3NKLA

Crystal structure of udp-d-quinovosamine 4-dehydrogenase from vibrio fischeri
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
122
structure length
122
Chain Sequence
AKKKVLIYGAGSAGLQLANMLRQGKEFHPIAFIDDDRKKHKTTMQGITIYRPKYLERLIKKHCISTVLLAVPSASQVQKKVIIESLAKLHVEVLTIPNLDDLVNGKLSIGQLKEVSIDDLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of UDP-D-Quinovosamine 4-Dehydrogenase from Vibrio fischeri
rcsb
source organism Vibrio fischeri
molecule tags Oxidoreductase/lyase
molecule keywords UDP-D-quinovosamine 4-dehydrogenase
total genus 40
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2010-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nklA00
1KETA 2DM6A 2NQ8A 3JD4A 4DVJA 1C0PA 2Z1NA 3O8QB 2R2GA 4YAEA 1A4UA 1SPXA 5EPOA 2ZB7A 3TPCA 4LW8A 3EZYA 2EKQA 1YB1A 3AY3A 2VNAA 4XYEA 4RLHA 1VL6A 1OAAA 2HJSA 3DHEA 2C5EA 1H6CA 4BNZA 1GEEA 2Q2WA 4F46A 1BW9B 1P1KA 1QLJA 4CM7A 5T8KC 4NFHA 3GVHA 4CMIB 5I7EA 4YQYA 2X0NA 5CDGA 3U62A 5JMWA 1LSOA 1V6AA 3B70A 3WJAA 4IS3A 1F8GA 2NUAA 5IN5A 4P8RA 3FI9A 3FNEA 2GCGA 1E7WA 4H16A 4J9UE 3RUFA 1O0SA 1QR6A 3T7CA 1P3DA 3NEPX 4A0SA 4M1QA 2FHSA 3W8EA 3D5QA 1LC0A 1MGOA 4OXKA 5T67A 4K6FA 1GYQA 3EMKA 3D3WA 4BNTA 2X5KO 3LT1A 4GX2A 4DQUA 1ZW1A 2QYTA 3JCZA 4L4SA 1PTJA 5C7LO 1Y8QA 1ADBA 3ZU5A 4U0KA 1QV7A 2D3TA 5A9SB 2O3SA 1NFQA 3QVTA 5A4DA 4IBOA 5JAIA 1BDMA 1EVIA 1GCUA 1T24A 3TZ6A 4GI2A 2PY6A 1D4FA 5JW6A 2YYYA 5ER9A 4WLUA 4G65A 4M55A 1DXYA 4GX5A 4IGFA 4Q3BA 5CAEA 4WEQA 2WJPA 2WD8A 1E0DA 2AQIA 3DBLA 3LYLA 4F45A 4FDAA 2X0JA 1Z7EA 2O4CA 4H15A 2AW5A 2PZMA 4RVDA 4UVEA 4NBWA 4UUOA 1K0UA 1LEHA 2JKVA 3IQDB 2E49A 5IFLA 3I52A 4RL6A 1TT5B 3WGIA 3H4VA 3DBHA 3RASA 1HYGA 3ZWCA 1MFZA 2B4RO 1T25A 1VJ1A 4WPGA 4Y98A 3SX2A 2QX7A 2YJZA 2YY7A 2GO1A 2YV1A 3DL2A 3QQPA 2O3JA 1D1SA 3C1TA 4XQGA 2VWQA 5JMPA 5EL0A 2VUUA 1HLPA 2Y1OA 3AOEA 5G4KA 4EGFA 1U2GA 4NU6A 4WE3A 2DUWA 4AJPA 4XDZA 4GQAA 2VRCD 2Y1GA 1PQPA 4KP7A 1FDSA 3RCBA 1IHXA 4DTIA 4BGIA 1HWYA 1XKQA 5IDQA 1R4NB 1I32A 4D41A 3PJEA 4BO8A 2EHDA 3ASUA 1AHHA 3NUGA 2C2XA 2J8ZA 4OGWA 4G2NA 3MEQA 4IXWA 2V7PA 4B7XA 2B4TO 3FNHA 1V35A 2I9PA 3BHJA 4XYMA 4HXYA 1Y7TA 1E3EA 4MVJG 4HADA 4ND3A 1NVMB 5HTOA 3I23A 1DAPA 3K8ZA 3OJ0A 3ULKA 3LF1A 4GMFA 1HRDA 4H3VA 1UR5A 1UZMA 2AHRA 2AQKA 4YWJA 3C7AA 3I9OA 3B1KA 3GZNB 1UZNA 1XIVA 4DIBA 4B8ZA 5KJCA 4LRSB 2H6EA 2IE0A 4O63O 3LDHA 4D7AA 3OJLA 2VT2A 4XYBA 4PRLA 3PIIA 4XB2A 1HDCA 3BIOA 4QEDA 1HSZA 1CETA 2I76A 3JQAD 4AJ1A 3KSZO 5TX7A 3A4VA 3KHUA 4GAEA 4Q3EA 4XJSA 1ZSNA 4ROSA 3TL2A 3GLQA 4EDFA 2R00A 1UDAA 2WYVA 3R3JA 1MP0A 1NFRA 5CP8A 1KERA 4FCCA 4UUPA 1I3LA 3PGXA 2HO5A 2VRCA 2VYVD 4YRAA 5FWNA 3DXFA 4M89A 4R3NA 4Z9YA 3DZIA 2DFDA 3P19A 1DIGA 2XOXA 2HJRA 3VPSA 4JN6B 4CV3A 1Y6JA 4XB1A 4DMLA 2UAGA 2W2KA 4TMFA 4OQZA 1BW9A 1U3WA 4CQLA 3GN1A 1X13A 4PLGA 2X0RA 1HE4A 2UYYA 3RD5A 1EE9A 3MWDB 4L74A 2PWZA 3HUDA 1EFLA 3F5SA 3UUWA 3ZWBA 4DA9A 3FPLA 1K3TA 4S3MA 5TF4A 4BMNA 1GL3A 2B69A 4RVSA 2AEMA 3ZWPA 1PJTA 1YQGA 5FFFA 1P9LA 1ML3A 3AY7A 4BMVA 5ITVA 3JYLA 4TRMA 1P1RA 1TEHA 3FN4A 4OMUA 5U9CA 2JHFA 2H5LA 2QZ9A 2E48A 3KXDA 4LCEA 5G4LA 5TRTA 3VZQA 3P5SA 4WK6A 2PH5A 3SC4A 3F3SA 1NM5A 1UP6A 2R00C 1Q7CA 1KVUA 2ZTVA 1KY4A 5L9AA 1R66A 2PZLA 3LT2A 4YA6A 4ZD6A 1DFGA 4KUEA 4EUHA 1ZK1A 5A9SA 1K2WA 3BMCB 2J5RA 3WNVA 2IYOA 4IM7A 1ZO8A 2YHUA 5JCJD 3PFFA 5IZCC 1ZJZA 4ILKA 3DZKA 1D1TA 2DBRA 3D1LA 3O26A 4PG5A 5THQA 4CUKA 2QHXA 1H0KA 3SVTA 3LQFA 4AJ4A 5IN4A 4R54A 1JW9B 2JCVA 4ZQGA 5B4UA 1IUKA 1VKOA 4EJMA 3ITKA 3Q11A 1E1LA 2V6MA 3QSGA 5CDTA 1LU9A 5HM8A 3E9NA 5CDUA 1HDXA 2B35A 1LSSA 3I1JA 4WUVA 4M8SA 3VDQA 3EC7A 3W4JA 2FOIA 4BO5A 3LC2O 4J1NA 5COAA 1BVRA 5GZ6A 1A72A 1VE9A 1YL5A 4W9NC 4CQMA 1A4IA 4C7JA 3RC7A 5B4VA 2BI7A 2WDZA 1BXKA 3KOUA 1NQAO 1RYEA 5U1PA 2P4QA 4N5NA 1PL8A 4ND5A 4NG5A 4JBIA 3CEAA 1I24A 2B4QA 3K9QO 1SMKA 3K31A 4AJNA 1A9ZA 1E5LA 2V6BA 2BGLA 5I8ZA 1B3RA 4XIJA 3RQSA 3ZWNA 2NV6A 4R9SA 2UDPA 4RPKA 4HV4A 1KBZA 1ULUA 2GSDA 4KUHA 5MGBA 2NLOA 5HBRA 3DDNA 3X2EA 3IP1A 4YEDA 4NZ9A 2B37A 2HUNA 1U5AA 3BZUA 5C7OO 1DDOA 4U8GA 4N18A 5BSEA 4W4TA 4IIUA 5I7SA 3BMNA 4II3A 3VKVA 5A1TA 1GEGA 4YAGA 3U09A 1VM6A 1NHGA 5TIIA 4OOFA 3B1JA 3G3EA 4IZIA 4PZDA 5B37A 2DTDA 3JQBC 1ZXBA 2PD6A 4JNKA 4E2ZA 3RROA 4MP6A 4BKRA 4PLPA 3RUIA 4ZRMA 3HJAA 1YH3A 5A3VA 4BGVA 4RVHA 4IIVA 3C8MA 1UXHA 3CZRA 4YBZA 2CVZA 2VWGA 4WLFA 3DHNA 2DC1A 3F4BA 1DJNA 4KOAA 4XYGA 3QJ5A 5BNTA 1P0CA 3CPSA 5EERA 5ER6A 4X54A 2CDBA 2E4AA 4NK5A 1DEHA 1NFFA 4QFDA 2I3AA 4CMJA 1EUDA 2FZWA 3EAGA 4XEHA 1RM3A 4CLOA 1JVSA 2O7QA 5L7YA 1PU2A 5JS6A 2BGKA 3RU9A 1E3LA 3S2GA 4P4LA 4MKZA 3JQ9A 1N1GA 4ALMA 3W8DA 4JQCA 1I2BA 2ZQZA 4D45A 2VTEA 3EY4A 2GZ2A 3OJFA 1KVTA 2DFVA 4CM5A 4CMKA 1X1EA 2WEKA 3R0IA 3S55A 4FJ0A 5JO9A 4QO7A 1RYDA 3AU8A 3S1LA 1VSUA 4U7WA 2O3TA 1BRMA 3E6AA 3H9QA 4JJFA 5JDCC 1XEAA 3Q0EA 2Y0DA 3DR3A 3ZW8A 4C7KA 2D0IA 3JQAA 1LA2A 4CLHA 2ZATA 2EW8A 4O0LA 2CUKA 1XGKA 3IMFA 5ICMA 1V9LA 3IOYA 1SCUA 4XGNA 1JAXA 4E32A 2YV3A 3ZU4A 3PLRA 5L53A 2B5WA 3PK0A 4OM8A 3ETEA 3GNTA 4IZHA 2HLPA 3ADPA 3PLNA 4J43A 5JAMA 3PYMA 4CR8A 1JU9A 3H65A 2UUPA 3QVXA 3RC9A 1G0OA 4BO4A 2JFGA 4AL4A 3HFSA 1RM5A 3E48A 2V6GA 1ZCJA 2Y1CA 3H5NA 1PS0A 4D3DA 3ON5A 1W73A 1N8KA 4FFLA 3U4IA 5G0VA 5I7VA 4D79A 3RIHA 1ULSA 4QFCA 1N2SA 1F14A 1NHWA 2FMUA 2V65A 4BO1A 4BHTA 3AI2A 4CLXA 5JY1A 4TZTA 1LJ8A 2NTVA 1ZK0A 2AG8A 2PA3A 1DFIA 3VOSA 1YBMA 4OXYA 2Q2QA 4OQYA 4NU5A 2GF2A 2WWRA 1H2BA 3LLSA 4YT2A 1Z74A 4Y8VA 4DXHA 5CDYA 2OP0A 1BWSA 4PLFA 3ZWWA 4FC7A 3ZWMA 1PGJA 2GDZA 4URFA 3QVSA 3PJGA 4OL9A 3V1TC 1EUZA 1R0SA 1MB4A 4EW6A 4ZHSA 1LC3A 3RUCA 2Z5LA 2BD0A 2Q2VA 2FZEA 4ALKA 2ZYAA 2YFQA 1X0VA 3RI3A 4D43A 4E6PA 1BXZA 2X86A 1M75A 2Y1EA 3NAQA 4NPCA 2FY8A 1ISGA 3DEYX 2GR9A 5L40A 5DNAA 2VHVA 4BGEA 4BNXA 5B12A 3BMNB 1O89A 2E6UX 4NH4A 3IIEA 4CL3A 3OH8A 4N7RA 4CLRA 2SCUA 3CIFA 4GBJA 4B7CA 2VQ3A 4AFNA 2J6IA 3H9EO 1Y5MA 3ROPA 3WR5A 4MDHA 2BF7A 1T1RA 2GN6A 3WQRA 2Q49A 2G0TA 3FHLA 1GAEO 3KM0A 4P4NA 4DIFA 3AUAA 3CXRA 2DVMA 3P2YA 4L4RA 5BSFA 2D4AA 3DTYA 3CZMA 3ZCXA 4FIZA 3E18A 4D44A 3AFMA 3JTMA 4KUGA 3ANMA 3UH1A 3GHHA 4MVJE 1UJMA 3ICPA 3WOHA 4DL9A 1JWAB 1C1DA 3RC2A 3DTTA 1NAHA 1QKIA 1EBUA 3NDIA 4FFNA 3IUPA 1UP7A 3JD1A 1NQOA 3H5AA 3K92A 3O03A 1WWKA 3ZNNA 3U5TA 4NI5A 2D5CA 2EP7A 1LI4A 2D59A 1U4OA 4JXKA 1ZIDA 4IJVA 3W1VA 2IZ0A 2GZ3A 2DTXA 4GX0A 4JCOA 4J0FA 3SEFA 1XU7A 2DAPA 4WGGA 1QYCA 3RFVA 1DRUA 1IOLA 4R3WA 5F5LA 2O23A 5DDIP 4PVCA 4Y6PA 1XSEA 1LLCA 3V2GA 3WBFA 3F1KA 4Q3AA 2YZ7A 1FJHA 3D4NA 4PZEA 1O8CA 5G0TA 4HWKA 1GY8A 1LXCA 3HQ4O 3ZHXA 4BNGA 3H9UA 1B2LA 1ADFA 1DIRA 2I65A 4RGBA 1EK6A 4WCFB 4DPMA 1H6AA 4XA8A 3PQDA 4LCJA 1GZ6A 1PIWA 1LSUA 1SEVA 2XXBA 4CV1A 1E77A 1OC2A 5CG1A 5AXAA 1N9GB 1ZEMA 3DZFA 1W0CA 2FPIA 2JL1A 4DYDA 1TA4A 4N5MA 5K6AA 4UVHA 5DCWA 4DREA 1HZZA 3ZGYA 3INRA 4OSOA 2G76A 5A5EA 3HE3A 4WLVA 5L7WA 4HFMA 5JSFA 3KEOA 3RUHA 1A7AA 2EGGA 5BNIA 2O3RA 4UVIA 3O9ZA 8ADHA 3CMMA 2BFOA 4UEOA 5F21A 1QYDA 1ISHA 1ONOA 3G49A 4NBTA 1DC5A 2C7VA 3I6IA 1Z73A 3WQSB 1PGOA 4FB5A 1IE3A 1AE1A 4ESOA 1IPEA 3ZWOA 1DRVA 3OFSA 2EF1A 1IL0A 1PS8A 1NTOA 4B3HA 3DZJA 3I6QA 1OI7A 1C1DB 4MVJP 4D3FA 2EGHA 2XPCA 1N7GA 4MVJI 3TF5A 3WFIA 3D4PA 4R51A 3DOJA 2BELA 4R4JA 3FWNA 3HDHA 4NR0A 1SAYA 2ZQYA 1YOVB 1DHTA 2OORA 4LVCA 4UREA 4I5DA 4L8VA 1EQ2A 4PG4A 1MG0A 4XIYA 5ADHA 3ZDFA 4D0RA 3BAZA 3ZHYA 1VI2A 4L4XA 4DQVA 2CVQA 1TB4A 1A27A 3AUUA 4UEJA 3RC1A 1O6ZA 2GN9A 1WDMA 2J3JA 3FF4A 3ZW9A 4RF2A 4FPXA 1DAOA 1GZ3A 3H8VA 1NPTO 4CMBA 4U0JA 2JJYA 2QQ5A 4YYZA 1FK8A 4M54A 2O7SA 3F4LA 4XDYA 5F3RA 2AE1A 1M2WA 1B7GO 4FN4A 4QTZA 1PQWA 1PEDA 2ET6A 4KDFA 3JQ7B 3DOCA 3LZ6A 3EDMA 1C3VA 2NU9A 2GGSA 1LNQA 3OEYA 2WYUA 5EN4A 5IZ4A 3D64A 3UOGA 1G0NA 3ZV3A 1LDGA 2Q3EA 3ONEA 2IZ1A 4H7PA 1GV0A 2W90A 3PHGA 4EBFA 5KNLA 3ZWAA 3N74A 4OIMA 2W8ZA 5TJHA 2HMWA 3JQFA 3WFJA 4RF3A 3NDJA 4CM1A 1I2CA 2ZCUA 5JBIA 3OETA 5DBGA 3MTJA 1HSOA 5JXWA 4ID9A 5TNXA 3WGOA 1F06A 2AMFA 5ES3A 2VZ0A 4J4BA 4PZCA 2F1KA 1DIBA 4FBGA 1XQ6A 4WOJA 1E7RA 4AJLA 2FP4A 1ZXLA 4WASA 4MVJA 3JQEA 4GKVA 1W8DA 3AK4A 2Q1TA 5CEFA 4RV9A 4CM3A 4IDEA 3W6ZA 1UXKA 1BMDA 4R68A 3KSUA 5I7FA 1SBYA 2OL4A 3G79A 2NTJA 1ZEJA 4ZGWA 3FRJA 3DBVO 1OZAA 3DO5A 1XLTA 2X7HA 4HUJA 2X5JO 2A35A 4IJKA 4R1NA 3DAPA 4MIOA 2H1SA 2FR0A 1EMDA 2CDCA 2ZJ1A 4PLVA 3D4OA 4O5OA 4R5MA 2VWPA 2CF5A 3QLJA 3PWZA 3TZKA 5G0WA 4RDHA 3HSKA 2P9CA 3AM4A 4CJXA 1I36A 3F1LA 7MDHA 4W82A 3WNQA 4BUCA 4TKLA 4CM4B 1S7CA 3KVOA 5KJEA 1T2CA 1U8XX 5JLAA 3QY9A 5T5QA 4BKQA 3OA2A 2A9FA 2OUIA 2I5PO 1GADO 1I33A 1PSDA 1PGPA 3L0DA 1YVEI 1U3VA 5BT9A 4TROA 4CQMD 5JE8A 4LK3A 2O48X 1QORA 4EEZA 3FD8A 1U9JA 1UAYA 5C3MA 3OQ1A 4UUNA 4RQTA 1FXSA 3TZHA 3AFNA 1HYEA 4KWIA 4YJHB 3WGQA 2PR2A 3DOOA 4IDGA 2EJWA 3Q1LA 1H9AA 3MOGA 4JBHA 3Q3CA 4R1SA 1DC4A 3F46A 4GSKA 2I99A 1EE2A 1GUFA 5JFOA 1N9GA 4MOWA 1ZFNA 3FWZA 3GDOA 1ORRA 1H2HA 3C7CB 3PGJA 5ILGA 4ND1A 1L1FA 3AUSA 4J7XA 4YJHA 1ZJYA 1QRRA 2XF8A 4PCVA 1HETA 2UVDA 3I9JA 4E2YA 3KUXA 3JYNA 1PZHA 5FI3A 3L07A 1SOVA 4J49A 2GNAA 4FFMA 5DF1A 4PLWA 1NNUA 3K96A 4YTEA 3ZV4A 3U4CA 4R9RA 4TWRA 4E5MA 5H82A 2X1HA 3CH6A 1K6XA 3CSDA 1LRLA 3OICA 1YBAA 4O1MA 1ONNA 4JROA 5CG2A 2GERA 3KYDB 1LDEA 4Y6RA 4CV2A 2ZTUA 2CNBA 1Y8QB 2WM3A 1V8BA 1C0KA 1HE2A 3NTRA 3C85A 3ONDA 2C54A 4QT0A 4UVGA 4CLDA 4E30A 1GYRA 3PTZA 3M1AA 5TSDA 1B16A 3MTGA 3WGHA 3WSVA 3NJ8A 1M6WA 4Z9FA 3Q2KA 2A92A 4FSHA 3PJFA 2BI8A 3GF4A 1GPDG 1V3VA 1PL7A 1YQXA 4RZHA 2E37A 1ARZA 2CMDA 4Q3DA 2CD9A 2DLDA 2ZTLA 2NQTA 4A03A 3GVCA 4PG7A 4IJUA 3F9IA 4IDFA 4JP3A 4Y6SA 2NVUA 4GGOA 4IY1A 4PLCA 1H6DA 2JCXA 1YXMA 1G6KA 4FFPA 4NFSA 1VLLA 3CTMA 1YGYA 4W6ZA 3W6UA 4MINA 3UGKA 3GC6A 1ZNQO 4IJWA 2Q50A 4AJ2A 5JDIA 5KKCA 3ORFA 1WW8A 5TLSA 3UW3A 5KIAA 2DTEA 3DAFA 4CM9D 4P4GA 3ANNA 1UDCA 1NR7A 1WDKA 4FGSA 5I9MA 3V8BA 3H9GA 2CVOA 2D8AA 3V1YA 5DT9A 1RM4A 2JAPA 2P5UA 4J90A 4DC0A 3WXBA 4FC6A 4J2HA 5CFZA 2P4HX 2VCYA 4ALNA 1WVGA 1IYZA 2DKNA 4E5KA 4IPTA 1HL3A 4OKNA 2Q46A 4WLOA 4ZRNA 3HN7A 3UXYA 1DOHA 2X22A 1ZZEA 3ZV6A 4CMEA 2Y67A 2QW8A 3U9LA 3DAGA 2ZCVA 2ZK7A 1B14A 3BHMA 1XR3A 4YB8A 4R01A 3WLEA 3ZHBA 4DWVA 1LBEA 2ILTA 1BSVA 3L9WA 3GQVA 2X4GA 4P22A 2A4KA 3GG2A 3QWBA 1IULA 1E3JA 3AM5A 3R3SA 4WNCA 1Y8RA 3HFGA 1QYVA 2YDXA 3P2OA 4KQWA 3OIFA 4NBRA 4RO0A 3E1KA 4CM6A 2FRDA 5KOIA 5EIOA 4OHUA 4RORA 4IMRA 3GPDG 3PQEA 4IDBA 3IAHA 4K9DA 5THKA 4RZIA 3L6EA 5T6BA 2DPHA 2DUUA 2DBVO 2Y0CA 4FD3A 1T2AA 1WAMA 4L0QA 4XRRA 4D3SA 3WX0A 1NR1A 2CSUA 3G1TA 3WIEA 1OC4A 1FDWA 1BXGA 4J9VA 4ZICA 4ZU3A 4HKTA 1XQ1A 4J16A 1JKJA 4OKIA 3WTCA 1Q0QA 3PPIA 1E1KA 4RPHA 3FR8A 4MPDA 3VHRA 3DONA 1MG5A 3E03A 3QWHA 3IDSA 2H9IA 3H7AA 5HA5A 4AVYA 4ZN6A 2J3KA 1Q0HA 5L45A 5DZSA 1QV6A 1ZSYA 1ADGA 3H9JA 2Q1UA 4DQXA 4DLLA 2PZJA 4WCFA 5L4NA 1Y1PA 2LDXA 2X5OA 1LLDA 4L73A 3RBVA 4BNVA 2BMAA 2CY0A 3I4CA 1X7HA 4J1QA 1XDWA 4B4UA 2P9EA 1EDOA 5KWEA 2OO5A 1PL6A 4PLZA 3WG9A 2Q1SA 2VOEA 1IHYA 3ZN2A 4RCVA 1F12A 1T2EA 1ENZA 5IJZA 2QRLA 5KJ1A 4XD2A 3WTBA 1QMGA 4TKMA 4RVGA 4IMPA 1QYXA 5JO0A 3BHIA 5KJFA 4MP8A 1CERA 4W7IA 1WDLA 2O2YA 4OH1A 2BGMA 3RVDA 3UAGA 2IXAA 3I3OA 2NWQA 1BTOA 3JQ6A 3RKUA 2HMUA 2RHRA 3WGTA 3PHLA 4Z9XA 4CMAA 2QYSA 2NU8A 1T1SA 3ROQA 1O94A 4RQUA 1MXFA 2OZPA 1RPNA 6ADHA 4FFRA 1KOLA 2FPGA 4B8WA 3PVZA 3NRCA 4RVUA 4OJNA 1S6YA 1O5IA 3VC7A 2IEBA 3PIDA 5BSHA 4P38A 3CUKA 3KSDO 4Q39A 1LQTA 3ITDA 4BNLA 4LMPA 3I9MA 1CYDA 1HKUA 2XAAA 3JYPA 1F8FA 4ND2A 1E3SA 4GVXA 4BNWA 1KEVA 1R4MB 1YOVA 3PWSA 4WLNA 3LSYA 1U7TA 2QRKA 2X6TA 4TVBA 2OXIA 3UVEA 4QX6A 4U6QA 3M6IA 3G17A 1CWUA 3VZRA 3C3XA 4UUMA 4E5PA 1GR0A 4DIOA 1J4AA 3QE3A 1YL7A 2Y93A 1YO6A 3FSRA 3U49A 5CDSA 5CEJA 1JA9A 2Z1MA 4CV0A 1Q0LA 1QYWA 4CLOB 3AW9A 4QXMA 3TOZA 3NYWA 3EHEA 1K6IA 3E9MA 3NV9A 2VZ8A 3KO8A 1CF2O 3U4HA 3H6KA 2GRAA 1E7YA 3CKYA 4Z3DA 1P1IA 1M76A 1QSGA 3B6ZA 2PV7A 1P1JA 4O6VA 1CIVA 3EVTA 1E6UA 1UXIA 5JCXA 4YJFB 3GGPA 1ZBQA 3GFGA 4GMGA 5I9NA 4U6SA 3GN2A 4RVFA 3AI1A 1PJ2A 2B0JA 1OBFO 3FTPA 5IZCA 3GUYA 2FSVA 1FMCA 2HK7A 5JC1A 2Q4BA 1SC6A 3MZ0A 4PLHA 1WMBA 4EYEA 4GGPA 3KB6A 1MX3A 3ZU3A 2IZZA 2NVBA 1HE5A 2HMTA 2AG5A 2Y0EA 4YRDA 1N1EA 5U4QA 4JLWA 4JIGA 1ZMTA 3C7DB 2VHXA 3FBGA 3WGZA 2HQ1A 4BS9A 3TFQA 4I5EA 4J3FA 5G0UA 1WNTA 3GPIA 3WS7A 3D5TA 5I8WA 4PFJA 3F5QA 4YXFA 4M86A 1U3UA 1YDEA 2Y05A 4ZQBA 2YHIA 4MVJD 1UDBA 5AXDA 3ZWVA 2GD1O 3PHJA 3PDJA 3VDRA 5JC8A 2G1UA 3MCVA 3SBOA 3OIGA 1I5RA 1I30A 3WSWA 5BSGA 2GLXA 1P45A 4KTVE 3GHYA 3TDKA 2XXJA 3ST7A 3PYXA 2FR8A 3JQFC 1HDGO 4BO3A 1R4MA 1E7SA 5KKAA 2AEJA 4XZ3A 4B3IA 2GYYA 4IQ8A 5CPBA 3I5MA 4J91A 4WLEA 4A2CA 3TZQA 1P1HA 1E1MA 1GQYA 3DHYA 4B79A 4BMSA 4B3JA 4MVJM 2WE7A 1EZ4A 3OF2A 4O59O 5CHEA 1SNYA 1U2DA 4JJIA 1R37A 4AJOA 4BO6A 4Z3KA 3HDJA 3UCFA 4B4OA 3OEWA 1E92A 1ENYA 3TNLA 3OBBA 3UN1A 1B0AA 1DRWA 3WWZA 3KYCA 3HB4X 4M87A 4HFJA 4BO9A 4OAQA 4NDNE 4CQMB 2HRBA 4ZQEA 3GVPA 4BO2A 1E3WA 4R1UA 1XWFA 4JX8A 5ILOA 3JQAB 3K30A 4D46A 3JQBA 4GH5A 2HMSA 4Z0PA 5BR7A 5LDHA 2FR1A 1K6JA 3LT0A 3PEFA 2C0CA 1B26A 1Y5RA 2AEFA 3CE6A 2VN8A 4XYLA 2A94A 3GT0A 4DYVA 1I3MA 4XKJA 3UHAA 2B5VA 2ZB3A 2CFCA 3GEGA 3SJUA 3W4KA 3RUEA 2DBQA 4R41A 4PRKA 4GLLA 1YJQA 5JPIA 3S2EA 3PZRA 1Z7BA 1J5PA 2HRZA 5K0ZA 4J7CA 3BMCA 2IEDA 4K6CA 1QXSA 4IDCA 2Q45A 5G4KB 3D0OA 4RPLA 1Z75A 1GQ2A 1R6DA 2BRUA 4YJGA 1W4ZA 1L7DA 4BNYA 3NJ4A 4CM8B 6LDHA 4HP8A 5B1YA 1Y8RB 1DLJA 3LC7O 3L77A 2PNFA 4K1LA 4E13A 3FNFA 3TL3A 1MV8A 3P7MA 4UULA 5IXYA 1KEPA 2RH4A 2X9GA 3GOHA 2X23A 3VH4A 3U0BA 3OQBA 4G5HA 3UICA 5KTKA 3SLGA 1YONA 2H63A 4XJTA 1UXJA 3RJ9A 1ZKMA 4CODB 4J1SA 4IINA 1HDOA 3PFWO 3GDGA 3V1UA 3E5MA 1YB5A 3NGLA 5T8KA 1M6HA 5DP1A 3HDYA 1PGNA 1X14A 3H3JA 3U4DA 5JDCA 3MJ4A 3SXPA 3C24A 4LRTB 4OXNA 3HB5X 1JKFA 5HRUA 5A3JA 3JQ7A 5DCYA 3E9QA 1IY8A 1V0JA 3GNSA 5BNFA 1LQUA 4FS3A 5TS3A 1NWCA 5AOVA 3DWFA 4XQEA 3WMXA 4BVAA 1QP8A 2VRBA 3L6OO 1GUZA 3DBHB 3GEMA 1ISFA 1KIFA 2R6JA 9LDTA 3LF2A 4J0EA 4DBZA 4KQXA 3QHAA 2VZ9A 4DC1A 1XYGA 5G2OA 2BFMA 1DFHA 3WIDA 1NPYA 3DQPA 3K2BA 4PG6A 1PWZA 2OHXA 1H6BA 1G1AA 5JY6A 4YAKA 2PTGA 5F5NA 3JV7A 5H81A 4Z6KA 3VVCA 2NM0A 1BDBA 1EVYA 2EV9A 3A1NA 3PRJA 1YE3A 1GZ4A 3KRTA 4ZA2A 4Z0TA 4YT8A 4I9NA 3WYBA 3NT2A 2HKIA 1UUFA 1V3UA 3CMCO 1EBFA 4OOEA 5TC4A 2C29D 4MJLA 1XHLA 4YJGB 5L7TA 3FCOA 3BMQA 3W4IA 1OMOA 3BMOA 3KZVA 4PVDA 3TJRA 2C5AA 4YJDA 1HDYA 4NIMA 1QG6A 4RJTA 2RAFA 3DBRA 5AYVA 1LDMA 1W6UA 3N7UA 4A7PA 3BXXA 3WQQA 4QECA 2PK3A 3ZNQA 1E1NA 4XWYA 4GWKA 3OECA 4FJ1A 4WOKA 4KTTE 3NTQA 3RUDA 1DO8A 4E31A 1R0KA 1HEUA 5CEEA 4J6FA 2QRJA 3BMOB 1VPDA 1NBOA 3IC5A 2ZYDA 1ZH8A 4OO3A 2EW2A 2JD0A 2OMEA 4BQPA 2EXXA 4F6CA 4NBUA 1JLLA 4CMEC 4ZJUA 5GMOA 1Z45A 4BO7A 3JSAA 3EK2A 4A27A 2QZZA 1SO8A 3RAJA 4NQZA 3GVIA 3SJ7A 4BNJA 3AY6A 3KTDA 3O8QA 1YDWA 4LN1A 1Z82A 1X7GA 2AQ8A 4UVDA 5IAAA 1DBVO 3QWIA 4XCVA 2DPGA 3MJTA 3KEQA 1XA0A 2Z95A 2C2YA 5EQFA 4Z0HO 2V6FA 3N58A 4AG3A 3G0OA 1HXHA 3ZHZA 1ZMOA 4NK4A 4JGBA 3TN7A 3WWYA 1C1XB 4GVLA 2YW9A 3IL2A 3JD2A 1VL8A 4WCDA 3C1AA 3OA0A 4CR6A 1J49A 4BKUA 1YJ8A 1PJCA 4CPDA 5KVSA 1UXGA 1MA0A 1T4DA 4CR7A 4CUJA 2Y68A 4E2WA 2NSDA 4I5FA 3WICA 3I4FA 3BTOA 3GR6A 3OQ6A 4YPOA 4WNIA 3AJRA 4ZQHA 3H2ZA 4J7UA 1KVRA 3VTZA 3EW7A 4GX1A 1P1FA 2UV8A 2EERA 1KVSA 1P74A 1U28A 5KJ6A 3DBRB 4NBVA 2GASA 4DMMA 2OGUA 3HHPA 2EP5A 2JD2A 4OSPA 3DC2A 1HT0A 4RF4A 1ONPA 4C4OA 4ALJA 2D1YA 4FJ2A 3QVOA 3IJPA 1EDZA 3ZNPA 4AJIA 2I67A 4E2XA 2VT3A 5IDXA 1MC5A 2RCYA 1ZUD1 4KZPA 1KS9A 1PZGA 2DQ4A 2UUOA 3WDSA 3HG7A 1B8PA 4BNUA 4DBVO 3IS3A 3AOGA 5A9RA 1DLIA 1LUAA 7ADHA 1C0LA 4D0SA 3GVXA 2POQX 3OJEA 4EJ0A 4YQZA 5J23A 4HFRA 2DBZA 4ALIA 5H83A 2VHWA 3OJOA 4RPGA 5IG2A 3NTOA 1EUCA 2DU8A 1JN0A 3GY0A 1K5HA 1LX6A 3U3XA 3INGA 3S2IA 4E5NA 3DFUA 1U7HA 3BTSA 1Q7BA 4M49A 1RM0A 3DFZA 2Q4EA 3L4BA 3IKTA 3ZWXA 3INTA 5EESA 3SLKA 1GCOA 3M1LA 5AVOA 2O2SA 1NWHA 3F6YA 3ENNA 3KLMX 2G5CA 1DIAA 1ISIA 4CQLB 3VPFA 4Q3CA 2W2KB 4YR9A 3BMQB 1NAIA 2P2SA 1GD1O 2PGDA 1R16A 4FFOA 4F6LA 3WGYA 3RFTA 5EQDA 1NVGA 5DP2A 3KBOA 2CZCA 1E5QA 3GK3A 4I5GA 4S1VA 3GAFA 5GZ1A 1LDBA 2RBEA 1I8TA 4G81A 3AWDA 2BLLA 5A02A 3GMDA 4HY3A 3CINA 1E7MA 1HDRA 4R1TA 1TXGA 3JYOA 1B3BA 2YQ4A 1CEQA 2EIHA 1DB3A 3BTUA 3FNGA 2RIRA 2WTBA 3L4BC 2IYPA 1FDVA 4YACA 2YV2A 5DCUA 5LDGA 1SOWA 1FF9A 3DZBA 5EINA 3RJ5A 2EWMA 1CQJA 4ONEA 5C37A 1YWGO 2BFAA 3AUTA 1R15A 2W98A 4WEOA 4BL5A 3GG9A 2TMDA 5L51A 1AXGA 3I83A 3WYCA 1I3NA 1MXHA 2DT5A 3LC1O 3JQ8A 4BKPA 1Y81A 4K28A 5A9TA 4I9HA 3GMSA 4NJOA 1P44A 4IXTA 4XX0A 1NPDA 1ZK3A 4MIEA 3T7EA 3OM9A 5AXBA 1UZLA 2HMVA 4CM4A 3S8MA 1M67A 3B20A 5TT0A 2J3IA 1VC2A 2ZB8A 3H3FA 3MJSA 5LCXA 2JHGA 2PGJA 3MJCA 1T26A 3VPXA 1T2DA 2E82A 2F00A 5EJ2A 5COBA 1MC4A 2J5KA 2VHZA 4YT4A 5FEUA 1M66A 3IUSA 5KVCA 1I2ZA 3DMYA 3Q6IA 4PG8A 3UKOA 4CMCA 1PJLA 1E3WB 1IB6A 4NNJA 1U5CA 3TWOA 3UCXA 1CJCA 1UP4A 4KMSA 2O4UX 4TQGA 1HE3A 1EVZA 3STHA 1ISMA 3DB2A 2P68A 4MKXA 5G0SA 5JYDA 4K26A 5L95A 4J4TA 4YCAA 4CLEA 2NVUB 3PP8A 4XR4A 4HBGA 2X9VA 1Y9AA 2AXQA 2EKPA 3GGOA 3IKVA 3ABIA 3TFOA 2GN8A 3MJEA 5AQ1A 3KV3O 1IZ9A 1KEWA 2GPTA 5DN9A 4BB5A 1NVTA 2FSSA 1ZSVA 2PGLA 5GZ3A 1UH5A 3RWBA 5FI5A 3LVFO 3JQCA 4F3YA 2PH3A 3KLPX 1PJ3A 4LGVA 1NYTA 2BKAA 4WECA 4CL8A 1VRWA 5JCJA 2W4QA 3W8FA 1A7KA 1VL0A 1GPJA 3T4EA 3Q2IA 5IXSA 2PFGA 3ONFA 5KVQA 5AXCA 1WP4A 3RFXA 3TOXA 4ITUA 3QA9A 4TSKA 2P5YA 3EGOA 4CMGA 1WLYA 1X1TA 1XCBA 2WD7A 3JQ9C 4YDRA 3PDUA 3VTFA 3WLFA 4CMIA 4FOSA 2JD1A 4FOOA 3KYDA 1EK5A 3PWKA 1JWBB 3S2FA 2YHIB 5BQFA 2VTDA 5KCZA 1KC3A 1FDTA 1HYHA 4UEKA 5A06A 1VKNA 2WMDA 3MWEB 4WKGA 2NNLD 2OP1A 5B4TA 4B4VA 3UF0A 3GH3A 1QLHA 1EEHA 2IXBA 3QWAA 4GKBA 3B1FA 4MIYA 5C5IA 3TRIA 2HK9A 1E7QA 1OFGA 2D5AA 3NT5A 1D8AA 3PZBA 3V2HA 4IQ0A 1OOEA 1N5DA 5FF9A 1AXEA 1WPQA 1SEPA 1IZ0A 1PJBA 3COSA 5F1OA 1Q2XA 3HZZA 3RBXA 4KDEA 1TI7A 4YT5A 4XQCA 1U8FO 1A9YA 1P31A 2PKQO 1NQ5A 2AE2A 2PD4A 3QVWA 5A05A 3VAZA 3A14A 3ZWYA 4NFYA 5DBIA 4J4HA 3LK7A 1BVUA 4JK3A 2VWHA 3VPGA 4DGSA 2C07A 4QUKA 9LDBA 3OMLA 1KVQA 4A73A 1YKFA 3LT4A 3H5RA 1GV1A 1PJQA 1ISJA 1HDZA 3ANLA 3GRKA 5GY7A 2TMGA 4D42A 3K2EA 2NADA 1LLQA 3JQGA 3OSUA 1WZEA 4EEXA 1BHSA 4BNHA 1MFPA 3ZU2A 4L75A 3GAZA 3A9WA 3ZH2A 1L7EA 5C7IO 1Y9EA 4RLSA 3FBTA 1LDYA 2Y99A 3GZ4A 1PX0A 2J5QA 1NQTA 3ROKA 3ROMA 4EITA 5A03A 2FN7A 3I9KA 3VKUA 4W7HA 4GLOA 3EZLA 4Y67A 1PR9A 1RKXA 4LSMA 5CPFA 4ZVVA 1JKIA 1HLDA 1O95A 1CRWG 4HFNA 4HX5A 1C14A 3E82A 3D3WB 2Y1FA 3FR7A 5JDIC 3TQHA 1R0LA 1PJSA 2WSBA 5FYDA 1N7HA 5TQVA 1GUYA 4IGEA 4XRGA 4J2OA 5DBFA 4RPJA 1TVEA 3HDQA 4J1TA 2IRWA 1U4SA 4BKOA 3A28A 3AM3A 5T64A 2HK8A 3QV1A 4A10A 2VUSA 4YAIA 2ZKLA 3VZPA 2JCYA 4INAA 1MLDA 1YB4A 2BHLA 3D7LA 1DC6A 4BNNA 4DRYA 4QO8A 4HNGA 3VPHA 2EJVA 4NJMB 1P77A 1AUPA 3L4SO 2I6TA 3RSHA 4XR9A 1I01A 1CQIA 5JYEA 3QRWA 1BXGB 2C7GA 2HAEA 3AOEC 4LSWA 1EVJA 2EEZA 3DMTC 1NP3A 4DLAA 1LSJA 4A26A 1DPGA 3TSCA 2P91A 3ETDA 3DZGA 3KYCB 2NVWA 3V5NA 1P0FA 3JQ8B 2X9NA 3R1IA 3HWRA 3GRPA 3GDFA 2EG9A 4NJMA 1X15A 5F1KA 2GZ1A 1AN9A 4RF5A 1X0XA 4MO2A 4GWGA 4BGUA 5ICSA 2G17A 3C1OA 2PKQP 4TRJA 4IUYA 4E33A 2JFFA 3JQGB 4EUFA 3K73O 1PR3A 3D3EA 4R5HA 2HSDA 5DOVA 1CDOA 3KETA 3K5PA 1YBVA 3BYZA 5JNLA 2OBYA 3RKRA 3I9LA 2VUTA 3GGGA 4MVJH 1NX6A 5TGDA 4DPKA 4IS2A 5L4SA 4CLRB 2QG4A 1X7DA 1SZJG 2B36A 1PGQA 3DZHA 3VH2A 4QQRA 1LRKA 5MDHA 3BA1A 8LDHA 4LVUA 2X8LA 4XQ9A 3DMTA 3NT4A 4BB6A 1ENOA 5K6AC 1TLTA 2CDAA 3ICCA 1ADCA 1YRLA 4JJGA 4GPD1 1B15A 1N92A 2AQHA 2P9GA 3PHHA 4I8XA 1PJ4A 4Y9DA 3WYEA 3GZNA 4WCFC 3PJDA 2C20A 5JAZA 1WMAA 4EUEA 4I08A 1A5ZA 4TRNA 2FWMX 2EKLA 2I3GA 4ND4A 4HNHA 5IF3A 3QWFA 1RWBA 1EFKA 2VHYA 1B8UA 2WD7B 3E8XA 4CUZA 4AJJA 3I9NA 3EUWA 5T57A 3ZZNA 2ZYGA 4WJZA 2C59A 3RBZA 4BOYA 1GQQA 3A06A 4PN3A 2RHCA 2Y1DA 1IPFA 2VYNA 4YAJA 4E0BA 4E3ZA 1PQUA 1J0XO 1GDHA 2BFPA 4BV9A 1UAGA 3GEDA 2VNSA 5COQA 3NKLA 5HS6A 3HADA 1GTMA 1LLUA 5EMHA 1AGNA 1ENPA 1HZJA 3ADOA 1ZK2A 3Q9UA 1V3TA 1XU9A 2IDZA 4IQGA 3ZV5A 2X58A 1WXDA 2W2LA 1O9BA 4IDAA 3WJ7A 4AJEA 3IP3A 3V2UA 1SB9A 1NXQA 1XELA 2YQ5A 1PWXA 2YUTA 5HS4A 3EYWA 4DLBA 1U3TA 3O4RA 2VYND 4FQ8A 4TRRA 5ENDA 3VVBA 2JAHA 1GYPA 3MJVA 1D7OA 3L6DA 2G82A 1E3IA 1DIHA 3VH1A 4AICA 2CF6A 4CM9A 3R6DA 5L4LA 1KEUA 2OFPA 1KY5A 4MKRA 4XGIA 4EZBA 4PGFA 4LMRA 3UFXA 3X2FA 2BH9A 2WE8A 4BNMA 3QP9A 5LC1A 2D2IA 2GUGA 3PYLA 3AI3A 4L76A 3SC6A 4CMHA 3E5RA 4B7UA 5ITWA 2Y66A 1HF3A 1KC1A 1PZEA 4R16A 2HDHA 4W9NA 2HU2A 4FR5A 1NASA 4BIIA 4B4WA 3H2SA 3K6JA 3M2TA 4FGWA 3VH3A 3IJRA 1XG5A 1E6EA 4EJ6A 2Q1WA 4L9RA 2O50A 2RH8A 2NTNA 4KWHA 3ASVA 4ALLA 4DUPA 1ZK4A 3GFBA 3ENKA 3M2PA 4RDIA 5L3ZA 4BNIA 1TT7A 2YFHA 5DULA 4N54A 1Z6ZA 4LISA 2AA3A 3F47A 3WMWA 1E6WA 2ZIZA 1SB8A 3QW2A 1FDUA 4A5OA 3DBLB 1DSSG 1RJWA 3MOIA 4DPLA 3JD0A 1GU7A 2ZB4A 3FTNA 1JDJA 3ZI0A 3LLVA 4E12A 1DJQA 3RU7A 5TJ9A 4E4YA 4UAGA 1Q7GA 4W99A 1KYQA 1LDNA 2LDBA 3PI7A 3LU1A 3AU9A 5I9LA 3ZNOA 2X0IA 2VOJA 1C0IA 4FW8A 1VJ0A 2PLAA 3VZSA 3O38A 4Q9NA 2ZJ0A 3PXXA 3ETGA 3Q9NA 1DHRA 4I9UA 4ZQFA 2NU6A 2WYWA 4PIVA 1AHIA 2Q99A 1WZIA 3FPCA 3OP4A 4OYRA 1JQBA 1C1XA 2OBNA 4MVJF 3NDRA 3JD3A 3NGXA 4BQRA 3HNPA 5JAQA 3WGGA 4E5YA 4IDDA 1YQDA 5IDYA 1JTVA 4Q3NA 4TVOA 4BV8A 4XGKA 4PLYA 4GL4A 2HCTA 2J3HA 1P33A 4AJKA 3WBBA 2NACA 4NMHA 2NU7A 4E21A 4AJHA 5ENVA 1PS9A 2JFHA 3UCEA 2VYVA 3RUAA 1TT5A 2ZTMA 2O3QA 1F17A 4CM8A 5IDWA 4N5LA 3L9XA 1LTHR 1R12A 3GA0A 3KYBA 4BNFA 3G1UA 1YL6A 1H9BA 5A5FA 4PLTA 3OIDA 1Q1NA 2QIOA 1JVBA 5KVVA 1ID1A 2GN4A 2B83A 1HTBA 1F0YA 2YDYA 3JQDA 4R69A 1GFSA 3PQFA 4MP3A 4TZKA 1DC3A 1U1IA 1I3KA 1D3AA 2I66A 4U5QA 1VJTA 3T4XA 1B8VA 3TZCA 4GSLA 3WB9A 4EI2A 1J6UA 5F1PA 1A71A 1JAYA 1LRJA 1R4NA 4NHEA 1BGVA 2PKRA 1BG6A 3PHIA 1H93A 4QSMA 1EQUA 1I0ZA 4YRBA 3GNQA 2PD3A 1I10A 3EVNA 4I1IA 3NX4A 4BO0A 3QIVA 1H94A 4II2A 5K9ZA 3JYQA 2OOSA 1T2FA 4JBGA 5HWSA 1H5QA 4JP2A 4YVFA 5DOZA 5A04A 1MUUA 3GUCA 2W2LD 4BNKA 1T4BA 5TT1A 2FPPA 3HN2A 2PZKA 1PZFA 3BTVA 1VSVA 4YJFA 1YS4A 3OHSX 1K89A 1ZVMA 2IODA 2O3UA 2C82A
chains in the Genus database with same CATH superfamily
4HDAA 3JD4A 4DVJA 3O3OB 3O73A 1W2WB 4G09A 4UOEA 1XZKA 2B94A 4UPEA 3R7AA 2Q07A 4FDLA 1LVGA 4FONA 1SPXA 5EPOA 1GM5A 3X2SA 2OV2A 2GA9A 2ZJOA 3K0FB 4YV2A 2R1VB 5ALEA 4O4JB 4ZV9A 1NQUA 5K6RA 4EGJA 4RLHA 4PYQA 3R3HA 1Z56C 5CA1F 2WJYA 3KKMA 1KAQA 2VAWA 5HIAA 5JAHA 3PE4A 1J20A 4P4SA 1GEEA 3HHEA 4WV3A 1N36B 5ALIA 1PEYA 1IIRA 1NE2A 4GP7A 3ED5A 4PSDA 5HCIA 5D1NA 4XVUA 2OSBA 3PXCX 3BL8A 1IQRA 5E9QA 4ARIA 2X0NA 3U62A 5JMWA 2Q7DA 2BSQA 4FR0A 1JHAA 5C1PA 2QRUA 1W1IA 2B92A 4WA7A 4RY0A 4BQNA 2GN1A 2MR6A 1JHRA 2AWOA 3HUFA 4C4YA 1AURA 2WICA 2GCGA 1XZFA 3FNEA 4H16A 4HAYA 4IHJB 3RUFA 1L7VC 1QR6A 1HQCA 2LWIA 4KIUA 5AW0A 2QR3A 4RTJA 1U8AA 4XM2A 2JJMA 4TWBA 1POXA 1YCFA 2FHSA 4KGXA 4M37A 3W8EA 4X97A 5B1DA 1WW2A 1HG0A 5JSUA 3H4TA 1GYQA 3IEMA 3EMKA 2HBYA 1U0OC 2BN4A 3GRZA 2BEWB 3LT1A 1UK9A 2QRHA 2QYTA 3TBFA 1YRHA 3ZU5A 3L43A 1QV7A 4L7QA 3LT5A 1QIDA 2I2CA 3HI4A 1NFQA 2CMHA 1Z0KA 1DAGA 3UKJA 4IBOA 1CY4A 3CUVA 4O2LA 3GUVA 2J3LA 2YMLA 3M4YA 1IK6A 4WVLA 3OE7D 2OA0A 2O05A 2YYYA 1OVMA 1PFGA 2XECA 4WRRA 2XOEA 5ER9A 2JI9A 4M55A 4UJ3A 1RRMA 2HJGA 5FPYA 4X65B 4C1BA 2Q6TA 3MS4A 1GCAA 5DFAA 3HH8A 1IN1A 2FPPB 4CL2A 2IS6A 1VIAA 1T36A 1TGVA 2NXEA 2YJGA 3C8UA 1DJLA 3ENVA 1GQOA 1SBIA 1ND5A 3Q72A 4FDAA 4F45A 4M76B 5SYNA 2PZMA 4PS0A 2ZE7A 4G4SP 3LX5A 2JJ1D 2E5LB 1QGYA 4UUOA 3OOHA 1K0UA 3UANA 2JKVA 2QUAA 4LQCA 4X1IA 4RVNA 1TT5B 4BATA 3H4VA 3ZCTA 3WGIA 4PYLA 4WDRA 3BD7A 5NLLA 2VJLA 2PSDA 2IKSA 3F90A 4C08A 2AN3A 2O57A 4UHBA 1M2NA 1NBIA 2VDWB 4K3UA 4QUAA 5JNUA 1XKLA 1A2KC 1P5HA 2WP0A 3E05A 1L5LA 2QX7A 4QVIA 2YY7A 1OLUB 3C1TA 5CB4A 3C15C 4E5VA 4EYOA 4KXUA 2AL7A 5EL0A 5EMLA 2C58A 1TKCA 3AOEA 5G4KA 3TMYA 4BJ5A 1WVMA 1U2GA 1UC4B 4EGFA 4NU6A 2JKYA 4E22A 2EBWA 4PE5B 3EGDA 5DTQA 2VPIA 2EW1A 4Z4QA 4F2GA 3HXMA 4EMSA 2N1BA 3RCBA 1OWPA 4G41A 3QXXA 1QOQB 4B9EA 4FT2A 4BXOA 1F2TB 5M2QA 1XKQA 2V7QA 3BB3A 1I32A 2VJBA 1WW3A 2W6ZA 1HX7A 4U1RA 3DDSA 3RIGA 4B47A 1PG2A 4N3AA 3NUGA 4Y2TA 4DG9A 3HWX1 2VDOB 4EDHA 1WZNA 4QU0A 1OI4A 3DW1X 5CK4A 2FSPA 1OI3A 2C9BA 1XTBA 1V35A 2RAUA 4JX9A 3BHJA 1SUFA 4JUIA 4WZ6A 4XYMA 1Q74A 3WWEA 2KX7A 3T7TA 1R8QA 4ND3A 3F9CA 1NVMB 3FZGA 3JTEA 4IDOA 5K3OA 1DAPA 1OKKD 4NS1A 3K8ZA 1CUXA 3OJ0A 3ULKA 2DQZA 3LF1A 1Z18A 3QENA 3DXXA 4GMFA 2AQKA 2ANBA 3C7AA 1AM4D 3HNRA 1GKYA 1UZNA 1XIVA 3CJRA 3IP9A 3TCKA 4D7AA 4CEHB 4Z9BA 2XNCA 3MNFA 4M1MA 1FFXA 3E22B 3FPKA 3NH9A 2ZSDA 2GX6A 4FSDA 4PRLA 4QFBA 4XYBA 3KOYA 1RYNA 3BIOA 5BOSB 2AD1A 1HSZA 1KJIA 5E6RB 1XLVA 2AFHB 3KKOA 4J7AA 3A4VA 4GAEA 1ZSNA 4EA9A 2FGJA 4EDFA 1UDAA 3PPVA 2XVYA 3EIUA 4HLNA 2JBAB 1G291 1Y3HA 4OL0A 3ZUPA 4BFSA 2UZIR 1UQTA 1YE5A 4FCCA 1YZKA 1I3LA 3V6LA 3AHJA 4YRAA 2VYVD 5KC8A 4OHXA 3DXFA 1WZ2A 3DZIA 3P19A 1DIGA 1CUZA 2YYSA 1GVNB 2NO9A 1PT9A 2NSHA 3PITA 2HJRA 2EJBA 3B48A 3FFBA 3OTWA 4V39A 5AJUA 5TMBA 3UG6A 1SVUA 1M5UA 4DMLA 2PUAA 3CZ9A 3IODA 5BSRA 1MT3A 4D0LB 2WQ7A 4BX0A 3GN1A 4Z4FA 3Q6MA 5THXA 1X80B 2VH1A 1QGDA 2XGJA 3T38A 1DUIA 3LPLA 1XHEA 2LPMA 1L5HB 1E63A 1VBMA 4G6ZA 3MWDB 4LGCA 2JBAA 2NPOA 5E1BA 3F5SA 3U7HB 5TQJA 1N6KA 3HGTA 4DA9A 1K3TA 4S3MA 5AVQA 2X2FA 1UK7A 5EZYA 1GKUB 3P96A 1CX9B 2AEMA 5AW2A 1Z4JA 1XDBA 1PJTA 5FFFA 4BMVA 3AY7A 4H6XA 4G4SO 4INOA 4CQJA 4TRMA 5IKMA 1HE8B 1RYFA 3IE2A 4FSXA 4OMUA 1IEVA 1E0AA 2PVPA 5ARCA 4P54A 5DHTA 2AMLA 3DSRA 4E94A 2H5LA 3KXDA 5J58A 1ZR2A 4TL8A 4LCEA 5TRTA 3VDNB 3VZQA 3MFYA 1M5RA 1RWMA 2PSJA 2XODA 3P5SA 4HF7A 4WK6A 4G5SA 3M0EA 5KNDA 3WNDA 3AJ8A 4E07A 1PEKE 2WWVD 4KU4A 1G3IA 2H1IA 2PZLA 3I8OA 1DFGA 5A9SA 1K2WA 1KE1A 4G9GA 1NRXA 1AQIA 3WE7A 3LL7A 3N2GB 4KVFA 4X71A 5AKEA 1K88A 4DTCA 3DZKA 5AVXA 2DBRA 2WJ3A 3D1LA 1DEOA 3PC2A 4HMPA 5H80A 2QHXA 5TDHA 1C5KA 2XNHA 4AJ4A 2P3OA 3NRBA 3PFHA 4DDHA 2ZRMA 5B4UA 1TO6A 3IQGX 2X2PA 2QJTA 2DWCA 3FUUA 1ANKA 4GOLD 4OUKX 4RSMA 5F35A 3IBCA 1VKOA 5JRJA 5LZ4A 1QU2A 3Q11A 1E1LA 3W5CA 4Q4AA 1PG5A 4LJ7A 1LU9A 1LF5A 4J07A 5L3QB 5CDUA 1HDXA 1LSSA 3I1JA 4IAOA 5DNDA 2RAPA 2WG0A 1TQ4A 2IC5A 1T0HB 3T52A 2BISA 4F3KA 3COVA 4IF6A 1YC5A 4BO5A 2YRXA 4WNAB 2OCGA 1GPKA 1TKBA 5COAA 1BMQA 4DW8A 1A72A 1YL5A 3KKZA 2BIFA 4W9NC 2NO5A 3M83A 4CQMA 3D81A 4GE3A 3CV3A 4MDYA 5LR6A 4JJKA 4D9FA 5DW3A 3GLGE 1WEHA 1EHIA 1YQTA 2IKQA 4GQBA 4NYMR 1SRQA 4ND5A 5U1PA 3T7JA 5HFNA 3PNQA 4JBIA 4KACA 3WBJA 1Q15A 2VSYA 2GBIA 1SRRA 2PL1A 3K9QO 4UOZA 3O74A 4RTPA 3ENQA 4R7ZA 4X3PA 1E3QA 4XIJA 3NO4A 2XY4A 3RQSA 5HM6A 3ZWNA 2ZM5A 2HX1A 2NV6A 1ACJA 2I2XB 5KSOA 3SVLA 1VYTA 3IH5A 1ULUA 5MGBA 3KLBA 1GGJA 5AW3A 5LXTF 5LUAA 1U0RA 2Z09A 4EKIA 4QT4A 2HK6A 3V4ZA 1IIBA 2GTPA 3BRSA 3PHBE 4YEDA 4KXWA 3E3NA 2XR1A 1U7PA 2Z30A 1FSGA 5NULA 5LMZA 4GMXA 2B37A 2JFNA 2JLAA 3D2LA 1UPAA 5AQEA 4JZYA 2GAJA 2PGNA 4IH1A 3TIFA 1ORWA 4JY7A 2ZVJA 1DDOA 3W7VA 4DMFA 2YS7A 5CTAA 3IAM6 1M33A 5ERXA 3BA6A 2O6LA 4N18A 4QBFA 5BSEA 4QTYA 4IIUA 4X1KB 5I7SA 3KR0A 5A1TA 3ZBTA 1T9HA 4YP7A 3AEYA 3VOAA 2IY9A 4EW2A 1FS4A 1TKAA 3B1JA 4NYIR 4I1PA 3FCXA 3SHQA 3I1FA 1NW6A 2PD6A 3EVGA 3NFRA 5EZYF 1U2DC 1II8A 1MIHA 4YJ3A 2G08A 1CJVC 4X45A 3T1VA 3TSZA 5CCDA 1NLZA 1WPXA 4PLPA 1RHRA 2WOJA 3C14C 3HJAA 4HSGA 1YH3A 4W5OA 5A3VA 5KU1A 3CVWA 4B82A 1RZRA 1K7YA 3MTQA 2NP6A 4RVHA 4YI5A 4B71A 2QWXA 1F8YA 3FTDA 1T8SA 2PQ2A 1CDEA 3AT1A 2X4DA 4RFVA 4DA8A 4AG6A 4DWJA 3DHNA 2DC1A 1J8DA 1A4XA 2HZBA 4XWOA 3NETA 2WSYB 4IKEA 5BNTA 1KP2A 1TA0A 2ZITA 3CPSA 2I3DA 4LHYA 5ER6A 2CDBA 1DI0A 3UHOA 3F7OA 2HXSA 1QNFA 1H69A 4HDRA 3USCS 3TAXA 4CLOA 3GGJA 3RE1A 2ODBA 2RGXA 2RHLA 5FRDA 2CEKA 3W34A 5I8PA 1PU2A 2H0AA 3JYHA 4IDHA 4RY2A 3TD2A 3RU9A 4UD6A 3T99A 4L8FA 4D9NA 1O5TA 3QLTA 1JBQA 3BH6A 3IIKA 4GICA 3CFYA 2UVQA 4JQCA 1QCDA 2VF5X 1LTQA 2Q8PA 5C8YF 4BWVA 3FKSD 1ORTA 1MJGM 1A8HA 3ABOB 1KVTA 2AZDA 4BYGA 2XDQB 1UKAA 1Y6RA 4JU9A 1O2DA 3R9WA 1KR5A 1X1EA 2X2EA 3QFTA 4WOPA 4WW0A 4FJ0A 3E1GA 4XCXA 1M1UA 4Y0VA 1S3IA 1QGAA 3AU8A 1W48A 4DADA 3N87A 1JJFA 3F6BX 2NUPB 1GGVA 3E6AA 4QUDA 1HT1E 4YDSA 4TV8A 4FYPA 5AM0A 4RUKA 1KEKA 3RAEC 4L16A 2Y0DA 3DR3A 1WHSA 4I1UA 2D0IA 2ZBPA 3JQAA 4GR9A 1E2PA 1L3BA 2AC2A 4O2RA 1LA2A 1PX2A 1EFPB 5TY0A 3S5JA 3VI4B 1D0IA 1CLUA 5IVKA 1XGKA 2XCIA 4IOKA 4X91A 2W00A 4N8EA 1V9LA 2JI6A 3R9XA 4G3XA 4YRLA 4FNGA 1SCUA 3BCHA 4QQFA 2BH2A 2YNMD 2CVFA 5LOVF 4E32A 5K0NA 3E61A 2YV3A 2ZAIA 3R0VA 4JL5A 1C3OA 3NH6A 4HQRA 2PRYA 2WWGA 3EG5A 3PK0A 3EMDA 3PSHA 2KJQA 3OMXA 3TIXB 4R2JA 1VQ1A 4IZHA 4BPBA 1QZXA 2HLPA 1SHLA 2B34A 3ADPA 4S0ZA 5JAMA 2QPOA 1AKYA 4PX9A 3EJ6A 2H3HA 5M29A 1T9KA 4LI0A 2HL6A 4X6XA 3HABA 1ZN9A 5A3SA 3C87A 4AYTA 4K0RA 1UBOS 3E48A 1U0FA 3H5NA 1FP7A 4GBED 2OZEA 1CV2A 4F1WA 2J3MA 3PCTA 3VR5D 1CR4A 1DP4A 1W73A 2PA0A 4PHCA 4YRIA 3U4IA 5H3LA 4JITA 1FMLA 1UEIA 4U2FA 4JC5A 4PHHA 1U0EA 4DNFA 4YLGA 1XL1A 2GZHA 1TZMA 3FYUA 3GMIA 4LXGA 4Y6LA 1BFKA 1N2SA 1MQ9A 4PM4A 3IBFA 1MNQA 4K40A 3UAOA 1LB1B 2V65A 4YRTA 4A91A 3AI2A 3VC3A 1VGRA 3S2YA 1OYOA 2Y6UA 4BO1A 1XAIA 4MUEA 4ENRA 3E4DA 5KNBH 4BLUA 1TECE 4KGZA 1ZK0A 4YFYA 4O1IA 1GNLA 1HEYA 3B9BA 4GZ5A 4TTJA 4AQYB 1ODFA 2QR5A 4RZ3A 1ZIXA 3TLBA 2Z6UA 1EIWA 2PKWA 5C5DA 2O1WA 1OQAA 2Q2QA 4OQLA 4U9HS 4UFNA 5SYMA 1FX0A 1H2BA 3LLSA 5ALJA 2XUPA 1CR2A 1BWSA 1QF6A 3TLAA 4QYTA 3M33A 4FC7A 3K1AA 2UZAA 3DZ8A 3TJMA 4WZAA 2CNLA 3V1TC 1VCOA 4LFAB 4F96A 1P2GA 3FPJA 1EUZA 1EX7A 1R0SA 1MB4A 1VDMA 2ZE5A 4LHWA 4COOA 4EW6A 5HW0A 1TADA 1RRCA 1SVSA 1B41A 2FUNB 1G7SA 2EC5A 2ZYAA 3NFYA 4M7RA 3BCRA 4MROA 4NH0A 1N2XA 4D43A 3KQSA 1BXZA 5DLEA 1M75A 4RTRA 3DO6A 4M0PA 1KGSA 1R5JA 5A4IS 1E0JA 1ISGA 5KO2A 2RK4A 3DEYX 3NCTA 4FMDF 1ABBA 5DNAA 4R9UC 1B43A 5DYWA 3WIOA 4L5IA 2L42A 1Z7GA 3GQBB 2A7QA 3V7WA 4C22A 3IDFA 3N5CA 2EZ8A 2O8VA 4LYJA 3IPCA 2R8OA 1SVWA 3LHSA 4GBJA 2A86A 4B7CA 5BN4A 4CQNA 4MAAA 3IPLA 3RK1A 2PKCA 1KF0A 2J6IA 1IBKB 2F7SA 1J07A 3IESA 1KNXA 1Y5MA 2DRIA 2HDWA 3BUSA 4ZC8A 1T1RA 3FG9A 2XYGA 2OHGA 4H3HB 4KIFA 4LAFA 1K75A 2MMGA 2Z57A 5BSFA 2V9ZA 5FWDA 3ZCXA 1SHUX 1A98A 1R8YA 3JTMA 1EK0A 1GGHA 3S44A 3GHHA 2JLVA 3ICEA 1COWA 4KRYA 3UGQA 4O8CA 3R6LA 3WOHA 1KXZA 4WAUA 1JWAB 4D5EA 3KU4A 1ZCBA 3Q0TA 3UAZA 3I4LA 1OJLA 2IU3A 1EBUA 2ZEJA 5CNJA 4ATNA 4B81A 3GRYA 3N2KA 1SIWA 2PLFA 1KTVA 4TMWA 1MCZA 2A9VA 3H11B 3JD1A 4J0GA 4JUDX 4I1VA 3FYTA 2PSEA 3LHFA 2BBWA 3O03A 4IWXA 1PQYA 3WGMA 2VCHA 3LECA 4NI5A 3NIBA 4E1VA 3KKLA 2WTXA 4F2PA 5ICEA 1O8BA 1GPYA 1MH1A 2EFEB 2D59A 4WFKA 5C8DA 2Y4NA 4ZOLA 3W1VA 2NYUA 2DTXA 1D5CA 1N75A 3AF6A 2ZLBA 4JCOA 2LV8A 3PQ7A 3H86A 2RHJA 3KYIB 4XQ0A 2CVPA 3S6JA 1FYDA 3NDPA 3VISA 4YMGA 2CYCA 3EVFA 4YQFA 2OGSA 2O23A 4ASUA 4Y6PA 3KHKA 1LLCA 1A69A 2H1RA 2XJ4A 4NU0A 4QARA 3V2GA 2A6PA 1UKCA 4R1OA 4Q3AA 3N76A 1GQRA 3JZAA 2BDUA 3D4NA 4WBSA 1O8CA 1GY8A 1JMVA 5ALXA 4ARVA 1ADFA 1DIRA 2FRXA 4RGBA 1EK6A 3F2IA 4WCFB 4HUQA 2H65A 2BOVA 1ESZA 1F1BA 3PQDA 4YX9A 2QL7A 4ZVKA 4LCJA 3STTA 3I8XA 5FWYA 3DGFC 3KVVA 4CKXA 5IAEA 3QBDA 5FBHA 1Q0RA 5CG1A 1EDDA 2YVLA 3GT7A 3H99A 4L51A 2JL1A 2QN9A 3NWPA 2PX8A 2QN8A 4DYDA 2X42A 2HT6A 5DCWA 4DREA 4OHVA 1AA6A 1NJ2A 2IELA 3EH1A 1E3DA 4LNHA 4TWZA 3ZGYA 5B57C 3UJ8A 4OSOA 5L7WA 3A6DA 5A5EA 2VUIB 2QZPA 5JSFA 2KBFA 4XJVA 1A7AA 4R8MA 5BNIA 1WCV1 1H2WA 2C4VA 4COKA 2DPXA 1WB4A 8ADHA 3OLVA 2OO7A 4UEOA 1Z2DA 4LJ9A 3UM9A 2IS1A 1ISHA 1LWOA 1FEZA 1GFZA 1ONOA 3G49A 1EU1A 3MT7A 4H2DA 5EQJB 4MQ5A 2VHJA 2LRHA 2VUHB 5CDFA 4PGHA 2A9KA 2DFPA 4MYCA 1Q3TA 1OX4A 1SWVA 3MLAA 5DHRA 3UAXA 3G8CA 1O0CA 3OZBA 3KEMA 1DU4A 1L7XA 3AVVA 3RYHB 1TPYA 4DFDA 4PR3A 2ZULA 3D2BA 5CLGA 1NULA 3SHWA 3WL5A 2DWQA 4BLPA 1NATA 1OYVA 2AJBA 2EF1A 2I7CA 2YUIA 1PS8A 3QUBA 3ND9A 1OFHA 2BW0A 2VK4A 5HOEA 5JEDA 2TMYA 4IIHA 1KDRA 1N2HA 4JU8A 3FFAA 3UH0A 1V1MB 2XTNA 3LDFA 3LFHA 1FLDA 3MOSA 4FEEA 4A2WA 1BDJA 2G67A 5FTMA 4B6SA 3PTAA 4FQ5A 2AUMA 2OILA 3DOJA 1TM5E 3V00A 3HDHA 2OYCA 1YOVB 3R3VA 1G21E 4LJKA 1DUVG 2K87A 3CF4A 4LVCA 3W3AH 1L1QA 2ZXFA 4GW3A 3U44A 2RGEA 1BJKA 3ZD9A 1MG0A 2ISSD 3F71A 4JOQA 3WLNA 1S2LA 3UEOA 3ZCUA 4D0RA 4MWZA 1U6JA 1VI2A 1XDZA 3DPIA 3AUUA 3HPQA 3BIWA 4KO4S 4UEJA 5KWJA 3FTCA 4HC4A 1WIWA 2BSAA 4BRWA 1P18A 3CR8A 2O7NA 3E8SA 5K0CA 3SVZA 4MRNA 4CKZA 5JT1A 2WIBA 5F3RA 1DE0A 1V4BA 3W5UA 1S4QA 1GZ7A 3ZHVA 1L5SA 2ZSHA 4QTZA 4UDYX 4Y1FA 4DHWA 1PQWA 1PEDA 4C05A 3EA4A 4Y2GA 1Z9BA 3DOCA 4CDGA 1EVQA 1XP5A 2Q0QA 3CA8A 1C3VA 2NU9A 5EE1A 5A6SB 1U6KA 1LNQA 3TQSA 2XE7A 1KS2A 2C2ZA 3FXAA 3UOGA 2QTHA 1G0NA 5IZ4A 3ZWQA 4AKEA 3NM6B 3QFCA 2B2CA 1I2AA 3V80A 5CYGA 3GLTA 2F2TA 1DTWB 4U3JB 2Y1WA 4WY8A 1XJ0A 4H7PA 1WUJS 2QL5A 3GRCA 3W1EA 4RIGA 3ISTA 1ODCA 4X85A 2YN0A 3MBIA 2ZM6B 4OY3A 2W8ZA 1JU3A 2FWBA 4MR8B 1ZGZA 2NUBA 2VL7A 3NI2A 4RE5A 4FD2A 5E2AA 3VPSA 4BFYA 1KOJA 4JJ6A 4EKDA 2XQKA 4H59A 4CM1A 1MB9A 3LY5A 2Q9CA 4X5OA 2OFFA 3DUWA 3MTJA 2C78A 1VBKA 3KNZA 4N40A 1Z29A 5TNXA 4URYR 1RLMA 3WGOA 1XXHE 4FBMA 4JB0A 4MUJA 2A1UB 2AOTB 3HKEA 2WPDA 3V34A 2EQ5A 2Z4RA 4FBGA 1XZDA 5LA6B 1CJMA 4WOJA 3ZGLA 3IPAA 1E7RA 5JMTA 1F8UA 5I5GA 3ACDA 3JAKB 1NKSA 3JQEA 2M9MA 4INJA 3OC6A 3NTUA 1QQ6A 3LWDA 3ERCA 3BE5A 2OV1A 4AZVA 1QVZA 1FXUA 5AFSA 3PPXA 3FKSA 5BN1A 1BWPA 3C45A 3D8TA 4DR4B 4EF4A 3UMMA 5EVCA 3Q9SA 1U8YA 1URPA 6REQA 1MBZA 3FHJA 3S7ZA 5I7FA 3G79A 2OHIA 3FRJA 3C6QA 3DBVO 1L5MA 1XLTA 3CUTA 5ALVA 4R98A 1YF3A 2NVOA 1E2DA 1XZIA 2H0RA 2V54A 4R1NA 5F23A 1A9SA 1ZGBA 5JJKA 3WZMA 3A31A 2G3YA 4O5OA 2BMVA 5CRIA 1CZOA 2BDEA 2VWPA 2CF5A 3QLJA 4KFUA 1E2QA 4BEVA 3W9UA 3LDUA 3FX2A 2FPIB 1YR8A 3G5LA 4ARZA 3AM4A 3EJWA 3KK0A 1JHXA 2GF0A 3Q8LA 2PANA 4CM4B 1S7CA 3TNFA 1J09A 2OLKA 1Z2OX 3KVOA 5J5VA 4OHKA 4Y7DA 2Q9AA 3QY9A 5JLAA 5T5QA 2XCSB 2OUIA 2I5PO 5TQ0A 5IM5A 4OK5A 1PSDA 1XAJA 3EQZA 1KL7A 3ROTA 3RVNA 1VYHA 1YVEI 1GNSA 2NSYA 3MGKA 3PNLA 4TROA 5BT9A 4I66A 4LY0A 1J56A 4QUBA 5JE8A 4CQMD 4DMGA 2PWYA 4ZYXA 3HP1A 4EEZA 1P0IA 1U9JA 3C4VA 3GD5A 2C04A 2OCLA 2YY6A 2QNIA 3NVAA 3PFKA 3PC4A 4HPWA 2WSMA 4LYDA 3TZHA 3V42A 1WL8A 4TMZA 4U7PB 2D7DA 2X8BA 2QX6A 1U1GA 2O2IA 4PS1A 3DOOA 2CKMA 3QLUA 1AGRA 2M98A 2E4ZA 3Q1LA 1ACLA 1QFSA 3HKDB 2CYAA 2XMGA 4UBMA 3MOGA 4RKWA 5T3YA 4R1SA 3Q3CA 4G4IA 1WDWB 5I9IA 2CCJA 3I37X 2RDMA 1JEQA 3HNOA 3VZBA 4CTMA 2I99A 2QKYA 1EP2B 1SGWA 1Y8ZA 2PRZA 1GUFA 5HUJA 3E2MA 4D92A 3HCWA 4MOWA 4CEIA 5B2FA 1H4TA 2ID8A 1SXGA 1H2HA 3PGJA 2HSGA 5BW4A 3TQTA 3VU1A 5ESWA 3KR2A 4YJHA 1I6LA 1ZJYA 2ID4A 2XF8A 1A5SB 3I9JA 5EEHA 1QGUA 2FZCA 3DVLA 3IKJA 4Y2JA 2GAFA 1GGNA 1PZHA 1V96A 1SOVA 2Q3JA 1ISPA 1GT6A 2C1XA 2VKQA 4FFMA 4PLWA 1NNUA 2ZI4A 1RT9A 2RGWA 4H6WA 4PNPA 4TWRA 3G68A 1IY1A 2PU5A 5B1HA 5BWBA 5T4FA 3CSDA 3QKSA 4DEXA 4OQXA 3L0BA 2RHMA 2NV0A 4X1OA 4DIMA 4CIBA 3ZJTA 2GVDC 3OICA 4O1MA 3TOVA 5ALGA 3CGWA 5CG2A 3TH5A 2E1PA 1F2TA 1KMNA 2NT3A 3ZE0B 3H16A 1NYLA 2ZTUA 3WADA 4CV2A 5I6DA 4LZAA 4WUTA 3OX1A 1LBHA 5A2QA 1AQNA 1V8BA 1LBQA 2C1ZA 3C48A 3H2GA 4O8ZA 3SR3A 4DNXA 3WRXA 3U4AA 4CLDA 5IVDA 4Z4EA 3PTZA 1II9A 3M1AA 1JE0A 3QU9A 5TSDA 2K4MA 3KXIA 3ODPA 1VDZA 4ZDIA 2XLBA 3H5VA 3DP9A 2AYZA 2BI8A 3GF4A 2RCNA 4KZKA 3HXPA 1RMYA 4DMRA 4QG7A 2HLDD 3OX2A 1PL7A 2G9ZA 5CM8B 3DH0A 1KHTA 3ETJA 4N0EA 1O54A 3PQ5A 4Q3DA 1ADJA 1Q1ZA 2CD9A 2I7XA 4U2EA 4W5TA 5K09A 4OFXA 5BV0A 3B1XA 4A03A 3GVCA 4PG7A 1VE1A 4IDFA 3L06A 4JP3A 4B5KA 4MQEA 2G6BA 5GAJA 1BS2A 5FHRA 3NHYA 4WT7A 2F67A 4IY1A 4O5AA 1T1JA 4RMHA 4UBOA 1MJFA 1G41A 3H8WA 1RNLA 3S27A 1RXWA 3JZFA 1VLLA 3W6UA 1M9NA 1B6RA 4MQ4A 1ZNQO 1MH9A 4IJWA 2Q50A 5ELMA 3RLFA 3B6EA 1SUSA 3WGKA 4BB5A 5JDIA 1GA1A 3GA5A 3GLIA 3Q0IA 5FKJA 1YC2A 2AZMA 5EAIA 3UW3A 2J0VA 3B85A 4G1EB 3NANA 3R4CA 1UDCA 2EKZA 1SD2A 2ZI6A 3GNLA 1C7EA 4LYFA 4TUYB 2BFWA 2IHBA 1NRIA 4G86A 5I9TA 2XXAA 3CT4A 4DC0A 4FC6A 1L7NA 4HK4A 4HVTA 1OH7A 1NXWA 3A9TA 4BLRA 4JJ7A 2VRNA 1DEXA 2Q46A 4OKNA 1IWBB 3UXYA 1GPMA 4FNAA 3ZV6A 2HF8A 5DI3A 1D4OA 1QS0A 4I50B 8ATCA 3N9IA 1ZINA 1M0WA 1Y63A 4EJFA 4LGYA 2Y67A 4IXMA 4CETA 3VPHA 1OAOC 1K9SA 3HPRA 1XTQA 4URHA 2B1RA 2GF9A 4MRRA 1Q2UA 2F43B 4O25A 1J97A 4WFQA 4CI0B 5KOJB 3JZIA 3QF4B 3WLEA 2I55A 3FUXA 1BSVA 1YCHA 1XRPA 3EGCA 3KJHA 4NARA 2A4KA 2ONYA 3QWBA 3AM5A 5CX1B 4LRXA 5TMDA 1KZ4A 1QQTA 1SQGA 3GJQA 1T3GA 2I7VA 2D62A 1Y5LA 1VKZA 4KQWA 2ZG6A 3OIFA 4NBRA 1XVIA 3HRHA 2AN5A 1MX1A 1MGPA 1WCYA 2BHRA 2XB9A 4NBLA 4UDOA 5CUQA 4KHPB 1IY9A 2RC5A 4IHAA 3E1KA 4H4CA 3CKKA 4HQ6A 5HR5A 5EIOA 2B21A 1AXRA 1XE3A 4OHUA 1Z7YA 4IMRA 4QLAA 4R8VA 3GPDG 2C3UA 2CE2X 3K70B 2F3RA 3BEOA 4D4JA 4DIKA 2DPHA 2R7LA 4QZVA 1A7JA 1L8OA 2ZTSA 4NCJA 2Y0CA 1S2MA 1UMDB 1THTA 1T2AA 1WAMA 2DBVO 2LP4Y 1C50A 3CJTA 3CPHA 3G1TA 3WX0A 4DAOA 4Z53A 3OE4A 3KR1A 5H1YA 2VLBA 2MSNA 4J9VA 2FQWA 3EOZA 4ZICA 1O87A 2WHYA 4U2KA 3KD2A 2VJOA 3I12A 1H5NA 3NAGA 1IUNA 1UMBA 4HKTA 1JXOA 5ILQA 4J16A 2CSXA 3WTCA 3KZKA 2DSNA 5BWCA 5DEIA 2D06A 3PPIA 1T2VA 3K0AB 4MPDA 3COPA 1N2ZA 1MG5A 5EGSA 2QJWA 3QWHA 3TE7A 2H9IA 1V6CA 3GFOA 3H7AA 2C7BA 4JJ4A 5HA5A 3IJEB 1OWMA 1Q0HA 4HS9A 4RLFA 5L45A 3A26A 3AF1A 3IELA 1ADGA 2HRCA 5AHWA 1KFEB 1SBNE 1IMOA 2WQZA 2EFHB 2FK7A 1TU4A 1DXHA 2C3MA 3H9JA 3P0JA 1TM1E 4WCFA 3H0EA 5DGDA 3MWJA 5DLDA 2LDXA 4EFMA 2FI1A 2QN3A 2X5OA 4BNVA 2XQVA 1UMCA 2JIOA 2BMAA 1OZGA 1N0HA 1X7HA 2CY0A 5ALMA 5IEJA 1P19A 2P9EA 1PDOA 1P8JA 2H1LA 1RXEA 1EDOA 1JXMA 3UB4A 2OO5A 5KWEA 1QLWA 1G2OA 1FXWF 2M2IA 3RG8A 4UAJA 3AJ9A 1YCDA 2LKDA 4RCVA 3PL5A 1WVIA 3UBMA 1SOMA 4A8PA 3NUQA 4JLPA 3L1UA 4Q4JA 1CUYA 4CKCA 1E2NA 2QRLA 4R1QA 1PZXA 1XEXB 1EVLA 3FPHA 2FSFA 3FCSB 5KJ1A 4IWNA 1FA9A 1GZHB 1XRJA 5K0TA 1CRZA 3UK2A 4X8MA 1T2UA 2UZ1B 1UKZA 3F3MA 5AOCA 4C7MA 1KKLA 2J08A 3F2VA 4WZBE 4ZO7A 4CZ2A 2ADMA 5FUWA 1MC8A 4MP8A 3LV8A 1CERA 3HEMA 1U0NA 1F38A 2O52A 3DQZA 1RLJA 4LE1A 3ZHCA 2B1GA 4EB8A 2H51A 3C3MA 2ZW9A 1IHDA 5IAGA 3RYHA 2NWQA 5KCMA 3LCJA 4KBFA 4ZYUA 2QYSA 5HIIA 3ROQA 1MXFA 3BWBA 5C8YA 3RNLA 3A32A 3PVZA 4MS4A 5ALNA 1KZ7B 1YBFA 4OJNA 1JHVA 1II8B 2IEBA 3DT8A 1KSHA 5K0EA 4CF7A 5I45A 1OFUA 4WSOA 1LQTA 4RHTA 2DBYA 1L5WA 2OB1A 1HKUA 3I9MA 4CF5A 2XEXA 3SF8B 3QU2A 3JYPA 4JKIA 4KG7A 4BNWA 1B8NA 1XCPA 2OO5C 2X5NA 4HLCA 3IJ5A 1ODLA 3C16C 3C6BA 3GJ7A 5LM3A 1G8JA 1U7TA 2D1SA 3G2OA 2AG1A 1LKZA 1F51E 3UVEA 1OXXK 3M5DA 5EXDA 2RGUA 1KIMA 4QHSA 2ZUSA 4IIEA 4NE7A 1CWUA 5EWJB 4NBKA 2C2HA 5ERGB 1W4CA 1NMZA 4H1WA 1B6SA 1GR0A 1MORA 4FNMA 3QE3A 4DIOA 1YO6A 3CR7A 3U49A 4HB2A 4CF4A 4TYPA 2OV6A 1PHPA 2Q3HA 4CLOB 4DABA 5HF9A 3EFOB 1BVYF 3G2NA 3KO8A 1M2FA 1V4NA 2AK2A 1VJRA 2C9DA 3N6XA 4S1NA 2ZJFA 5PNTA 3U3MA 1BWRA 1VPWA 1E9DA 2HW8A 3MLEA 3OU6A 4K2HA 4LOHA 1P1IA 1SCQA 3B6ZA 5HJ7A 2PV7A 1DZIA 4JOBA 3ZVLA 3EVTA 5DVZA 3B7PA 2IV2X 2GBGA 2ORVA 5JCXA 1X1BA 2ILVA 2E2WA 1AKUA 2C4NA 2W6MA 3MGGA 2XHZA 1G7TA 2W7TA 2X0EA 1Z5GA 2V0NA 3SSOA 3IERA 1NRWA 3AI1A 1PJ2A 4QUEA 4RVFA 3VR3D 3W7AA 4DWVA 2JA1A 2B61A 2CE7A 2D54A 1FMCA 2GN0A 5EFOA 4O2AB 5TVGA 4X62B 5HF8A 1SC6A 1X1AA 3NG1A 2AKAB 1DKMA 3DE3X 1Z62A 3KB6A 3MBKA 3OLCX 3SJAA 1MX3A 5GIOE 3WA6A 4QC2A 1GJRA 1SCJA 3R75A 4HYQA 1PK7A 1N57A 2C9CA 4L07A 1HE5A 1Q1QA 1TYEB 2W6PA 5BRNA 3UXMA 1UK8A 3KDSE 4YRDA 5BNWA 2CJXA 2H2AA 4FI3C 4JR2A 1X70A 3LBFA 4Y6GB 2VHXA 1K8YB 1VBFA 2G5PA 2HUPA 3ZY5A 3V32A 3CLTD 4J3FA 2WZDA 5K3BA 1KAGA 3AR8A 3W05A 3BXZA 1ZUIA 4O29A 2VAPA 4PC3A 5I8WA 2A1UA 1TGYA 1UDRA 2ZZMA 4FEAA 3RTCA 2QUHA 3KPWA 4C76A 5JZMA 4ZQBA 5DHAA 4AWXA 2OBXA 2ZSKA 3B51X 5ERYA 4RZ2A 1XB2A 2QW1A 2VTBA 5J2UA 2C88A 2G1UA 3SBOA 1OB2A 3E3LA 1TJYA 5BSGA 4I55F 2OHHA 5AK0A 3ZVKA 4K9RA 3GL9A 3TDKA 3PYXA 2FR8A 5JVDA 1J23A 5IT9A 2NZWA 1BA3A 3DL0A 1RR6A 5CVVA 3FDZB 3IV9A 4O1HA 4XZ3A 5FLEX 5KKAA 3SR0A 4IQ8A 3WHKA 3DV2A 4J91A 1N2CB 2KWIA 3PKJA 5FOVA 4A2CA 3DHYA 1JMYA 3K9NA 1XVTA 5JAOA 4AY3A 1P29A 5AK5A 3I62A 2ONCA 1KAMA 3R40A 1HBJA 4TPKA 1GNTA 4GBGA 3EA0A 1S02A 1PV1A 1D2NA 1EZ4A 1Z0ZA 2HLNA 3ELUA 3UHFA 3OF2A 4X1YB 4N65A 4AD8A 3VI3B 5LQJA 1SNYA 5SICE 3Q8MA 2WIFA 3NEYA 4CEJA 3OZVA 4B4OA 1FNNA 1LZKA 2SICE 3OEWA 1UM8A 3TNLA 4ZALA 4C0WA 4B73A 2GCEA 3EDQA 4MUHA 4DV0B 1JR3A 1BFUA 5KYWB 4OK6A 2JFYA 3O2JA 1RHKA 3HB4X 2Z6AA 5EE3A 1K7SN 1C4KA 3KELA 4OXXA 3FCUB 4IH4A 4NDNE 1KFBB 4ZQEA 3GVPA 3KFVA 3QKRA 4R1UA 4OHPA 4M99A 4A2PA 5ILOA 3JQAB 3DKVA 3CVVA 3MIIA 3CVYA 1KBOA 4QWMA 2AMJA 4TX1A 2BKXA 3UG7A 2FR1A 3K0CC 4K6HA 4W5WA 2CLMB 3UJ6A 3PEVA 1Y5RA 1JIUA 4P36A 1VE3A 1KRHA 1X74A 2A94A 3GT0A 5HCUA 3E9DA 2J9XB 1L8QA 4UZSA 3RTBA 1PFYA 2SKEA 4HRXA 1FLAA 2L0XA 1RQGA 2FW8A 2Q6LA 3I39X 3LWNA 5LIPA 3AKDA 1XI2A 1QZUA 1Z4QA 2JIQA 1B8OA 2DBQA 5EJ7A 1E1QD 4R41A 3HMKA 1YJQA 3IQXA 5JCPA 3S2EA 3IUYA 2YV5A 2ZWAA 1CUBA 3QE2A 3V1LA 5J3JA 3HO8A 1RWXA 4AMBA 4POOA 2GI4A 2ZYHA 1J33A 1QFYA 2VEOA 2HT1A 4QA9A 4I9FA 2CV1A 1G4HA 1TMOA 3REQB 2BRUA 3FCCA 3C6ZA 1W4ZA 4AUMA 1V4VA 4II7A 4PXYA 5KYVA 2OD7A 1NJFA 5AW1A 1U7WA 4RA9A 3QLEA 5ITSA 2XWBF 3K9WA 5FQOA 1KJ9A 1V8FA 2Q1XA 3F74A 1DLJA 3LFTA 3W04A 4E13A 1XD2A 2PX6A 2HIGA 3P27A 4NATA 3F7NA 4WVFA 4JLBA 4UE3S 2RH4A 2X9GA 4KWTA 3VH4A 1C7IA 2WAYA 3L1IA 4G5HA 2AR0A 1DKOA 3AKYA 4XJTA 5CM2Z 5EJAA 3RJ9A 1ZKMA 1FJGB 5B58C 4WKPA 5B5SA 1HDOA 3V1UA 3IUJA 5AW7A 2YVUA 5T8KA 2FX3A 5DO9A 1PGNA 5ICGA 3H3JA 2OGZA 2BFDA 3HCOA 3F9RA 2PCJA 4J0JA 4E88A 5JDCA 5JANA 3MJ4A 1NIJA 4LRTB 1YI0A 1T34A 2FPGB 1V7CA 1Y5NA 3GLVA 4UFOA 3R7NA 1AD2A 2ASVA 2EBFX 2XUJA 4LPSA 3JVEA 5A3JA 2QSUA 5DX0A 4GXQA 1V0JA 2ZRPA 3HP7A 3NHWA 1OB5A 1IAVA 1LQUA 1OBCA 1RADA 2V7VA 3NS7A 1RRVA 1NWCA 3AHHA 1QHGA 4F8EA 3CM0A 4YJ2F 3MWYW 4BVAA 4Y6QA 1Z5OA 3SBEA 1HMYA 4R3UC 4Q3KA 2XUDA 1OXMA 4KE8A 4URUR 5BSVA 4M88A 4XIFA 2C4TA 3THSA 3TI9A 3UATA 1ISFA 1EG2A 1AUOA 2JGMA 4BJHB 1EQAA 1K6EA 3OQHA 1VPVA 3K70D 9LDTA 4X92A 2Y6VA 2PQ0A 5AM5A 2O7VA 4J0EA 4RAQA 5JFTA 3LGAA 2BEVA 1EWVA 1EKXA 1RJGA 2QLBA 2VYCA 2XWJI 3QHAA 4KQXA 5CVDA 3CG4A 5GVRA 2C97A 5FEMA 5H9VA 2PWBA 5BWOA 1VLJA 5UKDA 4OG2A 5KOYA 1UBRS 3WIDA 1XV5A