3NKGA

Crystal structure of geba250068378 from sulfurospirillum deleyianum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
170
structure length
170
Chain Sequence
APNPISIPIDLSQAGSVVEKEVKIEESWSYHLILQFAVHDRKEDGGLDGKRVWKFLGFNSYDPRDGKQVGYVDYRLAKSELGDLIDETYDCDGTVVPIKITIHQINQDNTKKLIADNLYMTKGNGSGAYTRDITTISLDKGKYIFRIENIEAFSEMIGRKVDFTIYINKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein GEBA250068378
publication title Crystal Structure of GEBA250068378 from Sulfurospirillum deleyianum
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Structural genomics, unknown function
total genus 40
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18539 DUF5625 Domain of unknown function (DUF5625)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.790 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nkgA00
3NKGA
chains in the Genus database with same CATH superfamily
1OURA 1GZWB 3J7LA 2XJVA 1W9FA 4RS5B 2OYZA 1PO23 2JDAA 3OTFA 1HRI2 1S0FA 1HRV2 3O0XA 2WO1A 1NLQA 2DCTA 5FYIA 3RI9A 3VDDB 4PQ9A 5C8WA 3HBZA 5KWRA 3MV11 2VQAA 1FPN2 1LGBA 2KXLA 4AEDC 1WW6A 4IV3C 5A6XA 5BV6A 1VB2A 1QJY3 5CBLA 4B29A 1ZNPA 5D8AC 1RUJ1 3CF6E 4AL9A 2VXRA 3IWZA 1TMF1 2BOIA 2F17A 3ZYHA 2WR9A 1GZ9A 2D40A 4Q4Y1 1IQAA 5A7WA 4MG2A 1AYM1 3H50A 5CFCA 3V0AB 1LKNA 3KV9A 5IVEA 1VBE2 3LGRA 5FYVA 4MUVA 1QOSA 1O91A 4P9WA 1JYWA 5C70A 3VBSC 3KV5A 4P9JA 3ZIWA 2R1BA 5FBJA 5AVAA 2ARBA 1GYKA 2XJQA 4GB31 1BYHA 3N9NA 5KHJA 4IEOA 5BNNB 4KH9A 4NE9A 2RR11 4YVWB 2QUOA 4Y24A 3WNPA 1W9WA 3O12A 3LFIA 4JX0A 1KEXA 1LU1A 1YFXA 4HKLA 3UGFA 3MUZ1 2VOKA 1BCXA 1KDMA 4QQHA 3MW3A 3MUY1 5EJ1B 3WDWA 5DAPA 5JOXA 1K5MB 4JV4A 4Q4V1 4L99A 1AYN2 4ARYA 3ABZA 4R52A 1VAMA 2WNUB 4E2QA 3POWA 1SDWA 1AF9A 2VZPA 3WD5A 3OGGA 1YJLA 2WYSA 4QU2A 4BXFA 3SITA 1GV9A 1JMUB 2XUEA 3A4UA 4OQ8A 4HSJA 1SLTA 2VGDA 3HVDA 3N36A 3RVHA 4AHWA 3RGBA 3RWKX 1R64A 2GN3A 1REFA 3HN1A 2WN2A 3I59A 2VJXA 1UU6A 5AC91 1H8TB 3AC0A 5K9YA 2WSVA 5F2SA 5JR7B 4KL1A 3N9PA 4CXYA 1DGWA 1BEV3 3VLBB 4Y22B 3BU0A 2WO3A 4JRAA 4M3CF 3PDQA 5DG2A 3T4VA 1LOGA 2Z79A 1KS5A 1UOBA 5C8CB 5HCAA 3OJBA 3AYDA 1JN2P 1H6XA 3H1MA 5GLVA 1FOD1 1Z7S1 3Q9OA 3SLIA 3VZOA 5CA6A 4CDWA 3BTZA 5DUWA 1ZZ9A 1CWPA 1QJU2 4WM8A 2XONA 1RUG3 4KI5M 4Q4W3 1C8M1 4BQXA 5BNPB 1S0JA 2YV8A 4QQLA 1YEWA 1VB4A 2YG0A 4AE2A 3DPRB 2VZ1A 3AJYA 4W8JA 5J09A 1OD3A 5A6YA 2BQPA 2R041 2W1SA 4XURA 2A1XA 2B45X 4QB6A 4QPIC 2J22A 2JDKA 2HWB2 2W92A 1LRHA 3I8TA 2VO5A 2A3XA 4NN0A 4XJWA 2RS11 3LDKA 3K4AA 4I0BA 3SCFA 4CCDA 5HXMA 2X5IB 2OW4A 1NCQB 3SEPA 4AFDA 1FPN3 1G8WA 3N7JA 3MI8A 1G9BA 2VOTA 2XLFA 5BPXA 1KFUL 5J96B 4XQ4A 1RUI1 3I3MA 2OS2A 1W8UA 1PM7A 2Y8KA 2PYTA 5A1LA 4NRPA 3M4FA 4A6SA 2OKXA 1CAVB 2DURA 4MVTA 3WOGA 4Z82A 4CCMA 1JZ2A 1MZFA 4CVUA 1EPZA 3MIDA 4I0WB 3AP4A 1GNYA 4MXWA 3HNYM 1W28A 1CPMA 4CU6A 5FYTA 3LOIA 2ZGPA 4XETA 1ND2A 5B4XA 4Q27A 1JW6A 1W04A 3U1XA 3TEYA 1VBE3 5F5IA 4FSJA 2XVGA 5FYSA 1FT9A 2BVVA 4RN5A 4DXTA 2PHUA 1R083 4TLGA 4PDWA 1UYPA 1ND3A 2OQ7A 3RNSA 2FDKA 1U12A 1N1SA 4HVOA 1RIRA 4QGMA 1YNAA 1C1LA 4BLIA 4LBMA 1RHI1 1S0GA 2QQPA 4DXZA 3GZUC 3HT1A 2ZS6B 2BERA 4Y26A 1OPMA 4I09A 4PF5A 5FO7B 5C33A 2CNAA 2JDYA 1NOVA 3PUHA 3WCSA 3MHZA 3O1VA 2JDNA 4Y1XA 2WKKA 4V2VA 1RC6A 2KR2A 3BOPA 2QE3A 2VTXA 3CMGA 4LA3A 5J7MA 2AUYA 4K3UA 5FK7A 4SLIA 1B35A 3AP5A 4YG6A 2R49A 5F8PA 3OPTA 2CSGA 2DBNA 1W05A 1AYN3 4AQ6A 5FZ8A 3A7QA 4S2DA 3K77A 3OBRA 4YW3A 2C24A 3WDYA 4CUBA 3RS6A 2YC2A 1SCRA 1J3QA 1EUUA 2ZMLA 1YQCA 2G19A 2HEWF 3FHIB 4HETA 4JC1A 4WVVA 2IWGB 2Y6GA 2V4AA 2VBDA 3EO6A 1A78A 1KS4A 3GZEA 3MW4A 3PUIA 4HG6B 1SHWB 1US3A 4JZRA 1AL21 5E8AA 2HWE1 5A7PA 2Y6JA 1IKQA 1GP5A 1EP0A 2WNOA 4AFAA 3MYXA 1SZBA 3E1F1 4PI0A 5DZFA 1BMV1 5IVYA 4BB3A 4YG0A 3AMMA 3RFRA 4B4RA 4PI2A 3NQHA 2Z69A 1YIFA 3O14A 1JYIA 4OI0A 2WT0A 4JGZC 3THCA 3P3NA 3M3OA 1DQ6A 4LIUA 4Q0VA 4LLOA 1UWWA 5FZ9A 2QCSB 2PQQA 4AG4A 5KXDA 1AR82 5FMCA 1UYXA 1C57A 4FPJA 1Q8PA 3U75A 3I2DA 2ATFA 4EWAA 1ZZ7A 1ENSA 3AMHA 4BYYA 2ILMA 1QJU3 3B9CA 5C4WB 2PQSA 1GSLA 3MDPA 4IV1A 1HQLA 3OY8A 1TME1 5CFCC 3FFQA 4LXLA 2WRAA 2ZEXA 3E5UA 4F3JA 1FMD2 1WLCA 1RUF1 2JD9A 1EAH2 2B42B 1K3IA 2E32A 1J59A 1U0AA 3JXSA 2HWB3 2K9ZA 2QKDA 3USUA 4D7SA 4DNYA 1SDDB 4NROA 2ARCA 1EV11 5LY2A 2DV9A 2EVXA 1GU3A 4HOOA 5LZ6A 4M3CE 2RDRA 1QJX3 1O5LA 3LA2A 2EF6A 2HWD1 2JKXA 3NJXA 5FYHA 3S7IA 2QQIA 1W8NA 2WNVA 2ZGUA 4A44A 1JI6A 1QKQA 5C71A 1G6NA 1UPIA 3AKQA 4K7JA 5LWBA 2R0FA 4JDMA 2YHJA 5CIRA 1OA3A 2E63A 4META 4CCCA 5FKBA 1JHNA 3I4IA 5C6CA 2SLIA 1JZ8A 2X29A 4FBFA 2VZOA 4P02B 3ZYPA 2D7FA 4UF0B 1HN0A 3M3CA 4AEDB 2FDJA 1NZCA 3EMRA 3PVBB 3TOJA 2XHNA 5I8SA 3ZXDA 1ZZCA 5A3OA 4BHPA 2YFZA 1PIV2 4QD2A 1E5HA 3N9LA 5CYYA 5I0TA 5DDJ3 2QQLA 5LBBA 5I91A 1PGL1 2NM1A 4YW2A 2Q30A 1B09A 1W2UA 3LE0A 5LRRA 2HWF1 1NA1A 5H9PA 5K0UA 3VBSB 3O0VA 4ZKTB 4Q4X2 3FN9A 4YZ4A 5FY1A 2Z5WA 3BUCA 4P9GA 3KWVA 2VBPA 1N1YA 1X9TA 2OUJA 2DYCA 2W68A 1DYPA 4NIHA 3O1OA 4O9EA 1LECA 3KCCA 2H0BA 1LHVA 4Q0PA 5DQ0A 1H2LA 4CDWC 2QDNA 2E7AA 1UX7A 4K6BA 2XBO3 4RGKA 5FLJA 4WM8C 4GMP1 3WV6A 5F9TA 4KWUA 4MZUA 4HKOA 3WEZA 4XFFA 2FCVA 4RL7A 4DO0A 1OLRA 1MEC2 2OX0A 1DLLA 3DYMA 4LO4B 4N53A 4XUTA 2DVDA 1QJFA 1X7NA 1E5RA 1QWRA 1Q8OA 2RJ2A 2DVBA 3E5XA 3ETQA 2OZ6A 4QPWA 4OHZA 5F39A 5GZDA 1OXCA 2RJKA 1HQNA 1QGLA 2XLGA 4LK7A 4CSWA 2BVBA 2PAMA 4QB1A 2Y6FA 1N1VA 4L97A 1RMU3 1V9U1 2CYFA 3WNLA 2VD7A 1W3XA 3CJIB 1SLCA 3LWCA 1XB9A 1U5XA 1QH6A 4GKXA 5C7GA 1AR83 1ULPA 5LK5A 4E4HA 3AMQA 1MR5A 1LOFC 4BJ0A 1YQ8A 2GNTA 5F32A 4AAXA 3S57A 1S0BA 3U0ZA 2RV9A 1CGPA 2ZGOA 4IE6A 2FZ1A 1ND2C 1LCLA 1W9YA 2BUKA 1IS6A 1SFYA 1WMFA 2EXIA 3U07A 4XBNA 2JXAA 4ASMB 1EAH3 2BNMA 3QH6A 5ERLA 5FP8A 1AR61 4PDWC 4I30A 1AXKA 1ZVFA 2DU0A 1ND3C 3V56A 4DEQA 4LKSA 1UOFA 5FZ6A 2EXHA 4XIOA 4QX3A 1MS9A 1IPJA 2FQPA 1RUH1 3I3QA 1IKPA 2J1UA 2EXKA 2VZ3A 4UFLA 2CU5A 1W06A 1CJPA 1ZBE2 2JIJA 4NO4A 4ET7A 3LIHA 3MPBA 5JZGA 4JGYC 2LM3A 1DP0A 2ZZJA 2G9ZA 2ZXQA 4URTA 2CWMA 2AREA 2J1EA 3U11A 1B35C 4NWVA 1YIPA 1NYWA 3KCXA 2DCYA 4CYDA 1REEA 1XXNA 3HT2A 2HLEA 4NIIA 5JIUA 1HW5A 2PTMA 1S0DA 3E6BA 4X8PA 3J7MA 5D21A 1MPXA 2HEYF 5FZGA 1HXS2 3K46A 1BQPA 1TQ5A 4Q26A 1PIV3 3PVNA 4FXGB 4UFIA 4AQSA 5LBCA 2IVJA 3DN7A 1DHKB 4G9SB 5C5TA 1FAYA 1SLLA 4P9YA 4LHLA 1IGOA 3GGLA 5CAZA 3NW4A 1QNYA 2WWUA 1WMEA 5CZKA 4FPCA 1YC61 1UPSA 1PGSA 3UK9A 2MHFA 1R092 3J26N 4NOTA 3ZYJB 1QY4A 2ZGQA 4LUKA 2WIIB 3AP6A 2XHKA 1VBA1 2XB6C 3VL9A 4F83A 1EYBA 1LOEA 1EUTA 2BFUS 1DBNA 2OUHA 4HKWA 4NUBA 2JDZA 4YW4A 2UYBA 1RUE2 4YFWA 1A3KA 1OA4A 3KVBA 1IS5A 3RYPA 5T5JA 4ZU4A 3M7AA 4RHV2 3FL7A 4PIZA 4ES8A 3IPVA 1MQTA 4E4DX 2LROA 3PMSA 4HN1A 3MW2A 2AENA 1AR72 2WO2A 2Q5TA 3WW3A 4IV1C 1V6OA 1WCUA 5DPNA 5LBFA 2FDGA 1NX9A 4GALA 3VBFB 2NZ9A 3OYWA 1LHNA 5GJ6A 3DXUA 1MEC3 2PLV2 1W6MB 1H0BA 4QB2A 5JUVA 2ARAA 1IS4A 5FZBA 1RUC1 2WZPP 5M0TA 1RXGA 4LO6B 4PIXA 3ACIA 3L2HA 3PTRB 2V4VA 4GH4B 5L9BA 3DL3A 3M70A 5JIAA 1J83A 5SV5A 4A3XA 4KBZA 2WNVC 2XL9A 3ELNA 4UFKA 5LA0A 3RZZA 3HEIA 1V6KA 5FZAA 2WQ8A 2RM22 4TZDA 2WQZC 4WM7C 3W20A 1W6NB 4JGZB 1G7YA 2R0HA 2WJSA 4OUMA 4QKFA 5FZOA 2ZOEB 4QXBA 3BGAA 1JH5A 1NE4A 1NXD1 4ZU7A 4NMIA 1AHSA 5CG8A 1WMXA 1HV0A 3CZJA 5FZ7A 3M3QA 4QKNA 5JMCA 4QPGA 1UD1A 1O6UA 2R072 3UJOA 1LGCA 4QQ2A 1DIWA 1FV3A 1ACCA 2Q8CA 2WA4A 1JODA 5FFOC 4COZA 2JB8A 3NAPA 5T5LA 2Q8OA 3VKNA 1K12A 4FOVA 5EIYB 2RMU1 4R4XA 3GM8A 3JQWA 1T6BX 4LBLA 4B1LA 1NA1C 4JKKA 5JXGA 4FI9A 4DY5A 3N4MA 2BV4A 5FZ4A 1TE1B 5DUUA 1ZBE3 3IT8A 4MO3M 1COV2 4W50A 4NHYA 4UI9L 1UXXX 3U4SA 4DEVA 3Q8CA 4BPZA 4B4QA 2WFF1 3M8LA 3RMYA 1UZ0A 2VMHA 4MOAA 3PUQA 3U37A 1F9KA 2W5FA 3ZN5A 2QFEA 2VPVA 4M4RA 4BQ5A 4UAPA 5HI0A 2BW8A 4CCEA 3QH7A 2JG8A 4NRMA 2WQ4A 4JDOA 3ZFFC 1H1AA 3TBDA 3WW1A 1UU5A 2ZX0A 3O7OA 1WLTA 1UYZA 1HXS3 2VW0A 5GALA 4A6OA 2XJRA 1WCQA 4FOYA 4IEPA 4M01A 2E33A 3HJRA 1N3OA 4M3CB 2CAVA 2CDOA 2OQ6A 2QZ2A 2VQTA 4MGQA 1PNFA 4N53C 4RSUA 5FZMA 4UW6A 2RE9A 2VTFA 4IEXA 1JZ7A 4WVMA 1MS3A 2Z2SB 3KS7A 4LKEA 2GH2A 5F37A 4CCLA 5IK4A 1R093 4LNVA 2JG9A 4XF9A 4V2WA 3CEWA 4UFMA 3ZYBA 3HQUA 5A80A 4AK3A 3I2KA 3K51A 5A3MA 4Y20A 3ZR6A 1F4HA 1RUNA 3TN91 2VUAA 1GKBA 4HXCA 2WNEA 1O59A 5FY5A 5FZDA 1DDLA 5D1IA 3P3PA 1WKYA 1F15A 1W0OA 4Q0SA 5L7OA 2XMLA 3JBG2 4HBNA 3ZFEA 1APNA 1QEXA 3BVCA 1OUSA 4COWA 3E6CC 2AYHA 2G9GA 3VBUC 2GMMA 5ABJC 1SLAA 1W3VA 2VBBA 1PGW1 2VM9A 2WLQA 3PUSA 1NQDA 4NPMA 3LB9A 4IE7A 4BQWA 3WF4A 4QX0A 2CHHA 5FZIA 5DZGA 3NNMA 4N7UA 5JPMB 1WA6X 1PO22 3U10A 1VLNA 1ENRA 2ZX4A 4N90A 1QQP2 1RUD1 2JKBA 4H3WA 1PO11 3ZSJA 1UX6A 2Q1FA 5K4LA 4URAA 3TEZA 1I5PA 2C6SA 1QJY2 3Q8EA 1OPOA 3LEGA 1VBD1 3LZZA 4IQPA 5HV0A 2IZWA 2D98A 2IXIA 3ECQA 1KDKA 5BXXA 1RITA 2DVGA 3ZPYA 2Y0OA 4L11A 4ZU5A 4XFAA 4LR4A 3VGIA 2C26A 4DB5A 3S5AA 1XJAA 1RUJ2 1T2XA 5FK8A 3VBOB 4R9DA 5LA2A 5G05L 4DFSA 2C5DA 4LBOA 3SXWA 4MSVA 1AYM2 3T08A 5FUPA 3LKJA 4OULA 4I01A 2VL4A 1XYOA 1JYXA 2X53S 3OBAA 5FQ0B 4BXSV 3DECA 3WNMA 1LESA 4YARA 2JDHA 4XF1A 2Q8EA 3ATGA 4ZZ8A 4N43C 1XNKA 5J48A 3AZYA 1ZRFA 3WDXA 2PFWA 4MYEA 1VBC1 4QU1A 4F8AA 2ZCWA 3JD71 3WHTA 4CTEA 1HJGA 1UXZA 3MIGA 5A3LA 1BBT1 3TB0A 3KSCA 5C9AB 2G9FA 2IC1A 3R4DB 2RR12 1L7RA 3OSDA 4JGYB 4XCBA 2YMZA 4AEDA 3K3NA 5BUVA 5GM0A 4R8HA 1RVF3 5KHIA 3X29B 4YZ5A 5C3OA 3HN3A 3IKWA 3RJRA 4LO8A 3U4XA 4YGCA 5C3RA 1POV1 1SBDA 1W39A 1O7FA 1WBFA 5FZEA 4LK6A 4WVWA 1G9CA 1PNGA 1W6PA 1S2BA 5B4NA 2Y60A 1OHFA 4ZS2A 4HLTA 2FDHA 4XABA 1ZRDA 4P00B 2DCZA 1E5IA 4KU7A 4PF1A 3MO4A 4WZFA 1PMHX 5A33B 5IHRA 3TEXA 1JUIA 1Q5OA 2CTVA 3RWNA 2V72A 4G4FA 4AGRA 4FPLA 3LPGA 4OYUA 2ZX1A 1X50A 1YQ6A 3RG0A 3VD5A 4XVHA 2EIBA 2IXHA 3AYAA 1RL3A 5KXBA 3VUOA 3WR0A 1OKOA 2HWC1 1RUG2 2EALA 4H7MA 3WUCA 5CKMA 3VDAA 5F3CA 2VZTA 1KGYA 3ZR5A 1QJEA 2R063 3D6EA 4OUEA 2RS53 4P5HA 2D6LX 4AGGA 4H7LA 4YW6A 3GJBA 4IV1B 3U78A 3IDAA 2WT2A 3ASIA 4IEUA 3NAPC 1KFXL 2GALA 4XTMA 3WF0A 3H8XA 1W6QB 1CJDA 1DQ1A 4COYA 1C8M2 4H2AA 3OBTA 5C8CA 1LULA 4ORFA 1QQP3 2JDMA 4RYDA 3WF1A 3AZZA 1GQHA 4AI9A 4IW3A 2VAUA 2R042 3MLLA 5KXCA 1HB4A 3KV4A 4D6QA 3NV2A 1ULCA 2DTWA 5I93A 2VG9A 3WHUA 1GQGA 3AFKA 4RQPB 3J7HA 3O1SA 1L3JA 2R16A 4ISQA 5BNOC 4JHZA 4WM7B 3M3EA 1GMMA 4EZ4A 3AYEA 4IEVA 5C3PA 2P6HA 3VN4A 1W8TA 3QBQA 4Y5SA 5A32B 3ZLIA 1RUJ3 2W08A 1PMJX 5I0UA 4EJRA 3OD0A 1JUHA 4N9HA 4EZHA 5D2AA 1R082 4PHZA 5H9RA 4H55A 3ROUA 2Q4SA 1RYYA 4HFSA 4Q4Y3 2OZJA 4V1PA 3ALQA 1AYM3 1YFWA 5FZ1A 1TZOA 3IB3A 2ZMNA 1I5ZA 2MNGA 3P6BA 4HPKB 1LODA 2ZZQA 4YNIA 2YBKA 3I49A 4KG8A 2H0VA 4A4AA 4KGQA 1GOFA 4NWWA 4LEJA 3OG2A 3MBWA 1W8HA 4GAZA 1NA1B 2G1MA 3J8F1 3ME2A 1SPPA 4GB33 5DUVA 4YSFA 3AFGA 4ZONA 2RR13 1C1FA 5LEKA 1MS8A 4LQRA 3V0BA 3R4SA 3H42B 3K48A 4QXHA 3LPFA 2FDIA 1XE0A 2CWSA 4PLMA 3SKVA 5IFPA 3ZFFB 1QXPA 3AZVA 2V73A 1TNFA 2W91A 1IHMA 1UMIA 3MEPA 4XTPA 2JEMA 2VMCA 1WCSA 2X10A 5T5PA 1AUYA 4C8DA 1CAUB 3ENRA 2QQUA 5KHKA 4AI0A 3BKZA 2YBSA 4FVVA 2NMNA 2HH9A 3UGHA 4K9SA 1W6OA 5FLIA 2F4PA 2E7QA 3K2OA 4Q8LA 3WP3A 3MIEA 3ZKYA 3ZM8A 4FTSA 4QPYA 3D3AA 5JMOA 3WQ7A 1SFPA 1S55A 4XUPA 2ID4A 3BYWA 5AC93 1BMV2 2WS91 5DAQA 4BQ4A 2W1QA 2A3WA 4KWKA 1VRH1 3FUQA 4TN7A 2IXKA 3IDCB 2GC0A 1VRBA 4BMBA 1QIQA 2E7TA 4FFFA 3ZOIA 3C7FA 1DZRA 2MEV1 3POGA 1WZXA 4O7XA 1BVP1 2D6OX 4LA2A 4Q0UA 2PHRA 2WA3A 3IBMA 1LHWA 1Z7S3 3FLPA 2P3IA 4JQRA 3WDUA 3N7LA 2XH6A 2W0XA 5E89A 3SC7X 2BOJA 2XQRA 4PLNA 4Q4W1 1XYPA 2XJSA 4HSLA 3VBUB 1C8M3 5ABJB 1LU2A 1TME2 2X05A 4EN9B 4R9AA 5FP4A 3RZKA 3DKQA 3CLPA 5GLTA 4HN0A 3ZX7A 2A70A 1QJX2 4QDRA 4E2SA 3DKWA 1SLBA 1RUF2 1PX3A 2R043 1CZVA 2ET1A 2NMOA 4FT8A 4YVSA 5HBAA 3KD4A 5FTTC 2A7AA 5F6KA 1ZRRA 4XDPA 2W87A 2ZHLA 3WLUA 4CCJA 1H9PA 2UWCA 1HRI1 1MZ6A 4GWMA 4W65A 1HRV1 5I0SA 2B8MA 5DG1A 1N3QA 5FRAA 3GCXA 2HWD2 2LW8A 4B7EA 3UV9A 2W1UA 1VMFA 1RGSA 5T52A 2BU9A 1S0IA 5FY7A 3RQ0A 3QACA 4A45A 2VUDA 5C5UA 1V6NA 5IVJA 2PHDA 2JIGA 3L9JT 1OLMA 3I7DA 3NV1A 1BVVA 3H7JA 5CFDA 5DDJ2 2YYOA 3A0NA 2R30A 4QMAA 4CDQA 1Q8QA 1AX1A 3ZFGC 1CAXA 5FMOL 2ZA9A 5ANQA 1CESA 4EV0A 5IVFA 4RR3C 1Q43A 1NXMA 4FPFA 3CHXA 4CP0A 3DYOA 3R05A 4OCTA 1GFF2 2EIEA 5FYYA 4AEMA 4CU9A 1RHI3 3E97A 4CP9B 3K3OA 2HWF2 1OOPA 1TEIA 4CEWC 3T1LA 4JRLA 3WUDA 2YC0A 3Q8FA 1WGPA 4N43B 3WG3A 4C90A 1W0NA 2XDVA 5A6ZA 1HB3A 3O0WA 4TYSA 4AR2A 2XBO2 5LBEA 2PMWB 2P3YA 2I2SA 4CEYC 2AEZA 3KB5A 4YZ2A 3NSTA 1XU1A 2BPA2 3T3YA 1JU4A 5JWPA 3J9SA 4CDUB 4QM8A 3O1PA 3OYWB 1NCRB 5IK7A 2QQNA 2WZ8A 5CKQA 4TXWA 2ZBJA 3IN9A 2E9QA 3ZMNA 3N3HA 1OC1A 1OUXA 2SBAA 1AXYA 2RVAA 3RSJA 5FOBB 5LW9A 4AVAA 3ZDVA 1PK6B 5FBZA 2FBEA 1XNDA 3CDZB 4AOCA 2HWE3 3VBRB 2VQ0A 1RMU2 3VL8A 4Q0QA 3ZXEA 2VR4A 4K1ZA 2GZWA 1JOBA 4QKBA 2LRPA 3NNFA 4OVEA 1SG3A 3VZKA 1Y43B 2Y26A 2BNNA 3IIAA 1MACA 1D2QA 2K2SA 2W9XA 2ZKNA 3M3IA 1KJLA 4M0NA 4CUCA 4RGAA 1W2NA 3WY6A 2IFRA 4DY3A 3AL5A 3C8XA 3PJQA 2IXLA 3KHBA 2A6ZA 2Y33A 2P3JA 2Y6KA 3OCPA 2PHFA 4LBQA 1ODNA 4K1YA 1AJKA 3I54A 3NJZA 4LITA 3VBHA 3F2ZA 3WINE 5JSRA 1QJU1 1NLRA 4YRDA 1TME3 1WMDA 1E5SA 3AP9A 5ACA2 1I9RA 3FUOA 2AC1A 3VKFC 3ZSEA 4XPVA 2VMEA 1RUF3 3H8RA 3EYPA 2R6QA 1G9AA 3I2OA 3R0RA 4B4PA 2I45A 2BJSA 1C3HA 2HWB1 5FPLA 5LA9A 1SBFA 2P4EA 3ZN6A 1QXRA 3CBNA 1EV13 3C7EA 3RZLA 1GZWA 3J7NA 3KT4A 4NIGA 3M1HA 2A6WA 3T4HB 1UIJA 2GC1A 4RS5A 3GF6A 4YYOA 5H9SA 1O8PA 2A3YA 2HWD3 4JCKA 4BISA 1Y3TA 4HT1T 4IV3B 1UKRA 2GNDA 4LHSA 3VDDA 1NY72 2EIGA 5D8AB 3AB0A 3TNQA 3W9AA 4FQ4A 4AAPA 1OQDA 2J1VA 5L36A 1PVC1 3RZHA 1OF3A 2I74A 2RDNA 4BQ2A 5BNOB 2ZX3A 3Q8BA 4XYXA 2CGNA 1W2OA 5GZCA 2H6BA 2GSYA 3JB8A 2BGCA 2ENRA 4KWLA 1HB2A 4D7TA 4XACA 1CAWB 2VNOA 1ST8A 3THPA 3KF3A 1V0AA 4IE0A 1EY2A 5JOYA 3V0AA 2FMDA 2MPFA 3GHMA 1SQ4A 3EJKA 4XQDA 5FYCA 5JVVA 2LALA 3OGSA 4OHWA 2FMYA 1UKGA 3MIFA 3EQEA 4NVPA 4FPYA 3U14A 1YCIA 3THDA 2HWF3 4QGLA 5I8YA 1MS1A 3AYCA 3T1MA 4YGEA 5EV7A 5C3SA 3W59A 3AP7A 1XQNA 1IQDC 4LPLA 1QMJA 3FBMA 5BNNA 5FPZA 2D97A 1OVSA 3BPZA 1NAEA 4AYUA 5JOZA 1FATA 4YVWA 2ZMKA 1J3RA 3W58A 1ULFA 3S5QA 1V70A 4AHYA 1F8VA 1D2SA 1LEDA 3JCIA 2P34A 4HK8A 4P5YA 4L2NA 5EQUA 2DFBA 3EB7A 3DGTA 1K5MA 2C0ZA 4GMP3 3HOBA 3MLKA 1X82A 2X8KA 4KG0A 5ACA1 3I97A 2VW2A 2WNUA 2ZEYA 3LF7A 4K8FA 2QTWB 3B69A 4Z1VA 1AX0A 1AX2A 4IE5A 4YG3A 5FCCA 1YLLA 4DOUA 4S2FA 5L73A 1FV2A 2IUWA 3ACHA 2XKPA 4QQOA 1H4HA 4LE4A 1HKDA 1LEMA 3OD4A 5GLZA 2PHLA 1H8TA 1SMVA 1MVQA 3T0BA 4O65A 1F4AA 4LIVA 3OGRA 3ZO0B 1OFNA 1JZ6A 4Y22A 1XNBA 1S0CA 1KD7A 1AR81 4GWJA 2KA3A 2FDFA 4FPEA 3I3BA 4KWJA 2VUJA 5CFDC 2VMGA 4IGPA 5FWJA 1D0GA 3AMNA 1EPWA 4CDQC 1US2A 4XFCA 5A3NA 4MH0E 2WLPA 3OB8A 4BE3A 4TLFA 5ACA3 5FPVA 3I3DA 1FMD1 5BNPA 4QPIB 1ZX5A 1EAH1 1AR92 1AR63 3SCHA 3DPRA 3GBGA 3WP4A 4LULA 1MS0A 2CY6A 3SQOA 1R1ZA 4O61A 2DCKA 5AVPA 4FO9A 2Q1MA 3HQRA 1SBEA 1OOPC 1GLHA 1RUH3 2EIDA 4XXAA 3OUIA 3HNBM 2WZR2 4OFGA 2BDRA 2X5IA 1F2NA 1VIWB 1GANA 1VAVA 1NCQA 4INDA 5E6HA 4CU7A 3S0MA 5DMYA 1Q56A 2DUOA 5KHGA 1W8WA 2BP6A 4FPHA 1U5ZA 2CV6A 1DGWX 1O5UA 2BWAA 4UFJA 1H1IA 2B9VA 4UT5A 3PUAA 5F3GA 3KLSA 4UBGA 4DINB 1D4M1 4LBQD 1ASJ1 1H30A 3WQ0A 2W47A 1CAVA 2VW1A 1XYNA 4YM0A 1RB8G 3GXUA 3MF9A 3ES1A 1LENA 3B02A 3ZFGB 3A0KA 3WG4A 4DMIA 1CD3G 1WWYA 3NRUA 1GZCA 1NQJA 5IK8A 5EZWA 2XQXA 1W2TA 2VMFA 4RR3B 4E9KA 2TNFA 5FO9B 3FJSA 4Q4X1 2JDPA 1YQ5A 1X8MA 1XNAA 3P1IA 1CZSA 4RA0A 3UKTA 1WD3A 5FP9A 3BCWA 5CADA 5LASA 4CEWB 2XGXA 4OZOA 1PZ8A 4XEZA 4HK9A 1HLCA 4UW5A 4XFBA 1AZDA 1A34A 3A21A 5FUIA 4KMQA 5LCWL 3KT7A 1YFYA 1VBB2 2WABA 3CQOA 5E1RA 3BTYA 1WA4A 2PELA 4CEYB 2E53A 2GDFA 3WT3A 3ON7A 4C0HA 1H2NA 4R9BA 2A71A 1W90A 5JI7A 2RS31 1LOCA 4P08A 1JHJA 3AXEA 1MEC1 4IDZA 1C28A 1S0EA 2B39A 1V6JA 2UY8A 2WBKA 3OPWA 4IEWA 5J1XA 1R1A2 1VALA 5LATA 4XCAA 4XFGA 3AL6A 3FLRA 5B2GB 4XMIA 3WG2A 2HJIA 1ULDA 3G6JB 4LBNA 2EAAA 2IXJA 5A7QA 1QF3A 4XOGA 3NV4A 5CEHA 1H8VA 5A3WA 4CUGA 3O1TA 2L9LA 1S1AA 4Z2WA 3H0OA 1OKQA 4IGOA 3VDDC 1ODMA 1FX5A 2GNBA 3KV6A 1OH3A 1JBCA 2Z42A 1UF2C 1VBD2 1DU3D 3D4KA 2VOWA 4CP1A 5DAWA 1YO8A 4LOSA 5A7WB 5HPOA 5FY4A 1UZYA 3LSDA 3POEA 5CFCB 1PX4A 1K45A 2ES3A 1Y9GA 5LEJA 3FFZA 5C4WA 5SV8A 4MGKE 5F5QA 1N1TA 4BDVB 2E51A 1TG7A 3VD9A 5K0UC 3H7YA 1QXJA 3CO2A 1AR93 2ZGRA 5FZLA 1XSQA 1QJZA 2IVIB 4YFZA 4YW1A 1KITA 4LJHA 1W9SA 2D3RA 1GP6A 3KZ4C 2RMU3 3ZXKA 2GC2A 4ARXA 3BODA 3S7EA 1NUKA 2HEVF 3VZMA 2E31A 2DBIA 4K40A 2WZR3 1H9WA 1OQEA 2ZAAA 5JCTA 1ZBE1 1ZREA 4AWDA 4NR1A 4YVWC 5EJ3A 2WFF3 5FYUA 1RVF2 1CIYA 1VBC2 4B3NA 3VD4A 1JOJA 3VZJA 2OPKA 3IDBB 1BBT2 3WX5A 4FFHA 4AZZA 3ES4A 1GWLA 4LO7A 3IMMA 4HZFA 4UF0A 2DTYA 3RI8A 3WNKA 2AR6A 4GZ9A 4CDXA 1UY1A 4DQAA 5CKNA 3JUUA 4XF4A 3LA7A 1AXZA 3PIGA 2WNUC 4CE8A 4AFBA 4EROA 1PMIA 4PCRA 4AGVA 1JZ3A 5T55A 1O3TA 2QQKA 1FNZA 4EN6B 1WW5A 2GMEA 5A3UA 5IAVA 3I59B 1H1MA 3ACLA 3C7OA 3H8UA 4NRQA 2PHTA 4DUXA 2W46A 1FI2A 1UL9A 3B93A 4TTGA 3K75B 2W39A 5FAXA 4Y1VA 1GBGA 5G04L 3T30A 1KJRA 1H8TC 3VBSA 4E27A 4OHVA 2E6VA 3PVOA 2H6CA 1UNBA 2CGPA 1CIWA 1V6LA 2VNGA 1SACA 1PVXA 2RJLA 1NG0A 4GXLA 3SKJE 3TN93 3WQ1A 3HNMA 3ILNA 2EAKA 1RUE1 1WCKA 2V09A 2VOVA 2PHWA 4CDWB 1G9FA 5LK7B 2R062 4J1WA 2RS52 1VBB3 4RHV1 4WM8B 4QWNA 5F2WA 1K42A 1AR71 3NKGA 3MV01 1Z0HA 4Q8KA 1O4TA 3UYJA 1AJOA 4ATFA 1I1EA 2PLV1 1W8OA 3UJQA 2BNOA 4R9CA 2GH8A 3GHNA 5FKCA 3VKMA 2A73B 1R1A3 3FBYA 1G9DA 4X8NA 1HN1A 1PM4A 1XNTA 5JZGC 2ZEWA 3VKOA 2GP3A 4S2GA 1DQ0A 2VVFA 5T3NA 5GZGA 2GMPA 4CCKA 2X5IC 4Z2AA 1X9PA 3LEKA 4XZPA 1NCQC 2RM21 1MZ5A 3O1RA 4YZ3A 3A22A 4BZ4A 4GQ7A 2UWAA 1XE7A 2ZTNA 3CJIA 4QHOA 1VBD3 4ONUA 4MXWB 3TNPB 4Z92B 5IATA 4IETA 5GZEA 1TMF2 4AI2A 3NWKA 4I02A 3ITQA 4FAHA 1ND2B 4J6GA 5F1RA 4MX3A 1GOHA 4Q4Y2 4BK5A 3ZVXA 2WAAA 2YU2A 1F31A 1CVNA 3DUIA 4PDWB 1CX4A 4YM1A 1ND3B 1QU0A 3K4DA 2R071 1DQ5A 4DXRA 3MLJA 3I2GA 1UZVA 5A7NA 4COVA 1OQ1A 3B01A 2QQVA 4BU2A 4I2OA 5JI9A 1OH4A 4GB32 3B5LB 2Y0IA 2RG4A 1ULGA 4SBVA 4BQYA 3SH4A 2QQWA 2WYFA 1MQTC 1COV1 3MIHA 1LOAA 2VOXA 3ZKUA 4DXSA 3WZ1A 3PL0A 4CRQA 3KCYA 1YHFA 1ZM1A 2HYXA 2JE8A 4JTOA 1B35B 4WZCA 1VBC3 3V65A 3T2PA 4AI8A 5FOJB 3JD73 4OI4A 4CXWA 1TNRA 1NE6A 3AZXA 1GNZA 1JZ4A 1BBT3 1OT5A 1UIKA 5FZ3A 4Q4V2 4ZY9A 1JYCA 2R32A 2Y38A 2XWJB 4PBOA 2ZKLA 3MIBA 1JS9A 4QX2A 2VQUA 2EA7A 3DV8A 5CG9A 3E5QA 1O8SA 4CPBD 3POYA 1POV3 5L9RA 4XF3A 1O4YA 1IG0A 5IJRA 1DLCA 1NT0A 4Z8BA 4AVSA 1M06G 3LQCA 4XUNA 3ZSKA 1Z78A 5AC92 1XU2A 1G86A 2QZ3A 3GJAA 3TWIA 4OZXA 1WUVA 4PLOA 5GLWA 4XFIA 2G4IA 2VNVA 4XFHA 3EXUA 2XWBB 4UXAA 4KNCA 2PA7A 4AVCA 4Y5Z0 2VCMA 4XE9A 4FP3A 4OMCA 1LR5A 2DUPA 4MHUA 5FJHA 4GKYA 4QPGC 3LDRA 1FOD2 1VRH2 1Z7S2 2QQMA 1ULOA 3QLQA 3OY8B 5AFEA 5IUQA 3JBG1 1DCSA 2MEV2 5HCFA 4OI1A 2D6KA 4Y3OA 1PHMA 4LT5A 1BK0A 2J7MA 1L7QA 2HKXA 1ZBA1 1YI9A 3VBFA 4IGQA 4NAOA 3MPPG 4XAEA 3D82A 3USUB 2VVEA 4CUAA 1F5JA 1W6MA 1IG3A 2JICA 4GIQA 4EN8B 3IIIA 1A8DA 2R7EB 3ZMOA 1CONA 4I0AA 5KBFA 1PO21 2RS12 3VHPA 1UMHA 2WNVB 5DN2A 3QD6A 3WQBA 2QQOA 3TYJA 1HDKA 4GH4A 2JG8C 3OGJA 1E57A 4QDQA 2DCJA 4GWNA 5GKAC 4DS0A 1QOOA 2KD7A 2LUWA 4OMDA 4W6YA 4GJZA 4D7YA 1QJY1 1VE0A 5HCHA 1RUI2 5F6LB 4NIDA 4AW7A 3GCWA 4GWIA 4BLJA 3E6DA 5LB6A 1TMF3 1X8EA 1W6NA 1JTZX 4JGZA 3ZYRA 3R4UA 4HL0A 5FXZA 4JTNA 2JWPA 4CDXC 4ASLA 1BK1A 3HBKA 3FZ3A 3OOXA 3SCGA 3ORJA 4AVVA 3T09A 2EICA 2JG9C 1BZWA 3UKVA 3O1MA 1T6GC 2WC2A 3VB9A 5EHDA 5BY5A 3ST7A 5K0UB 2Y34A 4YW7A 4YGDA 1OSGA 1RHI2 1J1LA 1QNWA 4EN0A 4D6RA 5L19A 2ZHKA 4LKFA 4JKLA 1PZ7A 5L7OC 4QQPA 4WBBA 4JAAA 5JSPA 4CU8A 3ZFEC 1CX1A 1HB1A 2WWSA 3J8F3 3BN6A 3ZXAC 2D5FA 1QH7A 4Q4V3 1NLSA 4A7KA 1JXNA 2JDUA 2VVDA 3GDBA 5FXWA 4A2UA 4XJZA 4JVAA 4FFIA 5E16A 4XDQA 2XKOA 3AMPA 3VHRA 3H8OA 4N53B 3DEMA 1DZTA 1GQPA 1YUDA 2F6BA 3P5BA 2O0OA 4QAWA 4XHXA 2Y6LA 5IT6A 3THTA 1AL22 4M3CA 2HWE2 4IEYA 2W1WA 4QHZA 5IAXA 2JD4A 1JOPA 4GD4A 4BH9A 2W94A 4MV2A 4AHXA 1W03A 5DXDA 4W6XA 4FCAA 5FV3A 3MZHA 1W8FA 2FCUA 1F35A 1FNYA 3KQ4B 1YQ2A 4BCUA 5FPXA 5KXEA 4A7YA 5L9VA 2JE7A 4BWOA 2PAKA 3HR9A 5FYZA 1BEV1 5IVCA 2CL2A 2DWRA 3C2UA 2J1TA 2E26A 1GOGA 4E8DA 1HIXA 2DU1A 1RTVA 2BTVC 1W99A 2B4KA 2WS93 2OPWA 4UOJA 3CJIC 3VV1A 1FOD3 1VRH3 3GALA 4FPOB 4RGGA 2X09A 1UW8A 4XJ8A 4ISRA 2ZAHA 1DFQA 3HPNA 4UYBA 4R4ZA 5J98B 1JU3A 3OUHA 4IXLA 2FD8A 2MEV3 1RUG1 2B9UA 2GN7A 2YFUA 4L8QA 4N7IA 2R1DA 4O9GA 5CU1A 3WW2A 2Q8DA 3S6PA 3WNOA 3ZXLA 4ZS3A 4Y4RA 2J42A 2BGPA 2DF7A 3WNNA 1IPKA 4GMP0 1DG6A 4QX5A 5FLHA 5TSWA 1HX6A 1L7LA 4LORA 4IUGA 4ZHNA 2VZQA 1IS3A 3OBZA 4FTBA 1Y9MA 3LSEA 3CNAA 1EV12 2WL1A 2VZSA 2RS13 1ZZ6A 1V00A 2WINB 2ZEZA 1ZRIA 1S4CA 2B46X 1STMA 5JZGB 4YPJA 3IMNA 2XUMA 2WN3A 3BTAA 4AI1A 5LY1A 1FPN1 1HJFA 1MS4A 2GP5A 4A42A 2ARXA 1HRI3 3OPZA 1HRV3 1RUI3 2GC3A 1BJQA 4AXOA 1UZZA 1I3HA 5FYBA 2RDSA 1A6CA 1RXFA 2W3JA 5DABA 4MGTA 3C3VA 2ZPXA 1UY0A 1XRUA 4FXKB 3ZXGA 3VHNA 1VBE1 1REDA 1PVC2 2F4LA 4OLLA 3GYDA 2Q1ZB 1LOFA 2JX9A 5JXHA 3CJXA 1R081 1GP4A 2ZHMA 1X33A 3TAYA 1PGL2 1H6YA 3TRSB 3VBOA 3ZIXA 3O1UA 3MFCA 5T5OA 4OHXA 2VH9A 2PN5A 2W2IA 4C1XA 4EE2A 3BOWA 4TSVA 3T0AA 4EN7B 4LMFA 4UBHA 2KM2A 2DDUA 4B8EA 3RYRA 4BMEA 3AKTA 3NL1A 4YM3A 5LRSA 5FQ0A 4QT6A 2XPJA 5FMOS 4Q1RA 5ANNA 2ZJCA 3WG1A 2YC4A 4MGSA 1D0HA 3IPVB 4IL7A 1MQTB 1IPSA 2ORXA 3NKTA 4Y1UA 5F5AA 1AYN1 1V6IA 3IZOA 4IERA 4F7ZA 3L2YA 5C9AA 1ENQA 3SHRA 1P8JA 4N9IA 3GNEA 4JGYA 2FHRA 2VC9A 4DRVA 3O5SA 1SLIA 5C8CC 2VULA 1VAKA 5LA1A 3RMXA 3VBFC 4COUA 2IFWA 4PT6A 1AL23 4M4PA 5KHHA 2Y6HA 4LLFA 1UYYA 2WUHA 1UY4A 2YROA 1YWKA 4P9LA 4LHKA 3IM0A 2QVSB 3VD7A 4P9XA 5F3IA 1XNCA 4GH4C 4OHYA 1TVGA 5DZEA 1AL0G 1V9U2 5CB7A 2P5BA 5K8SA 2BBVA 2ET7A 2UU8A 3KVAA 4A41A 5FZOB 3JQXA 5A33A 3BU7A 1UCXA 3D5OA 4K20A 2OVUA 5IK5A 4YLZA 4XILA 3SH3A 3PHMA 1J58A 4QPGB 1MZEA 3AZWA 4U36A 3HAGA 4U2AA 5APAA 5J3UA 2VNRA 3URFA 3ZSLA 3T2QA 1LNSA 3AVSA 3NAPB 4UW3A 2WT1A 2A6YA 4Y33A 1AR62 3RJ2X 5K7PA 1DQ4A 3B9IA 3OF1A 1KXGA 4MGIE 4WV8A 3W21A 1D4VB 3SNMA 3KT1A 4K8RB 4LUMA 1W6QA 4E2GA 2CAUA 1SFNA 1C4RA 1QJX1 3ZN4A 4MXVA 3AM2A 3POIA 1Q8SA 1RUH2 4QX7A 2AACA 2VE1A 4HVQA 4J1XA 5EYYA 2P6CA 4FOQA 4B7KA 3JZVA 4C1WA 2D93A 3H1YA 2VZRA 5JR2A 1YRZA 3C7GA 3BIEA 1OA2A 4M00A 5FP3A 2JG8B 1XC6A 1OF4A 2BWCA 3OEBA 1F5FA 2ZGSA 5H9QA 1Y4WA 2D6PA 4RQPA 1XSRA 3JU9A 4NAMA 2YB7A 4WM7A 1LAJA 1M4WA 1Q3EA 1PVC3 3CIHA 3MICA 5AFBA 5EPAA 2UYAA 4WVMB 5DDJ1 4YW5A 5GZFA 4ZZ5A 5A32A 4CDXB 1D4M2 1ASJ2 5A1AA 1BLZA 3FC0A 3ZXJA 1HQWA 1WCDJ 2TUNA 5FIXA 1XE8A 5FZHA 4D3WA 3W5NA 2JG9B 1AVBA 1S2EA 4ASKA 3VKLA 3KQRA 4HPKA 3NNJA 4RFT0 1U5IA 2I07B 5I8TA 1ZRCA 4Y20B 1GUIA 3B3QE 4L0PA 2IXCA 1CR7A 1VBA2 2C1FA 5FZCA 3WF2A 3B7MA 4NHMA 2HBUA 3SEEA 4UW4A 2D3PA 3H3LA 3I2HA 4L92A 5JXJA 1W2AX 4BQ3A 5L7OB 2WAOA 3H3UA 3LEIA 1OFSA 3VZNA 4AQTA 3ZFEB 4YZ1A 1IZ3A 1OLQA 3DYPA 3KF5A 3NNLA 4B1MA 1GWMA 3AKRA 4YWAA 2XBO1 1LB2A 1CN1A 2FCTA 3LCPA 5FP7A 5FY0A 2J1RA 4FAGA 2YGLA 2LTNA 4MGYE 5IWFA 3T2OA 5FY8A 5EJZB 2W95A 1VP6A 3K4ZA 5KC5A 5A1FA 1W9TA 1RUC2 4OUSA 3KGLA 4YVSC 4Q1PA 3ZFFA 1ONAA 2J1SA 3WXPA 4D6SA 1OLME 3Q8AA 2RS32 1RJ8A 4HANA 1DGRN 2J1AA 3WW4A 1CAUA 2VZUA 4BK4A 4CCOA 1ALYA 2D44A 3BB6A 4X6QB 4EWDA 2K46A 1VMJA 2D6MA 3FMGA 2GNMA 1XPWA 3PJYA 5F7UA 1V9U3 2AZ5A 1RMU1 2ZHNA 5GLUA 2UWBA 2NLRA 4AFCA 3NMBA 4CZSA 2OIIA 1ZZBA 4FPKA 4A7ZA 2V5YA 3PURA 3IAPA 1DF0A 4J25A 5A70A 1Y7BA 3HWJA 1JYVA 2XJPA 3AKSA 4DZGA 2UURA 4JHTA 2DUQA 5A3PA 5FMBA 5A6QA 3VD3A 3ACGA 3PLQA 4AI3A 1A8MA 3B94A 4IEQA 3SMHA 3LFMA 1QDOA 4P14A 4Q29A 2P17A 2B5HA 2D6NA 1H2KA 1W8ZA 2ZGNA 4ZPIA 2A6VA 5IVBA 1QDCA 3VBOC 1YXWA 4LOTA 2RDQA 2RMU2 3HMYA 2D3SA 3VBUA 5ABJA 2WO7A 2Y64A 3JB4C 3W5MA 1FMD3 3C7HA 5DAVA 2VCAA 1ZZ8A 3FX3A 4AEKA 3N9OA 4W4ZA 4OI2A 5E88A 5FZ0A 1XBFA 1YYNA 4QKDA 3ACFA 3I2JA 3V64A 2WFF2 4EWEA 5IYYA 4E4ZA 1D7PM 3GBWA 4FQZA 3NNGA 1WW4A 2AGSA 3ILRA 2O8OA 4I3PA 4GJYA 1N3PA 5JOWA 4LBKA 2JECA 2HBTA 3MGUA 1QHDA 3UL2A 5C9AC 1NY71 1X36A 2VZVA 4RFRB 2XR4A 5F3EA 3KM5A 4FOWA 4HVRA 3LOBA 1PIV1 5FO8B 3NV3A 5FPUA 1ULEA 1N47A 1W6PB 1D4M3 1GR3A 4QHBA 1ASJ3 3R6SA 2C4XA 5DAXA 3BIWE 4JKMA 1CQ9A 1YFUA 2YY1A 2BFUL 3ILFA 3WDVA 2LS6A 2VCBA 4BIOA 1FYUA 2YZ4A 3LEMA 3N9QA 4NPRA 5HXVA 4KGGA 2A6XA 5FYMA 2WSUA 3PU8A 4P9IA 3IDEA 4DRRA 4FPGA 1VBA3 4BOWA 1RINA 2VMDA 4ES9A 3TN92 4CP2A 3PVEA 5J36A 2XXZA 4DUVA 2AEYA 1OVPA 1IOAA 4Q4X3 3MFAA 4XC9A 1BHGA 2OT7A 4A3ZA 4CP9A 3OUJA 5KR7A 3POBA 3J4UH 4FTEA 4XAAA 3VBHC 2GAUA 4AF9A 4XBLA 3RZJA 4N43A 3WVJA 1S2KA 1JYNA 3I3EA 4AVTA 4N8MA 1UN1A 1UY3A 3FLTA 3HD8B 2P37A 1NKGA 1OBNA 3KMHA 1FXZA 1RUC3 1PGW2 4IEZA 5C3QA 3PU3A 1WLDA 4WVZA 4XJAA 2P2KA 4NIAA 3RPQA 4PJYA 4CDUA 1Q8VA 1J3PA 3WSOA 2RHPA 2RS33 1J1TA 2NPIA 1JZ5A 3BTXA 1NCRA 2EXJA 1PZ9A 4RS5C 3WF3A 3BPSA 1POV0 1GWKA 2ZABA 4RD7A 1RUD2 4XXPA 4PIYA 4XBQA 2VCCA 1PO12 3POSA 4XJ9A 1MS5A 1PK6A 3I2IA 4D0QA 3VBRA 1LGNA 3H1WA 3WP6A 2ORZA 2ZGTA 3VDBA 2YXSA 3PTYA 1DQ2A 3PMEA 4QX1A 4XW3A 5A7SA 4DPNA 5HCBA 3VZLA 1MVEA 5JLVA 4AFMA 3AVRA 1C5HA 3CU7A 2B7YA 5JSOA 4RQPC 4XIKA 2VECA 4EYUA 3BI3A 2TBVA 4CPBA 1KQRA 4W6WA 2A5ZA 3POFA 3QCWA 3D0JA 4UWDA 4KQ7A 5A7OA 5T50A 4Y1ZA 4LKDA 3LIGA 2VTXJ 4XUOA 4Y4YA 4TWTA 4PQQA 2C9AA 4XHBA 1DGLA 2QJVA 1SCSA 2ETEA 3GZAA 3LA3A 5IW0A 1W0PA 3G7DA 5ISLA 4JQTA 4JDNA 5FPAA 2ZGLA 2VMIA 1QOTA 4GA9A 1GICA 5FUNA 1AR91 2BYVE 3FE5A 5HV4A 5JDBA 1SPPB 5BNNC 1VMHA 4Y1YA 4ITCA 2QQJA 3AJZA 3HQXA 2W52A 3SH5A 5FXVA 3JD72 1LOBA 3N7MA 3UT0A 2NYYA 1OD5A 5EP9A 3ZYIB 3V0BB 2ZACA 2WZR1 4E4SA 2HYKA 2GU9A 1K5MC 4IV3A 3LD8A 5FMDA 2Q0AA 1HXS1 3NVCA 5EYXA 4XZUG 3NO8A 3QOPA 5D8AA 1ZA7A 3FHQA 3KGZA 1RJ7A 1VR3A 3PNAA 4AVBA 2C9KA 2PXJA 2Z4FA 4XF0A 3VDCA 4AQ2A 5BNOA 5JPNB 5T54A 1O3SA 5FY9A 2VUCA 1GNHA 2A75A 3OGVA 3TEWA 1W6OB 3ZYFA 1CAWA 1XOYA 3AK0A 4D69A 2JE9A 5DUXA 1R091 1K5JA 2BRTA 1H4GA 1WBLA 1VJ2A 2P3KA 4L9BA 1BKZA 1DZQA 1UU4A 5EFUA 4OQ9A 3UETA 1DGRA 1UAIA 4ATEA 4QDSA 4ZXKA 2ERFA 4LE3A 3N9MA 3WDTA 2XVKA 4IE4A 1WLWA 1C5IA 4XQWA 4CA9A 2ADDA 4UFHA 3T2TA 4XJUA 1UZWA 2XG3A 4KBBA 4D8MA 2D43A 3AXDA 2HWC2 2YDEA 3D0SA 3DXTA 2XVLA 1RUE3 1UMZA 5F5CA 3UGGA 2JB4A 2VU9A 4RHV3 1VBB1 2CDPA 3LAGA 5BNPC 5IFTA 2V5DA 1LTEA 4QX8A 3DPRC 4S2HA 3A23A 4LHNA 5CVRA 1AR73 3ZPOA 4LO5B 3RDIA 3N35A 4Q5OA 1O3QA 3OEAA 3ZDSA 2PLV3 1YI7A 4YGBA 4YVSB 2K0GA 1ZBA2 2QBXA 1RUD3 3EBRA 4NHKA 2WZEA 2ZGKA 2NN8A 1PO13 4QXCA 1R1A1 2XJTA 3N7KA 4CCNA 2YUEA 1JYTA 4BM8A 4DUWA 4Q2FA 5BYNA 1O3RA 1WW7A 1ZYBA 1V6MA 1ENXA 1SEFA 2CGOA 1LHUA 2N7GA 5J37A 2YPJA 3D8CA 2RM23 1DYOA 2PHXA 4QGNA 3LDBA 3VHOA 5CFDB 2JENA 2XLAA 3RZGA 3USSA 5FXXA 3RZMA 4ZXEA 4MHRA 4CDQB 1DYKA 3APBA 4GULA 5FR3A 1POQA 3FHAA 3S30A 5A3TA 4E8CA 1CAXB 2ADEA 4HONA 1YJKA 5CNAA 1UOJA 1GZTA 2JJ6A 3EHKA 4KU8A 4MGZE 3RRDA 3CL1A 2DVFA 3ETPA 4NPLA 3CZUA 5FDBA 3INAA 2R073 3AKPA 3I2FA 2FZ2A 4QPIA 4BQ1A 1LJ7A 1LHOA 1O4ZA 2WWJA 1OOPB 4PBPA 3J8F2 3WCRA 5FJKA 4Y5TA 2AH2A 3UESA 3DF0A 2XJUA 1CZTA 2YPDA 2WDBA 5FZKA 2WFPA 2YGMA 1COV3 2XOMA 4FP2A 4FFGA 3H9AA 4HMZA 1HV1A 3NJYA 3SISA 1RVF1 3FWEA 4C91A 5IVVA 1OMIA 4G3YC 4CXXA 4EQVA 2ZGMA 1J84A 2YU1A 2XL7A 2P1BA 5I0RA 3T0DA 4C0BA 2OXBA 1I6XA 1H2MA 4AEJA 1UQXA 2VY0A 4QXKA 4XMAA 3ZXFA 2VXJA 1RUOA 4NJ4A 3UKNA 4LBJA 4CDUC 1URXA 2BBAA 2UY9A 4M0HA 2DVAA 4AHZA 3B00A 1NCRC 4K21A 3UNPA 5CISA 3MF6A 3GZTB 3DCQA 2BGOA 3PIJA 3POJA 4BIFA 2NP0A 4Z07A 4NHLA 4X6RB 5FREA 3M2MA 1PK6C 2DFCA 4LTAA 4BA6A 4MADA 1KRIA 3ZFGA 3VBRC 1UOGA 4H14A 3IAQA 4NHXA 4YM2A 5JXIA 3GBFA 1U5YA 2O14A 2WS92 1BXHA 4XUQA 3BALA 1ZA4A 1OI6A 3RYKA 5I0DA 3KHCA 2BEOA 5FWEA 4DIQA 5KC6A 4RR3A 2ZX2A 3WNXA 1BEV2 1NZIA 2QDRA 3CKHA 2YBPA 3H3ZA 2HWC3 4LBQB 5BNQA 5C4WC 1C8NA 4I3GA 4IESA 1VPHA 3WP5A 1UY2A 4CEWA 2R061 2RS51 3VBHB 3F95A 3AX4A 1UO9A 4QM9A 5EWSA 5FZFA 5FPBA 2PAEA 5EXOA 1WD4A 3ZSMA 4D94A 1Y9QA 2BZDA 2OA2A 3JBG3 5JAXA 4Q4W2 4CEYA 2O1QA 2QNKA 2TEPA 3HIFA 4MLOA 2O8QA 3NJVA 2NQYA 3ZYGA 4XDOA 1ZBA3 1QQP1 1CPNA 3ZN6B 2D5HA
chains in the Genus database with same CATH topology
1GZWB 2XJVA 4RS5B 2OYZA 1PO23 3OTFA 1HRI2 1S0FA 1HRV2 3O0XA 2DCTA 3RI9A 3VDDB 4PQ9A 5C8WA 3HBZA 5KWRA 2VQAA 1FPN2 1LGBA 2KXLA 4AEDC 1WW6A 4IV3C 5BV6A 5CBLA 1VB2A 1QJY3 4B29A 1ZNPA 5D8AC 1RUJ1 3CF6E 2VXRA 3IWZA 1TMF1 1GZ9A 2D40A 4Q4Y1 1IQAA 1AYM1 3H50A 5CFCA 3V0AB 1LKNA 1VBE2 3LGRA 4MUVA 1QOSA 1O91A 4P9WA 3VBSC 4P9JA 3ZIWA 2R1BA 5AVAA 2ARBA 1GYKA 2XJQA 4GB31 1BYHA 5KHJA 4IEOA 5BNNB 4KH9A 2RR11 4YVWB 2QUOA 4Y24A 3O12A 1LU1A 1YFXA 4HKLA 2VOKA 1BCXA 1KDMA 4QQHA 3MW3A 3WDWA 5JOXA 1K5MB 4JV4A 4Q4V1 4L99A 1AYN2 4R52A 1VAMA 2WNUB 4E2QA 3POWA 1SDWA 1AF9A 3WD5A 3OGGA 1YJLA 4QU2A 3SITA 1GV9A 3A4UA 4HSJA 1SLTA 2VGDA 3N36A 4AHWA 2GN3A 1REFA 3HN1A 3I59A 1UU6A 5AC91 1H8TB 5K9YA 2WSVA 5JR7B 1DGWA 1BEV3 3VLBB 4Y22B 4JRAA 4M3CF 5DG2A 1LOGA 2Z79A 1KS5A 3OJBA 3AYDA 1JN2P 5CA6A 3H1MA 5GLVA 1FOD1 1Z7S1 3Q9OA 3SLIA 3VZOA 4CDWA 5DUWA 1ZZ9A 1QJU2 4WM8A 1RUG3 4Q4W3 1C8M1 5BNPB 1S0JA 2YV8A 4QQLA 1VB4A 4AE2A 3DPRB 3AJYA 5J09A 2BQPA 2R041 2B45X 4QPIC 3I8TA 2HWB2 1LRHA 2A3XA 4NN0A 4XJWA 2RS11 4I0BA 3SCFA 2X5IB 2OW4A 1NCQB 4AFDA 1FPN3 1G8WA 3N7JA 3MI8A 1G9BA 2XLFA 5BPXA 1KFUL 5J96B 4XQ4A 1RUI1 1PM7A 2PYTA 3M4FA 3WOGA 1CAVB 2DURA 4MVTA 4Z82A 1MZFA 1EPZA 3MIDA 4I0WB 3AP4A 4MXWA 1CPMA 3LOIA 2ZGPA 4XETA 1ND2A 4Q27A 1JW6A 4FSJA 1VBE3 2XVGA 1FT9A 2BVVA 2PHUA 1R083 4PDWA 1ND3A 3RNSA 1U12A 1N1SA 4HVOA 1RIRA 4QGMA 1YNAA 1C1LA 4BLIA 4LBMA 1RHI1 1S0GA 2QQPA 3GZUC 3HT1A 2ZS6B 4Y26A 1OPMA 4I09A 4PF5A 5FO7B 5C33A 2CNAA 1NOVA 3WCSA 4Y1XA 2WKKA 1RC6A 3BOPA 2QE3A 5J7MA 4LA3A 2AUYA 4K3UA 4SLIA 1B35A 3AP5A 4YG6A 2R49A 4AQ6A 1AYN3 4S2DA 3OBRA 4YW3A 3WDYA 3RS6A 1SCRA 1J3QA 2ZMLA 3FHIB 2HEWF 4JC1A 4WVVA 4HETA 2IWGB 3MW4A 3EO6A 1A78A 1KS4A 4KL1A 5E8AA 1AL21 2HWE1 1IKQA 1EP0A 4AFAA 3MYXA 5DZFA 1BMV1 4YG0A 3AMMA 4B4RA 2Z69A 1YIFA 3O14A 1JYIA 4OI0A 2WT0A 4JGZC 3P3NA 3M3OA 1DQ6A 4Q0VA 4LLOA 2QCSB 2PQQA 4AG4A 5KXDA 1AR82 1C57A 4FPJA 1Q8PA 3I2DA 2ATFA 4EWAA 1ZZ7A 1ENSA 3AMHA 4BYYA 2ILMA 1QJU3 3B9CA 5C4WB 1GSLA 3MDPA 4IV1A 1HQLA 3OY8A 1TME1 5CFCC 3FFQA 3E5UA 4F3JA 1FMD2 1WLCA 1RUF1 1EAH2 2B42B 1J59A 1U0AA 2HWB3 2K9ZA 2QKDA 3USUA 4D7SA 4DNYA 1EV11 2DV9A 2EVXA 4M3CE 1QJX3 1O5LA 3LA2A 2EF6A 2HWD1 3S7IA 2WNVA 2ZGUA 1QKQA 1G6NA 1UPIA 3AKQA 4K7JA 2R0FA 4JDMA 2YHJA 5CIRA 1OA3A 2E63A 4META 1JHNA 3I4IA 5C6CA 2SLIA 2X29A 4FBFA 3ZYPA 2D7FA 4AEDB 3M3CA 1NZCA 3PVBB 3TOJA 5I8SA 3ZXDA 1ZZCA 4BHPA 1PIV2 4QD2A 5I0TA 5I91A 5DDJ3 1PGL1 2NM1A 4YW2A 2Q30A 1B09A 1W2UA 5LRRA 2HWF1 1NA1A 5H9PA 5K0UA 3VBSB 3O0VA 4ZKTB 4Q4X2 4YZ4A 2Z5WA 4P9GA 1N1YA 2OUJA 2W68A 2DYCA 1DYPA 4O9EA 1LECA 3KCCA 2H0BA 1LHVA 4Q0PA 1H2LA 4CDWC 2QDNA 2E7AA 4K6BA 2XBO3 5FLJA 3WV6A 4WM8C 4GMP1 5F9TA 4MZUA 4HKOA 4XFFA 4RL7A 1OLRA 1MEC2 1DLLA 4LO4B 4N53A 2DVDA 1X7NA 1QWRA 1Q8OA 3E5XA 2DVBA 4OHZA 3ETQA 2OZ6A 5GZDA 2RJKA 2XLGA 1HQNA 1QGLA 2BVBA 2PAMA 1N1VA 4L97A 1RMU3 1V9U1 2CYFA 3CJIB 1SLCA 3LWCA 4GKXA 1U5XA 1QH6A 1AR83 5LK5A 3AMQA 1MR5A 1LOFC 2GNTA 1S0BA 3U0ZA 1CGPA 2ZGOA 2FZ1A 1ND2C 1LCLA 3U07A 1WMFA 1IS6A 1SFYA 2BUKA 2EXIA 5ACA1 4XBNA 2JXAA 4ASMB 1EAH3 2BNMA 3QH6A 1AR61 4PDWC 4I30A 1AXKA 1ZVFA 2DU0A 1ND3C 3V56A 2EXHA 4XIOA 1MS9A 1IPJA 2FQPA 1RUH1 1IKPA 2EXKA 1CJPA 1ZBE2 4NO4A 5JZGA 3MPBA 4JGYC 2LM3A 2ZZJA 4URTA 2CWMA 2AREA 3U11A 1B35C 4NWVA 1YIPA 1NYWA 3KCXA 2DCYA 4CYDA 1REEA 1XXNA 3HT2A 5JIUA 1HW5A 2PTMA 1S0DA 3E6BA 4X8PA 2HEYF 1HXS2 1BQPA 1TQ5A 4Q26A 1PIV3 3PVNA 4FXGB 4AQSA 3DN7A 1DHKB 4G9SB 1FAYA 1SLLA 4P9YA 4LHLA 1IGOA 5CAZA 3NW4A 1QNYA 1WMEA 4FPCA 1UPSA 1PGSA 3UK9A 2MHFA 1R092 3J26N 4NOTA 3ZYJB 1QY4A 2ZGQA 4LUKA 2WIIB 3AP6A 2XHKA 1VBA1 2XB6C 3VL9A 4F83A 1EYBA 1LOEA 2BFUS 1DBNA 2OUHA 4HKWA 2JDZA 4YW4A 2UYBA 1RUE2 4YFWA 1A3KA 1OA4A 1IS5A 3RYPA 5T5JA 4ZU4A 3M7AA 4RHV2 4ES8A 4PIZA 3IPVA 1MQTA 4E4DX 4HN1A 3PMSA 3MW2A 2AENA 1AR72 3WW3A 2Q5TA 4IV1C 1V6OA 4GALA 3VBFB 2NZ9A 3OYWA 1LHNA 5GJ6A 1MEC3 2PLV2 1W6MB 1H0BA 2WZPP 1IS4A 1RUC1 4LO6B 4PIXA 3L2HA 4GH4B 3DL3A 3M70A 5JIAA 4A3XA 5SV5A 2WNVC 2XL9A 3ELNA 3RZZA 1V6KA 2RM22 4TZDA 2WQZC 4WM7C 1W6NB 4JGZB 1G7YA 2R0HA 2WJSA 4OUMA 2ZOEB 1JH5A 1NE4A 1NXD1 4ZU7A 1AHSA 5CG8A 1HV0A 3M3QA 5JMCA 4QPGA 1UD1A 2R072 3UJOA 1LGCA 4QQ2A 1DIWA 1FV3A 2WA4A 5FFOC 4COZA 3NAPA 2Q8OA 5T5LA 3VKNA 4FOVA 2RMU1 4R4XA 3JQWA 4LBLA 1NA1C 4DY5A 3N4MA 1TE1B 5DUUA 1ZBE3 3IT8A 1COV2 4BPZA 4B4QA 2WFF1 3M8LA 3RMYA 2VMHA 1F9KA 3ZN5A 2QFEA 2VPVA 5HI0A 2BW8A 3QH7A 2JG8A 2WQ4A 4JDOA 3ZFFC 1H1AA 3TBDA 3WW1A 1UU5A 2ZX0A 3O7OA 1WLTA 1HXS3 2VW0A 5GALA 2XJRA 4FOYA 4IEPA 4M01A 1N3OA 4M3CB 2CAVA 2QZ2A 4RSUA 1PNFA 4N53C 4UW6A 2RE9A 4IEXA 4WVMA 1MS3A 2Z2SB 3KS7A 2GH2A 5IK4A 1R093 4LNVA 2JG9A 4XF9A 3CEWA 4AK3A 3K51A 5A3MA 4Y20A 1RUNA 3TN91 2VUAA 1GKBA 2WNEA 1DDLA 5D1IA 3P3PA 1W0OA 4Q0SA 5L7OA 3JBG2 4HBNA 3ZFEA 1APNA 4COWA 3E6CC 2AYHA 2G9GA 3VBUC 2GMMA 5ABJC 1SLAA 1PGW1 2WLQA 1NQDA 3LB9A 5DZGA 4N7UA 5JPMB 1PO22 3U10A 1VLNA 1ENRA 2ZX4A 4N90A 1QQP2 1RUD1 2JKBA 4H3WA 1PO11 3ZSJA 1UX6A 1QJY2 1OPOA 1VBD1 3LZZA 4IQPA 2IZWA 2D98A 2IXIA 3ECQA 1KDKA 5BXXA 1RITA 2DVGA 3ZPYA 2Y0OA 4L11A 4ZU5A 4XFAA 4LR4A 3VGIA 4DB5A 1RUJ2 3VBOB 4R9DA 4DFSA 2C5DA 4LBOA 3SXWA 4MSVA 1AYM2 3LKJA 4OULA 4I01A 1XYOA 2X53S 5FQ0B 1LESA 4YARA 4XF1A 3ATGA 4N43C 1XNKA 5J48A 3AZYA 1ZRFA 3WDXA 2PFWA 4MYEA 1VBC1 4F8AA 2ZCWA 3JD71 3WHTA 4CTEA 3MIGA 5A3LA 1BBT1 3TB0A 3KSCA 5C9AB 2G9FA 2IC1A 3R4DB 2RR12 4JGYB 2YMZA 5BUVA 5GM0A 4R8HA 1RVF3 5KHIA 3X29B 4YZ5A 3U4XA 3IKWA 3RJRA 4LO8A 4YGCA 1POV1 1SBDA 1W39A 1O7FA 1WBFA 1G9CA 4WVWA 1PNGA 1W6PA 1S2BA 1OHFA 4HLTA 1ZRDA 2DCZA 4KU7A 4WZFA 5A33B 1JUIA 1Q5OA 2CTVA 3RWNA 4G4FA 4AGRA 4FPLA 2ZX1A 1X50A 3RG0A 2IXHA 3AYAA 1RL3A 5KXBA 3VUOA 3WR0A 2HWC1 1RUG2 2EALA 4H7MA 3WUCA 2R063 3D6EA 4P5HA 2RS53 2D6LX 4AGGA 4H7LA 4IV1B 2WT2A 3ASIA 4IEUA 3NAPC 1KFXL 2GALA 4XTMA 1W6QB 1CJDA 1DQ1A 4COYA 1C8M2 3OBTA 5C8CA 1LULA 4ORFA 1QQP3 3AZZA 1GQHA 2R042 3MLLA 5KXCA 3NV2A 1ULCA 2DTWA 5I93A 2VG9A 3WHUA 1GQGA 3AFKA 4RQPB 1L3JA 2R16A 4ISQA 5BNOC 4WM7B 3M3EA 3AYEA 4IEVA 3VN4A 3QBQA 5A32B 1RUJ3 2W08A 5I0UA 4EJRA 3OD0A 1JUHA 4N9HA 1R082 5H9RA 4H55A 3ROUA 2Q4SA 4HFSA 4Q4Y3 2OZJA 4V1PA 3ALQA 1AYM3 1YFWA 4HPKB 2ZMNA 1I5ZA 2MNGA 1LODA 2ZZQA 4YNIA 4KG8A 2H0VA 4KGQA 4NWWA 4LEJA 1NA1B 3J8F1 3ME2A 4GB33 5DUVA 4YSFA 3AFGA 2RR13 1C1FA 5LEKA 1MS8A 3V0BA 3R4SA 3K48A 2CWSA 4PLMA 3ZFFB 1QXPA 3AZVA 2V73A 1TNFA 1IHMA 3MEPA 4XTPA 2JEMA 1WCSA 5T5PA 1AUYA 1CAUB 3ENRA 5KHKA 4AI0A 4FVVA 2NMNA 4K9SA 1W6OA 5FLIA 2F4PA 2E7QA 4Q8LA 3WP3A 3MIEA 4FTSA 4QPYA 3WQ7A 1S55A 1BMV2 5AC93 2WS91 4KWKA 2A3WA 1VRH1 3FUQA 2IXKA 3IDCB 2GC0A 4BMBA 2E7TA 1DZRA 2MEV1 1BVP1 2D6OX 4LA2A 4Q0UA 2PHRA 2WA3A 3IBMA 1LHWA 1Z7S3 3FLPA 2P3IA 4JQRA 3WDUA 3N7LA 2XH6A 2W0XA 5E89A 4PLNA 4Q4W1 1XYPA 2XJSA 4HSLA 3VBUB 1C8M3 5ABJB 1LU2A 1TME2 4EN9B 4R9AA 3CLPA 5GLTA 4HN0A 3ZX7A 2A70A 1QJX2 4E2SA 3DKWA 1SLBA 1RUF2 2R043 4FT8A 2ET1A 2NMOA 5HBAA 4YVSA 3KD4A 5FTTC 2A7AA 5F6KA 1ZRRA 3WLUA 2ZHLA 1H9PA 2UWCA 1HRI1 1MZ6A 4GWMA 4W65A 1HRV1 5I0SA 2B8MA 5DG1A 1N3QA 5FRAA 2HWD2 4B7EA 3UV9A 1RGSA 5T52A 1S0IA 3RQ0A 3QACA 1V6NA 2PHDA 3L9JT 3I7DA 3NV1A 1BVVA 3H7JA 5CFDA 5DDJ2 2YYOA 3A0NA 2R30A 4QMAA 4CDQA 1Q8QA 1AX1A 3ZFGC 1CAXA 5FMOL 2ZA9A 1CESA 4EV0A 4RR3C 1Q43A 1NXMA 4FPFA 4CP0A 3R05A 1GFF2 4AEMA 1RHI3 3E97A 2HWF2 1OOPA 1TEIA 4CEWC 3T1LA 4JRLA 3WUDA 2YC0A 1WGPA 4N43B 3WG3A 4C90A 3O0WA 4TYSA 2XBO2 2I2SA 4CEYC 3KB5A 4YZ2A 3NSTA 1XU1A 2BPA2 5JWPA 3J9SA 4CDUB 4QM8A 3OYWB 1NCRB 5IK7A 2ZBJA 3IN9A 2E9QA 3ZMNA 3N3HA 3RSJA 2SBAA 1AXYA 5FOBB 4AVAA 1PK6B 5FBZA 2FBEA 1XNDA 2HWE3 3VBRB 2VQ0A 1RMU2 3VL8A 4Q0QA 3ZXEA 4K1ZA 2GZWA 4OVEA 3VZKA 1Y43B 2Y26A 2BNNA 3IIAA 1MACA 1D2QA 2K2SA 2ZKNA 3M3IA 4M0NA 1KJLA 4RGAA 4DY3A 3WY6A 2IFRA 3PJQA 2IXLA 2A6ZA 2P3JA 4LBQA 3OCPA 2PHFA 4K1YA 1AJKA 3I54A 3NJZA 3VBHA 5JSRA 3WINE 1QJU1 1NLRA 4YRDA 1TME3 1WMDA 3AP9A 5ACA2 1I9RA 3FUOA 3VKFC 3ZSEA 4XPVA 1RUF3 2R6QA 1G9AA 3R0RA 4B4PA 2I45A 1C3HA 2HWB1 1SBFA 3ZN6A 1QXRA 1EV13 1GZWA 3KT4A 3M1HA 2A6WA 1UIJA 2GC1A 4RS5A 3GF6A 4YYOA 5H9SA 2HWD3 2A3YA 4JCKA 1Y3TA 4HT1T 4IV3B 1UKRA 2GNDA 3VDDA 1NY72 2EIGA 5D8AB 3AB0A 3TNQA 3W9AA 4FQ4A 1OQDA 5L36A 1PVC1 2I74A 5BNOB 2ZX3A 4XYXA 2CGNA 5GZCA 2H6BA 2GSYA 3JB8A 2BGCA 2ENRA 4KWLA 4D7TA 1CAWB 2VNOA 3THPA 1EY2A 5JOYA 3V0AA 2FMDA 2MPFA 3GHMA 1SQ4A 3EJKA 4XQDA 5JVVA 2LALA 4OHWA 2FMYA 1UKGA 3MIFA 3EQEA 4NVPA 4FPYA 1YCIA 2HWF3 4QGLA 5I8YA 1MS1A 3AYCA 3T1MA 4YGEA 5EV7A 3W59A 3AP7A 1XQNA 1QMJA 3FBMA 5BNNA 5FPZA 2D97A 3BPZA 4AYUA 5JOZA 1FATA 4YVWA 2ZMKA 1J3RA 3W58A 1ULFA 1V70A 4AHYA 1F8VA 1D2SA 1LEDA 3JCIA 2P34A 4HK8A 4L2NA 2DFBA 3DGTA 1K5MA 2C0ZA 4GMP3 3MLKA 1X82A 2X8KA 4KG0A 2VW2A 2WNUA 4K8FA 4Z1VA 3B69A 1AX0A 1AX2A 4YG3A 5FCCA 4DOUA 1YLLA 4S2FA 5L73A 1FV2A 4QQOA 2XKPA 1H4HA 4LE4A 1HKDA 1LEMA 3OD4A 5GLZA 2PHLA 1H8TA 1SMVA 1MVQA 3ZO0B 1OFNA 4Y22A 1XNBA 1S0CA 1KD7A 1AR81 2KA3A 4FPEA 4KWJA 2VUJA 5CFDC 2VMGA 1D0GA 3AMNA 1EPWA 4CDQC 4XFCA 4MH0E 2WLPA 5ACA3 4BE3A 4TLFA 1FMD1 5BNPA 4QPIB 1ZX5A 1EAH1 1AR92 1AR63 3SCHA 3DPRA 3GBGA 3WP4A 4LULA 1MS0A 2CY6A 1R1ZA 2DCKA 5AVPA 4FO9A 2Q1MA 1SBEA 1OOPC 1GLHA 1RUH3 4XXAA 2WZR2 4OFGA 2X5IA 1F2NA 1VIWB 1GANA 1VAVA 1NCQA 4INDA 3S0MA 1Q56A 2DUOA 5KHGA 4FPHA 1U5ZA 2CV6A 1DGWX 1O5UA 2BWAA 1H1IA 4DINB 3KLSA 4UBGA 1D4M1 4LBQD 1ASJ1 1H30A 3WQ0A 1CAVA 2VW1A 1XYNA 4YM0A 1RB8G 3MF9A 3ES1A 1LENA 3B02A 3ZFGB 3A0KA 3WG4A 4DMIA 1CD3G 1GZCA 1NQJA 5IK8A 5EZWA 4RR3B 4E9KA 2TNFA 5FO9B 3FJSA 4Q4X1 1X8MA 4RA0A 3UKTA 1WD3A 3BCWA 5CADA 4CEWB 2XGXA 4XEZA 1PZ8A 4HK9A 1HLCA 4UW5A 4XFBA 1AZDA 3KT7A 1YFYA 1VBB2 5E1RA 1WA4A 2PELA 4CEYB 2E53A 2GDFA 3WT3A 4C0HA 1H2NA 4R9BA 2A71A 5JI7A 2RS31 1LOCA 3AXEA 1MEC1 1C28A 1S0EA 2B39A 1V6JA 2UY8A 4IEWA 1R1A2 1VALA 4XFGA 3FLRA 5B2GB 4XMIA 3WG2A 2HJIA 1ULDA 3G6JB 4LBNA 2EAAA 2IXJA 1QF3A 4XOGA 3NV4A 1H8VA 1S1AA 4Z2WA 3H0OA 1OKQA 3VDDC 1FX5A 2GNBA 1JBCA 2Z42A 1UF2C 1VBD2 1DU3D 3D4KA 2VOWA 4CP1A 1YO8A 1UZYA 3LSDA 5CFCB 2ES3A 5LEJA 3FFZA 5C4WA 5SV8A 4MGKE 5F5QA 1N1TA 2E51A 5K0UC 3H7YA 1QXJA 3CO2A 1AR93 2ZGRA 1QJZA 4YFZA 4YW1A 1KITA 2D3RA 3KZ4C 2RMU3 3ZXKA 2GC2A 3BODA 3S7EA 2HEVF 3VZMA 4K40A 2WZR3 1H9WA 1OQEA 2ZAAA 5JCTA 1ZBE1 1ZREA 4AWDA 4NR1A 4YVWC 5EJ3A 2WFF3 1RVF2 4B3NA 1VBC2 1JOJA 3VZJA 2OPKA 3IDBB 1BBT2 3WX5A 3ES4A 4LO7A 4AEDA 3RI8A 4HZFA 1M06G 2DTYA 4CDXA 2AR6A 4DQAA 3JUUA 4XF4A 3LA7A 1AXZA 4EROA 2WNUC 4AFBA 1PMIA 4PCRA 4AGVA 1O3TA 5T55A 1FNZA 4EN6B 1WW5A 2GMEA 3I59B 1H1MA 3ACLA 3H8UA 2PHTA 1FI2A 1UL9A 3B93A 2W39A 5FAXA 4Y1VA 1GBGA 1KJRA 1H8TC 3VBSA 4E27A 4OHVA 2E6VA 3PVOA 2H6CA 2CGPA 1CIWA 1V6LA 2VNGA 1SACA 1PVXA 2RJLA 1NG0A 4GXLA 3TN93 3WQ1A 3ILNA 5LK7B 2EAKA 1RUE1 1WCKA 2V09A 2VOVA 2PHWA 4CDWB 1G9FA 2R062 4J1WA 2RS52 1VBB3 4RHV1 4WM8B 1AR71 3NKGA 1Z0HA 4Q8KA 1O4TA 1AJOA 4ATFA 1I1EA 2PLV1 3UJQA 2BNOA 4R9CA 2GH8A 3GHNA 3VKMA 2A73B 1R1A3 3FBYA 1G9DA 4X8NA 5JZGC 3VKOA 4S2GA 1DQ0A 2VVFA 5T3NA 5GZGA 2GMPA 2X5IC 4XZPA 1NCQC 2RM21 1MZ5A 4YZ3A 4BZ4A 4GQ7A 2UWAA 1XE7A 2ZTNA 3CJIA 1VBD3 4ONUA 4MXWB 3TNPB 4Z92B 4IETA 5GZEA 1TMF2 4AI2A 3NWKA 4I02A 4FAHA 1ND2B 4J6GA 5F1RA 4MX3A 4Q4Y2 3ZVXA 1F31A 1CVNA 3DUIA 4PDWB 1CX4A 4YM1A 1ND3B 1QU0A 2R071 1DQ5A 3MLJA 4COVA 1OQ1A 3B01A 4I2OA 5JI9A 4GB32 3B5LB 2Y0IA 1ULGA 4SBVA 3SH4A 1MQTC 1COV1 3MIHA 1LOAA 2VOXA 3WZ1A 4CRQA 3KCYA 1YHFA 1ZM1A 4JTOA 4WZCA 3V65A 1B35B 4AI8A 1VBC3 5FOJB 3JD73 4OI4A 1TNRA 1NE6A 3AZXA 1GNZA 1BBT3 1UIKA 4Q4V2 1JYCA 2XWJB 2R32A 2Y38A 4PBOA 2ZKLA 3MIBA 2EA7A 3DV8A 5CG9A 3E5QA 3POYA 1POV3 4XF3A 1O4YA 4Z8BA 4AVSA 3ZSKA 1Z78A 5AC92 1XU2A 1G86A 2QZ3A 3TWIA 4OZXA 1WUVA 4PLOA 5GLWA 4XFIA 2G4IA 4XFHA 3EXUA 2XWBB 4UXAA 4KNCA 2PA7A 4AVCA 4Y5Z0 4XE9A 4FP3A 1LR5A 2DUPA 4GKYA 4QPGC 1FOD2 1VRH2 1Z7S2 3QLQA 3OY8B 5AFEA 5IUQA 3JBG1 2MEV2 5HCFA 4OI1A 2D6KA 1PHMA 4LT5A 2HKXA 1ZBA1 1YI9A 3VBFA 3MPPG 3USUB 3D82A 2VVEA 1F5JA 1W6MA 2JICA 4GIQA 4EN8B 3ZMOA 1A8DA 1CONA 4I0AA 5KBFA 1PO21 2RS12 3VHPA 2WNVB 3QD6A 3TYJA 1HDKA 4GH4A 2JG8C 3OGJA 1E57A 2DCJA 4GWNA 5GKAC 4DS0A 1QOOA 2LUWA 4D7YA 4W6YA 1QJY1 1RUI2 5F6LB 4AW7A 4BLJA 3E6DA 1TMF3 1X8EA 1W6NA 1JTZX 4JGZA 3ZYRA 3R4UA 4HL0A 4JTNA 4CDXC 4ASLA 1BK1A 3FZ3A 3SCGA 4AVVA 2JG9C 1BZWA 3UKVA 1T6GC 2WC2A 5BY5A 3ST7A 5K0UB 4YGDA 1OSGA 1RHI2 1J1LA 1QNWA 4EN0A 5L19A 2ZHKA 1PZ7A 5L7OC 4QQPA 4WBBA 4JAAA 5JSPA 3ZFEC 2WWSA 3J8F3 3ZXAC 2D5FA 1QH7A 4Q4V3 1NLSA 4A7KA 1JXNA 2VVDA 4A2UA 4XJZA 4JVAA 5E16A 4XDQA 2XKOA 3AMPA 3VHRA 4N53B 1DZTA 1YUDA 2F6BA 4XHXA 2O0OA 5IT6A 3THTA 1AL22 4M3CA 2HWE2 4IEYA 2JD4A 4BH9A 4MV2A 4AHXA 5DXDA 4W6XA 4FCAA 3MZHA 1FNYA 4BCUA 5FPXA 5KXEA 4A7YA 2JE7A 4BWOA 2PAKA 3HR9A 1BEV1 2CL2A 2DWRA 3C2UA 1HIXA 2DU1A 1RTVA 2BTVC 2WS93 3VV1A 3CJIC 1FOD3 1VRH3 3GALA 4FPOB 4RGGA 1UW8A 4XJ8A 4ISRA 2ZAHA 1DFQA 4R4ZA 5J98B 4IXLA 2MEV3 1RUG1 2B9UA 2GN7A 4L8QA 4N7IA 4O9GA 2R1DA 5CU1A 3WW2A 3ZXLA 4DXZA 3S6PA 2DF7A 1IPKA 4GMP0 1DG6A 4QX5A 5FLHA 5TSWA 1HX6A 1IS3A 4FTBA 3LSEA 3CNAA 1EV12 2WL1A 2RS13 1ZZ6A 1V00A 2WINB 2B46X 5JZGB 3IMNA 2XUMA 3BTAA 4AI1A 1FPN1 1MS4A 2ARXA 1HRI3 3OPZA 1HRV3 1RUI3 2GC3A 1BJQA 4AXOA 1UZZA 1I3HA 1A6CA 3C3VA 2ZPXA 3ZXGA 1XRUA 4FXKB 3VHNA 1VBE1 1REDA 1PVC2 4OLLA 3GYDA 2Q1ZB 1LOFA 2JX9A 3CJXA 1R081 2ZHMA 1X33A 3TAYA 1PGL2 3VBOA 3TRSB 3ZIXA 3MFCA 5T5OA 4OHXA 2VH9A 2PN5A 4C1XA 3BOWA 4TSVA 4EN7B 4UBHA 2KM2A 4B8EA 3RYRA 4BMEA 3AKTA 3NL1A 4YM3A 5LRSA 5FQ0A 4QT6A 2XPJA 5FMOS 4Q1RA 2ZJCA 3WG1A 1D0HA 3IPVB 4IL7A 1MQTB 3NKTA 4Y1UA 1AYN1 1V6IA 4IERA 4F7ZA 3L2YA 5C9AA 1ENQA 3SHRA 4N9IA 3GNEA 4JGYA 2FHRA 4DRVA 3O5SA 1SLIA 5C8CC 2VULA 1VAKA 3RMXA 3VBFC 4COUA 2IFWA 1AL23 5KHHA 4LLFA 2YROA 1YWKA 4P9LA 4LHKA 3IM0A 2QVSB 4P9XA 1XNCA 4GH4C 4OHYA 5DZEA 1AL0G 1V9U2 5CB7A 5K8SA 2BBVA 2ET7A 2UU8A 3JQXA 5A33A 3BU7A 1UCXA 3D5OA 4K20A 2OVUA 5IK5A 4YLZA 4XILA 3SH3A 3PHMA 1J58A 4QPGB 1MZEA 3AZWA 4U36A 3HAGA 4U2AA 5J3UA 2VNRA 3URFA 3ZSLA 3NAPB 4UW3A 2WT1A 2A6YA 1AR62 3RJ2X 5K7PA 1DQ4A 3B9IA 3OF1A 1KXGA 4MGIE 4WV8A 1D4VB 3SNMA 3KT1A 4LUMA 1W6QA 4E2GA 2CAUA 1SFNA 1C4RA 1QJX1 3ZN4A 4MXVA 3AM2A 1Q8SA 1RUH2 4HVQA 4J1XA