3NKUA

Crystal structure of the n-terminal domain of drra/sidm from legionella pneumophila
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
176
Chain Sequence
GSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSSDLDAFVIVKNDEDIKKVKPVFDALNNLCQRIFTASINPSRLIGTPDDLFGMLKDGMVADVEATAMSILTSKPVLPRYELGEELRDKIKQEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein transport
molecule keywords DrrA
total genus 56
structure length 176
sequence length 194
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2010-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.110 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3nkuA00
3NKUA
chains in the Genus database with same CATH superfamily
8ICSA 3MDCA 2BCSA 4K8VA 2VANA 1KEJA 2HHPA 4GXJA 7ICOA 3UXPA 4E7XA 4MF8A 4QZGA 5J2HA 5CHEA 4QZAA 3UQ0A 4K4IA 3WFPA 4PGXA 8ICBA 4WOYA 1R89A 5DB9A 7ICVA 1KDHA 3LQCB 4FH5A 4RWOA 5HRFA 4UB3A 3WFRE 2HN1A 9ICIA 5J2IA 9ICUA 4WH5A 4R63A 2FMPA 4LVSA 9ICLA 4N7RA 3NVOA 1TV9A 8ICJA 1XSNA 4PH5A 4NY8A 4KB6A 4RQ6A 4EBJA 3HW8A 4GXIA 1MIYA 3CK6A 1BPEA 2IHMA 3EF2A 3UPSA 1HUZA 5DB7A 1BPDA 4RT3A 3OGUA 2DRAA 3WFOA 4XQ8A 5EOZA 4QZFA 1WOTA 2GA9D 2W9MA 5DEDA 5J29A 4HX0A 3JCFA 1ZQYA 4I28A 4OAIZ 3JPRA 4WCWA 4WC0A 4X5VA 1ZQCA 4K9AA 9ICVA 4O68A 4OAFA 5JTGA 8ICTA 4K96A 9ICCA 3ISBA 4DOBA 4FHYA 5IIKA 4X0BA 4I2AA 4FO6A 4MFAA 4P2HA 4MFFA 5J2CA 1BPZA 1TFYA 2HN2A 9ICGA 4K4HA 3C5FA 4AT8B 4WC1A 5J2EA 5IILA 4I2DA 4I2HA 4MKPA 4F5OA 4KLTA 3V7JA 4PHAA 4I0UA 4RWQA 4NLZA 9ICBA 3HX0A 3H37A 4M04A 3RH6A 3OV7A 9ICFA 4KLSA 5J2BA 4KLIA 9ICKA 3AQMA 5J2FA 3AQNA 4NXVA 1VJ7A 4X4TA 1XSLA 2DRBA 8ICPA 1ZQWA 4FO1A 9ICNA 2NRKA 9ICHA 4X4QA 4UB2A 8ICUA 3OVAA 2B4VA 4Z6CA 9ICSA 4NXTA 3K75D 4EGWA 3C2KA 4WQLA 5CFSA 4WC3A 2FCLA 3OWGA 3NWIA 1ZQAA 4UBBA 2DR7A 3JPNA 2M2WA 2GWSA 4IQTA 4QZBA 4I29A 4I2CA 3OVBA 5D62A 4XJEA 5DBCA 1ZQNA 4UAYA 4KM5A 3UPQA 1NO5A 1ZQJA 4NXWA 5HRKA 1ZQPA 2ISPA 8ICHA 2BPFA 5HRHA 5J0PA 4RQ5A 4OAGA 5CP2A 4I2JA 4AT9A 7ICKA 4RT2A 4KLEA 4RPYA 3MBYA 7ICFA 4XQ7A 2ZH9A 2BCRA 1Q79A 4WBYA 1ZQEA 1UETA 4RPZA 4NKUA 4IQVA 4WBZA 7ICMA 5CFUA 5HC9A 1ZQZA 4UAZA 4OAHA 4XA5A 5D46A 7ICIA 1NOMA 4X4NA 5F2VO 2ZHBA 2BCUA 5IIIA 3C2LA 7ICQA 4KLMA 3JYYA 4O5KA 4JLZA 4DOAA 9ICXA 1YLQA 5CA7A 8ICXA 4R65A 4FHWA 3H3AA 5DDYA 5J0QA 7ICHA 3RJJA 4I2IA 4DO9A 5J2JA 8ICEA 7ICNA 4LZDA 1VFGA 4O9MA 5TZVA 4KLOA 4IG8A 4QZHA 2M2UA 4WQKA 4RQ8A 4EBKA 1JMSA 3JPQA 3C18A 3C5GA 2PFPA 5HHIA 4IQUA 4PPXA 1TVAA 3RJEA 2ZHAA 4JWMA 3WFSC 4M9LA 4Z6DA 2ISOA 4I2EA 4PHEA 4X4RA 4RWNA 4QZDA 4UB1A 4PGQA 4E8FA 9ICJA 5J2DA 4RQ4A 4WC5A 4KLFA 4I2FA 2ZH6A 4F5RA 5IIJA 4F5QA 4UD4A 3L9DA 4UB4A 4KLUA 4X4UA 7ICSA 4NXXA 5D49A 4WC7A 2GAFD 1ZQHA 5J0XA 2BPCA 2EWRA 4YCXA 2DR9A 3MGHA 1R8AA 1UEUA 4K9BA 3ER8C 4KLGA 9ICMA 5J0SA 4M5DA 4X0AA 4NXUA 3RJIA 2ZH3A 4PHPA 5DB8A 1RZTA 1ZQDA 4NLNA 5J0YA 3UXOA 9ICQA 5J0OA 4TUQA 4AT9B 2ID1A 1ZQRA 2BCQA 4P4MA 9ICRA 2PFOA 4DOCA 2O5AA 5CHGA 2ZH1A 4O69A 1ZQMA 4R66A 4LEVA 3OUYA 7ICUA 5BOLA 4KLLA 9ICOA 4EV6A 5DKWA 4NLKA 5IIOA 2B51A 4Z6EA 4WC4A 1TFWA 8ICVA 3PHZA 4X4OA 3PMNA 2ZH8A 5B3PA 5DBAA 5D4BA 1ZQGA 5J2KA 4AT7B 5HRBA 3B0XA 4PGYA 1KNYA 1BPBA 4F5PA 2DR5A 2BE3A 2ZH4A 4M47A 4NKTA 1Q78A 3HJ4A 9ICAA 4EEDA 4RQ7A 9ICWA 4M9GA 4QZ8A 4FHPA 3H39A 3ISDA 3MCRA 1JN3A 4KLJA 5BOMA 4M9JA 1XSPA 2DR8A 4R64A 3JPOA 3RJGA 3NYBA 1ZQKA 4TURA 4EP7A 5B3QA 5IINA 3V7KA 4QZCA 5J0WA 3RH4A 4LEZA 3OVSA 8ICKA 3RJFA 4RQ0A 2P66A 5CFTA 4I27A 7ICTA 5DBBA 5HHHA 2BCVA 4K97A 2PBEA 1ZQXA 3H38A 2PFQA 5BPCA 4E80A 3PNCA 3TFSA 4X4VA 1ZQLA 4KLDA 4FH3A 1GPJA 5J0RA 1ZQOA 4M0AA 8ICCA 4O67A 5HRIA 1JQRA 4RWPA 2BPGA 7ICGA 1MQ2A 5J0TA 4UBCA 3JPSA 8ICGA 3GDXA 3ISCA 1ZJMA 8ICYA 4NXZA 4RQ3A 4IQWA 3JPTA 4YD1A 4O6AA 5D63A 1ZJNA 3RJHA 8ICQA 1ZQFA 1FA0A 4ATBB 4I2BA 4MF2A 4X4SA 5CB1A 5HRLA 5DDMA 4XUSA 3OUYB 3MDAA 1OU5A 3UXNA 5HRGA 3WFQE 4O5CA 1ZQVA 1ZQBA 4YD2A 4YMNA 4Z6FA 3AU6A 7ICLA 4GXKA 2ZH5A 4KLHA 7ICPA 3RJKA 4RPXA 1ZQTA 1ZQSA 4YMMA 2O1PA 5DB6A 9ICTA 8ICRA 4AT7A 5J0UA 4KLQA 8ICIA 4M2YA 8ICLA 3HWTA 5J2GA 4MFCA 1MIWA 3C66A 4QZIA 2M2TA 4TUPA 2I9GA 3V7LA 3JZ0A 2ZH7A 2PXIA 4QZ9A 3NKUA 3UQ2A 3AQKA 3LK9A 8ICAA 1ZQQA 1ZQIA 4LT6A 4LZGA 1F5AA 5D61A 1UEVA 4ATBA 4WC2A 4JWNA 3AQLA 4FHXA 2B56A 4UAWA 1RPLA 2RFFA 7ICEA 4K4GA 3PMLA 1JAJA 1HUOA 8ICNA 4AT8A 8ICMA 3AU2A 4WC6A 3V72A 1ZQUA 2ZH2A 3ER9B 9ICEA 4RQ2A 4RQ1A 7ICJA 2FMQA 4NM1A 2IUBA 4F5NA 4LEWA 2BBJA 4EEBA 1BPXA 9ICPA 4K99A 1V4AA 4YMOA 8ICOA 2IHOA 3MGIA 3AUOA 4M9NA 3K7DA 4FHVA 4YN4A 4P4OA 3RH5A 7ICRA 1PX5A 4X4PA 3TFRA 2BBHA 1MIVA 4LEYA 4QZEA 5CJ7A 4S3NA 5DECA 2DVIA 5CWRA 2PFNA 8ICFA 5IIMA 4UB5A 1BPYA 1MQ3A 2M2VA 3C2MA 3HIYA 8ICWA 4K98A 3ERCC 3HJ1A 1R8CA 4NM2A 4UD5A 4XRHA 4TUSA 1R8BA 4O5EA 4M9HA 4P4PA 5HREA 4I2GA 2Q66A 2FMSA 4PHDA 5J2AA 8ICZA 5CR0A 3JPPA 5HRDA 4JLXA 5HR9A 3B0YA
chains in the Genus database with same CATH topology
4K97A 2B56A 4WH5A 4LEYA 3MCRA 4K8VA 4WQKA 4NXWA 4FO1A 4NXXA 4N7RA 4MKPA 4OAIZ 2GAFD 1GPJA 4OAGA 2EWRA 2B4VA 4KB6A 4O67A 2B51A 3NKUA 4OAHA 4NXTA 4JLZA 4K98A 5CHEA 4K9BA 3ER8C 3ERCC 5B3QA 4NXUA 3EF2A 3ER9B 4K9AA 4WQLA 5CFSA 3PHZA 2FCLA 3OWGA 4O68A 5B3PA 4LEZA 4LEWA 4OAFA 4K96A 4WOYA 4K99A 2IHOA 3K7DA 5CFTA 5D61A 5CFUA 4O69A 2GA9D 4XJEA 5D62A 4HX0A 4NXVA 4O6AA 4JLXA 5D63A 4LEVA 4KM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKU A; 
#chains in the Genus database with same CATH topology
 8ICS A;  3MDC A;  2BCS A;  4K8V A;  2VAN A;  1KEJ A;  2HHP A;  4GXJ A;  7ICO A;  3UXP A;  4E7X A;  4MF8 A;  4QZG A;  5J2H A;  5CHE A;  4QZA A;  3UQ0 A;  4K4I A;  3WFP A;  4PGX A;  8ICB A;  4WOY A;  1R89 A;  5DB9 A;  7ICV A;  1KDH A;  3LQC B;  4FH5 A;  4RWO A;  5HRF A;  4UB3 A;  3WFR E;  2HN1 A;  9ICI A;  5J2I A;  9ICU A;  4WH5 A;  4R63 A;  2FMP A;  4LVS A;  9ICL A;  4N7R A;  3NVO A;  1TV9 A;  8ICJ A;  1XSN A;  4PH5 A;  4NY8 A;  4KB6 A;  4RQ6 A;  4EBJ A;  3HW8 A;  4GXI A;  1MIY A;  3CK6 A;  1BPE A;  2IHM A;  3EF2 A;  3UPS A;  1HUZ A;  5DB7 A;  1BPD A;  4RT3 A;  3OGU A;  2DRA A;  3WFO A;  4XQ8 A;  5EOZ A;  4QZF A;  1WOT A;  2GA9 D;  2W9M A;  5DED A;  5J29 A;  4HX0 A;  3JCF A;  1ZQY A;  4I28 A;  4OAI Z;  3JPR A;  4WCW A;  4WC0 A;  4X5V A;  1ZQC A;  4K9A A;  9ICV A;  4O68 A;  4OAF A;  5JTG A;  8ICT A;  4K96 A;  9ICC A;  3ISB A;  4DOB A;  4FHY A;  5IIK A;  4X0B A;  4I2A A;  4FO6 A;  4MFA A;  4P2H A;  4MFF A;  5J2C A;  1BPZ A;  1TFY A;  2HN2 A;  9ICG A;  4K4H A;  3C5F A;  4AT8 B;  4WC1 A;  5J2E A;  5IIL A;  4I2D A;  4I2H A;  4MKP A;  4F5O A;  4KLT A;  3V7J A;  4PHA A;  4I0U A;  4RWQ A;  4NLZ A;  9ICB A;  3HX0 A;  3H37 A;  4M04 A;  3RH6 A;  3OV7 A;  9ICF A;  4KLS A;  5J2B A;  4KLI A;  9ICK A;  3AQM A;  5J2F A;  3AQN A;  4NXV A;  1VJ7 A;  4X4T A;  1XSL A;  2DRB A;  8ICP A;  1ZQW A;  4FO1 A;  9ICN A;  2NRK A;  9ICH A;  4X4Q A;  4UB2 A;  8ICU A;  3OVA A;  2B4V A;  4Z6C A;  9ICS A;  4NXT A;  3K75 D;  4EGW A;  3C2K A;  4WQL A;  5CFS A;  4WC3 A;  2FCL A;  3OWG A;  3NWI A;  1ZQA A;  4UBB A;  2DR7 A;  3JPN A;  2M2W A;  2GWS A;  4IQT A;  4QZB A;  4I29 A;  4I2C A;  3OVB A;  5D62 A;  4XJE A;  5DBC A;  1ZQN A;  4UAY A;  4KM5 A;  3UPQ A;  1NO5 A;  1ZQJ A;  4NXW A;  5HRK A;  1ZQP A;  2ISP A;  8ICH A;  2BPF A;  5HRH A;  5J0P A;  4RQ5 A;  4OAG A;  5CP2 A;  4I2J A;  4AT9 A;  7ICK A;  4RT2 A;  4KLE A;  4RPY A;  3MBY A;  7ICF A;  4XQ7 A;  2ZH9 A;  2BCR A;  1Q79 A;  4WBY A;  1ZQE A;  1UET A;  4RPZ A;  4NKU A;  4IQV A;  4WBZ A;  7ICM A;  5CFU A;  5HC9 A;  1ZQZ A;  4UAZ A;  4OAH A;  4XA5 A;  5D46 A;  7ICI A;  1NOM A;  4X4N A;  5F2V O;  2ZHB A;  2BCU A;  5III A;  3C2L A;  7ICQ A;  4KLM A;  3JYY A;  4O5K A;  4JLZ A;  4DOA A;  9ICX A;  1YLQ A;  5CA7 A;  8ICX A;  4R65 A;  4FHW A;  3H3A A;  5DDY A;  5J0Q A;  7ICH A;  3RJJ A;  4I2I A;  4DO9 A;  5J2J A;  8ICE A;  7ICN A;  4LZD A;  1VFG A;  4O9M A;  5TZV A;  4KLO A;  4IG8 A;  4QZH A;  2M2U A;  4WQK A;  4RQ8 A;  4EBK A;  1JMS A;  3JPQ A;  3C18 A;  3C5G A;  2PFP A;  5HHI A;  4IQU A;  4PPX A;  1TVA A;  3RJE A;  2ZHA A;  4JWM A;  3WFS C;  4M9L A;  4Z6D A;  2ISO A;  4I2E A;  4PHE A;  4X4R A;  4RWN A;  4QZD A;  4UB1 A;  4PGQ A;  4E8F A;  9ICJ A;  5J2D A;  4RQ4 A;  4WC5 A;  4KLF A;  4I2F A;  2ZH6 A;  4F5R A;  5IIJ A;  4F5Q A;  4UD4 A;  3L9D A;  4UB4 A;  4KLU A;  4X4U A;  7ICS A;  4NXX A;  5D49 A;  4WC7 A;  2GAF D;  1ZQH A;  5J0X A;  2BPC A;  2EWR A;  4YCX A;  2DR9 A;  3MGH A;  1R8A A;  1UEU A;  4K9B A;  3ER8 C;  4KLG A;  9ICM A;  5J0S A;  4M5D A;  4X0A A;  4NXU A;  3RJI A;  2ZH3 A;  4PHP A;  5DB8 A;  1RZT A;  1ZQD A;  4NLN A;  5J0Y A;  3UXO A;  9ICQ A;  5J0O A;  4TUQ A;  4AT9 B;  2ID1 A;  1ZQR A;  2BCQ A;  4P4M A;  9ICR A;  2PFO A;  4DOC A;  2O5A A;  5CHG A;  2ZH1 A;  4O69 A;  1ZQM A;  4R66 A;  4LEV A;  3OUY A;  7ICU A;  5BOL A;  4KLL A;  9ICO A;  4EV6 A;  5DKW A;  4NLK A;  5IIO A;  2B51 A;  4Z6E A;  4WC4 A;  1TFW A;  8ICV A;  3PHZ A;  4X4O A;  3PMN A;  2ZH8 A;  5B3P A;  5DBA A;  5D4B A;  1ZQG A;  5J2K A;  4AT7 B;  5HRB A;  3B0X A;  4PGY A;  1KNY A;  1BPB A;  4F5P A;  2DR5 A;  2BE3 A;  2ZH4 A;  4M47 A;  4NKT A;  1Q78 A;  3HJ4 A;  9ICA A;  4EED A;  4RQ7 A;  9ICW A;  4M9G A;  4QZ8 A;  4FHP A;  3H39 A;  3ISD A;  3MCR A;  1JN3 A;  4KLJ A;  5BOM A;  4M9J A;  1XSP A;  2DR8 A;  4R64 A;  3JPO A;  3RJG A;  3NYB A;  1ZQK A;  4TUR A;  4EP7 A;  5B3Q A;  5IIN A;  3V7K A;  4QZC A;  5J0W A;  3RH4 A;  4LEZ A;  3OVS A;  8ICK A;  3RJF A;  4RQ0 A;  2P66 A;  5CFT A;  4I27 A;  7ICT A;  5DBB A;  5HHH A;  2BCV A;  4K97 A;  2PBE A;  1ZQX A;  3H38 A;  2PFQ A;  5BPC A;  4E80 A;  3PNC A;  3TFS A;  4X4V A;  1ZQL A;  4KLD A;  4FH3 A;  1GPJ A;  5J0R A;  1ZQO A;  4M0A A;  8ICC A;  4O67 A;  5HRI A;  1JQR A;  4RWP A;  2BPG A;  7ICG A;  1MQ2 A;  5J0T A;  4UBC A;  3JPS A;  8ICG A;  3GDX A;  3ISC A;  1ZJM A;  8ICY A;  4NXZ A;  4RQ3 A;  4IQW A;  3JPT A;  4YD1 A;  4O6A A;  5D63 A;  1ZJN A;  3RJH A;  8ICQ A;  1ZQF A;  1FA0 A;  4ATB B;  4I2B A;  4MF2 A;  4X4S A;  5CB1 A;  5HRL A;  5DDM A;  4XUS A;  3OUY B;  3MDA A;  1OU5 A;  3UXN A;  5HRG A;  3WFQ E;  4O5C A;  1ZQV A;  1ZQB A;  4YD2 A;  4YMN A;  4Z6F A;  3AU6 A;  7ICL A;  4GXK A;  2ZH5 A;  4KLH A;  7ICP A;  3RJK A;  4RPX A;  1ZQT A;  1ZQS A;  4YMM A;  2O1P A;  5DB6 A;  9ICT A;  8ICR A;  4AT7 A;  5J0U A;  4KLQ A;  8ICI A;  4M2Y A;  8ICL A;  3HWT A;  5J2G A;  4MFC A;  1MIW A;  3C66 A;  4QZI A;  2M2T A;  4TUP A;  2I9G A;  3V7L A;  3JZ0 A;  2ZH7 A;  2PXI A;  4QZ9 A;  3NKU A;  3UQ2 A;  3AQK A;  3LK9 A;  8ICA A;  1ZQQ A;  1ZQI A;  4LT6 A;  4LZG A;  1F5A A;  5D61 A;  1UEV A;  4ATB A;  4WC2 A;  4JWN A;  3AQL A;  4FHX A;  2B56 A;  4UAW A;  1RPL A;  2RFF A;  7ICE A;  4K4G A;  3PML A;  1JAJ A;  1HUO A;  8ICN A;  4AT8 A;  8ICM A;  3AU2 A;  4WC6 A;  3V72 A;  1ZQU A;  2ZH2 A;  3ER9 B;  9ICE A;  4RQ2 A;  4RQ1 A;  7ICJ A;  2FMQ A;  4NM1 A;  2IUB A;  4F5N A;  4LEW A;  2BBJ A;  4EEB A;  1BPX A;  9ICP A;  4K99 A;  1V4A A;  4YMO A;  8ICO A;  2IHO A;  3MGI A;  3AUO A;  4M9N A;  3K7D A;  4FHV A;  4YN4 A;  4P4O A;  3RH5 A;  7ICR A;  1PX5 A;  4X4P A;  3TFR A;  2BBH A;  1MIV A;  4LEY A;  4QZE A;  5CJ7 A;  4S3N A;  5DEC A;  2DVI A;  5CWR A;  2PFN A;  8ICF A;  5IIM A;  4UB5 A;  1BPY A;  1MQ3 A;  2M2V A;  3C2M A;  3HIY A;  8ICW A;  4K98 A;  3ERC C;  3HJ1 A;  1R8C A;  4NM2 A;  4UD5 A;  4XRH A;  4TUS A;  1R8B A;  4O5E A;  4M9H A;  4P4P A;  5HRE A;  4I2G A;  2Q66 A;  2FMS A;  4PHD A;  5J2A A;  8ICZ A;  5CR0 A;  3JPP A;  5HRD A;  4JLX A;  5HR9 A;  3B0Y A; 
#chains in the Genus database with same CATH homology
 4K97 A;  2B56 A;  4WH5 A;  4LEY A;  3MCR A;  4K8V A;  4WQK A;  4NXW A;  4FO1 A;  4NXX A;  4N7R A;  4MKP A;  4OAI Z;  2GAF D;  1GPJ A;  4OAG A;  2EWR A;  2B4V A;  4KB6 A;  4O67 A;  2B51 A;  3NKU A;  4OAH A;  4NXT A;  4JLZ A;  4K98 A;  5CHE A;  4K9B A;  3ER8 C;  3ERC C;  5B3Q A;  4NXU A;  3EF2 A;  3ER9 B;  4K9A A;  4WQL A;  5CFS A;  3PHZ A;  2FCL A;  3OWG A;  4O68 A;  5B3P A;  4LEZ A;  4LEW A;  4OAF A;  4K96 A;  4WOY A;  4K99 A;  2IHO A;  3K7D A;  5CFT A;  5D61 A;  5CFU A;  4O69 A;  2GA9 D;  4XJE A;  5D62 A;  4HX0 A;  4NXV A;  4O6A A;  4JLX A;  5D63 A;  4LEV A;  4KM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...