7A 4NFCA 1T7VA 4LPXA 4R0LB 4L29B 1IB5A 3K8LA 5DVOA 3HZVB 4NKQB 5I15L 1O9WA 3BOVA 4TSCH 1PU0A 5FGCB 3OTTA 3OZ9H 2OBGA 4U3CA 3V5KB 3V5HB 4PV9B 4W9HC 1FDLH 2ZIDA 3FQUB 3GJFB 4YHIB 1OP4A 4RDQG 3U7WL 4UDTB 4L8SC 2NNCA 4J28A 3LNHA 4N5ED 4V1DD 4RX4A 4LPCA 4PCYA 3HC3H 2F5AH 4FNUA 3PNRB 4O2EA 2Y06H 3BKYL 5DWUH 4L9LA 1Y07A 1N59A 2IANE 4EXKA 1TDQA 1S5IH 1A6UH 3D9AL 3S48A 4G6JL 3Q1EA 3SOTA 5GS1A 1MJ7H 1MVYA 5ILTL 4XVTL 5HD8C 3GS7A 5EZPA 3LPOA 1Q38A 2EDNA 4PB9L 4LL9A 4OJCA 5CSZA 3MJ7B 5A1AA 5I15H 1CICD 2WC7A 1YSOA 4HS8H 4PRID 1BZ9A 2ENPA 2K6YA 2VSCA 3CQFA 4J4PD 3QEHA 1FAIL 1JK8A 1MAKA 3RL2A 5FYJD 3N1PC 4NN6C 2PCXA 4WDIB 3G08A 3U7WH 3DVFA 1SJMA 3A3YB 3BYYA 4U6VL 1TVDA 3HG3A 1N19A 2AKRB 3BIAX 1BMZA 2R0LL 5BO0D 4FQHB 1OGAA 2WTOA 3ZE1F 2F19L 3P9MB 4KO5A 1CLVA 1FVCA 3AU1B 5JPMC 4XPFL 3FMGL 4EF3A 2G75A 2KERA 5F7KC 5ILTH 1PIGA 3ELQA 4LLVB 5EO0B 3KLKA 3N55A 1FHNA 4LBAA 4M00A 4PB9H 3BAWA 1DL7L 3DX8A 3SPGA 1ZHLB 2YPVL 5L0QB 3M86A 3T4AB 1CFMA 3UP6A 1NCBL 3A5VA 4IS6B 3KBPA 4PM1A 2BY3A 1IBBA 2OLDA 5GGRY 5IM7B 5BS0A 5GS0D 3Q2NA 1YG9A 5D1ZB 5E51A 4QXTA 3RI5K 1HJCA 1OAKH 1AGEB 3OB0K 4FQCL 5TDPA 4JFXA 3GSQB 1N2RA 4IU3B 5ID1B 3WELA 2WXHA 4XX5A 2ZKWA 2ZXBA 3ASOB 4LF3B 1PL3A 4RMUA 4JZNA 1IGTA 4B9GA 5F8RC 2YUVA 2BSDA 3P1VA 4P57B 4XPFH 4XRCB 3MV7D 5L2KA 5EEZA 1T0OA 5BO1L 1RAMA 2X2YA 3CC1A 3BX7C 2EYTA 4JO1H 2JKWA 3LOWA 4R7NA 5A2JH 1DL7H 3O6LH 1JS4A 2Q0ZX 5DEZA 3WY4A 3GK8L 2YPVH 4OCLC 5FLVA 1SNRA 2JI3A 1PAMA 2Z31B 3NN8A 4LEXL 3T2LA 1U42A 1GS8A 4YBQC 4FQCH 4UQCA 5D7JA 2NR6A 1RZIA 5CJQL 2RR3A 3VYPA 4ELKB 4NIKB 3RLSA 1RZGB 4K94L 4LPWA 4P2AA 4HXAH 4ENEC 3QQ4A 4I5BB 4FZ8H 3HG2A 2EIBA 4MD4B 1E9QA 3QXWA 3ZE0E 2KBGA 4M7LL 2WNKA 3T08A 1BAWA 4L0YA 4G82A 1QD0A 4P5RA 3EH2A 2P45B 3TVMD 3WL9A 1R5VA 3HN5A 4L4VB 1S9VB 3OLIA 2A6JB 1BG9A 4DZ8A 3FN3A 3PRZA 5C0CB 1H5BC 3GWJA 3MREB 1FPTL 3BMWA 1OIOA 3S7GA 2NUTB 2QGDA 4LEXH 4NYLB 5B1JA 4RAVB 4RGNC 3QUHA 4ZOEA 2UZPA 1F58L 5C0AD 2CO6B 4UQEA 4F8LA 4JRWA 3H42L 3NFSL 2E9JA 1OW0C 4NQSB 1A7RH 4XP6L 2YD9A 4ELMA 5T5FL 4U1HA 1A3LL 2C3VB 3OD3A 4JKPL 4OCXL 2JKSA 5I6MA 2NUPA 1L6PA 3WDIA 5B1CA 1JNHA 1WLHA 5EOCL 2ZKMX 2IFGA 1MIEL 5HYJD 4PVNA 3QUYB 4CJ1A 1NAML 4K7FA 3KPOB 4A6YB 4CW1A 5TJWK 4JFTA 2CRMA 3HRZA 4NSKB 5A43C 3LSOB 1FPTH 5E5UB 1KXVC 4XCFH 4PJ7B 4Z7VE 5DF0A 8FABB 1RU9H 4LDCA 5IBTH 5ISZD 2LOEA 1A5FL 3MV9A 5FO8B 1IE4A 3EGSB 2W95A 1VAHA 4NQTA 5I16A 2GTZB 5FA3A 2ARJQ 3L3DA 4ZD3L 2XT1B 1A3LH 3MLZH 1K3IA 3JZYA 4JKPH 5D1QB 3V10A 2B1AH 1CFQA 1QZNA 3O0RL 4WWOA 5B1KA 2HFEA 3OL2A 1BQ5A 5EOCH 5FOJA 3P2BA 1OAUH 2DJMA 2QSQA