3NKGA

Crystal structure of geba250068378 from sulfurospirillum deleyianum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
170
structure length
170
Chain Sequence
APNPISIPIDLSQAGSVVEKEVKIEESWSYHLILQFAVHDRKEDGGLDGKRVWKFLGFNSYDPRDGKQVGYVDYRLAKSELGDLIDETYDCDGTVVPIKITIHQINQDNTKKLIADNLYMTKGNGSGAYTRDITTISLDKGKYIFRIENIEAFSEMIGRKVDFTIYINKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein GEBA250068378
publication title Crystal Structure of GEBA250068378 from Sulfurospirillum deleyianum
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Structural genomics, unknown function
total genus 40
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18539 DUF5625 Domain of unknown function (DUF5625)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.790 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nkgA00
3NKGA
chains in the Genus database with same CATH superfamily
4FPLA 1TEIA 3ELNA 1DCSA 3VN4A 1XYOA 3VHOA 1OBNA 2AC1A 2R32A 3AMQA 4GH4B 2VBPA 1CIWA 3UKTA 4KG0A 2WNVA 1WUVA 2RM21 2RMU2 1HXS2 2WSUA 3MIBA 4LXLA 4Q4W1 4XQWA 5FZAA 1C3HA 1B35B 3MICA 1OOPC 4J6GA 3URFA 2VMEA 1OLMA 2P4EA 4RR3C 1DQ5A 1DHKB 4BQYA 3P6BA 3LFIA 3AZYA 4XUOA 5FFOC 1VBD3 4TTGA 4XXPA 4Q2FA 1LULA 3GJBA 1COV1 4FTEA 4CDXB 3F2ZA 1GANA 1OLQA 3I7DA 3QOPA 4H14A 4YW7A 3VBUC 1JYTA 1S0BA 2R071 3H42B 3JBG1 2CGOA 5T54A 3WEZA 2WZEA 5JXIA 1SFYA 5JDBA 4NWWA 4JGZB 3MFAA 3IDEA 1BYHA 2GMMA 1QU0A 3INAA 3BCWA 2K2SA 2CDPA 2YB7A 4FFFA 2TBVA 4Y1ZA 3RSJA 4A4AA 1VMFA 4XDQA 5FZOA 1QQP3 2E7AA 3LPGA 4ZU5A 3WUCA 3GGLA 1GOHA 2HWE1 4LBKA 4AVSA 3NV3A 5FYBA 5LB6A 2C4XA 3Q8CA 1F4HA 2ZAHA 4DRVA 4B4RA 5IVJA 1DYOA 1XRUA 2NM1A 5DABA 3QACA 3BODA 5B4XA 1NAEA 3H0OA 3N9MA 1FPN3 4RS5A 4CCKA 2VTFA 2VCAA 4XJAA 2FCVA 1W6MA 4R9BA 4P9YA 1RVF3 1UMIA 5ANQA 3WW4A 1QJFA 1YFYA 1SG3A 2W0XA 5KBFA 3NO8A 1X82A 2E33A 4IEZA 1UYXA 4NO4A 2OZ6A 3K4ZA 1E5SA 2WS92 2WT2A 3EB7A 4B1MA 4BHPA 5JSRA 1FNZA 1YYNA 1GZWB 4XXAA 1LOAA 4L11A 2D6NA 2Y6GA 1VBE2 4RQPA 4XUQA 3T0AA 2WAAA 3OY8B 4AHYA 5K7PA 5IVBA 3C7EA 3SH3A 4OQ9A 1O59A 4LHKA 4K20A 4URTA 4CTEA 2VOWA 3TNQA 4JTOA 2BNNA 2P6CA 1GYKA 2W3JA 3DXTA 4YM1A 1VE0A 1RJ8A 2W46A 1XYNA 5A7OA 2BQPA 3PU8A 1ZRCA 4AEJA 2HH9A 2XGXA 2F6BA 2A6ZA 2BBAA 4HVOA 1MR5A 3BOPA 4MHUA 3WDYA 1UF2C 5FXXA 3ZXLA 2V4VA 3IPVB 4AFCA 1GWKA 1GUIA 3V0AB 3ACGA 4OI4A 4IE4A 3K3NA 4JC1A 4P14A 4FCAA 2HWD3 1N1TA 3EJKA 3HNYM 4BXSV 4PBPA 2Q5TA 1Y7BA 1RMU3 2W94A 3RVHA 3T1MA 2VD7A 1U5IA 5IW0A 4PDWA 2OS2A 4QU1A 4CDXA 1BZWA 1I6XA 4FTSA 2QQUA 3MLLA 1WLDA 3I2HA 1LR5A 1RIRA 1SBFA 4D7TA 2P3IA 2Y0OA 4XTMA 1AJKA 4D7SA 5LRRA 4Y22B 4JGZA 2HWC1 4K9SA 4ONUA 1RTVA 1ASJ1 2Z4FA 5TSWA 4U36A 2FD8A 3UKNA 2DV9A 2XDVA 5HCAA 2G9ZA 2XJPA 1AR91 3E5XA 3QCWA 3P3PA 1US2A 4PIZA 1QDOA 4Y1XA 3UT0A 3FFZA 5FP9A 5BUVA 1PHMA 4FP2A 4KNCA 4C91A 5JOXA 1CIYA 1B09A 1OA4A 2GU9A 2ZMKA 2AACA 2PLV1 4QKDA 2WNOA 2XWBB 4XCBA 4FPYA 4QPIB 2YC0A 3HEIA 5FPAA 2GNMA 1W8ZA 4QQPA 1ACCA 1J83A 3OGGA 4H2AA 4RS5C 4CPBA 5L9VA 3CU7A 4LULA 1X7NA 2QUOA 5CFDB 4BDVB 3CO2A 3FE5A 1HQNA 3K77A 4HKLA 3ZYJB 3ZSKA 4B1LA 4KI5M 4CXWA 1GZWA 3IIAA 3SNMA 1IZ3A 1EAH2 4Q5OA 3T4VA 1W8FA 3OY8A 4O61A 1RUH3 5I0DA 1FXZA 1QJX2 3KWVA 4YVSB 2HYKA 3KM5A 1LOFA 1PVC3 1YI7A 2WKKA 4TLFA 1VP6A 1RB8G 1Y9MA 1V6LA 2WFF2 2JIJA 3VKMA 3OTFA 4HT1T 1BBT3 3WCRA 2XBO3 3I3EA 5FO8B 1JZ8A 5DN2A 1OA3A 2RMU1 1HXS1 3DECA 2JIGA 3O1RA 4XQ4A 2JG9C 5DDJ2 2Y60A 4K7JA 3NMBA 1TVGA 4SLIA 2CTVA 4XF4A 3UNPA 1AR61 4P02B 4DEQA 3IAQA 5FMOL 4ZY9A 3IPVA 3VB9A 4BIFA 3V0AA 1IPKA 1E5RA 1CZVA 3ZPYA 1UO9A 2Q30A 2ERFA 4MGTA 2RV9A 2Q1FA 1JZ7A 1BEV2 4K8FA 1TMF3 2JENA 4AVAA 2R042 2W08A 2P3KA 2WAOA 4PDWC 5FAXA 4MGKE 4Y5TA 4CDXC 5IAVA 2DCTA 4HONA 4CU7A 3GXUA 2XVLA 2MHFA 4Y22A 4ASMB 1ND2B 3GF6A 4UFJA 1UAIA 1XE0A 5G05L 4S2DA 4FT8A 4P9WA 5J1XA 1GP5A 3BU7A 2Q8CA 3SH5A 1HV0A 3AB0A 3K3OA 1VRH2 1LHNA 1DZTA 2ZX3A 2DYCA 4NPLA 5J09A 2WT0A 3A23A 3MV01 5FKCA 5EIYB 3W59A 2VU9A 2YU2A 4HLTA 5FYTA 3T2PA 4QPIA 5IHRA 1M06G 5IVVA 4KL1A 1W90A 1KJLA 2UWAA 5CNAA 2J1AA 3CQOA 4DQAA 3C8XA 1VR3A 3BTZA 4NAMA 2BDRA 4QXKA 3HVDA 2JB4A 2WNEA 2TEPA 3EHKA 3WP3A 1LHVA 1UU5A 3H3LA 2LROA 4ZKTB 5K4LA 4Q0QA 4UF0B 3WG1A 4CP9B 4D8MA 2B46X 4N9IA 1X9PA 3CDZB 3WQ0A 5JXHA 3BPSA 2HWF2 2YU1A 3FUQA 4GJYA 3VD5A 1GV9A 2PAKA 1ZRIA 3IAPA 3POEA 3AVRA 2RG4A 4IEQA 1WCKA 4NR1A 4M3CE 2Q0AA 4XAAA 2XPJA 1K45A 1WW5A 2WN2A 5A3WA 3JUUA 4CDQC 4YVSA 3M3CA 4JGYB 4NIAA 3ZKUA 4BQ4A 1F35A 1AXKA 3H1MA 2VZOA 3DYMA 3PURA 4K1ZA 3FZ3A 1W2AX 1LOFC 3WF1A 2WO1A 2XVGA 3K2OA 4CPBD 2WQ4A 3M1HA 3ZYFA 3EYPA 3NL1A 3VD7A 1SBDA 5CG8A 4Q8KA 1XE8A 3L9JT 2P1BA 3WD5A 3ZFGB 1UYPA 3GCWA 1WLCA 3DPRB 4E4DX 3KQ4B 1FNYA 2Z42A 2ZGPA 2HJIA 5B2GB 3S7IA 5A1LA 2HWB2 3FHIB 3K51A 5KC6A 2XKPA 3ALQA 3OGRA 1VAVA 1I5PA 5IVYA 3VZLA 1CPNA 1Z7S3 1W9FA 2R063 5T50A 5KHGA 1QHDA 5IT6A 1PGW1 2AEZA 5DAQA 5A1FA 1VLNA 1A34A 2UWBA 3PIJA 4I01A 1XXNA 1QIQA 1EPWA 2DVBA 3WV6A 4N90A 4X6RB 2WUHA 1ND2A 2O14A 5AVPA 1LEMA 2VW2A 3AKQA 2ZGOA 2D43A 5LATA 5CKQA 3MIFA 4Y5Z0 5FJHA 2RS52 1QJY3 1UW8A 2Q8EA 3AJZA 5CAZA 4AQTA 1JU4A 4IE6A 3KCXA 3WSOA 3SXWA 1ZZ8A 1POV0 4AVVA 5IFPA 1MS3A 2YUEA 5FDBA 5KXEA 3ENRA 4QPIC 5FWEA 1QDCA 2WLQA 5FMBA 3CHXA 3VDBA 3AYDA 2JE7A 5L9BA 3M3QA 2ZJCA 5F39A 4CU9A 2X8KA 4E8DA 2P17A 3OBAA 1JYWA 4ZXEA 4UF0A 4CP9A 1EAH1 3OCPA 4SBVA 4D6SA 1ZZ6A 1GBGA 4XHXA 5C3PA 2J22A 3IN9A 4FPOB 3BGAA 4UFMA 1QEXA 1QJX1 2PELA 3RJ2X 2FCUA 4COUA 4PHZA 5FLHA 1OMIA 2B5HA 1J59A 4LE4A 3AZZA 1AYM1 1ZZBA 2CAVA 2JDYA 1X50A 3AKPA 3ZKYA 4OZXA 4W8JA 1G9DA 2B45X 2WFF1 4DINB 1KRIA 4NAOA 1F31A 1CN1A 4IETA 4JGYA 3MDPA 2BP6A 4YVSC 3WHUA 1AVBA 2LW8A 1VRBA 4WM7B 4CEWA 5DDJ1 5JSPA 4GB32 4EV0A 3AP6A 3WW1A 4D3WA 2HEVF 1AR83 1FMD3 4Y3OA 4ES8A 5FRAA 5IK7A 4QQLA 1ZNPA 1NCRB 3ETPA 3ZM8A 5JXJA 5CG9A 3ZFGA 3DPRA 2AZ5A 2RDSA 2ZPXA 4AQ2A 1V9U2 1MACA 5T3NA 4GIQA 5A7WB 3TOJA 1DGWX 3I2OA 2IXCA 4AVTA 1IKQA 4LBQB 5FLIA 1JW6A 3ES4A 3HJRA 4IEYA 2R041 4AHXA 3RZZA 3THPA 4DNYA 2XLAA 3FMGA 1HB1A 1YO8A 5FZ6A 3LOBA 1AYN3 1UU6A 2I07B 2Y34A 1LHOA 1RUOA 4IQPA 4GJZA 2VW0A 4AFDA 5CADA 2Y64A 3MW2A 3J7LA 5BNNB 4RSUA 4FTBA 5I8TA 1VBC3 4O9GA 3D4KA 1H2NA 4H55A 3S5AA 1F8VA 1ND2C 3FHAA 3WR0A 3VDCA 4COWA 3H8UA 4FQZA 1VBB1 2W1WA 4QDQA 5A3UA 4YARA 3NJYA 1VB4A 5FZEA 3W5MA 2CWSA 3SEPA 2WQ8A 2MEV1 4C1XA 4G9SB 4EWAA 4E2GA 4B8EA 5FUNA 1RUE3 4Z82A 4Q0VA 5CFCC 4HPKB 3D3AA 1XNTA 5FBZA 1W39A 3I2FA 4MXVA 5F9TA 5IFTA 4AWDA 1JZ3A 3ECQA 1Y3TA 3I2IA 1WBLA 4C1WA 3O1VA 1CAUB 3BIEA 3WDVA 1WBFA 3PTYA 1EPZA 3ZOIA 4FAGA 2UY9A 2IFWA 4D6QA 2BFUL 1JODA 1QXPA 4K6BA 1VPHA 4YW6A 2V5YA 4KBBA 4YW1A 1JUHA 3HAGA 1ONAA 1UX7A 2UYAA 2ZGLA 5FJKA 3DUIA 5C3QA 1RYYA 1E5HA 3WW2A 1J3QA 1ZM1A 3H8XA 1RUD2 5C71A 2ZZJA 1O8PA 2BVVA 2DTYA 4RGAA 3NJZA 2E7QA 4JGYC 3S6PA 4DY3A 3B93A 4JAAA 5F5AA 5A33A 3B5LB 2WYSA 1HB3A 4E27A 3J8F2 1MEC2 2CHHA 3LB9A 3ZFEB 4CEWC 5FK8A 4CP2A 2IXLA 3FJSA 1FOD3 5KWRA 5FZ7A 2ZBJA 2EIDA 2HWB1 1WZXA 1NCRA 1V6MA 1DZQA 3L2HA 3VHPA 5A1AA 3HT2A 1XYPA 1QH7A 3NV1A 3ZFGC 1WA6X 1D0GA 5FYUA 5A7WA 4Q29A 4ISRA 4YGBA 2XJQA 4LHLA 5CZKA 5FZBA 4LBQA 1HRI3 1DQ0A 5KHJA 4IV1B 4YSFA 3LKJA 1OPOA 2A5ZA 4F8AA 1UOGA 4YZ4A 2UYBA 5D1IA 2IVIB 3UGFA 4G3YC 4A2UA 3L2YA 2SBAA 5A70A 1LJ7A 1ZA7A 5F1RA 5HV0A 2GC0A 3E1F1 1WKYA 2UWCA 1U5XA 3KT7A 2RS13 4XILA 3C7OA 1S1AA 4MXWB 2R1DA 1AL23 2XQRA 1W0OA 4R4ZA 4XUNA 5BNQA 5BNNA 5FMDA 5FUPA 1RUI3 2RS51 1RUC3 2W2IA 1ENXA 3B02A 1BK1A 3WQ7A 3LSDA 3MLKA 4RHV2 3ME2A 4IEWA 1F5JA 3J9SA 3M7AA 3O14A 4PLNA 3WNMA 3I4IA 3VBOB 3VBRB 5H9QA 3VD3A 2CL2A 2DVFA 1VBA2 3RZLA 4XCAA 5CVRA 3N9PA 3O5SA 4HPKA 5KXBA 5JUVA 1POQA 5F6KA 4QQOA 1L7LA 4IL7A 4JCKA 3ACLA 3DCQA 1KS5A 4Q4W3 3TRSB 4P9JA 2QQOA 1W9SA 4DUWA 1KFUL 2XR4A 1ZRFA 4MUVA 1K5JA 1HQWA 2VMIA 2XL7A 1QNWA 1H6YA 1AR71 1SLIA 2JE9A 3FBMA 3GZEA 1G86A 3WT3A 1NXMA 4DZGA 4Q0UA 1J1LA 1YFWA 1P8JA 2BEOA 3MBWA 5K8SA 3ACFA 4WM8B 2PHXA 3ZIWA 4PCRA 3LGRA 5F32A 4GB31 2VNGA 1OOPB 5F2WA 1ULDA 1J84A 5ACA3 4XOGA 1LESA 5FY8A 3TWIA 4Q4X2 1RUG2 3KGZA 3ZR5A 3LCPA 2RM22 2P2KA 4CXXA 2VG9A 1V9U1 1SFPA 4EQVA 5EYYA 3KCYA 3ACIA 1NCRC 1QJU3 1WA4A 3U37A 1DLCA 3V64A 3MUY1 1U5ZA 3WY6A 4DPNA 2B9UA 1SCSA 3OBRA 4PI0A 1WD4A 4Q0PA 4IV1A 3OBZA 2XQXA 4BH9A 2W39A 1AX0A 5FZ3A 1AHSA 2R072 3JBG2 3T3YA 2QQIA 5JLVA 2NMNA 4XUPA 4D7YA 3A21A 4AW7A 1HRV3 1LHUA 5M0TA 2JJ6A 2ARCA 1UYYA 3WVJA 5KHIA 1JZ2A 1YQ5A 3N9QA 5C8CC 4J1XA 4MXWA 2ZOEB 3ETQA 3AKRA 4AI2A 1JYNA 4BU2A 4RFRB 2HWE2 3BVCA 3RG0A 2ZEXA 5BNNC 1RUNA 4YM0A 5F5QA 4LBQD 1FV2A 2RR11 2V4AA 5D8AB 1JUIA 4A6OA 2GN7A 2YPJA 4JTNA 4ORFA 3LE0A 3VBOA 2A6XA 2VY0A 3VBRA 1UN1A 1Z78A 5EJ3A 2BW8A 2ADDA 4OMCA 3EMRA 2JKXA 3DKQA 4HN1A 2C0ZA 5CB7A 4JQRA 4I3GA 1HDKA 5AC93 4A6SA 2Y33A 3SITA 4BISA 2VUCA 2GMPA 5I93A 1JOPA 1R092 1C8M1 4Q4Y3 1RUD1 4FOWA 3SCGA 5FYIA 3ON7A 4WM8A 3N7LA 1UZ0A 5JMOA 4AOCA 2JDMA 1MEC1 4R52A 1OD5A 4ZZ5A 1ZRDA 2Q1MA 4N53A 2PAEA 2X05A 3TN93 3HBKA 1OKOA 4FFGA 4NIHA 4YGEA 2DUOA 4HOOA 1UIJA 4QX3A 2ZMLA 4ZONA 4Q4V3 4FXGB 2DVDA 1OF4A 3T0BA 1JYXA 5LEJA 1WCDJ 5FZMA 4EZ4A 2PLV3 3GHNA 4HSLA 3WXPA 1RITA 2C9AA 3LFMA 3NRUA 4GZ9A 3LDBA 4CEYC 4EROA 2FMYA 1N1YA 1G9AA 3MYXA 4IV1C 4NVPA 1KS4A 4UBHA 1OC1A 1UZZA 4ARXA 4JZRA 5CEHA 1LGBA 1U0AA 4XFAA 1ASJ2 4S2FA 4W4ZA 3A7QA 5FZOB 5JOWA 1XU2A 5KR7A 4BQXA 3SCHA 4OHYA 4ISQA 1AR92 2R7EB 2P6HA 4HVRA 1T2XA 3U14A 2VOVA 5JXGA 4HN0A 1JYVA 2ZX0A 4PI2A 4RS5B 5D8AA 1W6MB 4O65A 4MGYE 4ZXKA 1K5MC 2OYZA 5J7MA 1US3A 4QKFA 4GKYA 2WRAA 1H9PA 1R64A 3RYKA 3POGA 2WBKA 4CA9A 3VBOC 2RMU3 4LKDA 1HXS3 1GWLA 4KH9A 2WZR1 4AEDB 1W06A 1XPWA 3PLQA 4BOWA 4OUSA 2X10A 5F3GA 3MUZ1 2VM9A 2Z69A 1I9RA 3HQXA 5T5OA 2LTNA 3U0ZA 1BKZA 4KWJA 1XBFA 4CU6A 1ENRA 1K12A 1DDLA 1W0NA 4OHWA 2J1VA 1QJZA 2CV6A 1SZBA 4MX3A 3ZMNA 4I02A 4QPWA 2JG9B 2CNAA 3H3ZA 4R4XA 4XJWA 2VC9A 5DXDA 5GZGA 4WM8C 1POV1 1J1TA 4Q4X1 1RUG1 4MZUA 1S0CA 2GP3A 4ES9A 4DO0A 2CGPA 2DF7A 4UT5A 1AR62 4N53C 3T09A 5G04L 4KU7A 4QX7A 4UFHA 1F4AA 4XAEA 3WDWA 5J3UA 2QQVA 4W50A 2RJKA 1GKBA 4PDWB 2WA4A 2DUQA 3LDKA 3MGUA 2G9FA 3C7FA 3IMNA 1RUJ1 1ALYA 2CAUA 2VULA 3CIHA 4XFGA 4LO5B 1G7YA 3OJBA 5LBBA 1MS0A 1SDDB 1JI6A 1N3OA 3OD4A 4GMP0 4JDMA 3ILRA 3ZYBA 2JECA 3A0NA 2WS93 1MPXA 2WR9A 4YGCA 1URXA 4FO9A 4P08A 4Z07A 1OH4A 4YZ1A 5IVEA 1VBE3 1CJPA 5A6ZA 5E88A 5FQ0B 4O7XA 5IJRA 4DMIA 2XH6A 2JICA 1OT5A 3I3MA 3PUHA 4BWOA 4I2OA 4QT6A 3GHMA 1RUF3 2XWJB 5CA6A 5D8AC 3IDCB 1BXHA 3J26N 1UL9A 4AXOA 3VKLA 2IXIA 3ZXJA 4NHKA 2EXHA 4R8HA 3LAGA 3N9NA 3NQHA 1LGCA 1V6NA 4HXCA 3ZSMA 4K40A 1A3KA 3N9LA 4AEDA 1HB4A 1HJGA 1LKNA 4C90A 2D6KA 3CKHA 4LO6B 4CDQB 4JKMA 1R091 5EP9A 5LRSA 4BLJA 1QF3A 2B9VA 4BMEA 4X8PA 2I2SA 4LORA 2KM2A 4BQ5A 3AJYA 4YZ2A 3W5NA 3LEGA 2Y6KA 2I74A 3U4SA 3V0BB 3DKWA 1HV1A 3E97A 4DUXA 2JG9A 1ULOA 3I2JA 2ZACA 2ZHNA 4IGOA 1BJQA 2L9LA 2PYTA 2ZEWA 5GM0A 3N9OA 4UOJA 2Q1ZB 3JD71 3R4UA 4QX5A 2NZ9A 1Q8QA 1K42A 1UOJA 1O8SA 4YG3A 4LO8A 4UAPA 5EQUA 3UESA 1UOBA 5ANNA 1O4ZA 5GLZA 4NIIA 2F4LA 1MS5A 4TZDA 3VBFB 2ZGSA 3POIA 3JQWA 1LGNA 2BWCA 4WVVA 5C7GA 2QBXA 3PDQA 2ZGQA 2WO2A 3UGGA 1C5IA 3EBRA 2P3JA 2O0OA 5SV5A 4D69A 5A3TA 2PHWA 1NE6A 3U4XA 1TE1B 1PGW2 2XLGA 1OURA 2XHNA 2A6VA 4B7EA 3KVBA 3RMXA 1LENA 3O0WA 1C1FA 1TNFA 4RFT0 1XB9A 3OUIA 4IUGA 2WABA 1EAH3 2D7FA 4MADA 3JB8A 1YQ6A 1AF9A 2FHRA 4NHYA 4OI1A 3ZN5A 5LEKA 5FQ0A 5E6HA 1PIV1 1GLHA 3B01A 3I2DA 4QGMA 1PO13 5FXWA 5L19A 5IVCA 3T4HB 4P9XA 1SDWA 2WFF3 4AFMA 5HPOA 4PT6A 3D8CA 2BVBA 2VUDA 2EICA 2JDPA 2OW4A 2VUAA 5E16A 3R6SA 4AGGA 5F3CA 3OPZA 2ENRA 4ZS3A 1D2SA 4XETA 1JZ6A 1DQ6A 1GQPA 3H1YA 1UU4A 3ABZA 1WW6A 3OEAA 4E2SA 2B39A 4AEDC 3S7EA 3S0MA 4XJZA 1CAWB 1PZ9A 1W6NA 4V2WA 4CDQA 3IT8A 4NRQA 4YZ3A 3GDBA 3R05A 3CJXA 3H7YA 1IQDC 1BEV3 3B69A 3Q8FA 1AX1A 1AYM2 5FYYA 3LQCA 2R043 2VO5A 3V65A 2WSVA 5C5TA 3V0BA 2E53A 5HXVA 5L7OB 1STMA 3M3EA 1Q8OA 4XQDA 3SC7X 1W3XA 3F95A 2C24A 4O9EA 1XNDA 4UFIA 3IM0A 4AI8A 1W6OB 4Y26A 2LM3A 5LA1A 3OGSA 3VZMA 1RXGA 3O0XA 2PHTA 2X53S 3PMSA 4XJ8A 3O12A 1DGLA 2DFCA 1EY2A 4FFIA 5EJZB 5IK5A 4JRLA 1VRH3 3ZYPA 3VUOA 4NIDA 5GKAC 1YCIA 3VBFA 5FTTC 4NROA 4OZOA 4BK4A 1ZYBA 5A3LA 2W47A 2ZEZA 4FQ4A 4LIVA 3K75B 2K0GA 4AI0A 3T08A 2GN3A 1RHI1 2JD4A 4JDNA 2A71A 2A7AA 2E32A 4OUEA 3THCA 4CP0A 5DAXA 3PUQA 4E4SA 1HN0A 5DG2A 4EJRA 4YG0A 3GZTB 2IFRA 3WDTA 1IG3A 4XIOA 3AXEA 1LOBA 3AL6A 2G9GA 3A4UA 5FYHA 2OUHA 4KBZA 3BTXA 2N7GA 1K3IA 2HWF3 3CMGA 3ZSJA 3NAPC 4LLOA 2SLIA 1RINA 1U12A 1KQRA 5FMCA 1VBB2 5CFCB 2GALA 3FLRA 2R6QA 5EJ1B 2RJ2A 2XJTA 2MEV2 3AZVA 3B94A 3T0DA 1BVVA 1REFA 4GULA 2VCCA 1YUDA 2W1QA 4YM3A 4Q1PA 5H9PA 3NNLA 4E9KA 3RI9A 4CCNA 2BERA 5C5UA 3DF0A 5F5CA 1UXZA 2ADEA 2XVKA 4ZPIA 2HWB3 4L99A 1VBD1 1CESA 1O4TA 1S0IA 1V6JA 3KF5A 3P1IA 4TYSA 5FUIA 3ZDSA 4URAA 1CAWA 1LU1A 2YFUA 2EXIA 2Z5WA 4C0BA 1JYIA 1UCXA 2VXRA 2BGPA 3VKNA 2W87A 3OD0A 4AVBA 1PO23 1ULPA 4WBBA 1AJOA 2WL1A 5T55A 4AYUA 2VOTA 4EZHA 5DZFA 4CEWB 4GALA 4A45A 1UKRA 4BXFA 5L7OA 5GZFA 1QXRA 4EYUA 4LITA 4I3PA 4YLZA 3EXUA 4RA0A 4HKOA 2QQPA 1GNHA 5KHKA 1RXFA 1REEA 1SQ4A 1LAJA 2VOXA 1WWYA 1W6OA 4GWIA 4X8NA 2Y6HA 5DZGA 2BYVE 1IPSA 1QMJA 2ZABA 1V6KA 3IKWA 1QY4A 1F2NA 4LEJA 1WW4A 2RS53 1N1VA 2OA2A 1FPN1 1GU3A 1Y43B 3ZN4A 5IYYA 4YVWC 1C5HA 2G4IA 1RVF1 3FLPA 2D98A 3VBFC 3WW3A 4AR2A 4GWNA 4HL0A 4UW5A 3PVOA 4BQ1A 1H2KA 3AP4A 1OF3A 2VTXJ 2VQAA 3C2UA 4N7IA 1GNZA 2RS32 4NUBA 4H7LA 1HW5A 1JN2P 1MS8A 3TB0A 2KXLA 4QXBA 4J25A 1TME3 5HXMA 3NNGA 4LO4B 3MPPG 4XPVA 3LA2A 3OG2A 1OPMA 2BV4A 4LQRA 4BM8A 2ZGTA 5JPMB 1PNFA 2IVJA 2Y6LA 4A41A 4NHMA 5CFCA 1G6NA 3GJAA 4UI9L 5HBAA 1NZIA 3VGIA 5FYMA 4D94A 3JXSA 1DQ4A 1DZRA 1PVXA 2VTXA 4GB33 3VD9A 4KQ7A 3WDUA 3VBHB 2XJVA 1NLRA 4IEXA 2W92A 1UYZA 1GZCA 1V70A 2WLPA 2HWD1 2GC3A 3OGJA 5FCCA 1E57A 3JQXA 2WZPP 2GNTA 2GC1A 3HBZA 2RJLA 3WNNA 4KGQA 1O4YA 4META 2QQJA 4XACA 1AR72 4OI0A 1OHFA 4AAXA 2VE1A 2FDFA 4XFBA 2VCMA 2WYFA 2WT1A 2EAKA 1OKQA 1R1A3 2FDHA 1OUSA 2E6VA 3T1LA 3EO6A 5A33B 2E9QA 4QX8A 4A3ZA 5L7OC 2FZ1A 5CBLA 1QKQA 1W6QA 2AUYA 4XFHA 4FOYA 2JWPA 3OGVA 1OLRA 3UK9A 3AFGA 3VHRA 5LBEA 2BGCA 4Z2AA 1J3RA 4Z2WA 1MS9A 3N3HA 3JCIA 3ZN6A 1H0BA 1PNGA 1Q5OA 2FZ2A 4QAWA 2GNDA 4Y4YA 2VVDA 4Y20B 3S30A 5B4NA 5C8CB 4C0HA 4HETA 1H6XA 1JTZX 1Q8VA 5CIRA 5FP4A 3BI3A 3MW4A 3BPZA 2DURA 2VZUA 4A3XA 1YNAA 1ULFA 4AEKA 4AQSA 2VPVA 1GP6A 2KD7A 1RUH1 3R4SA 1H1IA 3PHMA 4ZU4A 4BPZA 1PVC1 1MZFA 2WNUA 2QJVA 4LBNA 4XJUA 2EVXA 2RR12 2A3YA 1BBT1 2XBO1 2Z79A 3ZXEA 3B7MA 3FBYA 4EN9B 3ZSLA 2Q8DA 1IGOA 2DCZA 5J48A 1UZVA 2JDNA 2ILMA 3NW4A 1DYKA 1NLSA 3J8F3 4UYBA 5F2SA 3SQOA 1Y9GA 2Y6FA 4AQ6A 1CQ9A 1YQ2A 2PHFA 3LIHA 4QHBA 4W6WA 3PMEA 2IZWA 4H7MA 4GMP1 1H2LA 3VBHA 3OUHA 5HCHA 2G1MA 2QTWB 2ZA9A 4MG2A 1H4GA 1NLQA 2X09A 4XDPA 3WF3A 1G9CA 3K4DA 5F6LB 1NY72 5I0UA 5BNPB 1W9WA 4YW4A 1BHGA 3RS6A 1IQAA 4QPYA 4XABA 3RZGA 3LA3A 4Y33A 1J58A 1W6PB 5A3OA 3U11A 4C8DA 3TNPB 3MW3A 1C8M2 4LBJA 4IGPA 4LKFA 2AYHA 1DGRN 5DAVA 4TWTA 5GLVA 4QX1A 2DFBA 4D0QA 5T5LA 2D3RA 3WP6A 3E5UA 4AG4A 4F7ZA 3JB4C 5FZFA 2BRTA 2CDOA 2HKXA 3H50A 1UD1A 2VZSA 4M0HA 4M4RA 4AL9A 4XZPA 5JWPA 4QPGC 1F9KA 1VBC2 3CZJA 4I09A 4IV3C 2DVGA 4IEVA 4OCTA 2E51A 2BPA2 1WW7A 3FHQA 1YHFA 5FZ8A 2FQPA 1SLBA 4CEYB 3D0SA 4I30A 4RHV3 3WCSA 3I59B 4FVVA 4V1PA 5JI9A 3I8TA 1YFXA 2ZGMA 4QB2A 1YIFA 2WO7A 3RZHA 1T6GC 1ZBE2 3KVAA 1MVEA 1RUE2 5JIAA 4QHZA 1ND3A 4A7ZA 1YC61 1JHNA 1VBA3 4I0WB 4FPFA 2GAUA 1UZWA 3OSDA 4Y20A 4DXRA 3D82A 2ZGUA 1GICA 5FPBA 5C8CA 2O8OA 2AENA 3CF6E 1R083 5HI0A 2RS31 1W2TA 5CKMA 2ZKNA 5A6YA 1D0HA 4HG6B 5C3OA 3KD4A 2X5IC 3WX5A 5A32B 1N3PA 2DU0A 3NSTA 3PJYA 5HCBA 2WDBA 5FYVA 1K5MB 4DXSA 2E31A 5E89A 1J3PA 5LK7B 1FX5A 4AVCA 1W05A 2IUWA 4YWAA 1OFSA 2WNUC 1QOOA 2A6YA 3S57A 3IIIA 4XFFA 3USUB 3ZXAC 4DFSA 3RWKX 1WGPA 5EFUA 2X29A 2VNVA 2GZWA 3AXDA 3MZHA 1L7RA 2A1XA 1RUG3 1OA2A 2XL9A 4AZZA 2RM23 5ABJC 2EALA 4XURA 4DEVA 4FFHA 2ZMNA 1VIWB 2WZR2 4GA9A 3WQBA 4OHVA 3KV5A 4LBOA 3MLJA 3VBHC 1H30A 1Z7S1 5T52A 4LTAA 3VZKA 4LO7A 5BNPA 4LK7A 5CISA 3SEEA 1E5IA 1CAXB 5I0RA 1A78A 1W6PA 2A75A 5JOZA 1COV3 3UJQA 3RZKA 4HSJA 2ZHKA 2R073 3JBG3 4OULA 5ISLA 1XNBA 1YJKA 5FXVA 1ZA4A 3X29B 1ULGA 1X9TA 1KXGA 1ZVFA 4UBGA 3WF0A 2R16A 4N53B 5A6XA 2VQUA 2RS12 4JVAA 2LUWA 3MEPA 3BKZA 2AH2A 2IXHA 1C1LA 3ZYRA 3WNXA 3UYJA 1O3RA 5A3NA 1QJY1 2YG0A 1CX4A 2HWE3 2ZEYA 3ZIXA 2BTVC 4AAPA 4FAHA 4LIUA 2E7TA 3SLIA 2UY8A 4P9GA 4AK3A 4I0AA 4CEYA 1JHJA 4BCUA 3I59A 3IBMA 1W8NA 4NWVA 2R0FA 4FPKA 1MVQA 5L9RA 2XMLA 4N8MA 1A6CA 2R30A 2VGDA 3LA7A 1RUJ2 5C33A 5JR7B 4YGDA 1S0EA 5C9AA 5DUXA 2IC1A 4NOTA 5ERLA 4NHXA 3NNFA 1ND3C 5A3PA 4NE9A 5EHDA 1YEWA 3H8RA 3ZLIA 3VD4A 1H4HA 1XE7A 5LA2A 4COYA 4ZU7A 2PHRA 3MPBA 3O1SA 3E6CC 1REDA 5AVAA 2P34A 1R093 2P5BA 2CYFA 2GP5A 3BYWA 4IE5A 5FP3A 5A32A 4XMIA 3AM2A 2ZGNA 3TEZA 1K5MA 2BNOA 1S2BA 4A44A 3BN6A 5C3RA 1W9YA 2W52A 4Q27A 4M0NA 4ITCA 4QMAA 5FY5A 1DBNA 3RQ0A 1JZ5A 4UW6A 4WVMB 4LHSA 4XF0A 3USUA 1AR81 1FMD1 3AMNA 1IS6A 5F3IA 2XHKA 1FV3A 2G19A 3HMYA 3ZPOA 1O3QA 2J42A 4DUVA 1QXJA 4CCJA 5J98B 1OD3A 4IERA 3POJA 1KJRA 4BQ2A 2ZAAA 1NY71 2QQMA 3BALA 3I54A 4D6RA 1AUYA 1PZ8A 4S2GA 2YYOA 3WINE 1CAXA 4BLIA 5AFEA 5JMCA 5BNPC 2D97A 2O1QA 1AYN1 1QOTA 5FZIA 2Z2SB 4BJ0A 1CJDA 4JQTA 3RNSA 3NV4A 4YW3A 5LW9A 4R9AA 2H6CA 5F37A 5GZDA 4L92A 4CYDA 1U5YA 2QCSB 3MFCA 3UL2A 2ZS6B 1YQCA 2HWC3 3O7OA 5FZ9A 2ZHMA 2WQZC 1VBC1 3KQRA 3OEBA 1ASJ3 1H1AA 3WF4A 3JD72 2XKOA 3WUDA 4NPMA 1QOSA 1CWPA 5BNOB 1AR93 3NV2A 5I8YA 1W03A 2WZ8A 1UXXX 4OYUA 3HQUA 3ZFFC 2A73B 2VVEA 1WLWA 3RPQA 4DS0A 4GD4A 3VBSC 1ZBE1 3KHBA 2R0HA 4MLOA 2QDNA 4IESA 1RUE1 3WG4A 2YXSA 4OFGA 4UW3A 2YGLA 5T5JA 3RGBA 1SCRA 4FP3A 2K46A 2WA3A 4Y5SA 1W9TA 4QDSA 3WF2A 5C9AC 4CCLA 2R1BA 3M2MA 2ID4A 2QZ3A 2JDKA 3VLBB 4WZCA 4IEUA 2ORZA 4INDA 5AC92 4MOAA 1FT9A 4MV2A 5DUWA 5LY2A 4RYDA 4Z1VA 2TUNA 3Q8EA 4ZZ8A 2LALA 5AFBA 2JG8A 4PLMA 3BOWA 2GC2A 2OQ6A 5H9RA 2DBIA 3PNAA 4JV4A 5EZWA 1PIV2 5C3SA 3WP4A 2KA3A 1EV12 5FBJA 4YNIA 1W8HA 3N35A 3FL7A 2VL4A 2VZPA 1PK6C 2ZGRA 4OUMA 4WVMA 5FZ1A 3M3OA 3ZYHA 5K0UC 3DN7A 2FDGA 3PUIA 3U1XA 4CXYA 5C70A 2AGSA 2PHLA 3HIFA 4KG8A 4OLLA 1UY0A 1LB2A 2FBEA 5FPXA 4XW3A 1FI2A 5F7UA 4LK6A 3ST7A 1G9FA 4UFLA 1UY4A 1GZ9A 1AR63 2PN5A 4NMIA 1GOGA 2JD9A 4F3JA 4LPLA 2VW1A 1HRI1 2AR6A 1DG6A 4AEMA 3PVEA 4XBNA 4XDOA 4JKKA 3KSCA 3WNOA 1CPMA 1C8NA 1KITA 1SMVA 1UX6A 1YFUA 5JOYA 4NJ4A 2RDNA 1D4M2 2NPIA 3CNAA 2VZRA 1ULCA 1ZZ7A 4YW2A 2B8MA 4YPJA 4FPJA 2TNFA 3OPTA 1MZ6A 3A22A 1OUXA 2RS11 3PVBB 4E8CA 2HBUA 3T30A 1TG7A 5FLJA 2DWRA 3RJRA 1JS9A 4CUAA 3C7GA 1RUC1 1UNBA 2C9KA 5GLTA 4RGGA 4K3UA 1NQDA 2D6PA 5BNOA 3GCXA 1RGSA 2B4KA 2OVUA 4QXCA 1X8EA 1ZBA2 3THTA 1BVP1 1W2OA 2NN8A 2YHJA 4DOUA 3LD8A 1PMJX 5EV7A 4Z8BA 2FDJA 5FK7A 4P9LA 1S0GA 3ZYIB 2A3XA 2DTWA 3G6JB 4KWKA 1UKGA 2V5DA 3KB5A 3OPWA 4XC9A 1DP0A 2VQ0A 1WMEA 1VAMA 1NXD1 1RHI2 3I3DA 3KZ4C 1PGL2 3APBA 1PZ7A 3VKFC 1UMHA 2WIIB 3MIHA 1AX2A 5FOBB 3NAPB 4HVQA 4TLGA 5FV3A 5FOJB 4PIXA 2QFEA 2EF6A 2BOIA 4QM8A 4CP1A 3RFRA 1N47A 5CU1A 2JE8A 1NYWA 1OLME 2R49A 2VAUA 2VVFA 1NE4A 4LBMA 4BE3A 5I91A 3LPFA 2D40A 3R0RA 2W1UA 1SLAA 5DAPA 2JG8C 4EWDA 2VOKA 3NNJA 3W21A 2QE3A 5ACA1 1I1EA 1T6BX 4QDRA 4UW4A 1NA1B 3ZSEA 2QKDA 4HFSA 3K4AA 3KCCA 3VV1A 3B9IA 1SLCA 4M00A 1QJU1 1LECA 5L36A 1W6NB 1LRHA 1S0DA 2E63A 4M3CF 1EP0A 4TSVA 4A42A 4E4ZA 5A7QA 2VNRA 1VBD2 1Q8PA 2P3YA 1PX3A 5FY7A 4AHWA 1IHMA 1LOGA 3AMHA 5CYYA 3QLQA 5FPLA 4RL7A 3SMHA 3IDAA 1A8DA 5DMYA 1W2NA 2I45A 2PFWA 2XUEA 5LZ6A 2A6WA 2FMDA 5SV8A 1HRV1 2JDAA 2XJUA 2XUMA 5FP7A 1QH6A 1AXZA 3J7HA 2GSYA 4G4FA 1A8MA 2Q4SA 3TEXA 4QB1A 2VZ1A 1QQP2 2YFZA 5C6CA 4DY5A 3RZMA 1JOBA 4N43A 4YVWB 5GJ6A 2HYXA 5FPUA 1LHWA 3C3VA 4AI9A 3POYA 4YZ5A 2J1TA 5GZCA 3U75A 5BNOC 2WINB 2QDRA 1FPN2 2WWJA 1RUF2 4YW5A 1IPJA 1O7FA 5FZ4A 5LY1A 1RVF2 1LEDA 1IS3A 1HLCA 1ZX5A 4MVTA 4AI3A 4CCDA 4QKBA 2ZCWA 1GP4A 2A70A 2WN3A 4GH4A 4HKWA 1DGRA 4BB3A 3WP5A 3MO4A 1UY1A 5AC91 1LU2A 2YROA 4U2AA 2WNVC 3O1TA 1B35A 2KR2A 4EN0A 5IK8A 3BUCA 5IAXA 3BTYA 1SFNA 3NAPA 3OUJA 1OQ1A 3OBTA 3THDA 4Q4Y1 1HB2A 4OQ8A 1QJX3 1XNCA 2VMGA 1H8TB 2D6MA 1EV11 4TXWA 4LKSA 3AX4A 1AYM3 1X33A 4AI1A 3CJIB 1S0FA 3AKSA 3EQEA 5A6QA 2RDRA 1DGWA 3VHNA 3KHCA 5HCFA 2PA7A 3TN91 1NA1A 5DDJ3 1PMIA 3KMHA 4R9CA 3ZR6A 1XOYA 2YY1A 2V09A 4ET7A 2OPWA 3M70A 2QVSB 2VMFA 2WWSA 4LA2A 2IXKA 1ULEA 2D3SA 4M3CB 4TN7A 1SLLA 1VMHA 2W9XA 2DCJA 3PVNA 1CONA 2DCKA 4BK5A 4LHNA 3NVCA 3JU9A 4Q4V1 4IE7A 2HWD2 1W28A 3RZJA 1N3QA 3VL9A 4EN6B 3M4FA 5FY1A 1RMU2 2HEWF 5JZGB 1D4M1 4RD7A 3NWKA 4QGNA 3W9AA 2CY6A 3HN1A 3J7MA 4BA6A 3Q8BA 4LUMA 5F3EA 3KT1A 1V00A 3PUSA 5FR3A 3TEWA 1EUTA 4KWLA 1PGSA 1W0PA 2H0BA 4FPCA 3SCFA 4IW3A 5FYCA 5BPXA 5D21A 3ZVXA 2W1SA 1N1SA 3WG3A 3WNLA 1ENSA 3MIDA 3CBNA 4XTPA 5FYZA 3I2KA 1SACA 2YZ4A 3GNEA 3VDDB 1ZBA1 1OFNA 2GH8A 4YVWA 4JDOA 4N9HA 4NN0A 4Y24A 1G9BA 2IWGB 2WO3A 3N36A 3N7KA 4N43C 4RQPC 4CUGA 1O5UA 4GWMA 3DV8A 3O1UA 1PO12 3GZUC 1VBB3 1XJAA 5FXZA 5FWJA 4IXLA 4L8QA 4WZFA 1UIKA 4A7KA 1KFXL 2J1RA 1PGL1 2MEV3 2VH9A 5EXOA 1LTEA 4JKLA 4JRAA 3HNBM 1IOAA 4YG6A 1GWMA 2VJXA 4CE8A 4GH4C 3ZXFA 2DVAA 3KF3A 1EYBA 5FZGA 4ATFA 4EWEA 4GMP3 1B35C 2ETEA 1NCQB 1SLTA 1YI9A 3PIGA 3UV9A 1CR7A 1UQXA 1RUH2 3DL3A 2YDEA 4H3WA 4QX0A 3FN9A 1PVC2 1H8TA 2PQSA 4HANA 5FY0A 1JZ4A 1CGPA 2YBKA 4K8RB 3O1PA 3ATGA 2ZX4A 3AYCA 1XSRA 1BBT2 1G8WA 2XBO2 3CJIA 3GBWA 3I2GA 3QD6A 1O5LA 1JBCA 2CWMA 5J96B 3RI8A 4ARYA 3AMMA 5JSOA 5APAA 1WMXA 3I3BA 4JGZC 4HK8A 3ZXKA 1NA1C 4B4PA 3UGHA 4WVZA 1S55A 4YM2A 4CDWB 4M3CA 5A3MA 1W99A 1GFF2 2JX9A 4FXKB 2LS6A 3U07A 4CCCA 2A3WA 2OPKA 2PMWB 1AL0G 3ORJA 5JZGA 3RRDA 1W04A 1L3JA 2ET1A 2JKBA 2VZ3A 4CU8A 1Y4WA 1TMF2 4ASKA 1ZREA 1BK0A 2XJSA 5A7SA 5IK4A 4W6XA 2FCTA 3KV9A 1JXNA 1C4RA 5A7PA 4LE3A 3K48A 3LOIA 1IKPA 3RWNA 4QPGB 2WS91 3GZAA 4IV3B 1DQ2A 3RYRA 4XMAA 2ZKLA 4CUCA 5CFDA 1QQP1 1YIPA 1MQTB 1RC6A 2YC2A 2YC4A 2ARAA 3WNKA 4YRDA 1W6QB 1VBE1 1CVNA 2P37A 5FZ0A 5A7NA 2RS33 1NG0A 2D5FA 2NYYA 4GKXA 4IEPA 3C7HA 1UMZA 3VDDA 1KD7A 1SEFA 5DG1A 4XFIA 2YGMA 1JYCA 2YMZA 3MIEA 4DXTA 3E5QA 1RUF1 5KC5A 3ZO0B 3IB3A 2DUPA 3ZN6B 5LASA 1QWRA 1M4WA 2C1FA 4JHZA 1XNAA 1W8OA 1KEXA 1GR3A 1WCSA 4DRRA 5J37A 1PX4A 2Q8OA 5JIUA 4Y1VA 5BY5A 2C26A 4XE9A 3ZXGA 4CVUA 4OHXA 2WC2A 5JR2A 2UU8A 3VDAA 2FDIA 1NQJA 1YWKA 2MNGA 2RDQA 3HT1A 2X5IB 3LEMA 3PL0A 4K21A 3NKTA 1FAYA 1YJLA 2C6SA 3WZ1A 4CRQA 4AGVA 1NCQA 1L7QA 3I49A 1GSLA 2WNUB 1Q8SA 2OQ7A 4HMZA 4L0PA 1Z0HA 5FY9A 3WHTA 1AR73 1D2QA 2EAAA 2BNMA 1PO22 1UZYA 4FPEA 4MGSA 4RN5A 5FP8A 5FY4A 1BQPA 1H8TC 2J7MA 2YBPA 4CDUB 5ABJB 3AZXA 2BGOA 5DUUA 3CJIC 2OIIA 4F83A 5H9SA 1APNA 4IDZA 3KLSA 4W65A 4XZUG 1OVPA 3AMPA 3LWCA 3M8LA 3O0VA 3N7MA 4P9IA 5GALA 4CDWA 4N7UA 1Q3EA 1HQLA 1Q56A 2D44A 1V9U3 5T5PA 1RMU1 5K9YA 3HWJA 3GM8A 3ASIA 5E8AA 4BMBA 1NZCA 5FPVA 3HPNA 1Z7S2 1QNYA 4XVHA 4Y1YA 1EUUA 1NOVA 2R062 3DEMA 5IATA 3H9AA 1OQEA 5JZGC 2Y26A 5F5IA 2HEYF 3GBFA 3P3NA 1C57A 3AZWA 5E1RA 3FC0A 3FLTA 4E2QA 4LT5A 2B42B 2ZGKA 4QPGA 5LBFA 3KS7A 4IV3A 3VL8A 2NP0A 4OHZA 3OYWB 4QHOA 1MQTA 2AEYA 2J1UA 5CFDC 1RL3A 1DU3D 4PQ9A 2XOMA 4BIOA 3AL5A 4QKNA 1I5ZA 4LR4A 2NMOA 1QJY2 1TME2 1PO11 1XNKA 2W91A 3MI8A 4XF1A 2YBSA 3QBQA 1DF0A 5FZCA 3VDDC 2Y8KA 3SKJE 4R9DA 2RR13 2XJRA 4B7KA 1X8MA 1W3VA 1O91A 1JOJA 4GQ7A 4P5HA 2Y6JA 1XC6A 1ND3B 2QZ2A 1SBEA 2BOJA 2VZTA 4BQWA 2D6OX 2VNOA 4Y4RA 3VKOA 2BBVA 4HBNA 4OVEA 4FPGA 1S2EA 3CLPA 1UPIA 4QQHA 4GWJA 2PQQA 2X5IA 4YFWA 2QNKA 2AREA 3POBA 2JEMA 1UWWA 3ES1A 3I3QA 4IGQA 2GNBA 3ZDVA 1HN1A 2ZHLA 1BEV1 4MSVA 2VECA 1JMUB 1HKDA 5DZEA 4BZ4A 1CZSA 1NCQC 1ZRRA 5FMOS 2OKXA 1C8M3 1YQ8A 1RUD3 3AKTA 1R1A2 3RYPA 1W8UA 3WLUA 2WJSA 2EIEA 4FOVA 2Y0IA 4EE2A 4CDUA 1O3SA 4AE2A 5HV4A 2VMHA 3HQRA 1MEC3 3H1WA 5ABJA 5BV6A 1AR82 1FMD2 2ZZQA 5A80A 1DYPA 1QGLA 1KDMA 1NUKA 1CZTA 1S0JA 4PJYA 5DUVA 4DIQA 1BLZA 4XUTA 1VRH1 2GH2A 1D7PM 4MGIE 5GLWA 1HX6A 3TBDA 4MO3M 1Y9QA 4XYXA 2VXJA 4CDWC 2CGNA 1CAVB 3N7JA 3WNPA 2JXAA 4L9BA 1TMF1 3QH6A 3D5OA 2WWUA 3VZOA 2UURA 4B29A 5BYNA 1HIXA 1PM4A 3MF9A 1GQHA 1ZBE3 1FYUA 1DIWA 4PF5A 4AFAA 2OT7A 2XONA 4EN7B 5JAXA 2VQTA 1AYN2 1BCXA 5LA0A 2F4PA 4HZFA 2JB8A 2JDUA 2VUJA 2XB6C 3KT4A 1DFQA 3ZFFB 2HWF1 2ZX1A 3B00A 3CZUA 2LRPA 3OYWA 4KGGA 2OUJA 3AK0A 1V6OA 3ITQA 3H8OA 3HOBA 4QD2A 3VBSB 1MQTC 1CD3G 3VZNA 2OX0A 2V72A 2PTMA 4JHTA 5JI7A 3ZXDA 4HK9A 5KHHA 2PXJA 2QQLA 1W8TA 3PJQA 2MPFA 1R1ZA 1ODNA 1JU3A 2ATFA 3MF6A 5FYSA 1QJEA 3POWA 4W6YA 1V0AA 3LF7A 3AVSA 2E26A 5C9AB 1O3TA 1IG0A 4AHZA 1MZEA 4LOSA 2BU9A 2QQKA 4WM7A 1TQ5A 3WQ1A 4COZA 2NQYA 4QU2A 3J4UH 5I8SA 3PTRB 3RMYA 2FDKA 4ZHNA 1UY3A 3HNMA 4L2NA 3DXUA 1NT0A 2BJSA 2WZR3 4BYYA 3ROUA 3MV11 4M01A 4XBQA 4UXAA 5IVFA 5FIXA 5KXDA 3UETA 3DPRC 4L97A 5FO9B 2RVAA 1HJFA 4CSWA 1PO21 4NHLA 1SHWB 1ENQA 5C4WB 4M4PA 3O1OA 1PK6B 4CUBA 5K0UB 4X6QB 1IS5A 4GAZA 1WLTA 1W2UA 2F17A 2K9ZA 3FWEA 4K1YA 2Y38A 1JH5A 3D0JA 3BU0A 1POV3 2XLFA 5JVVA 4S2HA 2JDZA 4Q4X3 4CDUC 3LZZA 1FOD2 4J1WA 3LEIA 1X36A 4Q0SA 4PIYA 3LSEA 5FZHA 3SHRA 4FOQA 4BQ3A 4LBLA 5KXCA 4Q26A 3T2OA 5IWFA 1C28A 1MS1A 5JPNB 2R061 3DYOA 1CAVA 1HRI2 2YV8A 1WD3A 3NJXA 4ZS2A 2RHPA 1YRZA 3USSA 3FFQA 3HN3A 3GALA 2WFPA 4MYEA 1ZZ9A 5JCTA 1VAKA 1WMFA 2DBNA 1RUJ3 5EYXA 3AC0A 5LBCA 3U10A 3I97A 1BMV2 1WCUA 2ES3A 5LWBA 3R4DB 1I3HA 2BZDA 4KMQA 2D5HA 4XIKA 3J7NA 1R082 5I0SA 4V2VA 5FREA 5DQ0A 2ZTNA 1CAUA 1AL22 3TEYA 3ZFFA 1S2KA 3RDIA 4JX0A 1RUI2 1RUC2 1TME1 3TAYA 2W5FA 3SISA 3VBSA 3GYDA 1LODA 2EXKA 1RJ7A 4QX2A 3ILFA 4AFBA 4WVWA 1H8VA 4LKEA 1PM7A 2XG3A 4FI9A 5BXXA 3TYJA 3AYEA 3M3IA 2VMDA 5FO7B 4A7YA 2OZJA 1H9WA 4LLFA 4MH0E 3POSA 4XHBA 3MHZA 3NNMA 2PHDA 4RR3B 3ZFEA 4WM7C 3LIGA 3SKVA 2XXZA 2VCBA 4Q4W2 3AP9A 4UFKA 4XEZA 5J36A 2D6LX 1LOCA 3OF1A 1H2MA 3DGTA 4I0BA 4KWUA 3ACHA 1F5FA 3FUOA 3VBUB 4Y1UA 2JG8B 3UJOA 3H3UA 3HD8B 1S4CA 3IMMA 1OSGA 1UPSA 2ET7A 5FZDA 2DDUA 3T2QA 1R1A1 1COV2 2NLRA 5C4WA 2VBBA 2RE9A 1PK6A 2GMEA 5K0UA 3JZVA 3LEKA 4NPRA 1UY2A 2BUKA 4FPHA 1D4VB 3MIGA 1MZ5A 5DPNA 5ACA2 3KV6A 1KGYA 2ARBA 1WCQA 2EIBA 4LOTA 1W8WA 2W95A 4PBOA 4PQQA 1ZZCA 3JD73 1KDKA 4XBLA 1LCLA 1AXYA 1Q43A 2C5DA 3POFA 5GLUA 3B9CA 1QJU2 1XQNA 2VMCA 4UWDA 5LA9A 3WDXA 1TZOA 3O1MA 1ST8A 3NKGA 5IUQA 1VB2A 2D93A 1NKGA 1YLLA 4WV8A 4Z92B 1XSQA 2QQWA 3FX3A 3NJVA 3CEWA 3QH7A 4QM9A 5LCWL 3GBGA 4OMDA 1YXWA 1PMHX 3N4MA 4QXHA 3DYPA 2DU1A 2W68A 4GXLA 4ASLA 4DXZA 4PF1A 1HRV2 2B7YA 4FBFA 3BB6A 4LNVA 3VZJA 1GMMA 4QB6A 5FPZA 1VMJA 3KV4A 4Q1RA 1MS4A 2PAMA 3IZOA 4AGRA 2O8QA 1SPPB 4QGLA 1GNYA 2EA7A 4LA3A 3K46A 1XU1A 1GQGA 4OI2A 3PUAA 4QQ2A 3AP5A 4XF3A 4CCEA 1IS4A 1LNSA 1V6IA 3ZMOA 1DLLA 2PHUA 5GZEA 1PIV3 3ILNA 1LOEA 1EV13 2BFUS 4CCMA 3W58A 4RGKA 4QWNA 1FATA 3J8F1 2WNVB 3AYAA 3CL1A 5FKBA 2HBTA 4ATEA 1OOPA 2EXJA 4XF9A 2V73A 4DB5A 4RR3A 3H7JA 3B3QE 2VZQA 3ZFEC 3PU3A 5I0TA 1OH3A 4NRMA 4E4HA 4MHRA 3AFKA 2ZXQA 3Q9OA 4Q8LA 5CKNA 4LJHA 1WMDA 1VALA 3V56A 3VBUA 4FSJA 3BIWE 4EN8B 1AZDA 3IWZA 4Q4Y2 3LDRA 4MGZE 4IEOA 2GDFA 3WG2A 3ZYGA 4CZSA 3WOGA 3ZX7A 5FZLA 2OXBA 1D4M3 1GOFA 4AF9A 3IDBB 2DCYA 2QQNA 1F15A 4B3NA 5C4WC 1H1MA 3HR9A 3OB8A 2D3PA 3OOXA 4LUKA 2BWAA 1FOD1 2H6BA 2HWC2 4IE0A 4XJ9A 3E6BA 3TN92 1OXCA 1VJ2A 2VZVA 5FZKA 4COVA 4NRPA 2CU5A 4LMFA 1DQ1A 2J1SA 1O6UA 4RHV1 3SH4A 5EPAA 5F8PA 1ZBA3 4Q4V2 4YFZA 4B4QA 4MGQA 1CX1A 3UKVA 2HLEA 2PLV2 3D6EA 1OVSA 2ZX2A 1BMV1 3P5BA 2YPDA 4NIGA 1VBA1 5D2AA 2H0VA 2J1EA 4PLOA 5DAWA 5EWSA 2EIGA 3U78A 1RHI3 1R081 3VBRC 2ARXA 2VR4A 1OI6A 3KGLA 3S5QA 1AL21 3G7DA 3Q8AA 4P5YA 4XFCA 5LK5A 1RUI1 1NX9A 2JDHA 1ODMA 2ORXA 2VBDA 1OQDA 3E6DA 4N43B 4RQPB 1SPPA 4KU8A 4P00B 3AP7A 2IXJA 1TNRA 4YYOA 1GZTA 5L73A 4CCOA 3A0KA 5C8WA 3W20A 2CSGA 1UOFA 3T2TA 3BTAA
chains in the Genus database with same CATH topology
4FPLA 1TEIA 3ELNA 3VN4A 1XYOA 3VHOA 2R32A 3AMQA 4GH4B 3UKTA 1CIWA 4KG0A 2WNVA 1WUVA 2RM21 2RMU2 1HXS2 2WSUA 3MIBA 4Q4W1 4XQWA 1C3HA 1B35B 3MICA 1OOPC 4J6GA 3URFA 4RR3C 1DQ5A 1DHKB 3AZYA 5FFOC 1VBD3 4XXPA 4Q2FA 1LULA 4FTEA 1COV1 4CDXB 1GANA 1OLQA 3I7DA 3QOPA 4H14A 3VBUC 1S0BA 2R071 3JBG1 5T54A 2CGOA 1SFYA 5JDBA 4NWWA 4JGZB 3MFAA 3IDEA 1BYHA 2GMMA 1QU0A 3INAA 3BCWA 2K2SA 4Y1ZA 2TBVA 3RSJA 4XDQA 1QQP3 2E7AA 4ZU5A 3WUCA 4LBKA 2HWE1 4AVSA 3NV3A 2ZAHA 4DRVA 4B4RA 1XRUA 2NM1A 3QACA 3BODA 3H0OA 1FPN3 4RS5A 4XJAA 1W6MA 4R9BA 4P9YA 1RVF3 3WW4A 1YFYA 2W0XA 5KBFA 3NO8A 1X82A 4IEZA 4NO4A 2OZ6A 2WS92 2WT2A 4BHPA 5JSRA 1FNZA 1YYNA 1GZWB 4XXAA 1LOAA 4L11A 2D6NA 4RQPA 1VBE2 4CYDA 4AHYA 5K7PA 3OY8B 3SH3A 4LHKA 4K20A 4URTA 4CTEA 2VOWA 3TNQA 4JTOA 2BNNA 1GYKA 4YM1A 1RJ8A 1XYNA 2BQPA 1ZRCA 4AEJA 2XGXA 2F6BA 2A6ZA 4HVOA 3WDYA 1MR5A 3BOPA 3ZXLA 1UF2C 3IPVB 4AFCA 3V0AB 4OI4A 4JC1A 4P14A 4FCAA 2HWD3 1N1TA 3EJKA 4PBPA 2Q5TA 1Y7BA 1RMU3 3T1MA 1U5IA 4PDWA 4CDXA 1BZWA 1I6XA 4FTSA 3MLLA 1WLDA 1LR5A 1RIRA 1SBFA 4D7TA 2P3IA 2Y0OA 4XTMA 1AJKA 4D7SA 5LRRA 4Y22B 4JGZA 2HWC1 4K9SA 4ONUA 1RTVA 1ASJ1 5TSWA 4U36A 3UKNA 2DV9A 5HCAA 4PIZA 2XJPA 1AR91 3E5XA 3QCWA 3P3PA 4Y1XA 1QDOA 3FFZA 5BUVA 1PHMA 4FP2A 4KNCA 4C91A 5JOXA 1OA4A 1B09A 2GU9A 2ZMKA 2PLV1 2XWBB 4FPYA 4QPIB 2YC0A 2GNMA 4QQPA 3OGGA 4RS5C 3CU7A 4LULA 1X7NA 2QUOA 5CFDB 3CO2A 3FE5A 1HQNA 4HKLA 3ZYJB 3ZSKA 1GZWA 3IIAA 3SNMA 1IZ3A 1EAH2 3OY8A 1RUH3 1FXZA 1QJX2 4YVSB 2HYKA 3KM5A 1LOFA 1PVC3 1YI7A 2WKKA 4TLFA 1VP6A 1RB8G 1V6LA 2WFF2 3VKMA 3OTFA 4HT1T 1BBT3 3WCRA 2XBO3 5FO8B 1OA3A 2RMU1 1HXS1 4XQ4A 2JG9C 5DDJ2 4K7JA 4SLIA 2CTVA 4XF4A 1AR61 5FMOL 3IPVA 4BIFA 3V0AA 1IPKA 3ZPYA 2Q30A 2ERFA 1BEV2 4K8FA 1TMF3 2JENA 4AVAA 2R042 2W08A 2P3KA 4PDWC 5FAXA 4MGKE 4CDXC 2DCTA 2XVLA 2MHFA 4Y22A 4ASMB 1ND2B 3GF6A 1UAIA 4S2DA 4FT8A 4P9WA 3BU7A 3SH5A 1HV0A 3AB0A 1VRH2 1LHNA 1DZTA 2ZX3A 2DYCA 5J09A 2WT0A 3W59A 2VU9A 4HLTA 4QPIA 1M06G 4KL1A 1KJLA 2UWAA 5CNAA 4DQAA 1VR3A 4QXKA 2WNEA 2TEPA 3EHKA 3WP3A 1LHVA 1UU5A 4ZKTB 4Q0QA 3WG1A 2B46X 4N9IA 3WQ0A 2HWF2 3FUQA 1GV9A 2PAKA 4NR1A 4IEQA 1WCKA 4M3CE 2Q0AA 2XPJA 1WW5A 4CDQC 3JUUA 4YVSA 3M3CA 4JGYB 1AXKA 3H1MA 4K1ZA 3FZ3A 1LOFC 2XVGA 2WQ4A 3M1HA 3NL1A 1SBDA 5CG8A 4Q8KA 1XE8A 3L9JT 3WD5A 3ZFGB 1WLCA 3DPRB 4E4DX 1FNYA 2Z42A 2ZGPA 2HJIA 5B2GB 3S7IA 2HWB2 3FHIB 3K51A 5KC6A 2XKPA 3ALQA 1VAVA 3VZLA 1CPNA 1Z7S3 2R063 5T50A 5KHGA 1QHDA 5IT6A 1PGW1 1VLNA 2UWBA 4I01A 1XXNA 3WV6A 1EPWA 2DVBA 4N90A 4X6RB 1ND2A 5AVPA 1LEMA 2VW2A 3AKQA 2ZGOA 2D43A 3MIFA 4Y5Z0 2RS52 1QJY3 1UW8A 5CAZA 3AJZA 4AQTA 3KCXA 3SXWA 1ZZ8A 1POV0 4AVVA 1MS3A 2YUEA 5FDBA 5KXEA 3ENRA 4QPIC 1QDCA 2WLQA 3AYDA 2JE7A 3M3QA 2ZJCA 2X8KA 2P17A 1EAH1 3OCPA 4SBVA 1ZZ6A 1GBGA 4XHXA 3IN9A 4FPOB 3RJ2X 2PELA 1QJX1 4COUA 5FLHA 1OMIA 2B5HA 1J59A 4LE4A 3AZZA 1AYM1 1ZZBA 2CAVA 1X50A 3AKPA 1G9DA 4OZXA 2B45X 2WFF1 4DINB 1KRIA 1F31A 1CN1A 4IETA 4JGYA 3MDPA 4YVSC 3WHUA 1AVBA 4CEWA 4WM7B 5DDJ1 5JSPA 4GB32 4EV0A 3AP6A 3WW1A 4D3WA 2HEVF 1AR83 1FMD3 4ES8A 5FRAA 5IK7A 4QQLA 1ZNPA 1NCRB 5CG9A 3ZFGA 3DPRA 2AZ5A 2ZPXA 4AQ2A 1V9U2 1MACA 5T3NA 4GIQA 3TOJA 1DGWX 2IXCA 4AVTA 1IKQA 4LBQB 5FLIA 1JW6A 3ES4A 4IEYA 2R041 4AHXA 3RZZA 3THPA 4DNYA 2XLAA 3FMGA 1YO8A 3LOBA 1AYN3 1UU6A 2I07B 1LHOA 1RUOA 4IQPA 2VW0A 4AFDA 5CADA 3MW2A 5BNNB 4RSUA 4FTBA 5I8TA 1VBC3 4O9GA 3D4KA 1H2NA 4H55A 1F8VA 1ND2C 3WR0A 4COWA 3H8UA 4FQZA 1VBB1 4YARA 1VB4A 2CWSA 2MEV1 4C1XA 4G9SB 4EWAA 4E2GA 4B8EA 1RUE3 4Z82A 4Q0VA 5CFCC 4HPKB 5FBZA 1W39A 4MXVA 5F9TA 4AWDA 3ECQA 1Y3TA 1WBLA 4C1WA 1CAUB 3WDVA 1WBFA 3PTYA 1EPZA 4FAGA 2UY9A 2IFWA 2BFUL 1QXPA 4K6BA 4YW1A 2V5YA 4KBBA 1JUHA 3HAGA 1ONAA 2UYAA 2ZGLA 3DUIA 3WW2A 1J3QA 1ZM1A 1RUD2 2ZZJA 2BVVA 2DTYA 4RGAA 3NJZA 2E7QA 4JGYC 3S6PA 4DY3A 3B93A 4JAAA 5A33A 3B5LB 4E27A 3J8F2 1MEC2 3LB9A 3ZFEB 4CEWC 4CP2A 2IXLA 3FJSA 1FOD3 5KWRA 2ZBJA 2HWB1 3VHPA 1NCRA 1V6MA 1DZQA 3L2HA 3HT2A 1XYPA 1QH7A 3NV1A 3ZFGC 1D0GA 4Q29A 4ISRA 4YGBA 2XJQA 4LHLA 4LBQA 1HRI3 1DQ0A 5KHJA 4IV1B 4YSFA 3LKJA 1OPOA 2A5ZA 4YZ4A 2UYBA 5D1IA 4G3YC 4A2UA 3L2YA 2SBAA 1LJ7A 5F1RA 2GC0A 2UWCA 1U5XA 3KT7A 2RS13 4XILA 1S1AA 4MXWB 2R1DA 1AL23 1W0OA 4R4ZA 5BNQA 5BNNA 1RUI3 2RS51 1RUC3 1ENXA 3B02A 1BK1A 3WQ7A 3LSDA 3MLKA 4RHV2 3ME2A 4IEWA 1F5JA 3J9SA 3M7AA 3O14A 4PLNA 3I4IA 3VBOB 3VBRB 5H9QA 2CL2A 2DVFA 1VBA2 5CVRA 5KXBA 3O5SA 4HPKA 5F6KA 4QQOA 4IL7A 4JCKA 3ACLA 3TRSB 1KS5A 4Q4W3 4P9JA 1KFUL 1ZRFA 4MUVA 2VMIA 1HQWA 2XL7A 1QNWA 3FBMA 1AR71 1SLIA 2JE9A 3WT3A 4DZGA 1G86A 1NXMA 5K8SA 4Q0UA 1J1LA 1YFWA 2BEOA 4WM8B 2PHXA 3ZIWA 4PCRA 3LGRA 4GB31 2VNGA 1OOPB 1ULDA 5ACA3 4XOGA 1LESA 3TWIA 4Q4X2 1RUG2 3KGZA 3LCPA 2RM22 2P2KA 2VG9A 1V9U1 5EYYA 3KCYA 1NCRC 1QJU3 1WA4A 3V64A 1U5ZA 3WY6A 4DPNA 2B9UA 1SCSA 3OBRA 1WD4A 4Q0PA 4IV1A 4BH9A 2W39A 1AX0A 1AHSA 2R072 3JBG2 5JLVA 2NMNA 4D7YA 4AW7A 1HRV3 1LHUA 2JJ6A 5KHIA 3WVJA 5C8CC 4J1XA 4MXWA 2ZOEB 3ETQA 3AKRA 4AI2A 2HWE2 3RG0A 5BNNC 1RUNA 4YM0A 5F5QA 4LBQD 1FV2A 2RR11 5D8AB 1JUIA 2GN7A 2YPJA 4JTNA 4ORFA 3VBOA 2A6XA 2VY0A 3VBRA 1UN1A 1Z78A 5EJ3A 2BW8A 4HN1A 2C0ZA 5CB7A 4JQRA 4I3GA 1HDKA 5AC93 3SITA 2GMPA 5I93A 1R092 1C8M1 4Q4Y3 1RUD1 4FOWA 3SCGA 4WM8A 3N7LA 1MEC1 4R52A 1OD5A 1ZRDA 2Q1MA 4N53A 2PAEA 3TN93 4YGEA 2DUOA 1UIJA 2ZMLA 4Q4V3 4FXGB 2DVDA 5LEJA 1WCDJ 2PLV3 3GHNA 4HSLA 3WXPA 1RITA 2C9AA 4CEYC 4EROA 2FMYA 1N1YA 1G9AA 3MYXA 4IV1C 4NVPA 1KS4A 4UBHA 1UZZA 1LGBA 1U0AA 4XFAA 1ASJ2 4S2FA 5JOWA 1XU2A 3SCHA 4OHYA 4ISQA 1AR92 4HVRA 2VOVA 4HN0A 2ZX0A 4RS5B 5D8AA 1W6MB 4MGYE 4ZXKA 1K5MC 2OYZA 5J7MA 4GKYA 1H9PA 3RYKA 3VBOC 2RMU3 1HXS3 4KH9A 2WZR1 4AEDB 3PLQA 4BOWA 4OUSA 2Z69A 1I9RA 3HQXA 5T5OA 2LTNA 3U0ZA 1BKZA 4KWJA 1ENRA 1DDLA 4OHWA 1QJZA 2CV6A 4MX3A 3ZMNA 4I02A 2JG9B 2CNAA 3H3ZA 4R4XA 4XJWA 5DXDA 5GZGA 4WM8C 1POV1 1J1TA 4Q4X1 1RUG1 4MZUA 1S0CA 4ES9A 2CGPA 2DF7A 1AR62 4N53C 4KU7A 3WDWA 5J3UA 2RJKA 1GKBA 4PDWB 2WA4A 2DUQA 3MGUA 2G9FA 3IMNA 1RUJ1 1ALYA 2CAUA 2VULA 4XFGA 4LO5B 1G7YA 3OJBA 1MS0A 3OD4A 1N3OA 4GMP0 4JDMA 3ILRA 2JECA 3A0NA 2WS93 4YGCA 1URXA 4FO9A 4Z07A 4YZ1A 1VBE3 1CJPA 5E88A 5FQ0B 4DMIA 2XH6A 2JICA 4BWOA 4I2OA 4QT6A 3GHMA 1RUF3 2XWJB 5CA6A 5D8AC 3IDCB 1BXHA 3J26N 1UL9A 4AXOA 3VKLA 2IXIA 3ZXJA 4NHKA 2EXHA 4R8HA 3LAGA 1LGCA 1V6NA 3ZSMA 4K40A 1A3KA 4AEDA 1LKNA 4C90A 2D6KA 4LO6B 4CDQB 1R091 5LRSA 4BLJA 1QF3A 4BMEA 4X8PA 2I2SA 2KM2A 3AJYA 4YZ2A 2I74A 3V0BB 3DKWA 1HV1A 3E97A 2JG9A 2ZACA 2ZHNA 1BJQA 2PYTA 5GM0A 2Q1ZB 3JD71 3R4UA 4QX5A 2NZ9A 1Q8QA 4YG3A 4LO8A 5GLZA 1O4ZA 4TZDA 1MS5A 3VBFB 2ZGSA 3JQWA 1LGNA 2BWCA 4WVVA 2ZGQA 1C5IA 3EBRA 2P3JA 2O0OA 5SV5A 4D69A 2PHWA 1NE6A 3U4XA 1TE1B 1PGW2 2XLGA 2A6VA 4B7EA 3RMXA 1LENA 3O0WA 1C1FA 1TNFA 4RFT0 1EAH3 2D7FA 3JB8A 2FHRA 1AF9A 4OI1A 3ZN5A 5LEKA 5FQ0A 1PIV1 1GLHA 3B01A 3I2DA 4QGMA 1PO13 5L19A 4P9XA 1SDWA 2WFF3 4AFMA 3D8CA 2BVBA 2OW4A 3R6SA 5E16A 2VUAA 4AGGA 3OPZA 2ENRA 1D2SA 4XETA 1DQ6A 3H1YA 1UU4A 1WW6A 4E2SA 2B39A 4AEDC 3S7EA 3S0MA 4XJZA 1CAWB 1PZ9A 1W6NA 4CDQA 3IT8A 4YZ3A 3R05A 3CJXA 3H7YA 1BEV3 3B69A 1AX1A 1AYM2 2R043 3V65A 2WSVA 3V0BA 2E53A 5HXVA 5L7OB 3M3EA 1Q8OA 4XQDA 4O9EA 1XNDA 3IM0A 4AI8A 1W6OB 4Y26A 2LM3A 3VZMA 3O0XA 2PHTA 2X53S 3PMSA 4XJ8A 3O12A 1DGLA 2DFCA 1EY2A 5IK5A 4JRLA 1VRH3 3ZYPA 3VUOA 5GKAC 1YCIA 3VBFA 5FTTC 1ZYBA 5A3LA 4FQ4A 2K0GA 4AI0A 2GN3A 1RHI1 2JD4A 4JDNA 2A71A 2A7AA 4CP0A 4E4SA 5DG2A 4EJRA 4YG0A 3GZTB 2IFRA 3WDTA 4XIOA 3AXEA 1LOBA 2G9GA 3A4UA 2OUHA 2N7GA 2HWF3 3ZSJA 3NAPC 4LLOA 2SLIA 1RINA 1U12A 1KQRA 1VBB2 5CFCB 2GALA 3FLRA 2R6QA 2XJTA 3AZVA 2MEV2 3B94A 1BVVA 1REFA 4GULA 1YUDA 4YM3A 4Q1PA 5H9PA 4E9KA 3RI9A 3DF0A 2XVKA 2HWB3 4L99A 1VBD1 1CESA 1O4TA 1S0IA 1V6JA 4TYSA 3ZDSA 1CAWA 1LU1A 2EXIA 2Z5WA 4C0BA 1JYIA 1UCXA 2VXRA 3VKNA 3OD0A 4AVBA 1PO23 4WBBA 4AYUA 1AJOA 2WL1A 5T55A 5DZFA 4CEWB 4GALA 1UKRA 5L7OA 5GZFA 1QXRA 4I3PA 4YLZA 3EXUA 4RA0A 4HKOA 2QQPA 1GNHA 5KHKA 1REEA 1SQ4A 2VOXA 1W6OA 4X8NA 5DZGA 2BYVE 2ZABA 1QMJA 1V6KA 3IKWA 1QY4A 1F2NA 4LEJA 1WW4A 2RS53 1N1VA 2OA2A 1FPN1 1Y43B 3ZN4A 4YVWC 1C5HA 2G4IA 1RVF1 3FLPA 2D98A 3VBFC 3WW3A 4GWNA 4HL0A 4UW5A 3PVOA 4BQ1A 1H2KA 3AP4A 2VQAA 3C2UA 4N7IA 1GNZA 2RS32 4H7LA 1HW5A 1JN2P 1MS8A 3TB0A 2KXLA 1TME3 4LO4B 4XPVA 3MPPG 3LA2A 1OPMA 4BM8A 2ZGTA 5JPMB 1PNFA 4NHMA 5CFCA 1G6NA 5HBAA 3VGIA 4D94A 1DQ4A 1DZRA 1PVXA 4GB33 4KQ7A 3WDUA 3VBHB 2XJVA 1NLRA 4IEXA 2WLPA 1V70A 1GZCA 2HWD1 2GC3A 3OGJA 5FCCA 1E57A 3JQXA 2WZPP 2GNTA 2GC1A 3HBZA 2RJLA 4KGQA 1O4YA 4META 1AR72 4OI0A 1OHFA 4XFBA 2WT1A 1OKQA 1R1A3 2EAKA 2E6VA 3T1LA 3EO6A 5A33B 2E9QA 5L7OC 2FZ1A 5CBLA 1QKQA 1W6QA 2AUYA 4XFHA 4FOYA 1OLRA 3UK9A 3AFGA 3VHRA 2BGCA 1J3RA 4Z2WA 1MS9A 3N3HA 3JCIA 3ZN6A 1H0BA 1PNGA 1Q5OA 2FZ2A 2GNDA 4Y4YA 2VVDA 4Y20B 3S30A 5C8CB 4C0HA 4HETA 1JTZX 1Q8VA 5CIRA 3MW4A 3BPZA 2DURA 4A3XA 1YNAA 1ULFA 4AEKA 4AQSA 2VPVA 1RUH1 3R4SA 1H1IA 3PHMA 4ZU4A 4BPZA 1PVC1 1MZFA 2WNUA 2QJVA 4LBNA 4XJUA 2EVXA 2RR12 2A3YA 1BBT1 2XBO1 2Z79A 3ZXEA 3B7MA 3FBYA 4EN9B 3ZSLA 1IGOA 2DCZA 5J48A 2ILMA 3NW4A 1DYKA 1NLSA 3J8F3 4AQ6A 1CQ9A 2PHFA 4QHBA 4W6WA 3PMEA 2IZWA 4H7MA 4GMP1 1H2LA 3VBHA 2ZA9A 1H4GA 1G9CA 5F6LB 5I0UA 1NY72 5BNPB 4YW4A 3RS6A 1IQAA 4QPYA 3LA3A 3U11A 1J58A 1W6PB 3TNPB 3MW3A 1C8M2 4LBJA 2AYHA 1DGRN 5GLVA 4TWTA 2DFBA 5T5LA 2D3RA 3WP6A 3E5UA 4AG4A 4F7ZA 3JB4C 2HKXA 3H50A 1UD1A 4M0HA 4XZPA 5JWPA 4QPGC 1F9KA 1VBC2 4IV3C 4I09A 2DVGA 4IEVA 2E51A 2BPA2 1WW7A 1YHFA 2FQPA 1SLBA 4CEYB 3D0SA 4I30A 4RHV3 3WCSA 3I59B 4FVVA 4V1PA 5JI9A 3I8TA 1YFXA 2ZGMA 1YIFA 1T6GC 1ZBE2 1MVEA 1RUE2 5JIAA 4A7ZA 1ND3A 1JHNA 1VBA3 4I0WB 4FPFA 2GAUA 4Y20A 3D82A 2ZGUA 1GICA 5C8CA 2O8OA 2AENA 3CF6E 1R083 5HI0A 2RS31 2ZKNA 1D0HA 3KD4A 2X5IC 3WX5A 5A32B 1N3PA 2DU0A 3NSTA 3PJYA 5HCBA 1K5MB 5E89A 1J3PA 5LK7B 1FX5A 4AVCA 1OFSA 2WNUC 1QOOA 2A6YA 4XFFA 3USUB 3ZXAC 4DFSA 1WGPA 5EFUA 2X29A 3AXDA 2GZWA 3MZHA 2XL9A 1RUG3 1OA2A 2RM23 5ABJC 2EALA 2ZMNA 1VIWB 2WZR2 4GA9A 4OHVA 4LBOA 3MLJA 3VBHC 1H30A 1Z7S1 5T52A 4LTAA 3VZKA 4LO7A 5BNPA 1CAXB 5I0RA 1A78A 1W6PA 2A75A 5JOZA 1COV3 3UJQA 4HSJA 2ZHKA 2R073 3JBG3 4OULA 1XNBA 1YJKA 1ZA4A 3X29B 1ULGA 1KXGA 1ZVFA 4UBGA 2R16A 4N53B 2RS12 4JVAA 2LUWA 3MEPA 2AH2A 2IXHA 1C1LA 3ZYRA 3WNXA 1O3RA 1QJY1 1CX4A 2HWE3 4FAHA 3ZIXA 2BTVC 2E7TA 3SLIA 2UY8A 4P9GA 4AK3A 4I0AA 4CEYA 4BCUA 3I59A 3IBMA 4NWVA 2R0FA 4FPKA 1MVQA 1A6CA 2R30A 2VGDA 3LA7A 1RUJ2 5C33A 5JR7B 4YGDA 1S0EA 5C9AA 5DUXA 2IC1A 4NOTA 1ND3C 1H4HA 1XE7A 4COYA 4ZU7A 2PHRA 3MPBA 3E6CC 1REDA 5AVAA 2P34A 1R093 5A32A 2CYFA 5C6CA 4XMIA 3AM2A 2ZGNA 1K5MA 2BNOA 1S2BA 2W52A 4Q27A 4M0NA 4ITCA 4QMAA 3RQ0A 1DBNA 4UW6A 4WVMB 4XF0A 3USUA 1AR81 1FMD1 3AMNA 1IS6A 2XHKA 1FV3A 3HMYA 1O3QA 1QXJA 5J98B 4IERA 1KJRA 2ZAAA 1NY71 3BALA 3I54A 1AUYA 1PZ8A 4S2GA 2YYOA 3WINE 1CAXA 4BLIA 5AFEA 5JMCA 5BNPC 2D97A 2O1QA 1AYN1 1QOTA 2Z2SB 1CJDA 3RNSA 3NV4A 4YW3A 4R9AA 2H6CA 5GZDA 4L92A 1U5YA 2QCSB 3MFCA 3UL2A 2ZS6B 2HWC3 3O7OA 2ZHMA 2WQZC 1VBC1 3KQRA 1ASJ3 1H1AA 3JD72 2XKOA 3WUDA 1QOSA 5BNOB 1AR93 3NV2A 5I8YA 3ZFFC 2A73B 2VVEA 1WLWA 3RPQA 4DS0A 3VBSC 1ZBE1 2R0HA 4MLOA 2QDNA 4IESA 1RUE1 3WG4A 2YXSA 4OFGA 4UW3A 2YGLA 5T5JA 1SCRA 4FP3A 2WA3A 5C9AC 2R1BA 3M2MA 2QZ3A 3VLBB 4WZCA 4IEUA 4INDA 5AC92 1FT9A 4MV2A 5DUWA 4Z1VA 2TUNA 2LALA 5AFBA 2JG8A 4PLMA 3BOWA 2GC2A 5H9RA 3PNAA 4JV4A 5EZWA 1PIV2 3WP4A 2KA3A 1EV12 4YNIA 3N35A 1PK6C 2ZGRA 4OUMA 4WVMA 5K0UC 3M3OA 3DN7A 2AGSA 2PHLA 3HIFA 4KG8A 4OLLA 1LB2A 2FBEA 5FPXA 4XW3A 1FI2A 3ST7A 1G9FA 1GZ9A 1AR63 2PN5A 4F3JA 2VW1A 1HRI1 2AR6A 1DG6A 4AEMA 3PVEA 4XBNA 3KSCA 1CPMA 1C8NA 1KITA 1SMVA 1UX6A 1YFUA 5JOYA 1D4M2 2NPIA 3CNAA 1ULCA 1ZZ7A 4YW2A 2B8MA 4FPJA 2TNFA 1MZ6A 2RS11 3PVBB 5FLJA 2DWRA 3RJRA 1RUC1 5GLTA 4RGGA 4K3UA 1NQDA 2D6PA 5BNOA 1RGSA 2OVUA 3THTA 1X8EA 1ZBA2 4DOUA 1BVP1 2NN8A 2YHJA 5EV7A 4Z8BA 4P9LA 1S0GA 3ZYIB 2A3XA 2DTWA 3G6JB 4KWKA 1UKGA 3KB5A 2VQ0A 1WMEA 1VAMA 1NXD1 1RHI2 3KZ4C 1PGL2 3APBA 1PZ7A 3VKFC 2WIIB 3MIHA 1AX2A 5FOBB 3NAPB 4HVQA 5FOJB 4PIXA 2QFEA 2EF6A 4QM8A 4CP1A 1N47A 5CU1A 1NYWA 2R49A 4LBMA 2VVFA 1NE4A 5I91A 4BE3A 2D40A 3R0RA 1SLAA 2JG8C 4EWDA 2VOKA 2QE3A 5ACA1 1I1EA 4UW4A 1NA1B 3ZSEA 2QKDA 4HFSA 3KCCA 3VV1A 3B9IA 1SLCA 4M00A 1QJU1 1LECA 5L36A 1W6NB 1LRHA 1S0DA 2E63A 4M3CF 1EP0A 4TSVA 4E4ZA 2VNRA 1VBD2 1Q8PA 4AHWA 1IHMA 1LOGA 3AMHA 3QLQA 4RL7A 3SMHA 1A8DA 2I45A 2PFWA 2A6WA 2FMDA 5SV8A 1HRV1 2XJUA 2XUMA 1QH6A 1AXZA 2GSYA 4G4FA 1A8MA 2Q4SA 1QQP2 4DY5A 4N43A 4YVWB 5GJ6A 1LHWA 3C3VA 3POYA 4YZ5A 5GZCA 5BNOC 2WINB 2QDRA 1FPN2 1RUF2 4YW5A 1IPJA 1O7FA 1RVF2 1LEDA 1IS3A 1HLCA 1ZX5A 4MVTA 4AI3A 2ZCWA 2A70A 4GH4A 4HKWA 1DGRA 3WP5A 5AC91 1LU2A 2YROA 4U2AA 2WNVC 1B35A 4EN0A 5IK8A 1SFNA 3NAPA 1OQ1A 3OBTA 4Q4Y1 1QJX3 1XNCA 2VMGA 1H8TB 2D6MA 1EV11 3AX4A 1AYM3 1X33A 4AI1A 3CJIB 1S0FA 3AKSA 3EQEA 1DGWA 3VHNA 5HCFA 2PA7A 3TN91 1NA1A 5DDJ3 1PMIA 3KMHA 4R9CA 2YY1A 2V09A 3M70A 2QVSB 2WWSA 4LA2A 2IXKA 1ULEA 2D3SA 4M3CB 1SLLA 3PVNA 2DCJA 1CONA 2DCKA 4LHNA 3NVCA 3JU9A 4Q4V1 2HWD2 1N3QA 3VL9A 4EN6B 3M4FA 1RMU2 2HEWF 5JZGB 1D4M1 4RD7A 3NWKA 4QGNA 3W9AA 2CY6A 3HN1A 4BA6A 4LUMA 3KT1A 1V00A 4KWLA 1PGSA 1W0PA 2H0BA 4FPCA 3SCFA 5BPXA 3ZVXA 1N1SA 3WG3A 1ENSA 3MIDA 4XTPA 1SACA 2YZ4A 3GNEA 3VDDB 1ZBA1 1OFNA 2GH8A 4YVWA 4JDOA 4N9HA 4NN0A 4Y24A 1G9BA 2IWGB 3N36A 3N7KA 4N43C 4RQPC 1O5UA 4GWMA 3DV8A 1PO12 3GZUC 1VBB3 4IXLA 4L8QA 4WZFA 1UIKA 4A7KA 1KFXL 1PGL1 2MEV3 2VH9A 5EXOA 1LTEA 4JRAA 1IOAA 4YG6A 4GH4C 3ZXFA 2DVAA 1EYBA 4ATFA 4EWEA 4GMP3 1B35C 2ETEA 1NCQB 1SLTA 1YI9A 3UV9A 1CR7A 1RUH2 3DL3A 2YDEA 4H3WA 1CGPA 1PVC2 1H8TA 4HANA 3ATGA 2ZX4A 3AYCA 1BBT2 1G8WA 2XBO2 3CJIA 3GBWA 3QD6A 1O5LA 1JBCA 2CWMA 5J96B 3RI8A 3AMMA 5JSOA 4JGZC 4HK8A 3ZXKA 1NA1C 4B4PA 4WVZA 1S55A 4YM2A 4CDWB 4M3CA 5A3MA 1GFF2 2JX9A 4FXKB 3U07A 2A3WA 2OPKA 1AL0G 5JZGA 3RRDA 2JKBA 1L3JA 2ET1A 1ZREA 1TMF2 2XJSA 5IK4A 4W6XA 1JXNA 1C4RA 4LE3A 3K48A 3LOIA 1IKPA 3RWNA 4QPGB 2WS91 3GZAA 4IV3B 1DQ2A 3RYRA 4XMAA 2ZKLA 5CFDA 1QQP1 1YIPA 1MQTB 1RC6A 4YRDA 1W6QB 1VBE1 1CVNA 2P37A 2RS33 1NG0A 2D5FA 2NYYA