3NKLA

Crystal structure of udp-d-quinovosamine 4-dehydrogenase from vibrio fischeri
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
122
structure length
122
Chain Sequence
AKKKVLIYGAGSAGLQLANMLRQGKEFHPIAFIDDDRKKHKTTMQGITIYRPKYLERLIKKHCISTVLLAVPSASQVQKKVIIESLAKLHVEVLTIPNLDDLVNGKLSIGQLKEVSIDDLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UDP-D-Quinovosamine 4-Dehydrogenase from Vibrio fischeri
rcsb
source organism Vibrio fischeri
molecule tags Oxidoreductase/lyase
molecule keywords UDP-D-quinovosamine 4-dehydrogenase
total genus 40
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2010-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nklA00
4CV1A 4DXHA 5J23A 1A72A 2YQ5A 4RZIA 2VRCA 3BMOA 1LQTA 2J3IA 4QX6A 5ILGA 5EINA 3RC9A 3P19A 2VUUA 3BMNB 5EQFA 1YB5A 4FW8A 1S6YA 3P2YA 1UAYA 3NAQA 3AI2A 3PYXA 3JD4A 3ZDFA 3MOGA 4OM8A 3I4FA 4NZ9A 2JL1A 4RPGA 4H16A 5FF9A 4XKJA 2J3HA 4N7RA 4D45A 2C5EA 4FJ2A 1NR7A 4XEHA 1H93A 1LI4A 3GFBA 1UP6A 5BSFA 2DFVA 3NT4A 2X23A 4D79A 2I99A 3H2ZA 1LDYA 1UP4A 1MLDA 3DMTC 4BIIA 4WLNA 1U7TA 2AEMA 4YXFA 1B0AA 1NQAO 1RM4A 4ZICA 1YH3A 1ADGA 5L4SA 4HWKA 8ADHA 3HZZA 4KP7A 3O38A 4YJGB 3KSUA 4R41A 1VSVA 5C37A 3BTUA 3M2PA 2JFHA 4E6PA 1VPDA 4HFJA 3V1TC 3I83A 2D5AA 1UZMA 2VTDA 3QVWA 1JLLA 1PJ4A 2FPIA 1OI7A 4MKZA 4K6FA 3F3SA 4LRSB 3VPXA 3JQFA 3UHAA 3QWFA 4TSKA 1LC3A 5HM8A 2O3QA 4TZKA 1C14A 4Q3NA 1DIBA 3LU1A 1HE4A 2ZYAA 2YQ4A 1QG6A 1V6AA 5A4DA 2IODA 1CERA 1GDHA 3AUUA 2POQX 4YR9A 4D41A 1N7GA 2EIHA 3Q11A 5L9AA 1PWZA 1XIVA 4WPGA 1E5LA 3GAZA 3GRPA 4YQZA 4R68A 1BMDA 2BMAA 2GN6A 4WASA 2AXQA 5A03A 3CE6A 4J16A 2CDBA 2BFOA 4WCFA 2J5RA 3E82A 5CDYA 3OETA 4NFYA 1YL5A 5JDCC 2V6GA 1HYEA 4IDDA 1IULA 4N18A 5JLAA 2PA3A 3GNTA 4WNCA 3CH6A 2ZYGA 4CMHA 3RUIA 5JDIA 4ZHSA 5ER6A 3A1NA 1A9ZA 3FRJA 4R5HA 4CV3A 1MC5A 1EUDA 4TVBA 3WSWA 5AOVA 1Z6ZA 1ONOA 1A4IA 2DTEA 4P4NA 1PR9A 2DPHA 3ZW9A 3F9IA 3ITKA 1YXMA 2DQ4A 3GMSA 5TQVA 3ANLA 5KOIA 1IB6A 1QR6A 1YRLA 3HG7A 2RCYA 1LDGA 2DFDA 1Z45A 1M75A 3ITDA 3PLRA 4B3JA 4CQMA 4DTIA 4L0QA 4EJMA 4KUGA 2NU7A 1FMCA 3DDNA 5B37A 2Y1GA 3OP4A 2HRZA 3JYLA 4RPLA 3OBBA 3LDHA 3D5TA 4D3FA 4BO3A 7MDHA 3L9XA 3BIOA 3WNVA 3SEFA 2BGMA 4NFSA 5AXDA 4YRBA 4CMEA 4HBGA 1R15A 4BMSA 3M6IA 2GASA 3BMNA 4XJSA 3OJOA 3QRWA 5AYVA 4FPXA 4RVDA 1DFGA 1LX6A 1N1GA 2LDXA 5F3RA 2O3TA 4QO8A 1HRDA 4D3DA 4CMIB 4QUKA 1P9LA 4R5MA 5ES3A 3ZWNA 4MVJA 4OOEA 3TNLA 1K0UA 1WW8A 4H15A 2OP1A 1LJ8A 1ZH8A 2Q1WA 2ZB4A 1ISIA 1U1IA 1HTBA 2AE1A 1LEHA 5IF3A 3H5NA 4J4HA 2OUIA 2VOJA 4K6CA 2VYVA 1NHGA 4A0SA 4JNKA 1ISHA 3IAHA 2E82A 3UN1A 3ZWYA 4BHTA 2NWQA 2P9CA 1IOLA 1U3WA 2OO5A 3RASA 4BO4A 1JKJA 3FHLA 4UVIA 2VZ9A 3H5RA 1DLIA 3K92A 3FNEA 3WX0A 4OAQA 4BKQA 3JQGB 5ICSA 4R51A 2EGGA 4FIZA 5CDGA 3QHAA 4FGWA 1EVJA 4I1IA 1I24A 1KETA 3F4BA 2X58A 4CMGA 3KLPX 3MTGA 4WLVA 2X1HA 3KOUA 1DIHA 4CM5A 4A03A 2ZB3A 2A35A 4E2ZA 5KVSA 4KTTE 1H2HA 3GH3A 3UKOA 3VC7A 1EFLA 3D3WA 1R4NB 3WIEA 5JNLA 3RBVA 2FR8A 3FBTA 1A4UA 3DHNA 4CQLA 3NJ4A 3FCOA 2C7VA 3ZI0A 3PYLA 5I7VA 5KKAA 1E1LA 4XJTA 4B4WA 4O63O 3OIGA 3AFMA 4ONEA 3UH1A 3IJPA 5AXAA 1U5CA 3U5TA 5I9MA 1FDVA 4PLTA 1F14A 1MG0A 3GEDA 3H5AA 3E03A 2C0CA 3MJEA 4J0FA 3V2HA 3SJUA 1OFGA 4J2OA 3VTFA 2H5LA 4XQ9A 1EMDA 1D8AA 4BB5A 3WGYA 1XU7A 1T2AA 1FDWA 3HB5X 2FZEA 2Y67A 3RJ9A 2DBZA 1JW9B 3DXFA 4CPDA 3KUXA 4R9SA 4B3HA 3PWZA 3VVCA 4HKTA 4EBFA 3PJFA 3VHRA 2B0JA 1YB1A 1MB4A 2O7QA 4I9HA 1HZJA 2CUKA 5KCZA 2NACA 1Y8RA 4CR8A 4WCFB 4TWRA 3PI7A 3MOIA 1BGVA 3TZQA 3B20A 4LN1A 4AJHA 5DZSA 1YE3A 3GVHA 2C29D 2E48A 3KB6A 2OBNA 1U3UA 5DOVA 2FRDA 3JQ7A 1KVTA 4BNUA 2PR2A 3SXPA 2C54A 3GEGA 2R00C 5A05A 1KVSA 3ZV3A 5JMWA 3ASVA 3QWBA 3KTDA 5BT9A 1QYCA 2P9GA 2OFPA 1NM5A 5F1KA 1MFZA 4OMUA 2WE8A 4XWYA 4PLYA 2X4GA 1D1TA 3KHUA 3AOEA 4EJ0A 2TMGA 5C7LO 3KBOA 4MVJF 4P4LA 1NFQA 1WP4A 5L95A 4I08A 4ALIA 3RUCA 1O0SA 1RM3A 5CPBA 4CQLB 4MOWA 4IIVA 1R4NA 4WGGA 1PZFA 4GAEA 4J1TA 1BVUA 4XYLA 1EEHA 3LYLA 4IS2A 4RVHA 1IY8A 3QLJA 3FNGA 3GK3A 4B8WA 4KDFA 4YYZA 4DBZA 3EVTA 4J7UA 3MEQA 4MIOA 1PJTA 4PG4A 5DNAA 2I66A 3BYZA 5MGBA 1PTJA 2YHIB 1JVSA 4YT5A 2YW9A 1HE3A 3BMOB 4DMLA 3FTNA 4D0SA 1GU7A 3DZFA 3KM0A 2P5UA 2NQTA 4A2CA 5IJZA 2AQHA 4HV4A 1X1TA 3DC2A 4NJOA 3LLSA 1BXZA 1E5QA 1O8CA 1V3TA 4XQCA 5GY7A 3ZU4A 3ZWBA 2W4QA 3EDMA 4MVJG 2B35A 2FR1A 4PRLA 3VKUA 1SNYA 2X0JA 1BXKA 1HDRA 4MVJE 1I36A 1PX0A 4MVJH 4S3MA 5B12A 1C1DA 4UEKA 4A5OA 1D4FA 4DBVO 4IQGA 4RF5A 1R0LA 4DQVA 3RU7A 2WD7A 2QQ5A 3OFSA 2BI7A 4EUHA 1YQGA 4X54A 4I5DA 2O23A 3L6EA 3ZV5A 5TS3A 4NH4A 5JDIC 5TIIA 2DBQA 4E5PA 2HSDA 1R0SA 2JD2A 3WGHA 1ENPA 1YWGO 2D4AA 5TJHA 4RF4A 2WWRA 2BLLA 3UCXA 1PZHA 3UW3A 4CMAA 3PWKA 4TRNA 5DF1A 3T7EA 3WWZA 3FD8A 3OJ0A 3UCEA 1DSSG 2C2XA 1UDBA 1Y7TA 2IZ1A 5G4KA 1NQTA 3FWNA 5T5QA 5MDHA 4E33A 4L76A 1H6CA 4CM8A 2YUTA 1ONPA 1Q7CA 3JQ8A 4PZDA 1U7HA 4GLLA 1PL7A 4CQMB 7ADHA 4CM8B 2G0TA 4TRMA 3QVXA 5I8ZA 2J6IA 5I9NA 4BQPA 3ANMA 1R0KA 1L1FA 3OJLA 3I4CA 3TRIA 4UUOA 5FYDA 5H81A 1XEAA 3VH3A 5EESA 2DUWA 3FF4A 4PLFA 3NYWA 4FGSA 3TZCA 4BNYA 4QT0A 2A92A 2WDZA 1PGOA 2YV1A 3H7AA 4J1SA 3GAFA 3VPSA 3RROA 3KYCA 3F47A 3L77A 4NK4A 3ZNNA 4RQTA 1SC6A 4GWGA 1K89A 3O9ZA 2HAEA 1F8GA 2A4KA 2BKAA 4CLHA 2BFPA 2I76A 1I8TA 1K5HA 1NHWA 4M54A 4GVLA 5FWNA 3ZWVA 3S55A 3IUSA 4L73A 1GZ4A 1KBZA 1E7YA 3W8DA 4BNZA 3K5PA 1C0KA 3VPHA 3TZ6A 4TVOA 3EVNA 4IQ8A 5DBFA 4FJ0A 4XDYA 1JAYA 3OA0A 1WDLA 4Z0PA 2BF7A 5LDHA 2PWZA 1I3LA 3E5RA 5CFZA 4RVSA 4E2YA 1EQUA 2O3UA 3JQDA 1HZZA 3F4LA 1PU2A 1AUPA 3K73O 4PZCA 1CIVA 4W82A 1BWSA 4EUFA 2ZTMA 2PD3A 3DAFA 3GEMA 4D43A 5IDYA 1EVIA 4BMVA 3DR3A 3CMCO 4Q9NA 2IE0A 3RFXA 1GL3A 3IQDB 4BUCA 3OEWA 4YACA 2VRBA 4EYEA 4WLOA 5JFOA 4NJMA 2Z95A 4B3IA 3ENNA 5JMPA 4BO8A 5LCXA 5JY6A 3VOSA 4NJMB 1H94A 1BRMA 2HJRA 3U4IA 2PH3A 1B8UA 2DVMA 3PYMA 2ZK7A 1SO8A 3BMQB 3GNQA 3NTOA 4R01A 4RPKA 3OJFA 4IIUA 1EVYA 3OSUA 1W4ZA 3PIIA 3C1TA 2CD9A 3UOGA 3JD3A 3NDJA 4ZRNA 1TXGA 2Y99A 4OQZA 3OM9A 4QSMA 4IDFA 1M6HA 1G0OA 3VZRA 3ORFA 4WECA 4WEQA 3WJAA 3MJCA 1NASA 2RH4A 4K28A 1PL8A 3EW7A 4KQWA 5TSDA 2VHZA 5FFFA 1FDSA 2PKRA 1MUUA 2Y1OA 3R3SA 4N5MA 4LSMA 4UVDA 1G0NA 1XQ1A 3L4BA 4MKRA 3S2GA 2D3TA 4AJ2A 3HDQA 2Y66A 3UF0A 2SCUA 3P7MA 1EVZA 3DZKA 2JKVA 1IHYA 3NRCA 2RBEA 1E0DA 1EQ2A 1QYWA 3EAGA 1HLDA 4R3WA 1JN0A 1MGOA 3HADA 1NXQA 2EW2A 4FFPA 1NWCA 1WLYA 5JW6A 2F1KA 3S8MA 3N58A 1PS8A 2W8ZA 2Z5LA 4TRRA 3AOEC 1KYQA 4F6CA 4BGEA 5ENDA 4LVCA 4O59O 2QRKA 1P1RA 3JQBC 1GZ3A 4IDGA 4RLSA 1QP8A 3VKVA 2FOIA 5TJ9A 4B7UA 5IDXA 1YDWA 2PNFA 4HP8A 2VHXA 2O3SA 1LXCA 3GN2A 4CM9D 1PJ2A 4WNIA 1T25A 1DHRA 2XF8A 3RC2A 3WGZA 9LDTA 4JJGA 4II3A 1ZBQA 1BDBA 2VNAA 4FQ8A 2YY7A 2QRLA 1QYDA 3D1LA 1DRVA 1PGQA 1SOVA 2UVDA 1B26A 4HXYA 1IL0A 1PJBA 3RKRA 3EMKA 1X13A 3IP3A 2XAAA 5TF4A 3SX2A 5H83A 4W7IA 5CDUA 3JQ8B 2J5KA 3LK7A 5KNLA 2GZ2A 3DBHB 3RUAA 4BB6A 1H9BA 5F5NA 5HS4A 3ASUA 3DONA 4LK3A 2CNBA 4EUEA 5HBRA 4I9NA 3OQ1A 1LSOA 3HFGA 2JAPA 5T64A 1WZIA 4JX8A 3RBZA 2H9IA 4Q3EA 1UZLA 3JD1A 1XU9A 4E31A 5G2OA 1M76A 3GOHA 1YDEA 4E13A 2E6UX 3GNSA 3I1JA 3K6JA 3KSDO 3U4DA 1JWAB 3IDSA 1XHLA 4JGBA 1FK8A 1DAOA 1RKXA 4OSOA 1VE9A 1EE9A 1DB3A 4Z3DA 4XIJA 2V6MA 1HDZA 4FJ1A 2AQKA 2V65A 4CMIA 4BNNA 2CZCA 1MV8A 4IS3A 4PLWA 4XD2A 4Y6RA 1I2ZA 4GL4A 2NVUB 3WYCA 3QVSA 2VWQA 2OMEA 2PD6A 1DBVO 1HWYA 1ZSYA 1SEVA 3X2EA 1PQWA 1BG6A 4JN6B 4TROA 1XELA 1B14A 1QV6A 1DC5A 3ETDA 1PWXA 5A9SA 4WKGA 1UXJA 4ITUA 5JC1A 3MJTA 1MP0A 4NBWA 4Z0HO 4WJZA 3HNPA 3DAGA 2GLXA 2D5CA 3CMMA 4FOOA 2VYND 5F1PA 1LBEA 2DTXA 2BGKA 4JLWA 1QLJA 1UR5A 3PJDA 3B6ZA 4NIMA 1GADO 4BKUA 4MO2A 1YONA 1GQQA 4ND5A 1ULSA 1DC3A 2V7PA 4RV9A 4WK6A 3WGGA 2GPTA 4CMKA 4EW6A 1V3VA 4DPLA 1A71A 1X7DA 4DIOA 4R54A 3OEYA 4UVEA 3CEAA 2EXXA 4J3FA 4RZHA 1H2BA 1PZEA 3QE3A 3CINA 2GGSA 3DBLB 1ZK1A 1HSOA 2X9GA 4J0EA 4R1UA 1Y8QB 4M49A 4Q39A 3WTBA 1YBMA 1FF9A 2HQ1A 2D2IA 4E12A 4GQAA 3PQFA 4FDAA 5ICMA 4U8GA 3FSRA 1I2CA 1ZMOA 4AJKA 4GMFA 3E18A 2QZZA 2NNLD 3SJ7A 5L4NA 2QX7A 1LDEA 1VJ1A 3WR5A 4U6SA 3TDKA 2UYYA 1LLQA 2X7HA 2DBRA 3TOXA 2HLPA 3KRTA 3ZW8A 1CRWG 3ONEA 4LGVA 5A04A 3RD5A 1TLTA 1GYRA 3HN7A 4NI5A 3LT2A 3O4RA 4XA8A 1K2WA 3AI1A 3JSAA 4UUPA 4WOKA 4BGVA 4BO2A 3PLNA 5EN4A 5A3JA 1P1KA 1N2SA 3AOGA 4M86A 2TMDA 1KY5A 4CLEA 1NVMB 2CDCA 2QRJA 1U2GA 4DA9A 5TGDA 4I5EA 4QXMA 3RUEA 3VZPA 4NBRA 1SMKA 4HFRA 5DCUA 3K96A 4CM4A 1PL6A 2VHWA 5BQFA 3PQDA 4GLOA 3JQBA 1CETA 5KIAA 4RVFA 4TQGA 3RWBA 3U4CA 3JD0A 1LSSA 2WYWA 4Y9DA 1E6UA 1C3VA 4LRTB 3I23A 5L53A 2NQ8A 1T1SA 3Q3CA 4J1NA 4PLHA 3ZU2A 4YJGA 5B1YA 1ZIDA 3RIHA 1BW9B 5CDSA 5K6AA 4GPD1 3WLFA 4K26A 4YAJA 2EKQA 3KZVA 1GZ6A 5EQDA 4ZA2A 1E7RA 5HS6A 5GZ3A 2DKNA 2VUSA 3WICA 3MJVA 1I32A 1LC0A 1CWUA 2G17A 3INTA 1PJQA 2P4HX 3PEFA 1ZXLA 4CR6A 1M66A 1X0VA 3GGGA 1I5RA 1N8KA 4EI2A 3AM5A 1R37A 4UREA 4YTEA 4CL8A 3L6DA 2GR9A 3JQAB 4DUPA 1Y5MA 4CODB 4LISA 1E7QA 1VI2A 1VSUA 2FHSA 1H0KA 1PQPA 2H63A 1ZCJA 3ABIA 3HB4X 1U8FO 3D5QA 1BVRA 1E6WA 4CUZA 1I0ZA 5C7IO 2AHRA 2X0NA 4QFDA 2ZQYA 4IY1A 1KOLA 3WBFA 3RC1A 3AFNA 3ETGA 4FOSA 3ZU5A 3PHGA 4P22A 1L7EA 5K6AC 1TB4A 1SZJG 2WM3A 3RI3A 4HFMA 4BOYA 3VAZA 4AG3A 2QYTA 4J7XA 1BSVA 5TNXA 2YDXA 2LDBA 2R00A 3WLEA 4DIBA 4Z0TA 4WCDA 4R9RA 1F12A 1LSUA 3W8EA 1DIGA 1V0JA 1LDNA 4DGSA 4DL9A 4RORA 3JCZA 1UDCA 2C5AA 4YB8A 1E3WA 1KEVA 2XXJA 2VHVA 1GAEO 4IJUA 3H3JA 4ESOA 1A9YA 5A06A 4EEZA 3LVFO 5JDCA 3ZNPA 2YV3A 1YGYA 1ADCA 2VTEA 5ER9A 3ROKA 1Z82A 3QQPA 3UXYA 3GZ4A 4ROSA 1ZK3A 4JK3A 4PLPA 1L7DA 5EIOA 5H82A 4NFHA 2VYVD 3E6AA 4I5GA 2I3AA 3BMCB 3DOCA 2DM6A 3G17A 3PGJA 3ZWXA 2RHRA 3UAGA 1HDOA 1IUKA 4KZPA 4XQGA 3LT0A 1AE1A 5KJ6A 5GZ1A 3CUKA 1WWKA 3OICA 5TRTA 4EDFA 1PJCA 2RAFA 5JPIA 1R66A 1AHIA 2PTGA 4PVDA 1O9BA 4F45A 1C1XB 5IN5A 2VUTA 3E5MA 4TRJA 3TN7A 1ZK0A 1OC4A 2GCGA 4P38A 1YS4A 2D8AA 3DAPA 1KIFA 3W8FA 3CXRA 3JQ6A 2VN8A 1M67A 4YJDA 5DOZA 1E7SA 3GMDA 2P5YA 4CV0A 4GWKA 1DOHA 3IC5A 5IN4A 1KEUA 4Z9YA 3DTYA 1VM6A 3IP1A 4CL3A 3ICPA 5G0UA 1TT5A 3F46A 3W4IA 1P74A 4IDCA 4QFCA 4R1SA 1MC4A 1KEPA 5K0ZA 3ZHBA 2J3KA 3CKYA 4E5YA 3IKVA 1U4OA 3BMCA 1NAIA 1MX3A 3JQAD 2CY0A 3RKUA 4YJHA 3DFZA 1GD1O 2DT5A 4G5HA 4CQMD 4IDBA 2VHYA 4WLUA 3QW2A 5GZ6A 1UZNA 2VT2A 1ZK2A 3DBRA 3K2BA 4WLEA 1ISFA 1ZZEA 3GZNA 4G2NA 3G3EA 3AM3A 2R6JA 3QIVA 2FZWA 3JV7A 4HADA 4NDNE 4NU6A 4WCFC 3DZBA 5JBIA 3TZHA 1UXGA 2YDYA 1GCUA 3Q6IA 5IZCA 3PVZA 2X5OA 4D0RA 1A7KA 1HKUA 3C24A 4L4XA 3GVIA 2HCTA 1QXSA 1WVGA 3EZLA 1XG5A 3JTMA 4DWVA 5JAZA 1V35A 4IINA 3K8ZA 3PP8A 3V1YA 1XR3A 1NFRA 1NVGA 2ZJ1A 5DP1A 1E6EA 1GV0A 1PQUA 5DBIA 3WGQA 1DIRA 4NNJA 2W98A 2J8ZA 1HE2A 2VZ0A 3B1JA 3TSCA 2BI8A 2VNSA 2O4CA 1ISJA 2A94A 2X8LA 3IUPA 4OSPA 1FJHA 2X0IA 3MTJA 3I3OA 3KYDB 4DC0A 3EGOA 1HDYA 3T7CA 3OA2A 4NBTA 1KVUA 3RSHA 5ADHA 5KVQA 2EJVA 3QWIA 2HO5A 3GVCA 3NEPX 4RQUA 4YT4A 2VZ8A 3TOZA 5G0TA 1AN9A 1M2WA 1C0IA 3GLQA 5IZCC 3H9UA 3RQSA 2W2LA 1UXKA 2VYNA 5JY1A 1NAHA 1HDGO 2BELA 2O2YA 4OO3A 5CP8A 4GSKA 4ZU3A 3LZ6A 4RPJA 4C7KA 1A27A 2PZKA 4OIMA 1VKOA 1ZSVA 4L8VA 2Y0CA 4GGOA 4AJPA 5T6BA 4DQUA 3KVOA 3ON5A 4CMBA 4PZEA 1EDZA 1XCBA 3NGLA 3KYDA 1EK5A 4A7PA 1O6ZA 2OP0A 1I3NA 5CAEA 2Y0EA 3TZKA 4BVAA 3D3EA 1B8PA 3FPCA 4XGKA 3HFSA 4ND1A 4BL5A 4K1LA 3W4JA 5L7TA 4W6ZA 3A28A 1LLCA 1JQBA 4JXKA 2GZ1A 4BKPA 4XDZA 3AY6A 1X0XA 3MJSA 4CUJA 4Y67A 4U7WA 1PGNA 3KLMX 4QO7A 2VQ3A 2YFHA 3OH8A 2X5KO 1A7AA 4I5FA 5G4LA 5L7WA 2EHDA 1E3IA 2Z1MA 3BAZA 4UULA 3WNQA 1PIWA 3GDGA 5COAA 3DZIA 1B15A 3EC7A 2OBYA 3GG9A 4FBGA 4ALMA 4BNKA 1VJ0A 2Y1FA 5T8KC 4B7CA 4J7CA 3K30A 1LTHR 3HE3A 5BNIA 4CMCA 3L4BC 4EGFA 4OXKA 3KEQA 1ZJZA 4E5KA 4J91A 1ZUD1 4Q3CA 2OXIA 4AJLA 4YAGA 1KC1A 2WYVA 5U9CA 1GYPA 2IXAA 3BTOA 5KJEA 4XYMA 3S1LA 3VPGA 3ENKA 3HQ4O 3V2UA 1TT5B 4B8ZA 3R0IA 4MVJM 4MP3A 4CM9A 4CM7A 3NKLA 4U0KA 1P44A 1BXGA 1TA4A 3PFFA 1IPFA 1YOVB 3DOOA 3GQVA 4RGBA 3KSZO 3WMWA 5BSEA 5L40A 4HY3A 3VTZA 5LDGA 2IEDA 1Q1NA 4BNHA 2EW8A 5L45A 3N74A 3SVTA 1CQIA 1BTOA 4IJVA 4XYBA 1Y8QA 3H3FA 2I6TA 1ISGA 1UJMA 3AU9A 3FR8A 3RU9A 3WIDA 1U28A 3TWOA 1YBAA 2G1UA 1EDOA 1P1HA 2QIOA 3NV9A 1YJ8A 2AW5A 2EP7A 1NPYA 2C20A 3ZH2A 3AI3A 3D64A 4U6QA 5I8WA 3PDUA 1I3MA 4H7PA 4A27A 1J0XO 4Y98A 3ANNA 1Y6JA 3QSGA 2HJSA 1F17A 3HSKA 4O6VA 5KVCA 2GRAA 4QQRA 4AJJA 1TVEA 4DLAA 1CQJA 4YVFA 5A02A 1MA0A 1G1AA 2ZJ0A 1KS9A 2PGDA 2ZTVA 2PD4A 1Q7BA 4ZQFA 1X7GA 1ZSNA 4ZQBA 4CLOB 1B8VA 2DC1A 3B70A 1LUAA 4YDRA 3X2FA 3ROQA 3WSVA 4O5OA 3ZN2A 3AWDA 3PPIA 5F5LA 4J9VA 1W0CA 2Y1DA 4R1NA 3OECA 5JAIA 2O4UX 3D7LA 4KMSA 4TKMA 2Q1TA 4BNIA 3MWDB 3CPSA 2XXBA 2B83A 1HT0A 5ILOA 2R2GA 3OF2A 3O8QA 2AEJA 1KVRA 2OHXA 2NM0A 1QRRA 2JFFA 5JCJD 4FFNA 4YJFB 4LSWA 1RJWA 4A73A 4OXYA 1HETA 1QSGA 1VLLA 1WXDA 3JQAA 4FC6A 4JBIA 3I6QA 1GFSA 3WQRA 1UP7A 4CLRB 1DLJA 3ZU3A 2G76A 1EBFA 1Q2XA 4MVJP 1I01A 2XPCA 3B1KA 2FY8A 4RVUA 1XYGA 1V8BA 1PSDA 4GX0A 3TL3A 3I9OA 1VL8A 2Q49A 4WE3A 2VWHA 3PDJA 3WBBA 1R12A 4IGFA 3I52A 1EFKA 1U9JA 2X5JO 1DJQA 1XGKA 1Z73A 3D4PA 4Y8VA 4PLGA 3ZGYA 4XRGA 4YT2A 1OC2A 3FTPA 1T24A 3TFOA 5TLSA 3R1IA 4XGIA 1B16A 1LLUA 4MDHA 2NU8A 5CDTA 4Y6SA 2B4QA 3SC6A 1JKIA 1LDMA 4BMNA 5C3MA 4N5NA 1T4BA 2PZMA 4IJKA 3Q2IA 4GMGA 5JYDA 1NR1A 2O7SA 3NDRA 4AJOA 3NT5A 2P4QA 1JTVA 3TPCA 3ADOA 3E9QA 3GF4A 3MZ0A 4M89A 5THQA 3RFVA 3JQCA 2Q1UA 3U9LA 3VDQA 3BTSA 2NLOA 2C7GA 1LRKA 3RUDA 4OL9A 3GUYA 4WOJA 5B4TA 3PZRA 1ML3A 1WNTA 1GUYA 4CM4B 4J6FA 1XQ6A 1VRWA 2PZLA 1B2LA 1FDTA 3H2SA 4NQZA 1ENOA 1E3JA 2EJWA 1NWHA 3HN2A 3D4OA 3H9GA 4J90A 3W4KA 3ZWWA 3WG9A 2JD1A 4XB1A 1HDCA 4GX5A 1HYGA 2I65A 1B7GO 4R1TA 4E2WA 4E21A 2ZIZA 3O8QB 1O95A 1X7HA 3FNFA 2JCVA 5IG2A 4BV9A 2OL4A 1N5DA 4ZQHA 4W9NA 1P3DA 2B5VA 4IJWA 2IYOA 2GNAA 5A9RA 4JJFA 3DHYA 3N7UA 3KETA 1U3VA 2EKPA 3JD2A 1ID1A 3BA1A 1Q0QA 4YJFA 5HWSA 5I7EA 5L7YA 2UDPA 2Q99A 3MWEB 2NSDA 1C0PA 3L4SO 2Z1NA 1Y9AA 3LF1A 3PHLA 1I2BA 2UAGA 2DAPA 1X14A 1OZAA 3FBGA 4PCVA 1H6BA 2WTBA 2AQIA 2B4TO 1X1EA 4PG5A 1NFFA 3QVTA 2WD8A 5JO9A 2O3JA 1LNQA 2OORA 2GDZA 3P5SA 5KJFA 3VH1A 1GCOA 1HDXA 2ZYDA 5L51A 3M1AA 1I10A 1R16A 2WEKA 3DQPA 4MJLA 4D44A 2HUNA 4BNJA 1YL7A 3G0OA 1ENYA 1IE3A 3FWZA 3ADPA 3H8VA 1OBFO 2NVBA 4BO9A 1DC4A 1PR3A 3I9KA 5HA5A 2Q2VA 1GV1A 5IZ4A 1ADBA 4YWJA 1A5ZA 3DBRB 1H6DA 2HMTA 4YBZA 3GDFA 4FFOA 1EUCA 4XX0A 2B37A 1QMGA 4C7JA 3K31A 4AICA 5DP2A 1DFHA 4YJHB 3S2FA 2JD0A 4FD3A 3E1KA 4BNVA 1DRUA 1B3RA 1J4AA 1OAAA 3C1OA 5DCYA 4GH5A 3HDHA 3VZSA 4GI2A 3L0DA 2GYYA 2I5PO 1BXGB 2JCXA 3KYCB 3IIEA 2CDAA 3S2IA 1SB9A 4B79A 2D0IA 3JQEA 2HK7A 4MIEA 3PHIA 2ET6A 4II2A 3JQ9A 5JC8A 5KVVA 4YEDA 2QG4A 1Y1PA 5F21A 3QY9A 4MPDA 4B4VA 5CPFA 4JCOA 4ND4A 4NU5A 1M6WA 3P2OA 5DBGA 3EYWA 4P4GA 4O1MA 1WAMA 3QWAA 2E4AA 4UUNA 3STHA 2NU9A 1C1XA 1EZ4A 2DLDA 3OJEA 4BNXA 4FSHA 4E5NA 3LC1O 2BFAA 4GSLA 2VT3A 2JCYA 6LDHA 4DPMA 2G5CA 2ZB7A 5AXBA 4KWHA 3HWRA 2EV9A 1XWFA 3GT0A 4PG8A 3LT4A 5KKCA 2J5QA 1SCUA 2X6TA 1ZEJA 3U3XA 4AVYA 3Q0EA 5COBA 2CVZA 1F0YA 1WMBA 5JE8A 2DBVO 2AA3A 3DL2A 4M87A 4HNGA 1RM5A 1TEHA 3IMFA 2C82A 3SC4A 2Q1SA 1DDOA 3ZWAA 1K6XA 4DYVA 4L4RA 3I9LA 2HMSA 1I33A 4JBHA 4CMEC 1R4MA 2BFMA 1LDBA 1ZXBA 4CV2A 2ZTLA 3K2EA 4RDHA 5T67A 5BSGA 5CEFA 4N5LA 1D3AA 2VRCD 2ZCUA 5BR7A 2VWPA 2ZCVA 1NYTA 1EUZA 2AG8A 2C2YA 4H3VA 2WD7B 2I3GA 1GQ2A 4IDAA 4UEOA 1K6JA 3MCVA 1RM0A 2OZPA 3T4EA 1P77A 4GX1A 6ADHA 4XZ3A 3D0OA 1W73A 4E3ZA 5CEEA 4E0BA 2ZQZA 5BSHA 3ONFA 1XKQA 4FFLA 1SPXA 1F8FA 1WDKA 1PS9A 4HNHA 1E1KA 1YO6A 5IFLA 2NTVA 3WFJA 3SBOA 2Q45A 5A9TA 2W2KB 5L4LA 4ZRMA 4UAGA 4E32A 3V2GA 4ALNA 1XLTA 4CR7A 5I7FA 1Z74A 2GUGA 3ST7A 1ONNA 4RL6A 3RAJA 3WS7A 1DJNA 3WQSB 3I9JA 2NVWA 2H6EA 5T57A 2X22A 3GVPA 1GPJA 4G65A 3BMQA 2YJZA 1LRLA 2P68A 3DZHA 1DRWA 5KJ1A 2ZB8A 1ZVMA 3PWSA 1HL3A 2WMDA 2FP4A 3WWYA 3M2TA 1UXHA 1B3BA 3ZHYA 3C7CB 4PG7A 4OQYA 3PIDA 4NMHA 5EL0A 5A3VA 4PG6A 5TT1A 2RHCA 1O89A 5G0VA 4J43A 3TF5A 1R4MB 1GY8A 2EGHA 4W99A 3I9NA 4GBJA 2BH9A 4IZIA 4U0JA 3DZJA 4ZN6A 4G81A 1Z75A 4W9NC 1JKFA 3PHJA 4OKIA 3JQ7B 4DC1A 4L4SA 3UICA 3EUWA 3IJRA 1E1MA 1D7OA 3F5QA 1ZO8A 3DWFA 3VVBA 1AXGA 1YKFA 5FEUA 4R3NA 1Z7BA 2ZATA 1LU9A 1H9AA 2AMFA 5ENVA 2QHXA 3UVEA 4GVXA 3E9NA 5A5FA 3E48A 1PJSA 3LF2A 2PFGA 3PZBA 2AE2A 1QYXA 1Y8RB 2BGLA 3PK0A 3C7AA 2JAHA 3WYEA 4ALKA 4YT8A 2E37A 2Q50A 4IMPA 2A9FA 1P1IA 4JQCA 4E2XA 2FPGA 3LLVA 3EK2A 1PJLA 1E3SA 2V6BA 1ULUA 3GZNB 5TC4A 4OH1A 2EERA 3WGTA 4J49A 1HLPA 3DB2A 2H1SA 2PGJA 4IDEA 3ZWPA 4INAA 3TQHA 4NR0A 2GF2A 1KVQA 3V5NA 4LVUA 3U4HA 5EERA 3DZGA 2EG9A 4IXTA 1GUZA 2HMUA 2HRBA 3IS3A 1N7HA 4BO5A 3G1TA 4MIYA 4FFMA 1V9LA 3WYBA 2VCYA 4AJEA 3COSA 4AJ1A 4ZGWA 3G49A 5T8KA 3FNHA 3IL2A 2CVOA 3F1KA 1R6DA 3L9WA 4QECA 1AXEA 4CLDA 2PKQO 3U62A 5BNTA 2I9PA 3NT2A 4ZJUA 5CG2A 3KEOA 1NPDA 3EHEA 4BGIA 2BHLA 3AUSA 5ITVA 3UUWA 3K9QO 3ZV6A 2BRUA 1Z7EA 1FDUA 3I9MA 4A26A 1P31A 1DIAA 4HUJA 4BO7A 2CMDA 1ORRA 3GC6A 1ZJYA 4LCJA 2VOEA 3W6UA 3R6DA 2ZTUA 3H9JA 2GSDA 4J1QA 4BNGA 1LRJA 4XCVA 2GZ3A 2PV7A 4KQXA 2ILTA 4P8RA 4YAKA 3NX4A 1YB4A 3NJ8A 4MINA 5G4KB 3RJ5A 4F6LA 5B4VA 3LC2O 4OXNA 4BNMA 5LC1A 3CZRA 2UV8A 4BV8A 2C07A 1DO8A 2OOSA 3ETEA 5HRUA 3AW9A 1ZNQO 3TFQA 3ICCA 1QKIA 3GY0A 3TL2A 3WMXA 3ZCXA 4DMMA 3C8MA 3LT1A 3UGKA 3KXDA 4DPKA 4NHEA 2Y93A 1HF3A 2FWMX 4ND3A 3AY7A 3NTQA 4UUMA 2Q4EA 1E3WB 3WOHA 3RVDA 3WJ7A 1OOEA 2D1YA 2YFQA 3U0BA 1GQYA 5DULA 1DEHA 1AHHA 2PZJA 3PJEA 1ZK4A 3I6IA 4J4BA 4PLCA 2QZ9A 1RWBA 3GR6A 2QYSA 1ARZA 5COQA 3C1AA 3QJ5A 2HU2A 3ULKA 1VKNA 3NDIA 2HMWA 4OKNA 3AU8A 2PH5A 1T2EA 3VZQA 1SAYA 4D3SA 5IAAA 1JVBA 1I30A 1ZEMA 2FR0A 3UFXA 1E77A 2BD0A 5G0SA 4F46A 1NNUA 4DQXA 4YAIA 4TKLA 4BO6A 3PFWO 2XOXA 2W2KA 4ZVVA 4M8SA 4RF2A 3BHJA 4DVJA 2EWMA 4GKVA 2EF1A 4IQ0A 3WXBA 4R4JA 2Q46A 3Q2KA 2Y68A 4EZBA 4Q3DA 3LSYA 2CVQA 2IZ0A 1NP3A 1Y5RA 2YHIA 3OQ6A 4FC7A 3H4VA 4FN4A 4Z9XA 3E9MA 3FR7A 1F06A 1NX6A 1P0FA 1ZW1A 3GGPA 4JP3A 1H6AA 4BGUA 2W90A 3KYBA 3FN4A 3QV1A 3GPDG 4MP8A 2YYYA 4YQYA 4CJXA 3DFUA 2Q3EA 4XRRA 4FR5A 1T4DA 2AQ8A 4KOAA 2FSVA 4BKOA 1T2CA 1N92A 1SEPA 1E1NA 1E3LA 1BW9A 4WLFA 4MVJD 3RBXA 2V6FA 3GN1A 3ROMA 2GN9A 2HK9A 3OMLA 1E7MA 4KTVE 5DCWA 5JAQA 3VDRA 9LDBA 2OGUA 2Y1EA 4HX5A 4NBUA 4D46A 3UCFA 4J4TA 1LQUA 3WTCA 3L6OO 4BS9A 1U2DA 2CFCA 3AM4A 1XDWA 4XIYA 5A5EA 2CSUA 1TT7A 4K9DA 4UEJA 1CEQA 1Y9EA 4WUVA 4IXWA 2PK3A 4Z3KA 1PGJA 4KDEA 4AJ4A 3EY4A 1LA2A 3WFIA 4CLRA 3BHIA 1GYQA 3ZWOA 4Z9FA 3Q9UA 2VWGA 2WJPA 4EEXA 4RJTA 1RPNA 1JWBB 2IZZA 2NADA 3HDYA 3ZHZA 2FPPA 3U49A 3MJ4A 1OMOA 2JHFA 5F1OA 5FI3A 1EK6A 2HMVA 2IEBA 3NGXA 2P91A 4AJNA 4PN3A 4XR4A 4ILKA 3JQ9C 4OHUA 1T2DA 2GERA 4ZQGA 4D42A 4O0LA 3DBLA 1EE2A 5C7OO 5BNFA 1Q7GA 4BO0A 1T1RA 1VJTA 4NPCA 3RUFA 3NUGA 5KWEA 1J6UA 1JAXA 1UUFA 2NU6A 3VPFA 3KO8A 5IDWA 4R69A 1IHXA 1NBOA 4OOFA 1HXHA 4IBOA 1HE5A 1DXYA 1O94A 5I7SA 3ROPA 2Y05A 1G6KA 3DHEA 3E8XA 4RO0A 1DAPA 1E92A 3A14A 4BNLA 4DLLA 4LMRA 1RYDA 4XYEA 1D1SA 3QP9A 2D59A 4W4TA 4YPOA 5JCXA 3ZV4A 4B4UA 3FPLA 4JJIA 2FSSA 5A9SB 3GFGA 4KUHA 3WGOA 2YV2A 1VL6A 2DPGA 2P2SA 3JQGA 4Y6PA 3ZNQA 1QYVA 4DLBA 1J5PA 4PFJA 5K9ZA 4LCEA 3HUDA 1ZKMA 4MVJI 1GR0A 2B5WA 1U5AA 3DBVO 4B7XA 5ITWA 2F00A 3JYQA 2NTNA 3A9WA 1MXFA 4R16A 3D4NA 3OIDA 2I67A 1YJQA 1AGNA 3AY3A 1YVEI 4ALLA 2DTDA 1O5IA 3TJRA 4ALJA 3BHMA 2UUPA 4B4OA 2X86A 1NVTA 3BZUA 4CM1A 1XA0A 3O03A 5EJ2A 1Q0LA 1VL0A 2ZKLA 3B1FA 4J2HA 2NVUA 4OYRA 1FXSA 2Q2WA 3ZWMA 3ZZNA 5JXWA 2P9EA 4ND2A 3H9EO 1JDJA 4IMRA 5AVOA 4NK5A 4AL4A 3HDJA 3LC7O 4RDIA 3RCBA 4CM6A 1YOVA 2B36A 4ID9A 3DBHA 1S7CA 1NQOA 1PJ3A 3QVOA 4FFRA 1U4SA 1DHTA 4PLVA 3ZNOA 3ZWCA 3NTRA 2X9VA 5JS6A 5JO0A 1X15A 3A4VA 2AG5A 2FN7A 1PZGA 4Q3BA 1VC2A 4E5MA 4F3YA 4GX2A 2IXBA 2O48X 3S2EA 5CEJA 1KERA 3VH2A 4LW8A 4L75A 2O50A 4FB5A 1NQ5A 1DPGA 3O26A 4YA6A 5HTOA 4IUYA 1RYEA 1ISMA 4IGEA 5IXSA 3C7DB 4NBVA 4RF3A 2J3JA 1CJCA 1GUFA 3H65A 4PGFA 4PRKA 2DU8A 4XB2A 4EITA 4RVGA 4A10A 5JYEA 1ZFNA 2IYPA 3GGOA 3IKTA 4JIGA 3PXXA 5U4QA 1HSZA 4L74A 3F6YA 5FI5A 3CSDA 3ONDA 1HEUA 5U1PA 4L9RA 3G79A 4JROA 2Q4BA 1DC6A 5IXYA 4FCCA 4D7AA 3Q9NA 1P45A 3SLKA 1C0LA 2GD1O 4KWIA 5TT0A 3W1VA 2NV6A 1IZ9A 2HKIA 3AUTA 4GGPA 1KC3A 4M1QA 3DMTA 1K6IA 3WQQA 5JAMA 3JQFC 2JFGA 4Z6KA 1E3EA 4DRYA 1KY4A 1HYHA 1Q0HA 3Q1LA 2NTJA 4YRAA 1WDMA 1ADFA 3DTTA 1QORA 3WB9A 4ZD6A 1PEDA 4OGWA 1LLDA 3GHYA 3CTMA 1JU9A 4UVHA 3WDSA 3DEYX 3SLGA 2CF6A 2UUOA 4BNFA 5CHEA 2AEFA 4HFNA 2RH8A 4C4OA 1YL6A 4JP2A 3IOYA 1U8XX 1DFIA 3CZMA 4MP6A 2FMUA 3GVXA 3V1UA 3GUCA 3DMYA 1GEEA 4PIVA 1W6UA 3PTZA 3WGIA 1MG5A 4PLZA 1YQXA 4CLXA 1N9GB 3FI9A 1UDAA 1P1FA 1XSEA 3H9QA 1SBYA 3LQFA 3U09A 5EMHA 4BNTA 4IZHA 1WMAA 2B4RO 3RFTA 5CG1A 3AK4A 2X0RA 4I9UA 4CM3A 1N9GA 2E49A 4BNWA 8LDHA 2IRWA 5B4UA 1K3TA 3BXXA 5AXCA 1KEWA 3OHSX 5IDQA 4QTZA 4PVCA 1GPDG 4N54A 1WZEA 1QLHA 3F5SA 2NUAA 3PHHA 1TI7A 5EPOA 2PKQP 1MXHA 2GN8A 4XQEA 2WSBA 3VH4A 1UAGA 4CLOA 1GTMA 1CF2O 3INRA 1P0CA 1EBUA 1BDMA 3JYNA 4I8XA 1PGPA 4RCVA 4QEDA 4AFNA 4M55A 5JCJA 1Y81A 3INGA 3OIFA 1SB8A 2EKLA 4YRDA 1UH5A 3C3XA 2X9NA 3ZHXA 1N1EA 3M1LA 4XGNA 5THKA 1W8DA 4ZQEA 4RLHA 5DT9A 3AJRA 1NPTO 2O2SA 4RPHA 1PS0A 3PGXA 5DN9A 5C5IA 3GRKA 1H5QA 4UVGA 3CIFA 4NG5A 2GO1A 2EEZA 4IM7A 2Q2QA 2YZ7A 3HHPA 1CDOA 3I5MA 3H6KA 4CUKA 4KUEA 4DREA 3HJAA 1IPEA 4CMJA 3RC7A 4BO1A 1QV7A 3BTVA 4BKRA 2PY6A 4Q3AA 1MFPA 4URFA 2HK8A 3GA0A 3RUHA 3PJGA 3EZYA 3QWHA 4W7HA 5AQ1A 3PQEA 2DUUA 1UXIA 4XR9A 5G0WA 4MKXA 1WPQA 3KV3O 4AJIA 4WEOA 2CF5A 3OQBA 1I3KA 2C59A 4EJ6A 2JJYA 1P1JA 2JHGA 3DOJA 3A06A 3R3JA 3L07A 2Y0DA 4J9UE 3W6ZA 5KJCA 2W2LD 4E30A 2B69A 1E7WA 3D3WB 4TZTA 1GEGA 2PLAA 1LSJA 4DYDA 3GPIA 3JYOA 3G1UA 4JBGA 2WYUA 4YCAA 3C85A 1U3TA 1YBVA 1NTOA 4TMFA 4S1VA 3DO5A 5DDIP 1V3UA 4FS3A 1P33A 3AUAA 4YAEA 1T2FA 2IDZA 1ZMTA 1YQDA 4GKBA 2RIRA 5KTKA 1BHSA 1JA9A 5GMOA 3PRJA 5A1TA 1CYDA 4LMPA 2QW8A 2GN4A 2YHUA 1C1DB 4OJNA 2G82A 5JSFA 2EP5A 2O3RA 3F1LA 4XYGA 1ENZA 1SOWA 2WE7A 4DIFA 3GG2A 4BQRA 2HDHA 3GDOA 4U5QA 2Y1CA 3V8BA 5TX7A 5L3ZA 4IPTA 2PGLA 1T26A 3GHHA 1IYZA 4E4YA 5I9LA 1J49A 3T4XA 1IZ0A 3QA9A 3JYPA
chains in the Genus database with same CATH superfamily
4V0NA 1J1UA 1UZUA 5J23A 1JKXA 4MRRA 5A4KA 5CB8A 1LBIA 4Z7OB 5KYUA 2R65A 2C3MA 1L5VA 3HYTA 5H59A 5KTSA 3K94A 5LZ8A 3AETA 3SFTA 3QFHA 4NARA 5EQFA 2GD6A 1BJTA 3CEHA 1PLLA 3AI2A 1E9SA 3PYXA 4MB2A 2WAXA 2H5EA 2ZM6B 3I4FA 1WSAA 3VTKA 1UMCA 2F64A 1FNSA 3NHRA 1E5VA 1NVEA 1VLHA 2C5EA 2DJIA 1NR7A 2ZUUA 4XEHA 3RVLA 1UP6A 5BSFA 2XYQA 5CLGA 4G5RA 1M2FA 1AUOA 1EFAA 4HSGA 3ROTA 1EBBA 3SZUA 3THWB 3DMTC 2GBCA 3NIDB 3K5IA 1JAHA 4LWQA 2M1XA 3GRCA 3IKLA 1NMXA 4N7JA 4ZICA 2HHCA 4C4SA 5BWBA 4TTRA 5L4SA 1O58A 3OKAA 3H5OA 2CJWA 4Q3KA 2HRCA 2QTRA 3O38A 3ABQB 2PT6A 3KSUA 3WV5A 4TSRA 1NBMD 1VSVA 1N2EA 3D0KA 3FTQA 3FNBA 4E6PA 3S29A 2XUPA 3SQLA 1FFBA 3M6LA 1KJWA 5CVEA 4V1CI 1A5AB 3CUUA 4G8BA 3HO8A 3JAWB 5AW4A 3AX6A 4D8VA 1IG3A 1PJ4A 2FPIA 4WW0A 3T94A 4MKZA 1ZH0A 4K6FA 1EG2A 2R96A 1Z39A 3R9IA 3W8NA 4E11A 3P71T 1IVNA 2FF7A 3AO0B 4JXJA 1V37A 2Q0HA 1JQEA 1LC3A 2QAJA 4TSKA 5HM8A 2O3QA 4XWOA 1E0AA 2VC2B 1C14A 3JW8A 4Q3NA 4NQRA 1Q92A 1Y4UA 2D1TA 3FBWA 2ZYAA 2C78A 3T35A 2HLDD 2PZEA 1VJCA 4AY2A 1QVZA 3DFFA 1JPNA 4U2CA 4DIMA 4YPFA 5K0EA 4LYGA 4YFVA 2ONYA 2AD1A 1M8KA 1SUEA 2EIHA 3MGCA 2CXNA 3UANA 1XIVA 1BMDA 1QUFA 4CF3A 3M83A 2GN6A 1VKRA 5AVXA 2MR5A 4J16A 3P4XA 3R3UA 3AKZA 3V4SA 2V7QD 4XIGS 4WCVA 4H60A 1N5KA 4IDDA 4N18A 5JLAA 3VR6H 2ROQA 3DLBA 4QGAA 4F0JA 3GNTA 2PHZA 2ZYGA 4LHXA 4ENRA 4W5RA 3LOQA 1GNQA 2VQ6A 2O6HA 1BNCA 1EB9A 1USGA 2YXLA 3F98A 3L4EA 4DWWA 4ZHSA 1L5GB 3A1NA 2EG5A 1VPWA 4PHGA 8GPBA 1RSZA 4YQFA 1WOYA 1EUDA 1AUQA 4TVBA 2I3DA 1G63A 3GFVA 1C7ZA 3SVZA 2DTEA 4P4NA 1NUQA 1PR9A 4YO7A 4G5YA 2DPHA 4JVSB 3AB7A 3ZW9A 1A50B 4LECA 4YCNA 1L7MA 2DQ4A 1GNSA 4JI6B 3VHQA 4AS3A 4RXUA 3ICQB 2R8EA 3LECA 5EC8A 3EGEA 2GJSA 3ORHA 3ZVNA 1A3CA 4YK7A 1LDGA 3NIGB 1RQXA 1Z45A 3L79A 3KUUA 4B3JA 4BE4A 2PG3A 4L0QA 4H6XA 2DFLA 4LRUA 2E18A 5IWAB 4GYKA 4BRUA 1FMCA 4RAQA 1BJRE 2WT4A 5B58C 3EUAA 3L43A 1N2HA 2Y1GA 4F2WA 4UM7A 1P5JA 4KXLA 1WXQA 1VE1A 3LDHA 3MCTA 5ES4B 2CXTA 4BVKA 5LOVF 1USVA 1NKTA 2VAWA 2PMCA 3FB4A 1A0OA 4IL5A 5G41A 3WVNA 3BIOA 1W2GA 4G24A 2QRUA 7MDHA 2WPNA 2BGMA 5B1HA 1T0UA 1O77A 2O2JA 3H2BA 3TRHA 2HX1A 4D8YA 3RTEA 5B30A 1KXJA 1MPXA 2WUEA 4HYQA 4XCXA 1UOOA 2QN6A 5IDVA 3STVA 2GASA 3BMNA 1NLFA 3ZY4A 5IT5A 1H69A 2CJFA 1LX6A 4IV0A 3GUUA 3UGJA 2FLWA 1N1GA 2LDXA 3KXKA 1FYEA 1VMIA 3A11A 1QAOA 1L5ZA 4MUGA 1JRLA 3EAFA 1QGAA 2J41A 1TMOA 1HC7A 4R5MA 3IOEA 1CR1A 3MLEA 4IO1A 5JSQA 5JD6A 2HNKA 1K0UA 3IQEA 1UMKA 4H15A 5D1HA 4B45A 1ZH8A 2Q1WA 3AIMA 2SNIE 5AI8A 4F86A 1U1IA 4Y2YA 1HTBA 2AE1A 2EP8A 2VSOA 4UCFA 4LDZA 1W1WA 1DJMA 3IP5A 2QRQA 3LCCA 3VYTB 5GP1A 2J0SA 3WYNA 5DNWA 3CUEF 3WXMA 4Q18A 2JBHA 2WKWA 2OBMA 2IY9A 4PQFA 1Z4NA 2NWQA 1IOLA 1U3WA 3EA0A 2FU5C 3MAJA 4IO0A 2OXEA 3C8DA 4TYPA 2PXHA 1YA6A 4KIGA 5FXMA 1ZJ4A 1X80B 1OYWA 2PGAA 2AL7A 4ZODA 5GVRA 4BKQA 3RVPA 3MPUA 3OY7A 4FNOA 4X1YA 1EVJA 4FTWA 4I1IA 1I24A 3ZQJA 2Y1WA 3EGXB 2XOEA 2V9PA 4EJSC 621PA 1NQUA 2D1RA 5IKEA 2RHJA 1JE0A 3KOUA 1GTG1 4Q9LA 4YLYA 4IHJA 1NP6A 2A35A 1GO2A 4K0RA 4KTTE 5E0KB 5IKOA 3OVMA 3VC7A 2QTCA 5MN4A 1PNQA 5ALVA 1C9KA 2LNDA 1VL1A 1JH8A 4IICA 5JNLA 3LPAA 1BU5A 1Y1KE 4PZZA 4CQLA 2J0UB 1A8UA 1XTBA 3FCOA 3L8HA 5ITZA 1M7BA 3GQBB 4XJTA 3IA2A 1UKVY 1E3TA 1M74A 2IL1A 2NPIA 1VXRA 4O63O 3OIGA 3AFMA 3QXCA 5AUQA 5D00A 1MVLA 3RE1A 4HX2A 3ROGA 1E2KA 4LZJA 5I9MA 2KQUA 5DV9A 1AZLA 1Y1QA 4KN5A 4PS1A 1F14A 1MG0A 1VGQA 3AZQA 3QEKA 4EBBA 1KWKA 5H3HA 5A4IS 4K87A 2BEWB 1LVUA 1OV4A 1QVWA 3SJUA 4C04A 5IJWA 3E3LA 2VJAA 2H5LA 4A6DA 5KAPA 3OAAA 1D8AA 4NZOA 3TS1A 1XU7A 2F3TA 5K0GA 1T2AA 3PXBA 3RJ9A 1TQHA 4CPDA 3AVTA 1XP8A 2QPLA 2IHUA 3EXG1 4MTCA 4R9SA 4RHUA 5ALIA 3PUXA 2VJYA 3PJFA 3FHCB 3RIYA 2CJPA 3VHRA 3AHDA 1MB4A 2O7QA 4I9HA 2O8VA 2P9BA 4LS3A 4RTJA 3IAS6 5KCZA 4DN6A 4P5EA 1BCSA 4C7OA 4PTZA 3U1BA 2F2TA 4KYVA 2XQIA 5A0FA 3KAQA 4WCFB 1LZKA 2R6ZA 2W48A 2IYFA 3PI7A 5IHXA 1KMHA 2FSVC 4AJHA 1FRNA 2HV8A 2AN4A 5BUQA 1E32A 4WJLA 2E48A 2EZ9A 3ICVA 4HQKA 3QYFA 2OBNA 4U63A 1T34A 1KVTA 3D4LA 2PR2A 2B94A 1J0DA 3CZQA 4TYNA 1HLGA 5EJAA 3CZCA 1UBUS 3U3RA 2ZYWX 5F12A 2R8ZA 4K6GA 3WGJA 2P9GA 2PX5A 1NM5A 3BCUA 4RENA 5F1KA 4BVBA 3A1TA 2XY4A 1M2JA 3IKJA 1ZONA 2VTBA 1D1TA 4CDGA 4QUHA 4B7ZA 5LZ9A 1TADA 3G5TA 1JE1A 2WVJA 3DCYA 3R7DA 2FPIB 2XGJA 1DZIA 1NFQA 1IRXA 3P4UA 4ALIA 4D02A 3RUCA 3E23A 3KK0A 1JLLB 1T8RA 4IIVA 3TTTA 1R4NA 2FP4B 2QMQA 4GAEA 1E6LA 2CNWD 1BVUA 5DYYA 3F73A 1GG2A 4RVHA 4JC8A 1RWQA 2EARA 4Y2XA 1Q74A 4A2PA 2HWWA 3R44A 1KO8A 3QLJA 4WY8A 4DJTA 4F5DA 4KDFA 4EUKA 1E99A 4DBZA 1YHZA 1FSFA 3EVTA 5GONF 4YJKA 4MIOA 4OGKA 1OWMA 3BYZA 2ZCJA 1EWYA 1TVMA 1TZJA 1PTJA 3CSUA 3D8RA 2J9FB 3H6GA 4I55A 4BRSA 5LQCA 1JEYA 1HE3A 2PPVA 2VJMB 4TKUA 3I2HA 2JIQA 2J3DA 1BEZA 1ZR4A 4D0SA 2A6PA 2ZUBA 4LMAA 3N6XA 5AKJA 4MHOA 3O4IA 1EJ2A 3G02A 1Q6YA 2GCIA 4A2CA 1SQFA 3S3TA 4HG2A 4Z1MD 3STUA 4Z7JA 3LLSA 2AXNA 1O6BA 1SURA 2OY0A 3MIZA 1RIIA 1Q0ZA 3K9NA 1OHHA 1X87A 5C81A 4L27A 4JYAB 3EDMA 4MKHA 4MVJG 3PUZA 3BXEA 5EP2A 1Z6YA 1SNYA 3COPA 4CFYA 4KQ1A 2AN5A 3QELA 4MW9A 4FFWA 1PX0A 4S3MA 2NN3C 1C1DA 3TMKA 4GMDA 1U1FA 2P11A 1D4FA 1ZOPA 4UEKA 3IAM1 3VC3A 1F2TB 1EINA 2AJTA 3LMKA 4AZ0B 4RF5A 4DQVA 4KMOA 5FFNA 5CVUA 3RU7A 4C29A 2PMEA 1US8A 3U44A 5BXYA 3GL9A 3GW8A 3Q6NA 1BMTA 2JKZA 3HSSA 2EQBA 4C7BA 3LHFA 3ODPA 1YCGA 5TIIA 3L18A 3TECE 1IBLB 4QDKA 2JH3A 2DBQA 2E5FA 2I6GA 5IUNC 3WGHA 1ENPA 2D4AA 1T3LA 5TJHA 2VHUA 4D56A 1GR1A 3NANA 2JFQA 3RSOA 1VL5A 3I3SR 3HNOA 4LDPA 1VJRA 4PHCA 4TRNA 2XRMA 3ZVMA 1RXUA 2IZ5A 3B1YA 3OJ0A 1NMEA 3V8MA 1T0BA 3EHDA 3UBTA 1SBTA 2WB4A 3MHPA 3U7RA 2ODBA 3UCEA 4ARSA 5HKKA 2QJOA 1UDBA 3F6SA 3JSXA 3OPVA 4KLCA 1T6YA 3FWNA 3ZY5A 1OFUX 3T3NA 1RXCA 4TKVA 2EZTA 1A8IA 1ZIXA 4DWOA 1YAHA 2YUTA 1T1IA 2G83A 3LXXA 1ONPA 4MRAA 1Q7CA 3ZD7A 1DWQA 2I9KA 2RGEA 1BROA 1U7HA 1XN4A 2EOAA 3H1TA 4GLLA 4YASA 4YJ3A 1L3IA 1RKVA 4PXSA 7ADHA 4ZFNA 4LCBA 2J6IA 5BORA 3ANMA 2V74B 1R0KA 3F7TA 4WNYA 3IO3A 5F23A 1JEQB 3TRIA 2A9VA 2GLTA 4XASA 1TU0A 1JJ7A 3A4IA 5ESRA 3E7XA 1T4CA 3FWPA 3WBJA 4EF6A 1GGMA 1SQ0A 1UWVA 2MSWA 4P34A 3H5VA 5FD8A 2DUWA 3FF4A 1PT5A 1YZ3A 2QR3A 2AFIB 3S81A 4DUYB 4QBKA 4JD5A 3NYWA 3ER9A 4AKHA 4YGXB 1RPTA 3TZCA 4E2WA 1QUEA 2QWXA 4B84A 4B3SB 4QT0A 5CB4A 2YV1A 1KQOA 3AZPA 3SM3A 3NC4A 4EH1A 1QG4A 5KTTA 4KHPB 2BCGY 4IG9A 3KYCA 3L77A 5DGXA 5K1ZA 5GADl 3ZNNA 4P4SB 2OCPA 5KUTA 1U2EA 1NJ5A 3JARB 1SCBA 2WG1A 3LE8A 2HAEA 2ZT6A 3E9EA 2ST1A 2C92A 2XDWA 5CVVA 2WD9A 5J40A 4BCCA 1I8TA 4L5YA 2M2IA 2PBLA 1TCVA 1NMYA 2ZYRA 2IY7A 2ABWA 3RVMA 3S55A 5IUJC 1R10A 2BVNA 5KNBA 3PD7A 1JDBC 1UJNA 3QU7A 1GZ4A 1KBZA 3W8DA 5EP4A 4C6TA 3O47A 4G0WA 2FPGB 1C30A 2QTAA 1COWA 4XJVA 2BDTA 1FFSA 1OE0A 1X1QA 3N6RA 3UG7A 4E03A 5D5PA 2EBFX 1YMQA 4OV6B 4EYSA 1J7JA 3EBPA 4L4ZA 3G23A 3ECAA 5EVJA 5J4KA 4FJ0A 4XDYA 3NNDA 1T36B 4NYIR 1JAIA 2J7PD 3CCCA 4Z0PA 1CBUA 3TZLA 5LDHA 5CFZA 3E5RA 3ESQA 1T0HB 2C9BA 2FUNB 2XF2A 1P1BA 2O3UA 4RZ3A 2OAP1 1QOPB 1PU2A 1B00A 1AUPA 3BD7A 1CIVA 4FT4A 4PZCA 4RABA 3RIMA 3VYWA 3S5UA 4O4HB 2PD3A 1IWPB 2CHGA 3GEMA 1EVIA 1C8VB 16PKA 2PXCA 2VAPA 3OE5A 1FMJA 5HIKA 2VRNA 1JR3A 3CMCO 4M2LA 1XTJA 4IQ4A 1A2BA 1TK2A 4L0DA 5DWVA 4MAAA 3GJTA 5IVIA 3IQDB 4BUCA 1O2DA 2IEIA 1JHPA 1RS0A 4YACA 2EF0A 2V7GA 2VRBA 3KQVA 1OZFA 5AM2A 1ZITA 4UM9B 2D1SA 4DZZA 4E5DA 5BSWA 4QU8A 4XH9B 4EHIA 1UFRA 1QG0A 4PSUA 1ODIA 4AMYA 1I1HA 3BVPA 1E1CA 3GT4A 4RPKA 4BVGA 2VDOB 5LQJA 1TDJA 1EVYA 4XVQA 3CVOA 4E1BA 5D5HA 1AKWA 3PUWA 1U9YA 1ZD1A 5ED0A 1GFWA 3EG9A 4LAFA 5ENZA 4ZRNA 3HUTA 4G09A 2Y99A 3KKEA 4OQZA 4HAWA 3KEGA 3IURA 4KJXA 4QSMA 1M6HA 3I8SA 4JKIA 5LWQA 4GVPA 3WJAA 3ORFA 4I4CA 4WECA 5FPSA 1ECLA 1FVOA 2RH4A 3WK6A 4IV8A 2D2VA 1MR3F 1LD3A 2F4NA 2A0FA 2BEKA 2FPPB 2FVYA 5FFFA 3ZTYA 4KQIA 3GRFA 2AUNA 1MUUA 3R3SA 1DS6A 4EF4A 4DW8A 1QX3A 1G0NA 1UJ6A 3AI7A 4UVDA 5AMXA 1G3MA 3MCWA 1GITA 4OY3A 4ZV7A 4AJ2A 5IJAA 3I2YX 2IX9A 2W00A 3K8QA 2Y66A 3B5EA 3UF0A 3GCXA 3DZKA 2WM9B 2IXGA 2PUCA 1Z3CA 2BFCA 2RBEA 2YMLA 2HA4A 3CWCA 3REFA 2BHNA 3LO8A 2QGFA 1XTQA 3EAGA 4PCLA 5DYTA 3ZD8A 1RRMA 4LRWA 2BHRA 1Y5NA 1IU9A 5HM6A 2YCBA 2HSZA 3PFKA 1U9IC 1O94C 4ETWA 4GZ5A 5M04A 5JW6A 2AYXA 3RM3A 3N58A 4Q0MA 4LC9A 3F90A 2C97A 4P3YA 1JDZA 5BYAA 1QJCA 2EFJA 3BZBA 4FK8A 4BGEA 4G0UA 4OFBA 4ZYLA 4ZVNA 3FKSD 3ORQA 1RD4A 3CNLA 5KTNA 4PZAA 1OUMA 3JQBC 3E3NA 4ZCTA 3SEAA 3IYLW 4ZI7A 3CNQS 5DGTA 1NTRA 1QVAA 4RMJA 4WZ6A 4LE0A 1QP8A 5AVQA 1IM5A 1BCRA 2QVGA 4JBNA 4DA8A 2HHHB 4COOA 2BFNA 1BVYF 3U61B 4LYAA 4DZRA 3GCDA 2O3SA 2VYCA 1XCPA 3RYCB 3OZXA 3F9RA 3IE1A 3NHYA 5AI5A 3I1IA 1ZA2A 3BGDA 2XF8A 4K46A 2VJKA 5LMUB 4D3ZA 4JJGA 4BX9A 2OSVA 4JCCA 2E21A 1A88A 1Y5LA 4YI3A 3IESA 5C1OA 2OQRA 3BJZA 4QQ8A 2ZYVX 5FR2A 5F73A 2UVDA 4X71A 3I12A 5FPPA 3IBCA 1F1JA 1PJBA 4FOLA 1CE8B 3I58A 3PUHA 3RKRA 4RULA 3SX2A 4R8LA 2YJ5A 3FUXA 5H83A 4BFLA 2GNPA 1YDFA 5CDUA 4MW2A 2GZ2A 4BB6A 1CQPA 2H1LA 2NTEA 1UODA 4Q03A 1CUZA 1JDTA 1H8HD 1KH2A 3PNVA 3ASUA 4GP9A 3ZDRA 3DONA 1QQTA 1RADA 4RETA 1KDYA 1YIOA 3THRA 5HBRA 5KPJA 2QSUA 3SQMA 4BEWA 3LRTA 3G9XA 3DZ8A 5BUZA 4BP8A 5HGJA 4EECA 3DVAB 4WKCA 1DPFA 5LFAA 1HQKA 2FG7C 3D6AA 4D2IA 3BSWA 2KHZA 1UZLA 3GEEA 3UPDA 3UV6A 4HQ6A 1KU0A 1ZGZA 2ACKA 1FFDA 2FZ5A 3B9RA 2QRVB 3GOHA 4FILA 4TM7A 2FSGA 2JLVA 2E6UX 4NEHB 1EVKA 4BU1A 1JNYA 1QDLB 3GNSA 3I1JA 4ZT6A 4F6RB 1SJ9A 3WC4A 3IDSA 3PQ6A 1T0PA 5JASA 3DDUA 1PI3A 1M34E 3OLYA 1VE9A 4Z9BA 1DB3A 1G4AE 4Z3DA 4YN3A 1HDZA 2WSLA 2P6NA 3O4FA 3EA5A 1WHTB 1BD4A 4G0PA 1Y1LA 4CMIA 4IS3A 4PLWA 2NVUB 2VNJA 1QHXA 4EKIA 4FN5A 1EUCB 4M0KA 3GJ0A 5A4FS 3V4PB 1JU4A 2YBEA 1SEVA 4HNAB 4RV4A 3D81A 1BG6A 4RNDB 3IAAA 2QN2A 1XTSA 4X1IA 1YMUA 1QV6A 5T4FA 2CBGA 2A3NA 3WKBA 4WKGA 4ZMRA 3GH1A 5LUAA 3TQIA 3PIRA 2R9VA 2HBQA 4PANA 2GYUA 3MJTA 5E9AA 3FJOA 4TPKA 5E4JA 3T06B 3AF3A 3PGVA 1LBSA 1QIJA 3HNPA 1BFDA 5A5GA 3BCHA 1Q17A 2VYND 1XYYA 3BWMA 1BE6A 1HT3A 2ENWA 2R60A 3GLHB 3OX3A 4GRAA 1NJGA 1QLJA 5B2FA 5CFMA 3SP1A 4MDEA 4OYLA 4X1OA 4QZVA 2GX6A 4NIMA 1GADO 2GJAA 1KI6B 1U90A 2OCAA 4FCTA 2V7PA 3AUJB 4EW6A 2GPTA 1TW3A 2DHEA 2QTHA 1L4BA 4KE9A 4O4JF 3HTXA 5L8VA 4Z7QB 4DPLA 2EZUA 3OEYA 1V95A 1D03A 1DBRA 4RZHA 3T1OA 4E7PA 2P4SA 1KZGB 4MITA 1FU8A 2X9GA 3PF9A 4WXHA 5BUCA 2YZKA 1WUYA 1Y8QB 4Q39A 3UC5A 4G8CA 3B8EA 4MUJA 3Q1KA 4GOLD 2VNHA 1F9EA 2HA0A 2FX2A 4FXOA 4TXNA 1U2RA 4YX9A 2C57A 4Z54A 3KJHA 3O93A 1U9CA 1KDOA 5C37A 3V4OA 4KQCA 1AQLA 1EXWA 2QZZA 1Q44A 1LPMA 2C5GA 2FMKA 2QX7A 2ZP1A 3G85A 1LDEA 4NCKA 2M6LA 1DKRA 5BN5A 3PEWA 5FBQB 1DAEA 3DOFA 3WR5A 4D9MA 4JT8A 4Y1RA 2X7HA 1KBOA 1UOPA 3KRTA 1CCWA 2G88A 2QUKA 2R86A 2WP8J 1P2VA 3NBQA 4LGVA 5IC5A 4XQ0A 3A2NA 3R8XA 3TEJA 3HFRA 4UKDA 1BYIA 4GQIA 1I51A 2IYAA 3HN7A 4GR5A 5IULC 2HI0A 1KYXA 1OR8A 3AF5A 5EWMA 4UUPA 1V16A 4BC1A 2CLDX 3FRIA 3O7MA 2HZ7A 4J0DA 1P72A 3RSFA 4M86A 4AYXA 4QXOA 2QTNA 5C7YA 3SKYA 2TMDA 1Y0BA 1D07A 4CLEA 2Z5VA 1XRJA 3BIJA 3N7AA 4Q5IA 3WWEA 5LIPA 4W5TA 3OKFA 2IBMA 1CEXA 2MINB 2CVHA 5D51S 2PRIA 1AZWA 4C4AA 5TGDA 1EXVA 4QXMA 3OJCA 2OHVA 4PX3A 3PNPA 3H42B 1QFMA 1SMKA 4CM4A 1PL6A 2VHWA 4OJKA 3S0JA 4GM1A 4MS3B 1NE2A 1CETA 4HDSA 4RVFA 4Z4IA 1IY1A 1XLVA 4QRIA 4LXGA 4RHYA 2QI9C 1N2JA 4GD3Q 3SN6A 3TLMA 1IEXA 4Z99A 1L7XA 2IZ6A 5G1OA 2J1LA 3CYFA 2RGNA 3H84A 3URKA 5FPTA 1CPYA 1V4NA 3ZGNA 4DCSA 3IV6A 4LRTB 1N2CE 3I23A 2ID4A 1BKSB 1ESNA 3Q3CA 4PLHA 3STXA 4EY6A 1EFPB 5DHTA 1Z0KA 3FX2A 2DBYA 1ND6A 3L8GA 3NDPA 1SN7A 2WPDD 1Q6ZA 1M72A 4FHFA 1BW9B 2VP4A 1GFIA 1BDJA 2GD2A 3EUEA 1H5UA 4GI5A 4DCTA 5CDSA 4NAVA 1N6IA 1B6RA 1JFFA 2PT5A 1UPUA 3TSAA 1J5XA 3G2JA 2PQ2A 3KVNA 4DXAA 3L1KA 4MKGA 5C8ZA 3L4JA 1T8TA 5GZ3A 3V00A 4FI3F 3MJVA 4Y2RA 4OG2A 4RMGA 3EEQA 1X8KA 1UMCB 1K9VF 5IPFA 4XD7D 3R76A 4CNBA 2RIPA 4DMFA 2COKA 1T5HX 4AS1A 4DG9A 2WWGA 3QU5A 1YRYE 4KQEA 5KNDH 2P4HX 4JUBA 1ZXLA 4KBFA 4GHWA 1XTPA 3CO5A 3AG5A 4F8YA 4KIWA 5LP6A 1P2GA 3C4VA 1R37A 4CL8A 4AO8A 3J80A 5JYBA 2FNAA 2ZSBA 3OMWA 5F4ZA 2GPNA 3NIFB 5AHKA 3I64A 2WFAA 4RIIA 1S2OA 1V8PA 1RXYA 1LJLA 2OFWA 2V8BA 2W6PA 3BIWA 1UC5B 3HB4X 3SK0A 5JD3A 3TSYA 4FUQA 4PGAA 3OPQA 3VR0A 2YOFA 1JB1A 3SBXA 1E61A 5DE3A 1JQDA 1CNMA 4EFMA 4FYPA 1ZD4A 2VDWA 1TEVA 2W2VA 3G88A 4UDXX 1RCFA 1TB4A 3TCXB 5EFZA 5K6AC 3WKEA 1DXOA 4HFMA 3T3IA 5FDFA 3WB2A 1CR2A 3VAZA 1NC1A 3W6PA 3QBDA 3PHBE 3UJ8A 2VCEA 3WLEA 1TYEB 5EHXA 2CMGA 4R9RA 3A3PA 4IIFA 4QYMA 1O0BA 4E51A 3QUBA 2OVBA 2B8TA 3R5XA 4H0NA 1LDNA 1Y9DA 4YUXA 5DI3B 5AW3A 1ORTA 3D6FA 4GZLA 4M0MA 3WL6A 4RORA 1CW2B 3TB4A 1UDCA 3GLFB 2WHQA 2IEZA 2Z9DA 4JNCA 2GYWA 2V45A 4JYMA 1ZHOA 4OA5A 2AJCA 4GKJB 4D4IA 4RTMA 1SHJA 2ZOSA 3EGDB 4JX9A 2PCLA 3BWBA 5AI4A 3S1AA 5CJPA 3TW8B 3G2NA 3ZNPA 1G7SA 1YGYA 2A0KA 2H7YA 4JYBA 4ODIA 2OYCA 1H2WA 5ER9A 1Z82A 3ROKA 1LS6A 1XD9A 3CC8A 3BS4A 1P7WA 4MNTA 4ROSA 5D84A 1ZK3A 2ZIEA 4LYDA 1L7DA 2LW7A 3M1YA 2NZYA 5H82A 4B5KA 2JGKA 3Q3VA 4YAFA 3Q9LA 2Z5GA 2KS6A 3H2GA 4LJ7A 4GYJA 5HNKA 1DAHA 1FYDA 1HDOA 1IUKA 2Z08A 1J8YF 2P0YA 3JASB 2A0YA 3KFLA 4F9EA 1AE1A 3A2MA 4EMSA 2ZR0A 4JJKA 4OHBA 4LJSA 3VNAA 1L0BA 3FKJA 3HMQA 2ODNA 4RM3A 4LSGA 3G2LA 2HQOA 5L6MB 4AKIA 2R66A 2VTVA 3MCZA 4XOUA 4MQBA 3ENQA 3UATA 1I6KA 3K1TA 3PGA1 4HTFA 4RS4A 5IN5A 3OHMA 4N0PA 4PX9A 3LY7A 1P4RA 4TRJA 4ASUA 1M7GA 1T9DA 4MS4B 5EZYA 1WQ3A 5DKFA 3T38A 3JQ6A 2VN8A 5DOZA 3GMDA 2VSFA 2P5YA 1SG0A 4CV0A 3EIWA 1ZICA 1DRKA 1DOHA 3AFOA 5IN4A 1O1YA 2NUPA 4M9UA 1J5EB 1ZI6A 4IXMA 1QP0A 3A1SA 1G5TA 2X8AA 1P74A 3AGPA 4GOKA 5FOTA 5K3EA 2E6KA 1OXXK 2D4HA 3RV4A 3H83A 2IF0A 5TPWA 1W581 4C22A 1NAIA 3BICA 1MX3A 1AKRA 3JQAD 1A95A 4G36A 1T4MA 3NTUA 5BN3B 5M29A 3V1LA 2BFFA 2R8PA 2JBWA 3GAAA 1V7PC 1N3LA 4G5HA 4IDBA 3ZDZB 4WKBA 3E35A 4XX0B 4P7BA 1UZNA 5IVKA 4NCAA 1VYUA 1ZK2A 1ISFA 2HUPA 3G3EA 3AM3A 2BZ1A 4KACA 3CLHA 1VGRA 1W7AA 2FZWA 1MHTA 3G0IA 4NDNE 4XLTA 1X74A 5CITA 5JBIA 3P9RA 4UCXA 1GPYA 2X3UA 4G8DA 4ZCMA 1JEJA 3T5BA 3Q6IA 1MIOA 3PVZA 3EXEB 3QUCA 1HKUA 1QAQA 1F2UB 1ZUWA 2XTZA 3KDAA 1JSCA 4I4TA 2HCTA 2VQFB 3EZLA 1TD9A 1WJGA 2R2AA 1RLJA 4DWVA 3G89A 5JAZA 1G8JA 4C07A 2RJOA 3ET4A 5I9SA 3HKDB 2JVKA 1NFRA 1XP5A 4EHDA 3ANTA 3HDGA 3LYUA 1KFKB 4PC2A 4YRIA 3GYGA 3UA4A 2WIBA 4NNJA 3PFHA 2J8ZA 3LFTA 2YTZA 5LP6C 1GL9B 3QG1A 2JDID 1ISJA 2A94A 2H18A 3A4YA 3DAOA 3H0KA 4NOKA 2X0IA 1N6LA 3DH0A 5I7OA 5T3YA 1M2HA 4BATA 4M1ZA 3T7CA 2D8MA 4D99A 1HQCA 4KKXB 3EDYA 4BMCA 3K8OE 2VF7A 2NG1A 1PW7A 4DEVA 2EWVA 3QLVA 4LZNA 3A04A 2FWIA 1I80A 4RAOA 1G2IA 2VZ8A 4IF6A 1AN9A 1N2IA 2WWXA 3D8SA 5JS2A 3C3CA 2J9GA 3RQSA 4C87A 2IYNA 5FNVB 1U0BB 3IOCA 3PR1A 4CIAA 1GM5A 1DAFA 4LJ8A 5IVPA 1L8XA 2O2YA 1R0YA 1Z4QA 3GD7A 3NTLA 1J7KA 1QF9A 1ULZA 4RPJA 4WESB 2XKJE 2FN3A 3N2NA 5H3CA 3RJMA 4D3YA 3OQNA 3KQUA 3THYB 2PZKA 1TMKA 4D1YA 2Y0CA 4AJPA 4MJXA 5T6BA 1QPGA 5BPFA 2UZ3A 4CMBA 3L1VA 3AJ9A 3RHTA 1MTOA 4PZEA 3ZIAD 5IU6A 2W11A 1FJ2A 5B3LA 1EU1A 5BW8A 3G2QA 1UJ2A 3LA8A 3ODGA 3SU8A 4FGJA 3KYDA 2O0KA 1G20E 4FW9A 4QVGA 5CH3A 4DNPA 1F48A 3TZKA 1B8PA 5D87A 1XCGB 4A23A 3L06A 4IX9A 1E60A 4N6GA 2VQDA 3T3HA 5DHRA 5F64A 3UMYA 1CJSA 1SBNE 3W4JA 1E79D 1U3FA 5L7TA 1W5FA 1KMQA 2GZ1A 2WSMA 2OHFA 1WCXA 4EGJA 3R5TA 4TSFD 1NW7A 1TUIA 4LV8B 3HBFA 4AQ7A 4DAOA 2AG6A 2DUNA 2BTQB 2V7UA 3MJSA 1E4EB 5CT6A 2VYFA 4CUJA 3MXOA 4BQNA 1PK9A 5A6SB 3OH8A 3DLIA 1ST3A 4KLNA 1ZI8A 3KUKA 1E3IA 4LXQA 3WNQA 5COAA 4BRWA 1CJMA 2OBYA 3GG9A 1IAVA 3PE3A 5A1JA 2Y1FA 2VJCA 5DSTA 3CT4A 4P35A 2IJGX 2ODPA 1LPPA 5BNIA 4JLJA 1W2HA 4BCDA 3WZ2A 4EGFA 5EWJA 2QNBA 3KEQA 2D7DA 1JLSA 1Z7GA 1ZJZA 2W4IA 1E64A 2REBA 4Q3CA 5FA6A 5U9CA 3A7DA 3DEZA 1TECE 2IXAA 3ESRA 3VZBA 5KAMA 3BTOA 5KJEA 2AT1A 3VPGA 1G9XA 3ENKA 5HZKA 2O8FA 2CCGA 1NDQA 3F6CA 4MVJM 4CM9A 4X6LA 3UNXA 4F60A 1PL0A 4RHXA 2FQXA 5DMHA 1JG3A 2HA2A 4MROA 3NKLA 2HT1A 1BXGA 2Q21A 5DHSA 1YOVB 5KDLA 4PYRA 3GQVA 4JZYA 4M3NA 1WU8A 2AXEA 4RK0A 1JHOA 3SDBA 4WBNF 1SKYB 2FMXA 3PSAA 1JFLA 5D1NA 4BNHA 1OAOA 5IJ9B 1RMYA 1C8KA 5AM1A 5L45A 2FMIA 1RLMA 2QRGA 1BTOA 2LPMA 3VNRA 4BYGA 4IJVA 1JMKC 4NH0A 3VNBA 3O8BA 4KPFC 3UA3A 3DSRA 2I34A 3PC8C 3AU9A 3WIDA 3DE0X 3D8UA 4RJKA 4B43A 1MKYA 1EDEA 2HA7A 1J22A 1YJ8A 2M6RA 3PX3A 1UM9A 2AW5A 3KAKA 3H9CA 5JQWA 1KGSA 3ZE1B 2FG5A 3AESB 4U6QA 4YBRA 4COKA 3AKYA 3PDUA 1USIA 1A5SB 4L3OA 4A27A 1SG6A 1D1QA 1T8WA 2BKEA 2F59A 2ZREA 4EDHA 1N36B 4GXNA 2IH4A 4FQ7A 1M8PA 3HSKA 5LJLA 4AF8A 1X70A 2PUHA 4RLFA 2NO7A 1M1NB 4G4GA 4W9MC 2GRAA 4QQRA 1WMEA 4DARA 1AKNA 4DLAA 2JGDA 4YVFA 4L6AA 3IOBA 4LQDA 3CR7A 4IVQA 4X92A 1G1AA 3E3OA 1UF9A 2VBIA 3NNSA 4U00A 2HJGA 4B3GA 1DKUA 2HCRA 2R7MA 1UPBA 2XTJA 3G7SA 4ZQBA 3VR6D 3SXUB 3AHEA 1RZVA 5DI9A 3EIEA 4OU5A 5H5JA 3ROQA 1W93A 2F17A 4YMWA 1XHFA 4FFBA 1SA0A 3WSVA 4YV2A 4S2UA 4NPAA 3ZN2A 3AWDA 3R7LA 3UJ3X 1WE2A 3ZX5A 3OCUA 1E9AA 3NCTA 4BEVA 4L0CA 3JWJA 5KDDA 2Q9BA 2W93A 3I9FA 3W2GA 4OP1A 1AGXA 2O4UX 2LKCA 2Q1TA 4LF9B 3HCAA 2ZVPX 4C0JA 2ZS7A 1YQQA 4HYTA 4JSYA 3AKDA 4M4SA 3CLRD 5DVZA 4BBAA 3WLPA 4JDPA 2AOTA 5JNTA 1NNEA 2IS6A 3G6WA 2ZUEA 4N7MA 2ZRJA 2DERA 3OF2A 3V80A 1FDRA 4GMHA 4ZO9A 2QD5A 2OHXA 2RAUA 4F11A 2H2DA 4YJFB 1YBFA 3QKUA 3UWOA 4BWGA 1RJWA 1LPAB 4OXYA 3L5OA 4NCNA 3ZLUA 2Z6QA 3INYA 2HRRA 4Z7NB 2AV6A 1IG0A 3HPRA 3I6QA 2H48A 2OCBA 2O2DA 1GFSA 2VJPA 1UP7A 3OOHA 4ZVSA 5J2UF 3HI6A 2UZ1B 1GQOA 1L4NA 1P39A 1G17A 4YDSA 1Q2XA 3A3KA 4BE7B 1QQBA 1YCDA 1TKRA 1Z33A 3D3JA 4R31A 1ZCAA 1AV7A 1V8BA 1XPRA 3I9V1 3MT8A 2O2CA 1F0PA 3I9OA 1ZGCA 1VL8A 2AVDA 2OG2A 4UZEA 3DE6X 2CLEB 2FZGA 3FLBA 4UU8A 3ZGYA 1XGKA 1RI5A 2GTIA 2H4HA 2X5JO 3OUTA 5IJ0A 3DYIA 5T4HA 3RYFA 2JLYA 2P6OA 4F4HA 5L3SB 1C3EA 1NP7A 3ETJA 1Y6FA 1N6RA 2OR3A 3PE6A 4S24A 3SF8B 2X3FA 4MDHA 3RSGA 2PFKA 3FVWA 5CDTA 2XT9A 4HDMB 5BV2P 3ED1A 4V2UA 4BMNA 1N3BA 1TIKA 2CXQA 3B48A 1MRNA 2PZMA 3HBMA 3RRZA 3VR4H 4A2WA 2X40A 5JYDA 4GLJA 1W59A 2O7SA 5HK9A 1TA0A 1U7OA 3NDRA 4AJOA 3TPCA 3E9QA 3MZ0A 2JJ1A 4IWXA 2H3EA 5HE8A 4N4AA 4JC0A 3K70C 221PA 3D7RA 1YZFA 5LUBA 2NLOA 1VBKA 2C4UA 2K2QB 4O8CA 4PW0A 3S70A 4DA7A 5B4TA 5F4BA 3GLUA 3RWMB 4C0WA 1QHYA 1GWNA 1GUYA 3O8LA 2Q4TA 421PA 1T5LA 2R3SA 4Y9SA 1XQ6A 5TY0A 1IUPA 1KDTA 3C3JA 1OI3A 1L4MA 2Y1XA 3TTWA 1ENOA 2EJWA 1T13A 2B3DA 4N49A 4GXTA 3ZWWA 2Q0SA 1D9XA 1R2QA 2NXEA 1ESZA 1CUBA 1HYGA 2QW0X 4GX5A 3RJZA 5CCDA 1B7GO 4GPTA 3MD0A 4S12A 1U7UA 3OQJA 1O95A 2XGMA 3CONA 3QI2A 4IH9A 1U0TA 5IG2A 4YCDA 4ZYXA 4BV9A 2ZIUB 2OL4A 1G6OA 3V6LA 1UDWA 3NIWA 4I99A 4ZQHA 3D8NA 1R18A 2H2HA 4BCBA 4EG7A 1XZBA 3GELA 1YDGA 2QNIA 1NRXA 4MA4A 1SKUA 3BQMB 4NYMQ 3N7UA 4DCGA 2YL2A 1Z4PX 1UBLS 2JFNA 4EHJA 3PDHA 4S04A 2YXEA 1I4LD 4AKSA 5DSXA 4KGZA 4NAHA 4CTMA 3H4TA 3ZHOA 3CX3A 1SCAA 1YZQA 1RYMA 5EHQA 3JZMA 3MWEB 1FS5A 1UBOS 2Z4SA 1QU2A 3GPLA 2AOTB 2Z1NA 1I3CA 2OV6A 3FCUB 3WLIA 2EL7A 4M1MA 4EX7A 1WXWA 2PH7A 3DJFA 1X14A 3FBGA 4JJZA 2IT1A 2VJDA 1UBCA 5JNSA 4RA6A 3C98A 3W2TA 2IEGA 2FTKE 2ZG6A 1T3SA 3UK0A 3VR2A 3VJRA 4RADA 2ALJA 1G3IA 2O3JA 3P5SA 3HKDA 2GDZA 2HSWA 2RGDA 3D5EA 3HZOA 4JS0A 4EW2A 5K6RA 3NHZA 4RZQA 2YIDA 5L51A 4N0DA 1R16A 3DQPA 1C3OB 3FMOB 3HY3A 5MN6A 5IAEA 2PWAA 3K32A 3NIBA 1L3BA 2Z09A 5EUMA 1U5BA 4RCYA 1TZCA 4LYJA 4QU9A 3JWEA 2WHPA 2P8SA 3ADPA 2VSXA 5J2UB 3Q41A 3LPNA 4FP9A 1QIEA 3I72A 5HMMA 5J5CA 2NVBA 1W0JA 5H0IA 1FPMA 4TLCA 3SLRA 2BUBA 1J2UA 2OA0A 1PR3A 3I9KA 3SZ3A 3WLQA 4XM0A 1P9RA 4K05A 3X0DA 1H6DA 2HTFA 3GDFA 4XX0A 2Q5LA 1IK6A 2CZGA 4HR7A 4QBTA 4BZQA 5J58A 4J0QA 1CB7A 2QLLA 4EZEA 2JD0A 1JQJC 3U7IA 2PKCA 2CNOA 3N2GB 5DCYA 3K0EA 3L0DA 2WQ6A 1DG3A 3QXSA 4HH4A 3IIEA 2CDAA 3U6KA 2ZRPA 3JQEA 1E18A 2H9AA 3PHIA 2ET6A 1RU3A 2VPPA 2ZWMA 1NN3A 3A6HA 4II2A 2BTOA 3C5HA 4NOJA 5JC8A 5KVVA 1BE1A 1OIWA 3AJ8A 2FZKA 3QY9A 4CDNA 2PFSA 1U1GA 5KNCA 5CPFA 2G0AA 5ARBA 4NU5A 5TQ0A 4LDJA 3EYWA 1EVEA 3N8NA 4UUNA