3NKVA

Crystal structure of rab1b covalently modified with amp at y77
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-1B
total genus 59
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nkvA00
1J8YF 3C7KA 1IY1A 3B1XA 1U0HC 3F0TA 3FFAA 1T4GA 4HATA 4CDGA 4TYQA 5GJBA 2R6AA 3MCAA 3QG5A 2GZDA 2GNOA 3G0HA 3TR0A 2BM0A 1X3SA 1PUJA 3WY9A 3QEOA 2QPOA 1PLKA 3LBNA 3ZIAA 2CHGA 4BZQA 4ZIRB 4C3ZA 4NONA 3OFNA 2GXQA 2F1IA 5E4FA 2ATVA 2O5VA 3RS4A 2O0HA 5HTKA 1E3MA 1H8ED 3GLIB 1Q1BA 2AXPA 5JFGA 1N6PA 3AUYA 2FU5C 3BH7A 4DVGA 4HLQB 4OQNA 1G4AE 4DJTA 4GP7A 2BHRA 4M8NE 2ZE8A 4DSTA 2WMOB 1EFRD 4IVQA 3IUYA 4QJ5A 5E7MA 4BLPA 1W36C 1ZM4A 2BEJA 3EG5A 1GIAA 4MUAA 3DM9B 3ND9A 1NJFA 4TMVA 4QG7A 4OI0A 2EFDB 1KI3A 2ZR7A 3JVVA 1OJLA 1E2FA 4MRSA 4PSVA 4AKEA 4OK3A 4YDSA 4NL4H 2UVQA 5JCZA 3FKQA 4QKQA 1FMJA 2IK8A 1KMHA 1ODFA 4ARZA 1U9IA 2CBZA 4JVSB 3UKDA 1JQLB 2FDCA 4CEIA 1KDRA 3Q8XB 3NXSA 3CB4A 5JSZA 4PZZA 5LD2C 4DZZA 5GJWC 1ETUA 1FFHA 2J7PD 2ZU0C 1LV7A 3OEHA 4LHYA 1WXQA 2WJJA 2GEVA 3C5CA 5CYOA 1M8PA 2AFIE 1E9DA 1EFUA 1CS4C 1VPLA 4KVAA 1EESA 3MWJA 4IEEA 4F93B 4IDHA 1L2TA 2WWGA 3RRNA 3W9YA 1GNRA 2GJ9A 4NKRA 2GXAA 4DLSA 1KDTA 1NY6A 3U7GA 4YMUA 4NCJA 1YZGA 5FL7A 1D2EA 3QY0A 1TQ4A 5SZIA 2QE7D 1IN4A 2DCUA 1YR8A 3HYRA 2NPFA 2LWIA 3ZVNA 2VL7A 3QKRA 3EA5A 3FDIA 2ORVA 2DFKB 4PHHA 1F6BA 3FTQA 1ZRHA 2Z4SA 1EFHA 1KI1A 1XD8A 1DADA 4E09A 1WRBA 1MABA 2WZQA 2YOHA 2ZI7A 4JZKA 3LFUA 5DE3A 3MG9A 1Z0JA 2OAQ1 1E0JA 2R8RA 3V4FA 3A6PC 3RS3A 5IRCD 1AIPA 4RFSB 1U2RA 4B34A 3NDBB 3T1OA 1G4UR 4LOAA 721PA 4CW7A 3K9HA 4EPRA 1SVSA 3OEEA 2LKDA 1DTSA 1W0KA 2VP4A 1C4OA 1S9HA 3P1JA 1JAIA 4IOJA 3ZVLA 1NY5A 2GK6A 1RJ9B 1VYTA 4MUBA 2IT1A 4WZBE 3RS5A 3THWA 2WJVA 3FB4A 2JLWA 5C1BA 1XD2A 4UJ3A 4HUQA 1RW4A 4CT5A 1Q22A 3QXJA 3MWKA 2J0QA 1OW3B 3T34A 2QT0A 2XAUA 2FEOA 4MKIA 1KI7A 4Q5IA 4US1R 4Q4HB 4PC3A 1KO4A 1GL7A 3QPVA 4BFWA 5J4LA 4XSGA 3FVQA 4EQ6B 1ZW6A 3E70C 4GI7A 3A1VA 5EXSA 4ASUA 1XD9A 3BAFA 1E2PA 5J4VA 3ECCA 2KSQA 3K09A 1KYIA 1ESMA 1R0YA 3UWKA 1OXXK 1U81A 2JIZD 2H92A 2C77A 1W7AA 5LD2B 2ZSDA 4CEHB 1HEIA 2XTZA 4F4CA 2PH1A 2BKEA 3LW8A 2ZRFA 4CF7A 3U4QB 4QM6A 2ZJYA 1Q3TA 4PC7A 1XMSA 3T15A 3WRXC 5HZKA 4GZMA 3VTKA 3UANA 4YXWD 4JBWA 2VP6A 2AWOA 1RRPA 2I3BA 2W83A 4JLKA 1F48A 2ODBA 2WICA 4R9UC 2NO1A 2WIBA 1ELOA 1K5DA 1G3MA 3X1XA 3TW8B 1YZNA 3RRYA 2PZGA 2F7SA 2QSZA 2ZSAA 1ZUIA 1VHLA 2ZRGA 2D7CA 1OKKA 2GXSA 1RPZA 3SE0A 4BUJA 2F3TA 4URVR 3QPWA 2RB4A 2GA8A 1T8UA 3LD9A 5FTNA 1GNPA 2DYKA 2IEZA 5AJZA 2QTFA 4EFNA 3RWMB 5KHOC 5FTKA 1E9BA 2ODWA 1LS1A 2OILA 1UKZA 2OSBA 1D5CA 4P33A 2ZITA 5TB5A 4B3BA 3SQXA 1E9SA 3HDTA 3NBZC 2BMFA 1N2CE 1R4AA 1XNJA 4QJ4A 3QSYA 1F3OA 4BECA 5KYKA 3CPEA 3RSOA 3RS0A 3ZJYA 4IVPA 4NYJR 2DY1A 4S2EA 4B43A 2WTUA 1BS1A 1KSGA 1OFIA 2OBMA 4RD4A 4LK2A 3CH4B 2ZI4A 3FMOB 2NTYC 2NG1A 2ANBA 3NTUA 1SULA 2ATXA 3TW4A 3AKEA 5JRJA 1I4LD 1EFCA 3SEAA 2ZRLA 2O8FB 3LNCA 2NGRA 2P3SA 5EE9A 1JJ7A 1ZNWA 3NBFA 3TQCA 4HUQB 4ZKEA 2ODEA 4Z8YA 1NBMA 1GRNA 4Q03A 1ZUNB 1JEDA 3IGFA 4LYJA 2C96A 4L8GA 2SHKA 1G3IA 4ZDJA 1I4DD 3L0SA 2PMDA 2ZE7A 2EVWX 2GBLC 3B1ZA 3AUXA 4NH0A 1CF4A 1TEXA 3F5FA 1DEKA 1TX4B 4TL8A 4ERNA 3CW2A 3VKGA 1P2TA 5FPHA 5BYKA 3CUEF 1V5WA 5FBRB 3QKTA 4Q7JB 4C0SA 3WMFA 1XMVA 2O0KA 4NDZA 1II9A 3GLIA 4B2LA 4S35A 3LO5A 1KO1A 5H1YA 3K0CC 2YC4C 1R10A 4Q48A 4DLYA 4IDQA 1QG2A 2WM9B 5FOWA 2CLCX 3QIAA 2RMKA 1OXVA 3CF6R 4ZIRA 3H2YA 1NKSA 2OV2A 4JL6A 4DLXA 3T5DA 3CZQA 3K1JA 3UMRA 2I4IA 5CLQA 1DAGA 1GRRA 2ZRIA 4PPGA 4TQUS 4PSKA 4D4JA 1JR6A 2IXGA 1EX6A 5FTJA 3FMPB 1AKEA 2BWJA 1FX0B 1N5IA 2IYYA 2XSZA 4G01B 3KDSE 1XJCA 1E2IA 3Q85A 4ESHA 2JLXA 3CX7A 1AM4D 4KHZA 4WZAE 5IDVA 3RSLA 2JLZA 3VKWA 4LY6A 3MAAC 1NBME 2Z0MA 1WQ1R 2H17A 2WOJA 1IQPA 1E2HA 3BK7A 1NVWQ 5KNDA 1IOZA 4BRWA 4V0LA 4X8MA 4C0KA 4H1UA 4OHXA 1U0LA 1RRFA 2R6FA 4L4UA 4PO9A 5BYJA 2F1RA 3VR2A 5AUPB 5DN6D 2X2FA 1NIJA 2G88A 3CM0A 4URUR 4F4JA 2AXNA 2O8CA 2YINC 5JSZB 3GLIE 5FUXA 3QKSA 3RC8A 5FPSA 2X19A 2ZRBA 2FSHA 2E87A 4RY2A 3QXCA 4LBVA 4D0LB 3D31A 2B8TA 1XMIA 2JASA 3GQBA 4XVQA 4CEJA 1E32A 4GRAA 1L8QA 3RRZA 4TSFD 1ZCBA 3DOFA 2ZUCA 2VO1A 3O8DA 1G6HA 3GJ6A 4KLNA 1OSNA 2KWIA 4DDVA 6Q21A 1JQJC 1ZU5A 1AZTA 2PX0A 3ADDA 5FPYA 4O3MA 3AF3A 1XCMA 5A4JA 3MGCA 4WXRA 4ZDIA 1OF1A 2HF9A 5FR2A 3VAAA 3CIOA 1GOTA 2OBNA 3CF0A 1N0UA 1UKEA 4YONB 2NO7A 4HYYA 1FTNA 1N0WA 2PJZA 2N42A 1UM8A 3QXHA 1J70A 1BH2A 4BLOA 1OHHA 2LKCA 4MDEA 4BLTA 3OE7D 1HTWA 4CEJB 1KY2A 4JLNA 3SOPA 2GF9A 1ZNXA 4RZ2A 4RVCA 4NTZA 2DR3A 3PFIA 4PQRA 2G3YA 2XJ4A 1E2MA 5DI3B 4DUGA 2EWVA 2OUKA 3TLXA 3CX6A 2B21A 3IHWA 2RGGA 3TE6A 3UATA 1DAHA 3RVBA 5LB4A 1LNZA 3M1IA 2V3CC 2GJKA 5G3ZA 1FOEB 3IILA 2MSEB 1W4BA 1ZYUA 4A6XA 4LC1A 1ZIOA 4MGIR 4AWXA 4A2WA 2WWHA 5AUQA 4PQYA 5KPJA 1U9IC 3CZPA 2QZ4A 4G5OA 2XB4A 4XH9B 2JLYA 4M1MA 4W5JA 2IHYA 2BM1A 2GVZC 3WHKA 1E98A 4KJZA 4OKSA 3CRW1 4HSEA 4DHEA 4DSUA 4HAZA 4XJXA 4XWAA 4D4KA 2Q9BA 3KJIA 3O8CA 1XXHE 1J2JA 1N6NA 2FZLA 4V0MA 1E1RD 1BYIA 1Z0DA 3R20A 4YMWA 2PLFA 4II7A 3CRQA 3PUXA 2MMCA 4A92A 1NSFA 1X1RA 4BASA 4DUGD 1ZM3A 3CPJB 3PG5A 2BMJA 2EU8A 1KNQA 1C1YA 1Z0AA 2QORA 4I1OA 4IOLA 3PQCA 2BKUA 4NYMQ 3CPHA 4JLAA 1AS0A 1SKYB 4KYUA 4LDJA 2R65A 3VNUA 3PENA 2QP9X 1M7HA 1KGDA 3I92A 3X2SA 2J9RA 2QAGB 4M9QA 1KDPA 1UFQA 2ZM5A 3CR8A 1AGPA 4GT1A 1JI0A 1A4RA 4TL9A 1G21E 3EZ9A 2QE7A 5A0FA 1QHGA 3IO5A 4C7OA 5L3VA 1UPTA 3L8ZA 1GKUB 3UWOA 2Z83A 3CO5A 3MRSA 3AQ4A 3CWQA 1G5PA 3T35A 5C2JB 1X6VA 1FP7A 4Q47A 2IYVA 2J46A 2WHXA 4MDFA 4GOKA 2KE5A 1MO6A 2ZRKA 1E2GA 1K5GA 1KI6A 4X8LA 3TBKA 3K0SA 1IN8A 2AWNA 3LBHA 3PUZA 4JVLA 1II0A 1KSHA 3JVUA 1I2MA 2A5FA 1XZQA 4W5HA 4DWJA 3P4XA 3O8RA 1G3QA 1DAIA 4N0DA 2ZJAA 1U8ZA 821PA 1OFHA 3SBEA 2B6HA 1E1QD 4PR0A 4NYJQ 3TQFA 1W44A 1G8PA 1Z0FA 3DO6A 3FFBA 1RVDA 2JLRA 1FP6A 3QXXA 4JBXA 1NSTA 2WSMA 4G5SA 1G5RA 4FWTA 4B3CA 1OH6A 1QVAA 2G0TA 5LDDC 4Q1FA 1NN1A 3CLVA 4XWOA 3W3AA 3K0FB 3H86A 2GTPA 3HYTA 3CNNA 2ONJA 3BORA 2EFEB 2J87A 4TWZA 1JBKA 1ZD8A 2REOA 5EP1A 5KNBA 1CTQA 1ZC3A 2D2FA 1AGRA 4R2HA 4V02A 4KI0A 4Q9IA 4DCNA 4MRPA 3QG1A 3P32A 4MKHA 2GRJA 3B6EA 5CITA 3SC3A 4PC6A 2PL3A 1VCIA 3CNOA 4LUCA 1D2NA 3F8TA 2IYQA 1ZNZA 1KJZA 3EARA 2WV9A 5BN4A 4CZ2A 2V7QA 3FKSA 4ZPXA 4Q4AB 4B48A 4CGZA 3DEFA 2X8AA 5L3QA 1NIPA 4U5XA 1SXJB 4CEHA 4BQSA 4BFYA 2IUTA 1DPFA 4Z1MA 2QM8A 3GPLA 2J7PA 3U44B 2ZRAA 5AJXA 3DVLA 3QF4B 3EPKA 1H8HD 2AK3A 1X86B 2OESA 1LVGA 2FPKA 1MH1A 2CXXA 2HJGA 2WOOA 5SZJA 2YHSA 1P61B 1R7RA 4NHOA 1AS3A 1US8B 3GJ7A 1SVKA 2QA5A 4LGMA 4AI6A 4D25A 2RHMA 3KQLA 2F6RA 2JATA 4YMSA 2PCLA 5HKKA 2ECKA 4PHFA 4PZYA 3HU3A 1WE2A 2CVHA 2ZSEA 3GFPA 1KI2A 2YWGA 1G291 1RC8A 3WP1B 3DL0A 421PA 4HZIA 4D0NA 3REGA 2JLVA 1BKDR 3X1DA 4G0NA 2XZPA 2X1VA 5SZHB 3X1WA 1R8SA 1ZCAA 3NIBA 2O8EB 1LY1A 3B1WA 3D7MA 4ACBA 3I62A 4DLUA 1S8FA 2BBWA 1JNYA 3L2OB 2JIZA 5TDHA 2XZLA 3KKMA 5FOSA 1KK3A 3QKRB 1W36D 1KK0A 1ZM7A 1E9EA 1WA5A 2JA1A 4TQ9A 1NN3A 1GM5A 3K9GA 3SYKA 4Q1EA 4MGYR 2BOVA 3VMFA 1EX7A 5CB6A 4F4IA 3QXSA 1M2OB 4KYIB 2XEXA 3PUVA 5FBQB 4TLAA 2IWRA 2FH5B 4URXR 2CVFA 2QL6A 1ZP6A 4HB2A 4KSBA 1VKJA 1G3UA 5FI0B 5K8TA 2GBLA 3KXIA 3TAHA 4LPKA 4URYR 2W6JA 3HWSA 3D3QA 3GFTA 2WKRA 4JVMA 4NCIA 4OHYA 2EFHB 3OEHD 5CK5A 5F98A 3REFA 2REXB 4MITA 4CEIB 4RCZA 1SVMA 3EC2A 1E69A 4AG6A 2RGEA 5FL7D 5F9FA 2NO9A 3GLFA 2IF2A 5AWFC 3J81k 2E1RA 4EUNA 4DLTA 2AKAB 4QRHA 4Q9HA 5J4KA 2ZJ5A 4DSOA 4A0HA 3MFYA 1S3GA 1FTSA 1UBGA 2R6DA 2WWYA 4QOSA 2V9PA 3GJ4A 2JDIA 1AJEA 1GL6A 3AP3A 4P31A 5HE9A 5IK2D 2HLDA 5EP3A 1YHNA 2KB0A 2IW3A 4PPFA 1HYQA 4AKIA 3MMPA 4AURA 2XTMA 4A1FA 3I73A 2RGAA 3I8SA 1KOFA 3DKPA 3PVSA 4N1AA 1TF2A 2XITA 5HR5A 3QKUA 5CDFE 2FGKA 1CULC 4HLDA 3C8UA 2ZYVX 2ZE5A 4AYTA 2YV5A 3VX4A 1YZUA 4JVNA 1UJ2A 4DCSA 4ZO4A 2J45A 1W1WA 2P2LA 5D3QA 5G53C 3AF4A 4QGGA 1KIMA 2K5UA 2OXCA 4EAQA 2BCJQ 4KU4A 5F9HA 3I1FA 1JR3E 1QHIA 3RYTC 4NE2A 2N1BA 2ZRCA 2FGJA 2QT1A 3PV0A 3SJZA 4BFTA 3FYHA 3RS7A 4AG5A 1BYUA 1Z08A 1SXJD 5AR1A 4OQFA 2GCOB 3FHOA 2Q3MA 2QI9C 2R2AA 2F43B 4FCVA 3BFVA 3QOFA 4JT4A 4Q01A 2IX3A 1N6RA 1M7GA 2GJ8A 3MJRA 3IKJA 3DZDA 1IM2A 2FNAA 3A4MA 4P32A 2YVUA 5JWRA 3A8TA 1Z0IA 1F60A 2HEIA 5EE0A 1KZ7B 1CR1A 2FMXA 2HV8A 4YLGA 1VYUA 5KSZA 3LRPA 3BOSA 2WVJA 3LY5A 4JLBA 5AJWA 4I1UA 1RYHA 4Q4AA 4A8JB 4LHZA 1GL9B 1KK1A 2FZ4A 5FOXA 1L4UA 4H1VA 1VG0B 4P4UA 2JJ1D 4LJ9A 3ZZUA 2JJ2D 2W0SA 2ZUBA 4IFBA 2A5GA 4MGKR 4LRWA 1S2MA 1CJTC 2DWPA 2WJIA 3OHMA 1ZJ6A 5JJKA 1OXSC 2ZJ2A 4A8JA 2J59A 2HLDD 4BZXA 4B3GA 3MLEA 2G1KA 2GK7A 2VBCA 4TL6A 3WHLA 4LJAA 5JMTA 4EDHA 5FBVB 2BIFA 4G3XA 1Z63A 1KJWA 1NVUQ 1RFLA 2XX3A 4ZCIA 4DT1B 5EUQB 3AB3A 5B64A 1R6BX 3FHCB 2F43A 3BXZA 4JKIA 2RGBA 2IEYA 5GVRA 1XTSA 2AR7A 4HEJA 2BBOA 3L8YA 5GADl 2D3WA 121PA 3A1WA 4POAA 4Q00A 5CIWA 3U3MA 5GJCA 3U3OA 4W9MC 2QBYB 3ICEA 1T0HB 4C0JA 2IC5A 3W34A 4NYIR 3N5CA 4C2TA 2FFBA 3ZD7A 4M1SA 5DO9A 1UADA 1LF5A 3AEZA 4ON9A 2DFNA 4EJSA 5JJIA 3GEIA 1N6OA 2QMHA 3EASA 1GVNB 4Q4JA 1OH7A 4Q9KA 4YQFA 3VR3A 2ZR9A 2AN9A 1U94A 1NN5A 2CHQA 4I1VA 1ZINA 2QBYA 3AH8A 3OAAD 3VR6A 5FUYA 2QRZA 4K81B 1Q12A 3OE7A 3H4MA 4TQAA 1HH4A 3VNVA 3DMDA 4EFLA 4ABYA 3I4LA 1OXUA 2CK3D 5KTYA 3ICQB 3B9QA 3KQHA 2D74A 3W5JA 1E2EA 2VHCA 4A82A 4ACAA 1LW7A 2W2XA 3KB1A 1MT0A 4RZXA 2BBSA 3WNCA 4C0BA 1T9HA 1XTIA 4HI0E 4KBFA 3PIRA 5EXPA 2IYLD 4UXJA 4FD2A 4TZ0A 4B74A 2DBYA 4BFXA 3A1SA 1OPXA 1NG1A 1TU4A 4IFEA 4TLBA 2QAGC 1WDTA 5KUTA 1UEIA 5H70A 2VP0A 3UXMA 4PAQA 1G41A 2QQEA 4V0KA 3UK6A 3LBIA 3B1YA 4JSTA 1O87A 1HV8A 4ZDKA 1YR6A 2NO6A 2KI5A 1PJRA 3AP1A 2GAOA 1GITA 2Z6VA 4HDQB 3L82B 5FUWA 1XEXB 2GKSA 3R9XA 4D2IA 5FPKA 5JHHB 3CKLA 4JLMA 1GFIA 2P5TB 2VSFA 4Q19A 1TNDA 3B2EA 4LYHA 3BB1A 4Q7KA 5KDLA 4C2UA 3AKYA 4CRWB 4IVRA 3WBKA 4EIWA 2P6UA 1R5NA 2QEQA 2OAP1 3GLHB 4FMCF 2XB2A 3BC1A 5GVSA 3QQ5A 5CJ2A 5JI3E 3SYNA 3KX2A 3AKDA 1KSFX 3AGQA 5EZ6B 2WSSD 3ZQJA 2GCOA 4LWZA 1YRBA 4MRRA 1M6NA 3K0AB 1U99A 2OO7A 3BD9A 4HAYA 4UQOA 2FA9A 4QGFA 3FKSD 4QBGB 3EWSA 2IXEA 1S1CA 1Q1EA 2AX4A 1E96A 3GJ3A 3MWYW 4NCKA 3WRYC 3LXXA 1Z2AA 5DISB 4GOJA 2GVDC 4DLVA 2XZOA 4JBYA 1G7SA 4B47A 1HT2E 2A30A 1KI8A 2F3RA 3NH9A 1IONA 4B76A 1Q3HA 2AK2A 2MMGA 4GPTA 2MSCB 4TSFA 4EPWA 1QZXA 5BXQC 1PZNA 5FTLA 2CCKA 4Q4LA 2RGNA 4A2QA 1LS6A 1N6KA 1TAGA 1XJ0A 1WMSA 4EPXA 4F92B 1ZUHA 2HT6A 1CJUC 1P72A 2YNMA 2WSSA 4WXPA 2HCJB 3DHWC 2Q0HA 1P9WA 1E0AA 2A5DA 3THXB 1KAGA 1OXTA 1N6IA 4XTCS 3U6BA 1HY3A 3IIMA 3QBVA 2H7VA 4B33A 4KFTA 2RGCA 4H9GA 2CHVA 3U7HB 4O2LA 4N0EA 3RWOA 1P6XA 3M6AA 4B6FA 4HAXA 2QNRA 1X8KA 5BWMA 4TLCA 2C9YA 4IW3B 3GLFB 3EPJA 5DHAA 1A82A 4QC2A 221PA 4A8JC 4DEXA 1G64A 4YMTA 1FNNA 2GAAA 4PQFA 5DYGA 2VHTA 3DMNA 3R8CA 2O8CB 3Q5EA 3VHLB 1T3LA 3VU9B 4MRVA 3QENA 3SZRA 5B58C 4JYBA 4B3XA 2WWIA 3TAUA 2WWWA 2RCNA 2IL1A 1OYYA 3OIWA 4FI3C 3PUWA 4KLZA 5ELXA 2OCBA 3ASYA 1XCGB 1FQKA 4WOPA 2F1HA 2W6ID 1Y3AA 2BV3A 1OHHD 2ZROA 1FX0A 5TXGA 1XRJA 3AM1A 4OHVA 4QGHA 2IS1A 2H8KA 5KSPA 4KFSA 1P5ZB 1T3SA 1PLJA 4JYCA 4US2R 1S9DA 2GF0A 2YWEA 1F2UB 2VSOA 1XMJA 1KSJA 4XOIA 3O47A 4LZZA 4C0HA 1UEJA 2IYRA 4ZDWA 4DB4A 3N2IA 2UZ3A 1RZ3A 3RAPR 1Z22A 4JLOA 2O8DB 5E3HA 3ADKA 1II8B 5FR1A 1IY0A 3DOEA 1ZM2A 5B30A 3R9IA 2CDNA 3AVYA 1QHHB 1Z2CA 4RFVA 5DN6A 4HZUB 2H1LA 4KAXA 3KQKA 1RKBA 1TQ6A 2IHBA 5JWOA 2GDJA 1E9AA 3QPUA 2CNWA 4FMCB 3U60B 2HDNB 1W2HA 4TYNA 5UKDA 3A1UA 2E9SA 5EZ5A 3DKVA 2WJGA 1YJ5A 4DDWA 3EPHA 4Q4HA 4IRUB 2VF8A 4M9ZA 2IS6A 4OQXA 4BGDA 4GBMA 5E95A 1UAAA 1NKTA 4WZ6A 1US8A 3GEHA 3ADCA 1ZNYA 2QTHA 2G77B 1FNMA 2MSDB 2PJRA 1NL3A 3W8NA 4XTRA 5CLLA 3RRMA 1RRCA 5K8UA 1EFRA 2WWFA 1HT1E 4NYMR 3QF4A 2GHIA 1D6JA 2AL7A 2VLIA 1MV5A 3PEVA 3CRVA 3SR0A 5CJPA 3ZVMA 5HKKD 3KTAA 4Y0AA 2NQ2C 1G1MA 3DDCA 3MD0A 2PBRA 4K8OA 1IBRA 4W7SA 4TZ6A 4BLQA 1KKMA 4AKHA 4WIAA 5EQTA 4DCUA 4RD6A 3FOZA 1HQCA 2O8DA 3HR7A 5JBQA 3T1TA 2FEMA 1M7BA 2TMKA 4Z51A 1N3BA 3K09C 4XSHA 1Z06A 4GZLA 2UZIR 3TSOA 3HJNA 3SDZA 1XX6A 4HAWA 2ZYWX 3VR1A 1F2UA 4J0QA 4URZR 1B23P 3LXRA 521PA 4UNSA 3W8RA 2C9CA 2CCJA 3GEEA 4FN5A 4LYAA 4RCYA 4EJSC 4GNKA 3LLMA 4QHTA 1FQJA 2OBLA 3H0KA 4Q1AA 3I5YA 1CRQA 1DAFA 2NO0A 1VYVA 3O8BA 4LCBA 1NI3A 5K8IA 1XEFA 4TTQA 1S0UA 3K0FA 3Q3JB 5JS8A 4A4DA 4D82A 1IXZA 2F9LA 3T1VA 4UNNA 1TPZA 4X8OA 5D3MA 4U7DA 2R44A 4BEBA 3K70D 4OI4A 3HR8A 3OIVA 2QMEA 3WMGA 1TU3A 4R2IA 2JLUA 2XOKA 3BBPA 2JDID 4HLUC 4OBEA 2VHJA 1XPUA 5DI3A 1J8MF 1G8GA 4MKGA 3WYGA 3ZVRA 1YZKA 4LBYA 1CR0A 4WA7A 4A0FA 4ARZB 1GDDA 2JEOA 3BH0A 5J40A 1OB2A 1MO5A 1TQ2A 2DFLA 1NG9A 3PR1A 1KI6B 3GLGE 3P27A 3X1YA 2ZVPX 3VR4A 1Z6GA 3GJ0A 4G5GA 2C03A 2W2VA 2W6JD 4QBIA 1P75A 3GJXC 3TRFA 4C4PA 1IAQA 2WKQA 1DAMA 3C5HA 4EPTA 3T1QA 3CH5A 1XD2B 3KJGA 3L0PA 4LX0A 5TVKA 4C7OB 4KFUA 4I4LA 4E03A 3EZ7A 4NYIQ 1JB1A 1FZQA 1P2VA 3HP1A 4JS0A 1Q21A 2V55B 2V4ZA 3VFDA 2V7QD 3U6KA 1SXJC 4RD0A 2NZJA 3RLFA 2PZFA 5FOVA 1AZSC 1I2DA 1OFUX 4MGZR 3EPLA 1ZC4A 1XTRA 3MSXA 2OCAA 1VCOA 1P4SA 2ZRJA 4UNRA 2J3EA 2BC9A 3OIUA 4MA4A 2ZYTX 1P7CA 3FWYA 1IN5A 2CLDX 2Q3FA 1Z8FA 3U5ZB 2ERXA 5EJEA 3CF2A 1DBSA 1M34E 2F9MA 1MR3F 1FUUA 2FSGA 2PEZA 3B1VA 3F3YA 3CBQA 3AVTA 1TL7C 2IA5A 1F2TB 2OFOA 2YOFA 1LTQA 4FW9A 3WNBA 2X77A 1VG1A 2H18A 3BIFA 1QHYA 4WBSA 1E79A 3IBYA 2R6GA 2ERYA 2ONKA 4D4LA 5BW8A 2C5LA 5TV2A 3GLHA 4O2RA 1UKYA 1J7KA 3Q7PA 4TLEA 3NWJA 2D2EA 1NF3A 2V54A 2VIIA 4UXIA 2XOKD 3LH5A 5K8LA 2ZAMA 4Z54A 4DXAA 3U7FB 2WJHA 4JJZA 1ZU4A 5C18A 2GCNA 4KBGA 3KKNA 3IO3A 1SQ5A 2QTVB 3JZMA 1P62B 1F2TA 1KDOA 1IN7A 2OLJA 1R0ZA 2RHDA 3T61A 1MO4A 2KBFA 4V0OA 4HUTA 1M74A 3CRRA 2P5SA 1QF9A 2QG6A 2ZJBA 3KKPA 3KUCA 3Q72A 4MH0R 3NG1A 2VYFA 5HZHA 1YVDA 4OQLA 2L0XA 3R8FA 4PO8A 1KHTA 3RDPA 4C9BA 2IYWA 2BJVA 2JJ1A 1XFAA 1Z47A 1R5OA 2P6NA 3L0IB 3CWZA 1IN6A 2VA8A 2C78A 3HU1A 3PCRB 5FI1B 2BDTA 3VR5A 4L9SA 3DPUA 1E9FA 1KNXA 4R71A 5KU1A 2QP3A 3PEYA 5EE5B 3RS2A 4QNMA 4EKDA 1RE0A 2JLQA 1DVRA 3I61A 2EYUA 4MYUA 3U7EB 3SS8A 3B8HA 1NMYA 2B92A 2CMKA 4BFZA 1WBBA 3A58B 3FE2A 1A5TA 2WJYA 1W4AA 1CIPA 4P4SB 2GJSA 4EJSB 1S4QA 1N5JA 3U2QA 2RH5A 2RGNC 3UG6A 5JJLA 1XCPA 1GAJA 3LA6A 3FMFA 5FL3A 4Q1CA 1AKYA 1G7TA 4NMMA 1FMLA 2N46A 2J0UA 4Q9JA 5G41A 3TH5A 3TUZC 1NLZA 2DPXA 3FMIA 1Z0KA 4JSYA 4RZ3A 2XGJA 2ZRPA 1U0JA 2OLKA 2YOGA 1N6HA 2A9KA 1NMZA 4D6PA 2H16A 3PXGA 4DT1A 4PFSA 1ZMXA 4DKXA 2VP5A 1GSIA 1T6NA 2DWOA 4HLCA 4ASUD 1SVWA 4GFDA 5IF9A 4KODA 2VF7A 1BOFA 2BMEA 4DDUA 4NCNA 2I1VB 2Z5FA 1N5LA 5EP4A 5J5CA 3EZ2A 1BIFA 1E94E 2ZRMA 2QRNA 1OIVA 4OI1A 2QY9A 3BJIC 2P67A 3TUJC 3KZ1E 1EK0A 4R7ZA 2ZR0A 3BFXA 4PPNA 5KNCA 1A1VA 3GJ8A 4PSAA 2G0NA 2OT3B 3PEWA 2ZYUX 5KSOA 3EX7C 1E2DA 1ANKA 1X8JA 2ZVQX 1VCNA 3MJHA 2Z4RA 4HB0A 3KQUA 1UDXA 4Q18A 2AKYA 2EW1A 4NBSA 1Z28A 3VX3A 2A78A 3R7WA 5CB8A 2BEKA 4BPBA 2FWRA 2C95A 1C9KA 1P9RA 5TMPA 2Q6TA 4PZLA 2GZAA 1JJVA 1DOAA 1OLOA 3SJCA 3TNFA 1ONBA 1Q57A 4EQ6A 2WPDD 2VSXA 3ZS8A 1YZLA 1TUEA 1DE0A 2QGZA 3EZ6A 5C4MA 1KO7A 4LYFA 4MRNA 2B7CA 1YQTA 3A4LA 4LPSA 2NOAA 3LX8A 5CIQA 3EIEA 1K6MA 2C2HA 1CJMA 2Q9AA 1VCMA 1RJ9A 3Q5DA 4MYCA 1GP2A 2DWQA 5IK2A 5J47A 4PAMA 1JAHA 4NZYA 1W0JA 4RD2A 3B85A 4IKEA 5F2EA 2OFXA 3SFZA 1OV4A 1XJQA 1G7RA 1NLFA 3KKOA 1PLLA 4M1YA 4FMDF 1VMAA 3KFXA 4MYHA 2CNWD 4RD3A 5FBWB 4P3YA 4LJYA 5DSZA 1DAKA 1Q1QA 2FFHA 2BCGY 3ZYCA 5E7JA 3PUYA 4WW0A 4GDFA 5KDOA 1BMFA 1KAOA 1GZSA 3NH6A 5C4GB 4M1TA 1AQUA 3N2EA 3OF5A 4M22A 2JAQA 4V0NA 2FSIA 1E2JA 4L5BA 1YZTA 3LWNA 1EG7A 4A2PA 4JL5A 4QL3A 4AD8A 3IEUA 1JEEA 5L8VA 4TTPA 2P0EA 2QN6A 3IBGA 5EXTA 1CBUA 3C16C 1DELA 3KFVA 1E99A 5JECA 4KSCA 2JLSA 4OK6A 1EWRA 4PTLA 2RGXA 1HE8B 4G5QA 5EE3A 2Q9CA 4US0R 4JLVA 2H57A 4Z8XA 2Y8EA 3LW7A 4BZPA 2OEPA 2ZQ5A 1ZD9A 1T5IA 3TVTA 3D6TB 3BRWD 4QJ3A 4BEJA 3BWDD 4FIDA 1G8HA 2PCJA 3U4QA 1PUIA 3SHFA 1ZAKA 1QHXA 2XNSA 3BH6A 3VU9A 1PV4A 4KXFB 4DLZA 1MKYA 2GEDA 2FOLA 4L16A 2REBA 2Q21A 1E6CA 3KTAB 3BGWA 3NVAA 4OHZA 3HPQA 4FCWA 5FOTA 5G40A 4AYXA 3WYFA 2W00A 1Z6XA 1I4TD 3UIEA 3TSWA 4EFMA 3B78A 1P2SA 4MKFA 1U90A 1W36B 2ODNA 2ZI3A 1W46A 1AK2A 3BB4A 1LF0A 3KUDA 1AS2A 2VTKA 4B44A 2PT7A 1XPOA 3LLUA 4OQMA 2A2ZA 3THWB 1NRJB 1TUIA 4JLDA 3THXA 3AVWA 1NN0A 3B9PA 2LCFA 2R6CA 4W5WA 4NPHA 2QENA 5EE1A 4F7WA 3AF2A 1G7CA 2XNDD 2O52A 4RD1A 1RRGA 3NHBA 2IYTA 2ORWA 2GETA 2V8OA 1QHHA 3K0CA 1KMQA 4M53A 4DIEA 2W2TA 1P2UA 3KQNA 1WBDA 1CJKC 1OIWA 2ZJZA 3JZAA 3WYAA 4AKGA 4IJMA 1II8A 1NNEA 1KO5A 4HAUA 2ZRDA 2PMKA 1L7VC 3K9LA 1F5NA 3G82C 1W4RA 2HYIC 5AJVB 4M4SA 1R5BA 3TKLA 2CLSA 2PEYA 1IJFA 3EAQA 5EP2A 4LJ4A 3TIFA 1N25A 3OFND 4HDOB 3BFKA 1Z6AA 1CJVC 2IYXA 2IYSA 3QUSA 4E07A 5JI2E 1TADA 3TMKA 4D26A 2PT5A 4OHWA 3L43A 5JZVA 4LV6A 2HYDA 4TT3D 2QUZA 2QAJA 1EFTA 2QPAA 4OJQA 3QEJA 3ZH9B 2ZJOA 2D7DA 5P21A 1GTVA 2NIPA 5JCPA 3BE4A 5L3QB 2ZU6A 1A2KC 3GCGA 3IEVA 4LV8B 1NLYA 4DLWA 4EPVA 1UBCA 5F3WB 2YJTD 3LQQA 4I1SA 2FPLA 4M0LA 3QVVA 2F55A 3ZGXA 3GJ5A 4QHYA 1HURA 3S1AB 3V00A 3H1TA 1D9ZA 1KMHB 1T5LA 1VTKA 2ZREA 2HXYA 3D8BA 5EUMA 1YU9A 1SKQA 2AD1A 1J99A 3NEYA 3U3KA 4ZI2A 5AUNB 2QQ0A 1AA9A 3C14C 2IUUA 3U3RA 4YMVA 1H65A 2XNDA 2ZXUA 3E5HA 4LV5B 3KJHA 2YKGA 4KVGA 1RYFA 2QU8A 3ZS9A 2OCYC 3KXLA 4JMPA 3T12A 3AVVA 2ZETA 3PITA 2OFWA 1JALA 3EXAA 1G18A 4M1OA 4P4TA 4U02A 3GLGA 1ZVQA 3QBTA 1G8FA 3C4JA 2VRWA 2AD5A 1Z07A 2OHFA 2CE7A 1QBKC 1CR2A 3E1SA 4OL0A 3TUIC 1UDWA 3AVPA 3TJZA 2JGNA 4Q1BA 4A36A 2IBMA 3FPAA 4QFMA 4TYPA 3EC1A 2W6IA 1YE8A 4RKFA 1N0VC 3M4YA 4RSGA 4AY2A 1XDBA 2FSFA 1K8RA 2HJVA 2VP2A 2ZJ8A 2VHQA 4WVFA 1P60A 2ZTSA 1W5TA 3K0AA 2BJWA 2QPTA 2O0JA 3TSZA 3AVUA 1WF3A 2IWHA 3SN6A 4PXAA 2A5YB 1B0UA 1AQYA 1T8TA 3NKVA 3AGPA 3A36A 4G5RA 1NVVR 3ADBA 3V4RA 3ETLA 4GL2A 3EA0A 1NVVQ 1UBEA 3NHAA 2X2EA 4LHVA 1KK2A 1DARA 2OM2A 4IOMA 3WBJA 5JS7A 2O8BB 2W0MA 5B2ZA 2ORIA 2ZS7A 4B32A 4HAVA 4D0GA 5L3SB 1CEEA 1DS6A 1W0KD 1XEXA 3W5IA 4LJ8A 4ZV4A 4FMBB 1MO3A 2WWXA 4PHGA 4M1KA 4M9XA 2CJWA 4C0QC 4QXAA 5GJVC 5HCIA 1OYWA 1G9XA 1XTQA 3K70C 3AVQA 4JKYA 4OYHA 3AVOA 5JEEA 3LV8A 4D4MA 2H5EA 1UBFA 4C0LA 2R62A 2P6RA 1XF9A 3ONWA 4B2PA 4MYTA 5HE8A 3QJYA 3AVXA 2FFQA 4LJ5A 3GD7A 2EYQA 4TMXA 3GP8A 1T91A 3ZZ0A 4NP6A 2BBTA 4IXNA 4E5UA 2ANCA 2A7QA 4CYMA 3G5UA 4NU0A 1S3SA 1Z29A 3U61B 2C99A 2GWHA 4UJ5A 3RHFA 1CXZA 3K53A 5DH9A 1N6LA 4B75A 3E2IA 4D80A 1VG8A 2GESA 1IY2A 2HXSA 2FJUA 2YWFA 1SGWA 2NMVA 3WP0A 4M1WA 3OEED 2C04A 2JCSA 1H8EA 4KO8A 4TMZA 2HF8A 2D06A 3L0OA 1IHUA 5L3RA 3GFOA 2F1JA 4Q7LA 4RZUA 4B73A 2VEDA 2AHOA 4XVUA 1YRAA 2IYUA 3CNLA 1W49A 5BN5A 1Q1ZA 2HCBA 5DYIA 1JECA 1XEWX 4BFVA 1KJYA 3NC1C 3VQTA 4UNPA 4UXHA 1OKKD 4LJ7A 4HB3A 1Q20A 3FHTA 3RABA 2EFCB 2IXFA 3SQWA 4DDTA 4UNQA 5DLQC 1RIFA 5DI9A 1IXRC 3SJBA 3GLGB 4FCTA 1W48A 2NZ8A 2V1UA 3THYA 1WB9A 1YZQA 5D3MB 4PANA 5ANRB 4TYYA 5M04A 2RAPA 5TY0A 1IXSB 3PJRA 4KV9A 1G17A 1VIAA 5FH9A 2WKPA 1YKSA 4XIGS 4LI0A 4M21A 1E0KA 1E2NA 1G16A 3BS4A 2CL0X 2VPPA 4YXWA 1P73A 1ZBDA 1JPNA 3AP2A 3P26A 1Z5ZA 1T0JB 4RKEA 1QVRA 2QMUA 3IHLA 5BQ5A 5CDFA 1CKEA 4IDOA 1G19A 2RKOA 4FMDB 4Q02A 4QGAA 4GMXA 3S1AA 3FGNA 4LBZA 1V43A 2EQBA 3QKSB 4B71A 1PVOA 1J90A 3B5JA 1KKLA 2JJ8A 1HUQA 3T06B 1T3HA 4A6PA 1BO6A 4I81A 1E4YA 4QBFA 1OH5A 2FE4A 3UMFA 3BB3A 1ZIPA 1DO0A 4B35A 2J0VA 4PAOA 1KTVA 4V0ME 5L3SA 5LB2A 4TMTA 3ZDQA 2O8BA 2ASEA 4N3NA 1G8YA 2ZI6A 4P0TA 4R98A 1QHSA 3B82A 4Q7MB 2XXAA 8OHMA 1TTTA 3KB2A 3SI7A 4CT4B 4QM7A 1FW6A 4B3FX 5FFMA 2G6BA 3AF0A 3CRMA 3M0EA 1P9NA 2HT1A 2GILA 1KZGB 1KI4A 1XPRA 1GKIA 4BLRA 4DSNA 1G5TA 1NBMD 1W5SA 2XJ9A 5CK4A 4IDPA 3SU8A 2WBLC 3EWAA 3IDQA 4PC1A 4DB2A 2YC2C 2PZEA 1QHNA 2CCGA 1GWNA 1EGAA 3NC0C 2EFGA 2CE2X 3LVRE 1HQYE 2CL6X 3W6NA 4O25A 1E79D 4U00A 1MRNA 1XB2A 3K9NA 3SHWA 1XXHA 2FX3A 2R9VA 3K8YA 4HZUA 3SFVA 1TQDA 1SVLA 1XXHB 2FFAA 2ZUDA 4AIIA 1TF7A 3OESA 1A7JA 3GLFE 5BN3A 1W0JD 1JXOA 3RANA 3I5XA 4OK5A 1U98A 4ZKDA 3DM5A 4LBWA 2D4HA 4AYWA 3K0EA 3SYLA 4O0MA 5LBIA 3NEJA 3TK1A 4RJLA 2IF0A 2GEUA 4DIDA 1SHZA 3I8XA 1GILA 3QF7A 4TL7A 4DEYA 3EZFA 2QM7A 1JPJA 2A5JA 2O8FA 2CK3A 2V6JA 4BLSA 1VHTA 2WPDA 3C15C 3KXKA 4HDCA 2V6IA 2DHRA 4FINA 4PO1A 5JRZA 4ITRC 4GOXA 1DO2A 3W6OA 3P4YA 3SNHA 1MOZA 3X1ZA 2WAXA 4TMKA 2IS4A 4AC9A 3BERA 3B7GA 1DG1G 2XXAB 3IPYA 1OIXA 1S1MA 3U44A 1U8YA 3KKQA 3TVDA 1L4YA 2Z43A 4OJKA 5KDDA 3ZZTA 3A4NA 2J7KA 1SXJA 1MRSA 3V9PA 2WAYA 3W6PA 1XTKA 1COWA 4BE7B 2KJQA 4KITB 1SVOA 4B6EA 2QROA 3QNUA 5IT5A 1XBTA 3LVQE 1CP2A 1CR4A 2YYZA 1WCV1 4PHTA 5CYPA 4CVNA 4YDHB 1E4VA 5JEDA 4A9AA 4Q21A 1SXJE 3QE0A 3HPRA 3LDAA 3ND8A 2UKDA 4KCGA 2VP9A 4WAUA 1G6OA 2P65A 4XVRA 4HB4A 1VDZA 1O3YA 1Q44A 5IHPA 5J4YA 1NJGA 3I3SR 2IYZA 1E0SA 3LAWA 4GP6A 4QHSA 5FPTA 4LC0A 1ESNA 4UKDA 1VECA 2GXUA 5C46F 5DIFA 3UG7A 4HLUA 5AJYA 5FOUA 4ILEA 4OI2A 2JJ2A 2D62A 1E2LA 1XEWY 2FF7A 5TARA 2GJAA 3THYB 2O8EA 2ZIAA 2QSYA 3AKCA 5DNYB 4XWKA 4BFUA 2CEAA 4QBHA 4URWR 4DCVA 3AF1A 5KSYA 3T5GA 4MQBA 3CR7A 4GSYA 3OIYA 1KY3A 4L15A 2OE2A 1SVIA 3H84A 3GMTA 4IEIA 1R2QA 4A15A 4FXPA 5HCNA 1XWIA 4M2LA 3W3ZB 1CLUA 1JR3D 2ZS8A 3CX8A 4X8HA 4F91B 1UF9A 2AFHE 4BRUA 3B13B 2C98A 2OCPA 5H68A 1Q0UA 2XSZD 1SZPA 4JLPA 3TGPA 2RGDA 4IXMA 1N5KA 2XTNA 4QNRA 2Q3HA 1Z6YA 3ASZA 2VHUA 4FWIB 2PLRA 1COWD 2OG2A 3LX5A 4L9WA 1ZM9A 3UPUA 4DC9A 2QAGA 1S96A 2PX3A 3IPXA 4KFRA 4NCHA 4RFSA 1OFTA 4DBLC 4LSGA 3K70B 2YZ2A 4AK9A 4EPYA 1CRPA 1GRQA 3RNLA 1GNQA 2BVNA 2FV8A 2FN4A 1TF5A 3EIQA 3OZXA 1TMKA 4C0AC 1MABB 1R0WA 3MUFA 4IOKA 1E9CA 3Q9LA 4Z1MD 1JR3A 2VH5R 1U8AA 5JHGB 1GUAA 4TLDA 3ZD6A 1FUKA 3IQXA 4Q66C 3MWLA 1LFDB 1UKVY 2ZSBA 5FTMA 2G9NA 4TTRA 1NVXQ 3N70A 1P3JA 1IJEA 3WXMA 2GCPA 2CJWB 1NP6A 5EXXA 4I99A 1Z6TA 1HE1C 3IIJA 1DG3A 5B57C 1CU1A 4A0GA 1XZPA 2C8VA 2EWWA 5FUVA 3EIHA 2B8WA 3VKHA 2ZAOA 1TEVA 3NBYC 2GZHA 1E1QA 1XU4A 4JL8A 3DZ8A 1DAEA 4JIMA 2QMOA 2V1XA 4XD7D 2J0SA 2NPIA 2ZI9A 2ZPTX 3NDPA 5A5GA 2ZRNA 4JJKA 5HPYB 2ZRHA 3PEUA 1Z3IX 5FBLB 1BMFD 3ZQ6A 1W47A 5AUOB 1SKYE 1GKYA 4JLJA 4Q1DA 5JLJA 1XP8A 2J0UB 2DB3A 2FPMA 2QP4A 2J41A 2ZANA 2ZSFA 3C41J 3VHXA 1EWQA 1E2KA 1D2MA 1OH8A 4Q4JB 1HA3A 1W2GA 3QVUA 4TMWA 1QG4A 3P20A 4B3DA 1X8LA 1ZD1A 3SJAA 3I72A 2CL7X 3U3JA 2KBEA 3KL4A 5J4HA 1A2BA 4GMDA 4P4SA 5CM9C 5H8WA 1FL9A 4ZI3A 2W58A 3ZIAD 621PA 2VQSA 3A1TA 3KJEA 5DGXA 2C9OA 3A37A 3I32A 4LHWA 1FPMA 3OAAA 4F38A 4TN1A 1WP9A 4E22A 1GG2A 3THOA 3ZLJA 4XD7A 1E1RA 1KI9A 4IHQA 1VIYA 2B7BA 2YWHA 3EW9A 5E7IA 1Z83A 1AN0A 2ZS9A 4DCTA 3TR5A 5KO2A 3CONA 4G1UC 3AV0B 5KOYA 4ESVA 2WMNB 1KO8A 1VG9B 1D9XA 2DFTA 2ZE6A 4Q9LA 2WIAA 1X1SA 5AK0A 4ZCMA 5CM8B 1M1YE 3R7WB 2HUPA 1QDEA 3UMSA 3R9WA 3Q7QA 4PPQA 3IQWA 3WNDA 4D81A 3HU2A 1W4CA 4ZCLA 1G3RA 1Y63A 2OXRA 1SHKA 4K46A 3B60A 3SBDA 2G1JA 4B2IA 4CIDA 5JWHA 3RC3A 1R0XA 5DHFA 4TYWA 4LJ6A 2IUSA 3W90A 1OE0A 2J1LA 2IS2A 4DRZA 3QI2A 1D8TA 1YR7A 4PC2A 4TT3A 2OZEA 1EXMA 2A3RA 4BFSA 1G20E 2ZI5A 1JXMA 2ZEJA 1E2QA 3WMEA 1OT3A 2QGNA 4BWYA 4IDNA 5KPDA 1OB5A 4PX9A 2I1QA 3LQRA 2BMDA 4C30A 4JT2A 4Y0VA 4LHXA 3IIKA 1YR9A 3GLHE 3NBXX 4M9SA 1XTJA 1H8HA 5G3YA 4DLRA 4A0RA 1QRAA 2J5XA 5SZKB 4V03A 2FG5A 1R8QA 1E9RA 1NMXA 1LB1B 5LPNA 2G83A 4YC7A
chains in the Genus database with same CATH superfamily
3IP3A 2NVBA 3B1XA 4R7TA 2WIJA 1U0HC 1LTHR 3FFAA 1T4GA 3NCTA 4V2UA 4TYQA 1N2EA 2FLKA 4MI6A 4CDGA 1AGYA 1Q7TA 3QG5A 5GJBA 3HK2A 1UPUA 3O74A 4ZAZA 2VK8A 4LSMA 4RS3A 5T5QA 4KNYA 3QEOA 2LIVA 1IBMB 3ZIAA 1MQ8B 3NZEA 1P2GA 3OFNA 3OTWA 3QH4A 4G6ZA 5IKMA 3LX6A 1P1HA 2GXQA 1K4YA 2F1IA 4GLFA 3HG7A 4Y6LA 5DYYA 3FNGA 5HTKA 1H1LA 3V9AA 2R47A 2AXPA 5JFGA 2O59A 3BDAA 4ZZIA 3AUYA 2B1IA 3FOEC 1DTWB 3UM9A 3LY9A 3RLIA 1CQIB 4YO8A 3NBUA 4NS4A 2I2XB 4F3KA 1V3TA 1B2RA 3TW6A 4H16A 2WMOB 3TNLA 1G4HA 4PIPA 4QJ5A 1Q7CA 4JK3A 2PA3A 2WTBA 5A6SB 4C4RA 2P0AA 1EVIA 3DEAA 2E48A 4LYEA 4BNKA 5HBRA 4Q39A 4DA4A 1CUVA 4R8KA 1LPSA 1GIAA 2B4AA 5JSFA 2XA9A 1M9NA 2PWAA 1HOXA 3COZA 3DM9B 3ND9A 1NJFA 2EFJA 3WQQA 1D1QA 4C3VA 2JF0A 3PNPA 1MOPA 4RCVA 4YJ3F 4DUPA 4TYMA 3EW7A 1JE0A 1KYQA 1UPBA 2DKOA 2I6GA 2ZR7A 4AKEA 1E2FA 4ROTA 4ZEVA 6ABPA 2VRNA 4HWRA 4FFBA 4F85A 4CIBA 3QRWA 3HKDB 4IJUA 3FGOA 3RIHA 1D0SA 4HRYA 4JQOA 3RIYA 4J16C 1XR3A 3EBOA 5FT9A 5JXGA 1M5TA 3OT5A 4XYGA 1J5EB 3K15A 4P5PA 3T3DA 2PLAA 1DZIA 3OJFA 1GFSA 4I9NA 1MO2A 2R86A 5LD2C 4QD3A 1SQ0A 1MDFA 2ASVA 5A9RA 1SWWA 1ID8A 3G8DA 4ZO7A 5ECYA 4AO8A 1TCVA 2WQ7A 2WJJA 1FNCA 2NUBA 2ZB3A 1N8KA 3DO8A 3LKBA 1MB3A 3Q9SA 4PYIA 4WEOA 4WH0A 4Y18A 5JPDA 1M8PA 1M0WA 1YNOA 1E9DA 2YUIA 1CS4C 1NRXA 4X66B 1SUBA 4HP8A 4QFCA 1L5RA 1NLUA 4KVAA 3MWJA 3OZUA 1H23A 3MHTA 1L2TA 3RRNA 5DM4A 3H1GA 4EG3A 1V6CA 4DLSA 4KXXA 3B3FA 4U2CA 1NXVA 3E9NA 4NBLA 4MDHA 2DERA 2FEAA 1YZGA 5FL7A 2VATA 4P81A 2AMYA 3WYEA 2QLJA 2V7WA 2NPFA 1T0PA 3C8DA 1YR8A 3HYRA 1GPAA 1YBFA 2JBAA 3FCEA 3QKRA 3ZXXA 3FDIA 3IR6A 1GAWA 4EW3A 1QRSA 1HLDA 3FIUA 3GCZA 3K0HA 4W8OA 3WGTA 5AI9A 5L4NA 3D4PA 3T3IA 4F84A 1FTYA 2PY6A 1EFHA 1KI1A 2I78A 4QZVA 4E09A 1WRBA 1YB7A 4WBXC 3V1KA 2BUCA 2GS9A 4J75A 2BGJA 3V34A 4G65A 2QRGA 2BTQB 4OVKA 5CVCA 2WQZA 1TZMA 2UZAA 4HPXB 5DE3A 5DMXA 1HO3A 1QIDA 3VYWA 2V0NA 3MJVA 3ND6A 3NDBB 2WF5A 3T1OA 4Q3KA 1IWOA 2IRWA 4IVNA 3RYFB 4CW7A 4EOGA 4EW6A 1NPTO 3ZOZA 2LKDA 1B3RA 1P5HA 1DTSA 5K03A 3CLTD 4XDYA 4B9AA 1QB8A 1NY5A 2GK6A 1VYTA 3PDHA 1JEYA 2NSYA 2WJVA 1ES9A 2H08A 2Z3ZA 1LDNA 1G6KA 2BEWA 4UJ3A 2J4DA 3HSYA 4WNYA 1KH3A 1W6RA 1XZIA 3DEIA 3QXJA 4QTUB 5AJTA 2HADA 2J0QA 2K2WA 3T34A 5T57A 2XAUA 2FEOA 3WGGA 1KZ6A 3FN4A 3GJRA 3M7IA 4Q4HB 4Y7DA 2DM6A 2D0PB 1GL7A 3EMDA 4PC3A 8AT1A 5JW6A 4XSGA 3FVQA 4EQ6B 1DINA 1WCIA 1ZW6A 7MHTA 3PPWA 3Q4GA 2GCEA 1E2PA 5J4VA 4ID3A 3IE1A 4Q9DA 1Y5MA 5ICEA 3ACBA 4I0WB 5A7GA 4KPGA 3CBGA 1CQPA 1ZH0A 3FTNA 1QQ6A 4J7XA 4KN9S 1QCZA 1OXXK 2A0UA 2JIZD 4Z3DA 4ERXA 5LD2B 2DGDA 2ZSDA 1MDBA 4OSEA 4CEHB 2XZDA 3EBPA 4BZZA 1HEIA 2GDZA 1FPQA 4F4CA 1DU4A 5H4HA 5F52A 2PH1A 1F7UA 4QM6A 2ZJYA 4PC7A 3REQA 1XMSA 3A1NA 4AZVA 2PO7A 4NBUA 5K09A 3ENKA 9GPBA 4BMNA 1PWHA 3HDHA 5CA0A 1CUBA 1PZHA 4EG0A 1PWEA 2UYQA 4XR9A 5DLPA 4JGBA 4JBWA 2HD4A 2O7QA 3H4VA 1V71A 3GF4A 4W9NC 4JLKA 2ODBA 3LNTA 4X65B 5AOAA 1F0KA 1T2FA 2V58A 1MT3A 3F8WA 4PFQA 5JLAA 3RV4A 3UWMA 1Y48E 4GWGA 3TW8B 3RRYA 5U4XA 5C7OO 2PZGA 3UK0A 1NQWA 3I6QA 2C4WA 4D9JA 1W4ZA 1WNTA 2QJWA 1T0BA 2JPDA 2ZSAA 3FWPA 1VHLA 4OX9B 1BCSA 3WLFA 1JPVA 3B1JA 4E5VA 2EG5A 1SPBS 1BH6A 2IOHA 3SE0A 4URVR 4Z3KA 4U6NA 1YRYE 4ZMSA 2IEZA 4JGIA 3LQYA 5KC8A 2A88A 2QTFA 3OTOB 3RWMB 3RTDA 2OILA 1UKZA 1YSCA 2OSBA 2Y6VA 3BSYA 3MT8A 4N9WA 5C1BA 3SQXA 1J2EA 2B6NA 4J0HA 4NBTA 4XX0A 4ZO6A 2DLCX 3CMMA 1XNJA 4RJ2A 5BNTA 5U9CA 3W5AA 5CXUA 4QJ4A 1GO2A 3GRRA 1M8JA 1XPRA 1YONA 3B70A 1Y9JA 4QREA 3TRDA 4ZARA 1OJ7A 1VSBA 2DULA 4L4YA 3LIIA 4S2EA 3RS0A 1K3UB 3X43A 5L7TA 2CN1A 3TZHA 1YMQA 1OFIA 1H69A 1SC9A 1SXIA 4KHPB 1ZA2A 3VC7A 1DRWA 3WZLA 3H9UA 4AG3A 1U4OA 1SULA 3TW4A 4RPLA 1UBKS 3HFGA 5JRJA 1QP7A 4NENB 5FBKA 4F9FA 4CM9D 4QUAA 3LNCA 1ZGHA 2NGRA 2P3SA 1YS4A 2OV3A 3JRXA 4N01A 4C7KA 2Z57A 3AERA 1Z4OA 2JLCA 3QX7A 2O3TA 1PQUA 1YE3A 4V3CA 1KL7A 1GLVA 4JNKA 4Z8YA 5DT9A 1GRNA 3RARA 3GT3A 4HK4A 1SG6A 1NVMB 4KXMA 5EWLB 3WR5A 3DD1A 1RJWA 2YX1A 4KL8S 4YMHA 4DGSA 3HQ4O 2PMDA 2PRIA 3L7CA 4JNCA 4JI5B 2HH9A 4IH4A 4EL5A 2EVWX 2GBLC 1QV6A 3AUXA 3B1ZA 1TW2A 3KOZA 3L8CA 1R0KA 3F5FA 4G4GA 4NZNA 5ER9A 3WJ7A 4DW8A 4KFCA 5JSKA 3LPAA 3BG5A 2ZUFA 1DIBA 4ERNA 3F7NA 3CW2A 3VKGA 2JFFA 1VMIA 5FBRB 3OWHA 2LV8A 4YJFB 4FB4A 5A5EA 3B3GA 2O0KA 5DVZA 3ME5A 5IWCA 3LO5A 2YV2A 4L07A 4Q3OA 1ZK2A 3HJBA 4FUTA 3NWEA 4TV9B 3WZ2A 1QG2A 5FOWA 1YNSA 3H87A 1U6IA 2PBLA 3CF6R 4GYKA 4ZU1X 4ZIRA 1I2BA 1NKSA 2FHPA 4JL6A 5AHRA 2CLLB 1JJAA 3K1JA 2I4IA 2G4CA 3T38A 1XAGA 1Z2EA 2ZRIA 4K0RA 5E6RA 4L8WB 4ZICA 1PS8A 2A86A 3HA7A 5HM8A 3ABIA 1AKEA 1WW8A 3FMPB 3VM6A 4V38A 5FAXA 1PS9A 2FSVC 1FVHA 4V1CB 2XSZA 4ESHA 2HA6A 1C9YA 1N2HA 2JLZA 1D4ZA 2FPGB 1H2XA 3VKWA 1PVDA 4YRBA 3OZDA 2QRLA 3NLLA 1WKCA 2HEGA 4C7VA 2VQFB 1AC5A 1WQ1R 2NYVA 3HRIA 4CCYA 4D3YA 5GOZA 1TUBA 4YT4A 1Z7YA 3BK7A 4OH7A 4F06A 3SC6A 4C0KA 1U0LA 1RRFA 5AUPB 3M9WA 3IOMA 1ZL0A 2X2FA 3CM0A 2I3GA 3EG9B 2R1VB 4K1LA 4URUR 2C8JA 2VUTA 3TF5A 1LNQA 4Y0NA 5HMLA 5CCXA 4NBVA 3RTEA 2W8ZA 3BGDA 2Q2VA 1ZRSA 5JSZB 5EIOA 3QKSA 1FCJA 2GYYA 1ZCJA 2V7XA 2P7IA 2X19A 4W1QA 5FPSA 4L3OA 3RFXA 3OTGA 4R54A 2E87A 4BB0A 2AN4A 3A3YA 2WF9A 3D7RA 3GRFA 4GXQA 1SIUA 3D31A 2B8TA 3FYSA 4XVQA 4CEJA 1EPUA 5ALUA 3REOA 1XNRB 1X1QA 4RK1A 5EKDA 3O38A 2JHAA 3RRZA 1ZCBA 1GPUA 4CNBA 1W76A 5KWEA 3C3CA 4RY9A 3ROFA 4X6UA 4ER3A 1Y9EA 4JIGA 4BNVA 1FBTA 4G56A 1G6HA 3R77A 2A9PA 3GJ6A 2PL5A 4DDVA 2FI1A 1JQJC 1ECFA 2GB4A 1AZTA 1JHYA 2H8GA 3D2LA 1RYMA 2ET6A 1PT9A 2WDPA 1I8TA 2EGUA 3MS7A 4J0IA 3UMBA 4CIVA 1O96B 2FDXA 3GLTA 2R00A 5A4JA 4DEVA 3MGCA 4JMLA 4MCIA 4WXRA 3OZIA 4ZDIA 3VH4A 4QEDA 2JGRA 4I5FA 5FR2A 1YFLA 3A4YA 5A04A 1A9PA 1UKEA 2Q2WA 2NO7A 5H3HA 3H99A 3V2HA 1UM8A 4GMKA 2RONA 1T1RA 3MOIA 1VL2A 1BH2A 1OHHA 2B30A 2LKCA 4XJSA 1FJXA 5ALDA 3GO4A 4L73A 3GA7A 2X9VA 3O95A 4XI9A 3SX0A 1QNFA 3JRWA 2NUAB 3SOPA 1L1EA 3X1KA 1NWHA 1SQSA 1F6DA 3OH8A 2BEVB 1X39A 3E9RA 4IUDS 3PFIA 4Y9UA 2G3YA 4DUGA 5DI3B 1PEAA 2PZJA 2ZW9A 1LCIA 4FZRA 1IHYA 4G0PA 3TLXA 4EVSA 5KQGA 3UATA 3TE6A 1L6IA 1JHPA 1NMQA 1Z56C 3M1IA 3UUFA 3PQDA 4K6HA 4Y6PA 5LQCA 1V7CA 2V74B 4RHUA 1W9HA 2IEDA 2ST1A 3SK0A 1ZYUA 4A6XA 1M54A 1QWOA 4WI1A 4W63A 3V4OA 1GFZA 1ZIOA 4MGIR 3GPDG 3UXHA 3STYA 1JILA 1C7IA 4N7MA 3ROQA 5KI6A 5MN5A 5AUQA 4Q4DA 3V55A 4JU8A 1CY0A 3CZPA 1OFUA 1CZUA 2QMQA 2XMZA 4MUEA 1Z6QA 2J09A 3CNHA 1HDRA 2OGTA 1FDWA 1O54A 3KJXA 4M86A 3V3KA 5FUMA 4M7WA 2IHYA 2GVZC 1E98A 4KJZA 4K7JA 4CT5A 3I6BA 2DY0A 3T41A 4XJXA 1ZA1A 4XWAA 1Z13A 1CB7A 3R3UA 1WVMA 3U37A 5BSFA 4BX2A 1O89A 1J2JA 1CFZA 1GQSA 1PK9A 1BYIA 2PD4A 3G5AA 2HBZA 3HGMA 1UBOS 3IVXA 1NWCA 4M0FA 2OD2A 4RETA 5DV9A 3RRFA 3CRQA 4A92A 2MMCA 3OTQA 3VVBA 1DCMA 3IMEA 3BMQB 3KT3A 4EITA 4QOJA 4MVJF 3MFQA 1DC6A 1DKUA 2G67A 4EO7A 3CPJB 3KAPA 1ST2A 1HRKA 3PG5A 4D56A 3S8EA 3WG9A 1K6JA 1KNQA 2QORA 4YO7A 1NUSA 2YWXA 2XMSA 2YFHA 3PQCA 2Q3LA 1NXTA 4JLAA 1HFJA 1AS0A 2OL4A 4NFHA 1AV6A 4ISBA 3BXOA 4I4NA 1X0VA 4PYKA 4YALA 2QP9X 4FNMA 3VNUA 1UFQA 2OD9A 5C8DA 4JQSA 3AF6A 1PNOA 3DW3X 1F51E 3CR8A 3DFKA 1FA9A 5AVWA 2XVMA 1J00A 1JI0A 3BX1A 2BP7B 3JYLA 4GT1A 2ALJA 1CZOA 1IEQA 1V48A 3LUHA 3SX2A 1R0SA 4FILA 3QELB 3IO5A 5A0FA 3UGKA 5F23A 5L3VA 2FPPB 3L8DA 1UPTA 3UOAB 3ONFA 1R0RE 3L8ZA 1YQWA 3DTVA 2A0FA 3FTPA 4I5IA 4YRSA 1G5PA 2W7TA 5ALKA 5B1HA 2ODQA 5EZYF 3ZE1B 3EVEA 2VHVA 1ZBQA 2IYVA 2QNBA 4PG5A 4Q47A 4EJMA 2KE5A 3K0SA 2QSUA 1AQIA 3AX6A 1CZHA 2I76A 2AWNA 2L69A 4K9MA 1I4EB 4QXQA 5FRDA 1SCQA 2EBHX 3ZY3A 1C41A 1KSHA 4R8MA 3CTMA 2UXDB 1XN4A 5LBTA 1UM9B 2TRSB 3P4XA 3Q6MA 3ONNA 1K6IA 3HGQA 4FX5A 1G3QA 3CFYA 4JJ7A 5ES3A 3O8RA 1U8ZA 2RSLA 4ZZ0A 821PA 1YK1A 3O94A 4M54A 1OREA 3SBEA 4F45A 1GUYA 4PR0A 5HUQA 1YJBA 1W44A 5DLYA 4JBXA 3G2JA 1RVDA 2JLRA 2TS1A 2J3KA 4NOJA 1TJ4A 4FWTA 4PZUA 4B3CA 1BD4A 4PG6A 4YA6A 2PS1A 5AVOA 2DPLA 4Q1FA 2NZUG 3GJQA 4H3SA 4REQA 3CLVA 3S1LA 4E88A 2DPMA 5E2AA 3W6UA 2IZ5A 1IMOA 1BVHA 3HYTA 1VLJA 1MJNA 2X3YA 3BORA 3DWIA 2DPGA 1Y4DE 1N0HA 1JF8A 2REOA 5EP1A 5KNBA 1ZC3A 1K5PA 5E4JA 4KI0A 3TSAA 4DCNA 1YL7A 3HN6A 5GAJA 4WOCA 3O90A 3VHQA 4ER0A 1W87A 2H5JA 4H7FA 3WB1A 4B4WA 7REQA 2OA0A 2WD7B 3IIEA 3EEYA 2X9LA 1XCBA 2FPXA 2BFPA 2GD1O 5B2FA 1VCIA 4BV2A 3CNOA 4TWJA 4J03A 4N8SA 3U17A 4F3RA 5ENZA 3KOYA 3OPYA 1USVA 3QLUA 3F73A 5HXAA 1UZNA 2NAPA 5IKPA 1EIZA 2WV9A 5BN4A 3QWHA 2OBXA 1KZHA 3D6VA 4LHSA 2RD2A 5JZSA 1NIPA 1SHJA 5TIIA 3ZHVA 4JUBA 1AKQA 5L4LA 4F72A 4Q6WA 4WBNA 1Y3BE 2H65A 4MHOA 4MIYA 2J7PA 3OKFA 4ECAA 4BV9A 5A0TA 3U44B 2FFRA 3AWDA 4PBTA 2ZRAA 4QNNA 5AJXA 5A9SA 3UUGA 4YJ3B 4DANA 2JFPA 3KO8A 3EPKA 1XZCA 2CDRA 2IYOA 1NDHA 1X86B 4U2BA 2AYZA 1A8HA 2CXXA 3ACCA 3JQ8A 4UQPA 5G2OA 5SZJA 2JD2A 4L7VA 4TZKA 4CKEA 5ICMA 1R7RA 1XXLA 1AS3A 3GJ7A 3MJSA 1SVKA 2Y6UA 4LGMA 5DW3A 3U4CA 4ZK2A 4UTNA 3BMNA 4D25A 4AI6A 5AKLA 3R3JA 1MFZA 4JY7A 3KQLA 4UEOA 1FLVA 1MC4A 1SCUA 2JATA 2Z9DA 4E1BA 3ER8A 2JI7A 1JZTA 1RS0A 3B51X 5G4KB 2ECKA 1ENPA 3IHTA 3L01A 1OMOA 4HCJA 4PHFA 3HU3A 4PZYA 2CVHA 2ZSEA 4FFRA 1DHTA 1OC2A 4ZO9A 3EK2A 1G291 3O4HA 4U2DA 3KUXA 3G2LA 3NB0A 4OTZA 5D86A 2H0RA 2XNKA 4LVCA 4AMYA 3H0CA 2JLVA 1BKDR 4UBNA 1PIWA 3PHIA 1FFBA 5SZHB 1QMGA 3ZXYA 2ZR8A 2GRUA 3NIBA 1DOHA 4F9EA 3Q3GE 1K8XB 4BJ1A 1Z4PX 3B1WA 4JLSA 3I62A 2HX1A 3L2OB 4DLNA 4L8VA 5A7FA 2V7VA 3DWGA 3WNVA 3TIXB 1YZHA 3H16A 4PZCA 2JFXA 5FOSA 1KK0A 3O1LA 3NEPX 5A4AA 4DQKA 3N05A 2GO7A 2JA1A 3GUCA 3HI4A 3I42A 1Q84A 4TQ9A 4KE8A 3K9GA 4ZALA 2BMWA 1DFGA 3SYKA 2I62A 4L85A 3PPYA 2BOVA 5C8YA 4H4CA 4L8LA 5IT4A 3VKUA 3N75A 4JB3A 4BNXA 4PX2A 2IWRA 4DMMA 5CT4A 5HG0A 3PJEA 5HUHA 1YT5A 3LC0A 4UHDA 1QH9A 1Y81A 3UVEA 4D44A 1ENYA 1G3UA 3H2GA 4NWIA 1SO8A 1Z5VA 2FXVA 4DTIA 1EGMB 4CKCA 8GPBA 5REQB 4CBVA 3KXIA 1ZN2A 3TAHA 2MWMA 4AP6A 2Q46A 3T7JA 3DKIA 1V1MA 2OKCA 2W6JA 4Q7EA 4FXOA 3R7LA 2WKRA 4JVMA 4HDSB 3SZMA 2Q5HA 3IC5A 2ZWPA 3N76A 3ZV6A 2C83A 2FF5A 3OEHD 4AS3A 4CMIB 3TOSA 2J3DA 5F98A 2Q9UA 2C59A 2G4VA 2W37A 2OXTA 1LPNA 1LZLA 2H48A 2REXB 3GH1A 3V7NA 1FFXB 3P9CA 2PYDA 1WPGA 2H54A 3WGJA 4AG6A 3OFVA 2G63A 4RESA 5FL7D 3RREA 3GLFA 3AHIA 1O08A 4ZOEA 4PLYA 3TQQA 3PP8A 1C8LA 1H1DA 3D6NB 3OJXA 5AXBA 1MW9X 3P2YA 4ZEOA 1YQGA 1JHDA 4DSOA 3KYDB 4UBMA 3PF9A 1S2LA 3GBSA 4JBGA 1DBIA 1M76A 4KAFA 2HIMA 1CF9A 2O0LA 4JJGA 4KO3S 1ACLA 3UCXA 3LUAA 3GJ4A 5ENVA 3UH0A 3AP3A 1D3AA 2R11A 3OD1A 2VOEA 3U40A 3LFHA 2KPOA 2OMKA 5SY9A 4GQBA 2IW3A 4HT3B 1HYQA 2A0XA 1HSOA 4LOHA 1LFAA 4CM8B 5T4EA 2RGAA 3I8SA 4X7MA 4PLWA 1KOFA 3PVSA 3K8OE 5MFZA 1P7ZA 2P2NA 3UHJA 4YWJA 2X0EA 4QQRA 1JVNA 3BRQA 2PZKA 2V65A 3T9FA 3TZLA 5K01A 5ILOA 3MTIA 3H2BA 4AZ3A 1S4MA 1YZUA 5ICSA 3NIGB 1EYZA 3E58A 3KRTA 3DLHA 2J45A 4TRNA 5D01A 2RBGA 3PWZA 4NJMB 3VZBA 4ZYVA 4DWOA 1JU4A 1U9ZA 1QIEA 4RHXA 2FN8A 2HK9A 3AF4A 1KIMA 3IR5A 3PL1A 4K86A 4RXMA 2I2AA 4EAQA 3B38A 3QVLA 1LWNA 1QHIA 3L41A 1GPLA 3RYTC 3R75A 4D4IA 1VJGA 3R41A 4GZ5A 2ZXFA 4PNZA 3EZLA 3T3GA 3B7PA 3BRSA 4JUIA 2X3UA 5BOVA 3UAZA 4EGSA 6CHYA 1VBFA 3PV0A 1GARA 3PFCA 3SJZA 4AG5A 3T0IA 1FU4A 4IQ0A 2CNBA 5DWVA 1IU9A 2B5VA 5E1OA 3FWZA 3I09A 2H9YA 4G81A 1T8WA 3AB8A 4R41A 4UULA 4LFBB 3PJGA 2B0CA 1BCRA 3PDIA 5DOVA 1MAUA 3NHKA 2H3EA 4ETWA 3BFVA 4NJEB 4Y1RB 2QVZX 3ONEA 4P3OA 1N6RA 2H52A 3R5TA 4FGJA 3IKJA 5IAKA 5LDGA 1IM2A 3C5VA 3JCZA 1DNPA 3PZBA 2YVUA 5KEIA 5A9SB 3BHNA 2YRXA 5EE0A 5T67A 5IP5A 3WLLA 5ARCA 4WN3A 4MW2A 1BXGA 2A0YA 3LY5A 1QIJA 4ANFA 3LGSA 1ZOLA 2DWUA 3TM5A 2D6FA 4D0SA 5HFJA 5E3JA 5GONB 3T8YA 1RYHA 4X84A 2J32A 1CW2B 1GGHA 3LLVA 3UJHA 3LDHA 5KHLB 2JJ1D 4FEYA 4ND5A 4LJ9A 4WCFB 3ZZUA 1YBMA 2ZB2A 2QJRA 3MM4A 4MGKR 3IKMB 4U7HA 4YAGA 2DWPA 3GP5A 3OHMA 3EYWA 5JJKA 1KMCA 4HF7A 4KREA 2XBLA 4EG1A 4BZXA 3BXPA 1YUNA 2G1KA 3NEAA 2BT4A 2VBCA 4LJAA 3TDMA 4K03A 5JMTA 4OYLA 4QYIB 1GYRA 1ORWA 2IPAB 3JVDA 2CWWA 4EDHA 4IUYA 3JSAA 4G3XA 4LWQA 4O1IA 2IU3A 5IT0A 3HCPA 3OCJA 4MS3A 1WQ4A 1PYOA 5B64A 3KKEA 3BXHA 3NAQA 4J0CA 1YL5A 3CEPB 3RK4A 4BO7A 1L4NA 2IIPA 3E84A 3FCCA 1PJSA 1EFVB 1VLZA 4PLCA 1CC1S 5GADl 2JCYA 3P94A 2CDCA 2FRDA 2LGJA 3A1WA 1LRJA 3CKMA 4QULA 5COBA 5GJCA 5HIJA 3U3MA 2EL7A 1T0HB 3SMVA 2F8LA 4C0JA 4JENA 3AFOA 2W2LA 2GN1A 3N5CA 4AN1A 1IZZA 1XU9A 2FFBA 4YCSA 4YRMA 3ZD7A 4QXRA 1Z5OA 2B5OA 2R4UA 4QLAA 3S2ZA 5LQRA 3NGMA 3TXAA 3OG9A 1UADA 2YN4A 2DFNA 3SMQA 2LCQA 2QMHA 4HNQA 1M1NB 1CIJA 1GA4A 1ULTA 1WV0A 2B7LA 1EA7A 2WVHA 4H6PA 4RKYA 4Q9KA 1DKOA 1YQ9A 4H7KA 3JD2A 4I5GA 2AN9A 3THSA 1B4DA 1NN5A 3W5UA 3KAJA 1ZINA 3EUWA 3TL2A 3AH8A 5I8ZA 3VR6A 2WC1A 4X45A 2QBYA 4K81B 1PGQA 3TN7A 1G2OA 1QCCA 2CKMA 2J3LA 2QX4A 1YFJA 4Q1VA 1DAPA 1HH4A 3ZWWA 4F2GA 1GPJA 5K20A 1QO7A 3H8WA 5ARBA 3RU9A 3KQHA 3PQ6A 3W5JA 3BSFA 4WECA 5DM70 4R5HA 3N2LA 5FO1A 2VHCA 4O4LB 4YAKA 4CTKA 4MHTA 1LW7A 3WFIA 4HY3A 5FNZA 3ZD6A 2WAOA 3W4KA 5KMGB 3GT7A 4HNHA 1E3QA 2AFHB 4XR4A 4BXOA 2WHEA 4RTNA 2GBIA 5BPHA 3D8HA 4F56A 2HRCA 4FFPA 3FBWA 3LC1O 1AY0A 3MRXA 4I4TA 4LXGA 3TE7A 3NI2A 3BSWA 3GQBB 5I9NA 1HFKA 4TZ0A 3OP4A 4EO9A 3NGLA 5IC4A 5J58A 5IT9A 3L4JA 2MR6A 1WDTA 5FEUA 1UEIA 4MI3A 5KUTA 4P2GA 4GBJA 5C8ZA 2P9CA 4FEAA 4RNDB 3LPMA 4B3RB 3ZWNA 3OT4A 3I9V6 1XQXA 1G41A 2YY7A 2BFDB 2VYVA 1O87A 3GNLA 4GI2A 4ZDKA 4CMJA 2GN2A 2KI5A 3JQAB 3AP1A 4WMLA 4ALIA 1PYDA 4XVHA 2Z6VA 4DM4A 4EL0A 3DE5X 3L82B 3G49A 2FW6A 4DPLA 2C2XA 3O4JA 2GKSA 4GZ3A 4IAOA 3UJ9A 4KR7A 2AOXA 3WIBA 2EG9A 3I28A 1GFIA 2P5TB 2VSFA 3SJ7A 3ZZ1A 3CYFA 4H0NA 3AKYA 4WUVA 5DEIA 2IY7A 1USWA 4WJLA 4K6OA 4P34A 3VDMA 4Z1OA 5JD4A 1GZ7A 1T15A 3BC1A 6AT1A 3QQ5A 5JI3E 3KX2A 4REOA 4EMSA 2WR8A 1MJGM 5EZ6B 4DLPA 1I6LA 3ZQJA 2GCOA 3N8HA 1VL6A 3RYHA 3U7QB 3X0DA 1M6NA 3T4UA 3NTXA 1GPNA 4UQOA 2FA9A 4QGFA 2BRUC 1UIMA 3EQ7A 3EWSA 4CQMD 5I47A 1S1CA 2AX4A 3BAZA 3GJ3A 3WRYC 4CIXA 1MJFA 3QMMA 3DG9A 3ETDA 1OTHA 3QJ5A 3SXPA 4D3DA 4YQEA 4DLVA 1GZHB 1GZ4A 3KTOA 3QPBA 2A30A 1E9VA 4B47A 1HMYA 2F3RA 4C08A 4U0JA 4X1IB 1LBHA 4M9CA 5ITZA 4QXMA 5KTOA 4B76A 3C1TA 1CETA 3QVTA 3PZRA 4GPTA 4YFVA 1MXFA 5H82A 1SKAA 1TYZA 4N49A 3SR3A 1C2YA 1Q7EA 3I5AA 2UYHA 1N6KA 4IMIB 1WMSA 2ZJ1A 4QUGA 3TTUA 4EPXA 5T7BA 5IN4A 1ZUHA 1V6SA 4NARA 3RH0A 3DVSX 2H1CA 2PZLA 2OG1A 3G2NA 1P9WA 1NFRA 4HX5A 1T36A 2O2JA 1KAGA 5BR7A 1YF3A 5TQ0B 1ZUNA 4XTCS 1GR0A 2XB6A 1SHTX 4XDGA 4EI9A 5AFSA 3V1YA 5JXIA 2Q4RA 1NJ5A 1Y6JA 4KFTA 1DT3A 2GHTA 2DRIA 1DKNA 1ECJA 1MENA 4EX7A 4F6CA 5DP1A 2R97A 2QR3A 1E1DA 2AZDA 2P40A 3M6AA 4MYDA 2QD4A 1QZTA 2QNRA 5B3JA 1CQWA 5BWMA 1HZZA 1S02A 2O2HA 4TZTA 3OUUA 5DHAA 2FB9A 3ILHA 4Q82A 2IELA 2M1XA 4U3JA 4FN4A 4EGFA 4BN5A 1FNNA 2COEA 5GM2A 1M2HA 2VHTA 3A1EA 1BEUB 4Y6GB 2EF0A 3HCOA 3R8CA 4JD5A 3EPRA 3Q5EA 1H2FA 1P9LA 3P9NA 4FZVA 5A0VA 2JVIA 2VPIA 2A9QA 1FP1D 3EIUA 2XMGA 2ZTVA 4V39A 4YPFA 3D3NA 3QENA 3UJPA 3MWDB 1V7QA 2JCXA 4B3XA 2AG8A 2WWIA 3IESA 2WWWA 4RL4A 2RCNA 2IL1A 1OYYA 3FZGA 2HKIA 3PUWA 3TTSA 4ZXPA 1PNTA 4X9XA 5ELXA 3RG2A 1SRQA 2OC9A 1ZISA 2FWIA 2YVQA 1EI9A 3V4ZA 3VUFA 4XPIA 4BMPB 2CWDA 5DMHA 4DIFA 1QRRA 3H1BA 1NNI1 3TRIA 1Y3AA 2H1RA 1ZGBA 3ZWKA 3VDNB 1XRJA 4DRXA 3AM1A 1TMGE 3HXLA 1PLJA 5E6RB 2B37A 2BFCA 3KPWA 4O4JA 3H8VA 3AI1A 4IINA 4ZDWA 3NNNA 2CXUA 1ESZA 1P74A 3N2IA 5KYXB 1JWBB 1VSTA 2VH1A 1C9JA 4X20B 1MGOA 3H5TA 4GKAA 4IF6A 1ZOPA 5HFAA 3QBEA 5ICFA 3U81A 1EX1A 1M6YA 4EHIA 1IY0A 3QE4A 3C4VA 4G63A 4GEKA 1M34A 3R9IA 4OB6A 1Z2CA 4RFVA 3GRAA 1UPFA 4U8HA 3RKUA 2H9AA 1N5RA 4ZMRA 4KAXA 2VRCD 2QLNA 2XADA 3ZXSA 3KQKA 3L7AA 5T41A 3K3PA 1TQ6A 4QELA 4XIIA 1XZHA 2GDJA 5BT9A 5MGNA 3AHJA 3WKBA 1CFJA 5J2TA 1JTVA 1RYBA 4FMCB 4YJKA 4AJOA 4JBHA 1RT9A 3K1AB 1K97A 3A1UA 5CYGA 1VSQA 2R7NA 5C7YA 2OMEA 2P2SA 4G9GA 5G02A 2ZUTA 3EVAA 3EGIA 2EZ4A 4IIJB 4BGDA 4FGUA 1R1DA 3FSGA 1UAAA 2ZGVA 3BGIA 3K20A 4ENQA 4TXNA 1US8A 3ADCA 1ZNYA 4HH4A 3NATA 2G77B 1FNMA 2Z2KA 3B36A 2PWZA 2VTEA 4GM0A 4C6SA 1FDUA 2PJRA 4W82A 3S7ZA 4D8YA 4KDRA 3HV2A 2D1QA 4XTRA 5BRJA 3RRMA 4YQYA 1EFRA 2JGLA 1HT1E 2WWFA 2XHZA 3K1AA 3IEIA 3OQBA 4NYMR 2GHIA 1H0KA 2C2OA 4ND7A 2XYGA 4RYDA 2YJ4A 2VXBA 3OZTA 5BNZA 3PNLA 4YMIA 2GN9A 5HKKD 2O1SA 3ANNA 3KTAA 3E1KA 3JARB 2I34A 4XYMA 1PP4A 4LXTA 4Y2UA 4LFCB 2YBDA 4FJ0A 4OBXA 4FCCA 1QDUA 4UE2A 4AKHA 1PV2A 1Q0QA 4DCUA 3PIIA 3OTHA 4HGZA 4RD6A 5EAIA 2QTTA 1HQCA 2O7RA 3AUAA 4HQ6A 3FNEA 1XTZA 4X20A 2FEMA 4OAPA 4Z51A 4XSHA 4IPTA 3ZU3A 1Z06A 2UZIR 1ZMTA 4XASA 4H3VA 1T26A 2H0AA 3SDZA 2ZYWX 1Y4AE 4HQ0A 3X44A 2BFCB 3A27A 4QDUA 521PA 1PSZA 4UNSA 1JKMA 4O02B 5F4BA 4OLHA 1E61A 1VHDA 3O5AA 4XD2A 2ECOA 2FDRA 4AJJA 4FQ8A 4RXUA 4L9AA 3OOSA 4IICA 1CRQA 2NO0A 3O8BA 5K8IA 4J76A 3JAKB 5CG1A 3EODA 2HY7A 4NBWA 2RK3A 3CE9A 3G9UA 4UNNA 2FZEA 1A4XA 3KQPA 2XODA 4FYVA 5D3MA 2R44A 3LCRA 5TSDA 3VYVA 4BN4A 1BN6A 3MWDA 4R3NA 4F4UA 3OIVA 5FXMA 3K70D 1L5NA 3Q2OA 1V9SA 2EJTA 3CQ9A 5EHIA 3JSXA 4CI9A 1DIOB 2IW1A 2NUPB 4R2IA 5IJWA 3BUSA 4IGFA 1XPUA 1N75A 3JQBA 4BMZA 3A70A 1ATZA 1YS7A 3DZBA 1RHUA 2AB0A 3HEMA 4LDZA 3MMXA 4AP9A 4D57A 1M6HA 1ZD3A 1ENOA 1YZKA 1JQBA 2X5NA 2QF7A 4WA7A 3RU3A 1XDWA 2CVOA 1J8VA 1Y5RA 2EX4A 3JR7A 5M34A 2JEOA 3BH0A 3BZBA 3CSUA 1TQ2A 3PNKA 4OOFA 4ZQHA 1D07A 3PR1A 4UTXA 5JE8A 3V97A 4BB9A 1V5IA 3VH3A 3N0WA 4B1FA 3P8ZA 3VR4A 5HRAA 1NYRA 5HZGA 1C1XB 1X0XA 2W6JD 3P7MA 3BL5A 2RHJA 3UC5A 1EP1B 3TRFA 3BCSA 4C4PA 4E5NA 1IAQA 2WKQA 1A9YA 5TF4A 4EPTA 2BEWB 5MN6A 4B83A 3KJGA 3L0PA 1JE1A 4YBRA 5AXDA 3WLAA 5TVKA 3WJ2A 3GCDA 4KFUA 5TQ0A 1QFSA 3EZ7A 1GKKA 4NYIQ 1JB1A 1FZQA 1RNLA 2OZPA 1KWGA 3KJNA 3HP1A 2F4VB 3QU9A 2V4ZA 4MWBA 2V7QD 3TX6A 4BMYA 5FP0A 1TJ5A 1X77A 3E5RA 2QQFA 4YV0A 2CZGA 2NZJA 2PGDA 1YS6A 2WMDA 2XQKA 1TAUA 2VAMA 2Q6KA 1JQAA 1I2DA 4MGZR 4XGRA 5EJ5A 1ZC4A 2PPLA 3S6JA 3MSXA 4LOIA 1T3GA 2OCAA 2VZEA 3KQWA 5ITZB 3U16A 2WU1A 2XR1A 2B8NA 2Z5GA 1MF7A 1SXGA 4ENSA 3OIUA 1WSBA 1DXQA 4MA4A 4HNGA 5EJ2A 4O29A 2Y92A 1QIMA 3W7AA 3P0EA 3FLEA 3N28A 4BO3A 3L0CA 5K0JA 1C50A 1R6DA 4PRLA 3VSAA 1KAHA 1Q74A 1DQZA 2ERXA 2Q1SA 3CF2A 3AR6A 4WTOA 2G06A 1M10A 2OGZA 3CBQA 4WPGA 2NTEA 4RM3A 4DQ0A 3AVTA 1F2TB 2EW2A 4EMUA 2HZ7A 3CLTC 1Q15A 1KMIY 2YOFA 1BW9A 1LTQA 3PFNA 4Y2HA 2X77A 4RLSA 4JDPA 2H18A 3DCIA 3O8OA 2ID7A 1QHYA 1ETHA 4TPKA 1B6TA 2ZIZA 4LZWA 2ONKA 4D4LA 5BSMA 2C5LA 3LHFA 4O2RA 1UKYA 4BUCA 4PBRA 3NWJA 1NF3A 2W4MA 3RU7A 4UXIA