3NKVA

Crystal structure of rab1b covalently modified with amp at y77
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
b'EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-1B
publication title The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nkvA00
2KBEA 1CJMA 5BWMA 5D3QA 1LTQA 3SC3A 2OCPA 1JB1A 5AJXA 3A1UA 2QGZA 2JDIA 2GXUA 1IOZA 2ZSEA 3MCAA 3EC2A 5UKDA 2W6JA 1E9CA 3TJZA 2BKEA 4UNQA 1I4LD 5G53C 2O8CA 1LF0A 4ILEA 3VTKA 1TUEA 3IO5A 1HQYE 3EWSA 3QF7A 4B3FX 1ZM9A 4GOKA 4TSFA 4DCSA 3ZVNA 3P4XA 4HLCA 1DO0A 3KQNA 4QGGA 2IYZA 4QJ5A 3L8YA 1JJ7A 2BBTA 3BB4A 3TR0A 4XTRA 5GVSA 3SJZA 2RGXA 2OE2A 5JEEA 2JIZA 3IDQA 4PQYA 4ZV4A 3HR8A 1N6KA 1Z29A 5EXSA 2ZU0C 4HUTA 2RH5A 1TU3A 4L15A 1EWRA 3BORA 3CX8A 1ZP6A 4RD6A 4R7ZA 1H65A 1YQTA 2F7SA 4XD7D 3SNHA 1E2KA 2P65A 3DMNA 4LBZA 2A78A 1GRRA 4NYMQ 3P27A 3SJAA 2C03A 5JI2E 3VKWA 3I5XA 1E2IA 3BIFA 5G3ZA 5HKKD 3C7KA 1Z2CA 1SULA 1OIXA 4HZUB 2IW3A 5BW8A 1DAMA 1Z83A 4OQMA 2Q3FA 2DWPA 2WIAA 5DHAA 1M1YE 4A0FA 1EFTA 1YZUA 2LKCA 4QL3A 1E9FA 2IA5A 2IUSA 1S4QA 2GJ9A 4Q7JB 4RZXA 1YKSA 1XXHB 1G3IA 1HEIA 4V02A 5LDDC 5LB2A 2OXCA 4B71A 1G3QA 2QMOA 1FX0A 1GM5A 2W6ID 2XNSA 4M9QA 2ZU6A 4IOMA 3THYA 5F9FA 1XZPA 1W5TA 2CE7A 5CJPA 1LB1B 1X8JA 1E2DA 2I1QA 2QMHA 4NPHA 1YR9A 3PEUA 3SR0A 5KNBA 2ODNA 3ZD7A 4A9AA 3EXAA 2Q21A 3LW8A 4POAA 4BPBA 3MWJA 1F6BA 1KJZA 1LF5A 2BBWA 3NH6A 1P9WA 3PVSA 4CEHA 4DIDA 4RZ2A 2VP4A 4QHTA 5CM9C 3OE7D 4QJ3A 1CJTC 1UKYA 4URUR 1ZC4A 2O52A 2EFCB 4YDSA 3R9WA 3WP0A 2A9KA 2FSFA 3AF0A 4JLDA 4XD7A 3UMSA 2PLRA 1W2GA 2JLSA 3C16C 2V8OA 5FBWB 1F48A 1NN3A 4WVFA 4LBWA 4TN1A 4TZ0A 4KSCA 3LBIA 1QHNA 4R2HA 4JSYA 2OV2A 2QENA 5HKKA 1U9IA 4NTZA 2OFWA 3DL0A 4UXJA 5DSZA 4G5OA 5EXTA 4DSOA 2DYKA 2FJUA 3TVTA 2F55A 4M8NE 1MT0A 1IXZA 4IDQA 2VHUA 2DB3A 1XEWX 1BKDR 3QG1A 1E9AA 3EASA 3U7EB 2C78A 4G5SA 2BMEA 3TRFA 2ZE5A 1N6NA 4X8OA 2Z4RA 1CTQA 2QUZA 2W6IA 1U8AA 3F5FA 1G7CA 1P9NA 4L16A 4PHTA 2IUTA 5AUNB 1Z0AA 4GRAA 1FW6A 2V55B 1KOFA 3CO5A 3EG5A 1HYQA 4LY6A 4JKIA 4RFSB 1MRNA 2WOOA 1ZVQA 1A7JA 2UZIR 1S9DA 3RS2A 4O2RA 4HEJA 3OE7A 1QDEA 3CH4B 4R2IA 3EA0A 4ZCMA 5JCZA 1Q1ZA 2IHBA 3HPRA 4DSTA 1AGPA 2OBNA 1V43A 2O8FB 1FQJA 4MKGA 5A5GA 4LCBA 1YR7A 1ZUIA 3NC0C 1Z07A 4LPKA 1CU1A 3KUCA 3VU9A 5EZ6B 4M1OA 1BH2A 4KVAA 5FOVA 4YXWD 3PJRA 2XX3A 3SN6A 4A2WA 1KTVA 3I73A 1JR6A 3THWA 5IRCD 5DH9A 5C4GB 1ZUHA 4ZI3A 4JS0A 1OLOA 1U0JA 5J4YA 1GKYA 1B0UA 3FPAA 2NGRA 2EFEB 3TIFA 4HLUA 2BM0A 1KGDA 1PLLA 2Z5FA 3AKEA 3MGCA 2QAGB 1E9EA 1DAKA 1MRSA 2FSIA 3Q5EA 4JJKA 2HT1A 4AI6A 2CL7X 3AF3A 3OAAD 3BBPA 2WWGA 3TMKA 2QP3A 1Z28A 4GOJA 2FGJA 1WDTA 621PA 1Z22A 4HLUC 1CR0A 2OUKA 3GLHA 5AJYA 4B34A 3C41J 4DLVA 1P7CA 4DZZA 5J47A 2X19A 1BS1A 4BWYA 2DY1A 1W1WA 5FBQB 1XDBA 1RFLA 4N0DA 5DI3A 4RD3A 2IYWA 4D80A 3OIYA 2C77A 2VL7A 4HB0A 1E2PA 2O0HA 4B32A 5CB8A 4FMDF 1SXJB 2J45A 1GRQA 4HAWA 3HU3A 4NYIQ 5IK2A 5HR5A 1NMXA 1NVVQ 3K0EA 2UZ3A 3LDAA 3CPEA 2IHYA 2VSFA 2R65A 4R98A 2HYIC 1A82A 2D7CA 5KOYA 3W6PA 2BEJA 5KDLA 1DG3A 4FINA 4M1YA 1ZNXA 3B78A 3EW9A 4NONA 1AS3A 1JNYA 3RAPR 2QU8A 1XJCA 3RS0A 5K8TA 4HDOB 3KB2A 1Z6AA 4MGIR 3VKGA 1F5NA 2NOAA 4Q1CA 4CEJB 1GKIA 4GPTA 1P9RA 2XTZA 1QHGA 3GLHE 4JVSB 3HR7A 2XB4A 3OIWA 5B57C 1GZSA 1TNDA 4C7OB 4OK5A 3FMPB 5KO2A 2X2EA 3AVTA 2PEYA 3NIBA 5H8WA 3CPJB 1M7BA 2AKAB 4F4CA 3P4YA 1ZU4A 5EZ5A 1RYFA 3VAAA 4U7DA 1F2TA 1TEXA 2ZI6A 3LY5A 1H8HD 3K70B 3UMFA 1R0WA 2IXEA 2W2TA 4OK3A 1RYHA 1OHHD 4ZI2A 1L4UA 2H92A 3T12A 4OJQA 3JZAA 1OIVA 4IFBA 1LS6A 1XMVA 3DEFA 2AXPA 2OLKA 4Q9IA 1KK1A 4CYMA 1VIAA 4ZPXA 4Q1AA 3R7WA 2ZIAA 2LKDA 4M1TA 5FOSA 2XZLA 2ZAMA 3AH8A 1VHTA 2GDJA 3T06B 4DLSA 1GNRA 1G19A 2XXAB 2FWRA 4MYHA 1A5TA 3ADKA 2QAGC 2CMKA 2IYRA 5FOUA 3CF6R 1G9XA 4TYYA 5CIQA 2X1VA 5J4VA 1JXOA 2HXSA 4LJ7A 4TQ9A 4MYCA 2YYZA 5KSYA 4QBFA 2QSYA 3GJ3A 4JLKA 1RRPA 2ATVA 3CZQA 4D4JA 5AR1A 1KO7A 3S1AB 4F7WA 2C5LA 4E22A 3WHKA 1NLYA 1W48A 1NI3A 1SXJA 1X8KA 3R9IA 4B3CA 2YWEA 4KXFB 1Q0UA 3PCRB 2ZXUA 2WKRA 2F3TA 4U5XA 2P3SA 3M0EA 2YHSA 3CUEF 2I3BA 1QHYA 3LNCA 4QNMA 3ZZTA 1W36B 2J87A 5L3QA 5JMTA 1SXJC 3NH9A 2CE2X 2OLJA 2A30A 4B3BA 3EPHA 1H8HA 1JPJA 2GJ8A 1OHHA 3AF2A 1E9RA 1AK2A 4ARZB 1W0KD 2GF9A 1S3SA 3KX2A 1GRNA 2ZETA 1E2EA 1D9ZA 2QRZA 1SKYE 4M0LA 1UDXA 3UATA 3TNFA 1J70A 1OXSC 2ZRAA 3M4YA 3LVRE 4IHQA 4C7OA 2ZRHA 1NNEA 3U61B 1T6NA 4PHFA 2JEOA 2FFQA 2ZJ8A 2Z0MA 3G0HA 1SVLA 5TXGA 2ZRMA 4GNKA 3AUXA 4IXMA 1DG1G 1UKEA 2A5FA 3LLMA 3VR3A 1OT3A 1JAIA 2AL7A 3ZJYA 1ZAKA 2ERYA 3MMPA 1KY3A 1U90A 1ZU5A 2FA9A 4TLBA 4M1KA 2Q9BA 4EPWA 1OB5A 1SXJE 4JLAA 2GA8A 121PA 2PX3A 5AUPB 1Z6TA 2CNWD 5EP4A 4LJ4A 2C04A 3K8YA 1N6RA 2QMEA 5JRZA 4EPVA 4CT4B 3EAQA 4Q1DA 3CH5A 3K70C 3H1TA 1ZUNB 2Z6VA 4MKFA 4BECA 3RANA 2C95A 3QKRB 3ZVMA 3THXB 5HZKA 2PX0A 4RD0A 1N6LA 4DKXA 4FWTA 1KSJA 1LY1A 1SVOA 2HCBA 2HCJB 4ABYA 3ZQ6A 1KDTA 2ANCA 2GJAA 4D0NA 4HAZA 4M21A 4A6PA 2XXAA 1VCIA 3I4LA 1AKEA 2ZE8A 5C46F 2ATXA 4PSAA 2Q3MA 1IN5A 1KJWA 2PT5A 4HUQB 1GG2A 3AP1A 1NY6A 1E98A 3UIEA 3AKDA 5KPJA 3L0IB 2GVDC 4M1MA 3KKOA 1TU4A 3WHLA 4TYNA 4MGZR 1DPFA 2YC4C 4MRNA 2ZAOA 5J4HA 2H57A 1FQKA 4JBYA 5AK0A 3S1AA 4RKFA 4YMSA 3A4MA 2YJTD 1N6IA 1DOAA 2NO9A 3R9XA 1G8FA 4LJ9A 4TYQA 2ZI7A 2ZUDA 4LYHA 2VO1A 1ZNZA 1G5PA 5E7IA 2VP9A 2IF2A 3OFNA 1E2GA 1E0AA 1IQPA 1T5IA 2WVJA 1R8QA 1FMJA 1X8LA 2YKGA 4URVR 2WPDA 2W00A 3CR8A 4LI0A 2CNWA 1W36C 3RYTC 2ZI4A 4ARZA 2JA1A 3LV8A 1Z08A 1ZM4A 2QPAA 2BMDA 1KYIA 4K8OA 4UXHA 3KXIA 4MH0R 2RKOA 2I4IA 4V0MA 1B23P 3LXRA 4D81A 1GNPA 5TDHA 2BHRA 2ZRJA 3KJHA 1OFTA 1F60A 1RRFA 3PENA 2MSDB 2IYTA 5K8UA 3B13B 3SJBA 2ZVPX 2OT3B 4FWIB 4NCJA 1WB9A 3VX4A 2C9OA 1KO8A 1UBCA 1ZIPA 2J41A 1T91A 2IK8A 521PA 2XNDD 3LRPA 4LC0A 4BFYA 1W2HA 2XTMA 4A92A 5L8VA 4OJKA 2ONKA 1N0UA 3LLUA 2ZYVX 2B8WA 3A36A 5FPSA 5FR2A 1ZIOA 4OQLA 2R6DA 1VYUA 5HE9A 4TLCA 5F2EA 5TB5A 5TY0A 4TT3D 1G4UR 4QBGB 3QKRA 1E2MA 1UBEA 1C1YA 2J7KA 3IHWA 2G9NA 2FFBA 3I92A 3QPVA 3QVVA 2DPXA 3ZGXA 1MO5A 4XVRA 4MRPA 2XTNA 1E9BA 3DKVA 5AUQA 3A6PC 2OAP1 5HPYB 3Q5DA 4V0ME 3LXXA 1QF9A 3FKSD 1GKUB 1KI6B 3B1XA 5H1YA 3QPUA 1Q44A 2CLCX 1YZQA 2BJWA 1EWQA 4C2TA 1E2JA 5TARA 5M04A 4FXPA 4G1UC 4RFVA 4P4UA 5JJLA 1J7KA 3A8TA 1NBMD 1SHZA 1M74A 3SFZA 2VIIA 3F8TA 2W83A 1F2UB 5G41A 3W8NA 4C30A 3W3AA 2J5XA 2E87A 2KSQA 3K09A 2R6GA 3KJIA 3LFUA 4W9MC 1RJ9B 2QRNA 3IIKA 4PANA 1II8B 2HDNB 3GLIB 1R0ZA 2BBOA 3HWSA 4UNNA 2D06A 2R44A 2VPPA 4A6XA 3U4QA 1RW4A 1XP8A 2C9CA 5FTLA 3ND9A 5EE9A 3I8SA 2IS6A 4A2QA 1ZC3A 5FUWA 2DFTA 4NYJR 3QF4B 3SHWA 4DEYA 2XNDA 4IW3B 2ORVA 2C96A 3X1YA 2CL0X 3GJ7A 4V0NA 1R5BA 5DIFA 1KK3A 3EPKA 2JGNA 1R10A 221PA 1TQDA 4PTLA 4DDVA 3B1YA 2BVNA 1S3GA 3CRRA 2JLZA 2NMVA 4TT3A 4MYUA 3E5HA 1RVDA 2FN4A 5G3YA 2FNAA 5CM8B 3EWAA 4EDHA 1WF3A 5JJKA 1DAFA 4N1AA 1M8PA 3Q9LA 4L9SA 1MO6A 5E7JA 3G82C 3AVYA 3ASYA 4C0KA 2H1LA 2O8CB 4Q47A 3N2IA 4P3YA 1HV8A 1R6BX 2PZEA 5CIWA 4B6EA 2AXNA 3AQ4A 1NMZA 1GILA 1KO4A 2WSSD 3RSOA 2WM9B 5JSZA 1GP2A 3FMFA 5DGXA 2QPOA 2G77B 1MV5A 3VR1A 2XGJA 3VNUA 1GVNB 3BS4A 4NU0A 4PC1A 3TQCA 2D2EA 4I99A 3JZMA 4G5RA 2OCAA 4EFLA 4JKYA 4HB4A 4QG7A 1ZBDA 1R0XA 3E70C 4PAMA 4TZ6A 5EP3A 3SE0A 3BE4A 4LHXA 4OHWA 3A1WA 1L2TA 4UKDA 3B6EA 1P4SA 1KI6A 3DM5A 2AD1A 4B73A 1E9SA 3EC1A 3PV0A 1E0JA 5AUOB 4GOXA 3AVUA 1S1MA 4IEIA 4Q1EA 1BO6A 3FDIA 5EJEA 1MKYA 2GZAA 2IEYA 3W3ZB 2VA8A 4B2IA 2VBCA 3IQXA 3T1VA 3WNCA 1U0HC 5KDDA 3KDSE 3IEVA 3FB4A 4IDPA 2L0XA 3B60A 1NP6A 2GZHA 3EPJA 4OQNA 1KJYA 2MMGA 2ANBA 2R8RA 1JPNA 2JASA 1WMSA 4AYWA 1II8A 2F1IA 4XSHA 4GI7A 3GLGA 1EXMA 3TUJC 2OAQ1 1U81A 1XB2A 1E1QD 1KI1A 2FOLA 1CR2A 1LNZA 4AWXA 5FOTA 1FX0B 5KSZA 3C15C 2FZ4A 2QA5A 1QHSA 2YWHA 3QF4A 3THYB 1XTKA 3GEHA 4IXNA 2VHCA 1E2FA 4A82A 4H1VA 2GK7A 5EUQB 1NG9A 3B82A 4D25A 4Q01A 4IFEA 4IOKA 2WSSA 1IN8A 4RCYA 3TK1A 4NMMA 1HA3A 1WRBA 3ZZUA 1EG7A 3N70A 1W7AA 4CEHB 2ERXA 3DOFA 5J5CA 1HQCA 2KB0A 3QVUA 4X8HA 1PZNA 3RWMB 2X77A 4UJ5A 2D7DA 3AGPA 1KNQA 5FH9A 1RRCA 3ICEA 3QIAA 4O0MA 4BGDA 1N5KA 3WY9A 2PCJA 2BV3A 3H84A 2JJ8A 4GZLA 3NHAA 3WMGA 3ZS9A 4MDFA 3RLFA 3BD9A 4B43A 1XCMA 3D31A 2GJKA 3L43A 1FNMA 2F1JA 4NKRA 3GLIE 1NVUQ 1KZGB 4G3XA 1VCNA 1AN0A 2F9MA 3EPLA 3SQWA 3QXHA 3EZ2A 3UWOA 1VMAA 1QHXA 4P4TA 2V6JA 3WMEA 4NYMR 2ZYWX 1GNQA 4LC1A 2KJQA 2I1VB 2OCYC 3I5YA 1G7SA 4QXAA 3P20A 4HDQB 3SU8A 3SHFA 3F0TA 1EFCA 1T0HB 1XZQA 3MRSA 1UBGA 1NL3A 2WKQA 3WYAA 2ZJAA 2ZS8A 3O47A 4K81B 1Y63A 3WNDA 5EXXA 3NDPA 4G5QA 1UBFA 1E1QA 4AK9A 1NIJA 1OFHA 2A5DA 2GTPA 1DAIA 4PZZA 1CKEA 4BFZA 2GEVA 2H7VA 4ITRC 1CEEA 2B8TA 5IF9A 2RAPA 2CVFA 3CBQA 3DOEA 2V1UA 2GK6A 3H0KA 1XEXB 4OQXA 4BRUA 1K5DA 1IXRC 4FD2A 4P32A 1YJ5A 1C4OA 3L8ZA 3N2EA 3K0CA 1ZW6A 3U2QA 4C0AC 4YQFA 1E2LA 4YMVA 2NZ8A 4B3XA 2O5VA 4JLMA 4BLRA 3X1WA 1TAGA 5E4FA 3I3SR 4D0LB 4M22A 4AURA 1P62B 3KJEA 4DHEA 2ASEA 4NCIA 2J9RA 4AIIA 2AR7A 2PBRA 1YE8A 5KSOA 3WNBA 3QXCA 4FW9A 3PR1A 4MKHA 2PL3A 3VU9B 4CW7A 3KKPA 2GILA 1MR3F 5CYOA 2E1RA 4JYBA 3GLFA 5IHPA 4DUGD 3EX7C 4F93B 2FPMA 5HE8A 1XCPA 3NBZC 3THWB 1BOFA 2EYUA 1D5CA 3MWLA 1G291 1UDWA 4MITA 5JLJA 1JALA 3GFPA 1E9DA 1Z0DA 3QEJA 4HAXA 4QHSA 4AYTA 3PIRA 3QSYA 4JSTA 2XOKD 2XITA 5JECA 2Q9AA 4M2LA 1IN6A 4LX0A 2UKDA 3CRQA 3QUSA 5GJBA 4EPTA 5FTNA 2ZJZA 4FMBB 2ZI9A 2FPLA 5B64A 721PA 3FGNA 1KI7A 1ONBA 3A37A 2P0EA 3SFVA 4ZO4A 4MQBA 5DYIA 4TMZA 3REGA 3GLHB 1CXZA 4JBXA 2BKUA 3Q3JB 2FV8A 3AKYA 5KTYA 2EFDB 1KAOA 4HAUA 1GWNA 4LBVA 3LBHA 1E2HA 5DISB 1T3HA 3UMRA 4UXIA 1CULC 2MSEB 8OHMA 3UG6A 3CWQA 4AKIA 2VF7A 4O3MA 2HJGA 4XWAA 5DI3B 1U9IC 1HT2E 5JCPA 4KFTA 5EP1A 1E96A 2CL6X 4OI2A 3GLFE 3W34A 3ZQJA 2WMNB 4LYJA 1KNXA 2XJ9A 4JT4A 3CIOA 2DR3A 3AGQA 4QOSA 1P60A 2AD5A 4LOAA 3BFKA 3LBNA 3SQXA 2P2LA 2V1XA 1R0YA 2O8DA 1BIFA 3KB1A 1KKLA 2HXYA 3RS4A 2ZSFA 1XEXA 1XD9A 2BCGY 2WV9A 3CF0A 2JAQA 4Z8XA 4UQOA 1MH1A 1ZD8A 3DHWC 4RKEA 2RGEA 3OEHD 3U3MA 4Q7LA 3VMFA 3BERA 4CRWB 5FTJA 5KPDA 4L9WA 1SVKA 3NC1C 1MO3A 1VG0B 4ON9A 3CKLA 2XOKA 5EE0A 4D82A 2WAXA 1RRGA 2ZRCA 1W5SA 2FE4A 3HYTA 2ZRPA 4B47A 4R71A 1OFIA 1KHTA 4PAOA 4PHGA 2GVZC 4KU4A 4D2IA 5CYPA 3AVWA 2EWWA 4OI1A 2ZJBA 1GIAA 4QBIA 5J4KA 1F2TB 2JLQA 4I1UA 3VHLB 1NN5A 2QN6A 3NBXX 2J3EA 4Q9KA 3AEZA 1I4TD 3T5GA 1Z3IX 2GBLA 3T1TA 1HE1C 1WE2A 4HZIA 3NTUA 2J46A 4OI4A 5C18A 2D2FA 4C0SA 3X1XA 1KMHB 4Z54A 3R7WB 2G0TA 3PEVA 2RB4A 4URZR 3BJIC 1RPZA 3CRVA 2FF7A 4BLTA 1XU4A 3BAFA 3RRNA 3SS8A 5CLQA 1SKYB 2ZITA 1VG1A 3I32A 4LHVA 4LRWA 2IS1A 4Q48A 1A1VA 1HY3A 2NTYC 2UVQA 4RD4A 5J40A 4DLRA 4EIWA 4MUAA 3IIJA 1NVVR 2BWJA 2PEZA 3IBGA 3OEHA 3UKDA 3VR4A 2IBMA 2HLDD 5B58C 2EU8A 5FPKA 2AHOA 5KU1A 3IILA 4KV9A 4PSKA 2YNMA 3TQFA 1E3MA 1PV4A 1Z0IA 2RGGA 2H8KA 3W5JA 3L82B 3KQHA 4OK6A 2EW1A 4PHHA 4RSGA 4AYXA 4C3ZA 4AKHA 1SQ5A 1G3UA 5L3QB 3AP2A 1TX4B 1XPOA 3CRW1 2J59A 4JLNA 3WRYC 4F91B 1Z5ZA 4YXWA 2JLXA 2KWIA 4DLZA 4NHOA 2OCBA 4EPYA 4TLAA 4G5GA 1W0JD 4RVCA 1YHNA 3GEIA 2R62A 3NVAA 1KSFX 3IQWA 4P31A 5FBRB 1VDZA 3CNNA 4M1SA 1Q22A 1A4RA 1G5TA 1TUIA 2DWOA 3K1JA 4Q00A 1YZNA 4DLUA 4JVLA 3T1OA 5JWHA 3U60B 1US8B 1PJRA 1K5GA 2XZPA 2QM7A 4FCTA 3VR2A 1KSHA 3NWJA 5KDOA 1U2RA 5JEDA 1BYIA 3O8CA 2ZEJA 2VP2A 3SBDA 3SZRA 3TR5A 5LD2B 1FNNA 1OXTA 1XFAA 3LAWA 3OAAA 2FZLA 4AY2A 1KZ7B 5G40A 2C8VA 4L4UA 4DB4A 4LYAA 4CDGA 2ZS9A 3KUDA 1SGWA 1NY5A 4Q02A 3U5ZB 3QXXA 3T34A 1FPMA 2W0SA 4IEEA 4MRSA 1P61B 4F92B 5F9HA 4ACAA 2HLDA 2ZRBA 2OM2A 3ADBA 1VHLA 3ZYCA 3PXGA 421PA 1KMHA 3GEEA 3HP1A 1JAHA 4J0QA 1AIPA 3AF1A 1DAEA 2EFGA 3BB1A 3A1VA 2AN9A 5JS8A 4B3GA 2G0NA 5HCIA 3AVVA 2NG1A 2PCLA 4ZCIA 2FFAA 2HYDA 3CW2A 1N5JA 1Q1EA 5DNYB 5EQTA 2ZYTX 2YOGA 4I81A 4AD8A 3UWKA 2OBMA 2ONJA 2O0KA 4XWOA 4A8JA 1E2QA 2VSOA 3P1JA 4KCGA 4URYR 1XD2B 3JVVA 1W0JA 3U3OA 5DN6D 5EP2A 4OBEA 5DE3A 2WSMA 4OI0A 3ZVRA 4Q4JA 3B8HA 4HAVA 3LQRA 3T35A 3DVLA 4Z51A 4ASUD 1ZM2A 1LV7A 3CLVA 2RMKA 1TF7A 3L0PA 1SVIA 2O8EA 3CWZA 3PG5A 4HAYA 2P6RA 3WXMA 4Q18A 1XX6A 2PH1A 3ZIAD 3BH6A 4Q4HA 5C2JB 3B2EA 3P32A 4E03A 5JHHB 1ESMA 2ZJYA 1KAGA 4CF7A 4MRRA 1GAJA 4P33A 5HTKA 4PC3A 1FTSA 3P26A 2F9LA 1ZNWA 6Q21A 1XEFA 1XJ0A 2J0UB 5CK4A 3ZZ0A 1X6VA 4HSEA 1COWD 1IBRA 3G5UA 3EA5A 2HT6A 4FI3C 2QTHA 4K46A 1XMIA 2HF8A 1G3RA 2FEOA 2VEDA 5FFMA 3ECCA 4YMTA 5L3SA 1US8A 1JXMA 2PZGA 2ZRGA 1MABB 1PVOA 2ZSAA 3ZVLA 1GL6A 1X1SA 2F1RA 3TGPA 3PUYA 4G0NA 2HEIA 2N1BA 4HDCA 1KKMA 2OO7A 1HUQA 4KBFA 5IT5A 4II7A 3KQUA 5JFGA 2BC9A 2FDCA 2GESA 2F43A 4QM7A 5DLQC 4BZQA 2D3WA 3AM1A 2ZYUX 2ZRFA 2WMOB 4DJTA 1N5LA 2O0JA 3EZ7A 2P5SA 1W44A 5C1BA 1UM8A 4M9SA 5TV2A 2IX3A 3WBKA 3EARA 2WOJA 3UXMA 4DSNA 4M9XA 4MDEA 3U3RA 4UJ3A 3K9LA 3C4JA 1D6JA 1UADA 2WWXA 2QM8A 2EVWX 2V54A 2JCSA 4XIGS 2PJZA 4O2LA 1G8PA 2J7PD 1P2SA 4DVGA 3QBTA 5BN4A 4ASUA 4BLPA 1JR3D 3PEYA 3C5CA 3ADDA 2X2FA 2CXXA 1I2MA 4KI0A 2B6HA 3FVQA 1OJLA 3ZIAA 3D7MA 1OYYA 4Q7MB 4ZDWA 1PLJA 3AF4A 4WA7A 4D26A 2BOVA 3RC8A 2EYQA 5E95A 1CIPA 2ZR9A 4PC6A 5HZHA 1CR1A 4PAQA 2WJHA 1XCGB 2PMDA 3TAUA 2G88A 3HDTA 1Z63A 1XD2A 5SZHB 1KK0A 4PR0A 4WXPA 1E79D 2FGKA 5BYKA 1COWA 3U7HB 1JBKA 3CR7A 4OHZA 4KITB 1TF5A 1W0KA 4B35A 2Z43A 3RRZA 5L3VA 4GZMA 3Q72A 2ZM5A 2IF0A 1ZCAA 2EWVA 1TPZA 3Q7QA 4XJXA 1VYTA 4Q9JA 2VYFA 4KVGA 1Z06A 1VG9B 4TMXA 2QMUA 2D4HA 3U7FB 2NIPA 4OHYA 3U4QB 2AKYA 5FR1A 2FU5C 2JLRA 3TUZC 1AJEA 4V0OA 1T5LA 1Q3HA 1JQJC 4M9ZA 2J0UA 3VKHA 1KO5A 1G18A 1XTSA 2XJ4A 1E0SA 3M6AA 4GT1A 4PPQA 3PUVA 3PUZA 2DBYA 2JLUA 2ZTSA 2FSHA 4JLBA 1XEWY 1K6MA 1KO1A 1QHIA 4KAXA 1TADA 4ZIRB 1MABA 3K0AB 1G21E 1BMFD 3CF2A 3LVQE 5D3MA 3TBKA 2J7PA 3LH5A 3TUIC 1JR3A 4LHYA 4XH9B 2V4ZA 2WIBA 2WJJA 3IHLA 4TL6A 4LJYA 4W5HA 4QBHA 4RCZA 1IN7A 1IN4A 2BMFA 1GOTA 1NN1A 2VP6A 3BH7A 1DELA 5CJ2A 4ZDIA 4XVUA 3FTQA 3BWDD 2NPFA 4DDUA 3TSZA 3TKLA 4KSBA 4A36A 1W49A 1SVWA 5JSZB 1QRAA 3GJXC 3GCGA 1AKYA 1E79A 1YZKA 2A7QA 2ZR7A 2WAYA 3WYFA 4E07A 3K53A 4IVQA 5F3WB 1N3BA 1I4DD 2C98A 2YV5A 2DCUA 4C0QC 1E2NA 2BEKA 3NKVA 4F4IA 4TTRA 4TMTA 1SKQA 2QI9C 1G3MA 2ZRKA 4CZ2A 4EKDA 4A0HA 3D3QA 1SHKA 3SEAA 2BM1A 3ZLJA 2P6NA 3K9HA 5JWOA 3KFXA 1N0VC 1P3JA 3TW8B 2QGNA 3VX3A 3KKNA 5E3HA 3KKMA 1KI8A 3CONA 4EJSA 4N0EA 1JR3E 4TL9A 5LB4A 4B2PA 1D8TA 3KXLA 1OKKD 3B1ZA 4HI0E 4BFVA 5DHFA 4DXAA 4LZZA 1I2DA 3T1QA 1NLZA 1V5WA 1YR8A 3DZ8A 2BIFA 3LX5A 3H86A 1AS2A 4Q03A 1GFIA 4KJZA 2QSZA 3GJ5A 4FIDA 1T3SA 1BMFA 3W8RA 2IS4A 1GITA 2Q3HA 1P2VA 4BZPA 3GLGB 3KQKA 4S35A 1G20E 4P4SA 2GHIA 3HU2A 1VPLA 1ETUA 2V9PA 3ICQB 1CJUC 3K09C 1AM4D 5DYGA 2VP5A 4C9BA 3RVBA 4D4LA 2ZQ5A 4TTQA 3GD7A 3RSLA 1QVRA 3BGWA 3OHMA 1E6CA 1AQYA 3H4MA 1UKVY 1U98A 4N3NA 4ZDKA 2V7QD 3OESA 3WYGA 2GCOA 4DB2A 2EQBA 2FX3A 4JMPA 1G8YA 1KDOA 4GFDA 4B76A 2F6RA 4OYHA 3RABA 4C2UA 2OG2A 1KY2A 2AK3A 4FCVA 1F3OA 3IKJA 3K0AA 4ZIRA 3ASZA 2AK2A 3NBYC 2GXSA 2QQ0A 3DO6A 4B3DA 2F1HA 3FWYA 4US1R 1OIWA 4E5UA 1OXUA 2ZANA 4EQ6B 1WBDA 1XPRA 1TQ4A 2QY9A 3AVPA 1L4YA 2RGDA 2MSCB 2VTKA 1NRJB 1DO2A 3T5DA 3FKSA 1XNJA 1NSFA 2IYXA 1J90A 2R6AA 1TF2A 4C0HA 2IYQA 4PZLA 1Z6GA 2QQEA 1G6HA 4M4SA 1X3SA 4WOPA 1XMJA 2IL1A 2XZOA 4KO8A 3AV0B 1NN0A 1NBMA 2GXQA 3MWYW 4BFXA 2QP9X 1L7VC 3A4LA 1IY2A 1DS6A 2CVHA 4QGAA 2VRWA 2DFNA 3AB3A 2DFKB 4BE7B 2QBYB 4ACBA 4TYWA 3GMTA 1U8ZA 1YZLA 2Q9CA 1Y3AA 1G5RA 1PUIA 2AWNA 2YOFA 3BFVA 1ZNYA 3EZ6A 3QKTA 2AWOA 3EZ9A 1EX6A 1WXQA 2W58A 5CLLA 5FL7D 5H68A 1H8ED 4GDFA 1NSTA 1E69A 1XTQA 2YOHA 4NCKA 4RD1A 4NH0A 4XVQA 5GVRA 2V7QA 5JHGB 2JDID 2ZSBA 4KFRA 3THOA 2IYSA 2BDTA 1UEJA 2XSZD 4W5WA 1KIMA 1M7HA 3LD9A 3AUYA 4BRWA 1N6HA 2ZROA 4KLZA 1NJGA 4Q4AA 3VQTA 3QNUA 1KI3A 5K8IA 1S0UA 3E1SA 4JT2A 3IUYA 3TVDA 4L8GA 3DDCA 4TSFD 1NBME 1DBSA 4GMDA 3FHCB 3W9YA 2X8AA 2A2ZA 3U3KA 4BLOA 2GXAA 4PO9A 4QRHA 2G1KA 2ODWA 4YDHB 3TSOA 4AG5A 2N42A 1KI2A 3GLFB 2FMXA 1QHHA 5F98A 1Z0KA 1DAHA 4QGHA 2OFOA 3RS5A 4PZYA 3PITA 3M1IA 1Z0JA 2RGNA 1IY1A 2YINC 3WBJA 4L5BA 4TMKA 3CM0A 1CBUA 3MLEA 4JL6A 5EE5B 4EQ6A 4Z1MD 1VCOA 2ZRDA 3DMDA 4R9UC 1J8MF 5L3RA 3VFDA 2BMJA 2W2VA 2ECKA 4GP6A 4ZKDA 4JJZA 5LBIA 4BLQA 4LUCA 5AJVB 2HJVA 1RZ3A 2JATA 2HUPA 3UANA 2ZJ2A 4LV5B 5FL7A 3A1TA 3K9NA 3GLGE 2P67A 4NZYA 1G6OA 4W7SA 1SVSA 2VF8A 4KFSA 1T8UA 3K0FB 2JLWA 1SVMA 3HJNA 1HH4A 3QPWA 1E4VA 1W4RA 2QE7D 2XSZA 2QBYA 4JLOA 4U02A 4DBLC 4URWR 4XSGA 1OW3B 1ZMXA 3SI7A 4CEIA 3RDPA 2WWYA 1XJQA 1VG8A 1OH7A 4V0LA 4QGFA 4WZBE 3NDBB 3OEED 3C5HA 2WTUA 2WKPA 3QKUA 1N25A 4OKSA 3SDZA 2IEZA 4LJAA 2O8DB 2GEUA 2YZ2A 4F38A 2PJRA 2ODEA 4LSGA 1GUAA 3PQCA 1GTVA 2IT1A 1QBKC 3MD0A 1AA9A 2B7BA 4PO8A 2WICA 5JS7A 3MJHA 4TTPA 2IYUA 3LWNA 2F3RA 2NO0A 3CPHA 2RGBA 4Z1MA 2CHVA 3OF5A 3B1VA 1QVAA 3K0CC 2IYYA 3TH5A 5FBVB 2N46A 3FMIA 3KL4A 4QFMA 3QI2A 4LGMA 2SHKA 1YVDA 3GJ0A 4KODA 1FL9A 3TW4A 3FE2A 1KMQA 4CGZA 3SYKA 1OXXK 1UEIA 3MJRA 3OZXA 2QNRA 4DT1A 2D62A 1N5IA 2QE7A 2DHRA 2V3CC 2H17A 4QC2A 4H1UA 1T3LA 4HB2A 4EFMA 4Q7KA 4CVNA 2QL6A 1FFHA 1VKJA 3QXJA 4NBSA 2GJSA 3MAAC 2LWIA 3QENA 3GJ6A 2WWIA 1ODFA 3OEEA 1G64A 2MMCA 1P5ZB 4JZKA 1N6OA 3EIEA 3I72A 1YRAA 2PMKA 3LW7A 1NKSA 5JWRA 3PEWA 4ZKEA 1KI9A 2CEAA 3K0FA 2WZQA 4JLJA 5EE3A 3EZFA 1W46A 1XTIA 2B92A 4KYUA 4A1FA 3WP1B 3B1WA 2OHFA 4TQAA 2GAOA 4H9GA 2KI5A 5KUTA 3AVXA 3W6OA 4XWKA 1NIPA 3CB4A 1XPUA 3KTAB 4JLPA 4TL8A 4BQSA 2VHQA 4LPSA 3DKPA 3BFXA 4JLVA 4LHZA 3BXZA 2VH5R 4MGKR 4Q9LA 2XB2A 1ZM3A 4PO1A 1OV4A 5AWFC 4AKGA 4IOJA 5CB6A 4PPNA 3MSXA 1G17A 3WRXC 4DUGA 1N2CE 4MYTA 1Q12A 2OSBA 2WHXA 3QOFA 4BFSA 2ZUCA 4US2R 5FPYA 1II0A 1K8RA 5CITA 1U99A 4Q9HA 1OPXA 1S1CA 4LJ6A 1R5OA 4FCWA 4DCTA 2AFIE 4Q5IA 1G1MA 1XTJA 4B48A 4HATA 4A2PA 4OHVA 4X8MA 5GJWC 2CJWB 1TQ2A 3KFVA 3PFIA 3QG5A 1II9A 5TVKA 2WJIA 3RHFA 1J2JA 4HZUA 1G8HA 4YMWA 5FTKA 4C0LA 4C0JA 1NLFA 4JVNA 2PZFA 2OILA 4ZDJA 3IIMA 3AP3A 1U8YA 5FPHA 1S9HA 3F3YA 1JEEA 3TE6A 3O8BA 2QEQA 3EIQA 4FMCB 4PSVA 4YLGA 4YONB 4CIDA 2IXGA 3NG1A 3W5IA 1KSGA 1XXHA 3V00A 4Y0AA 1HTWA 1ZM7A 5IK2D 1ZYUA 4V0KA 2J0QA 4DRZA 4BEBA 4DLXA 4BFWA 1R8SA 2GBLC 2V6IA 3KZ1E 3T15A 1IM2A 2BCJQ 4PQRA 2H18A 4NP6A 1JECA 2ZUBA 3KQLA 5BN5A 3BC1A 1EX7A 1O3YA 1O87A 5J4LA 1NG1A 1LFDB 4HLDA 1WQ1R 5AJZA 5C4MA 4KBGA 4PC7A 2R6CA 1DTSA 1DAGA 3H2YA 4XOIA 3RRYA 2ZSDA 4NYIR 2ZS7A 4U00A 2IWHA 4A8JB 1M2OB 2OESA 3QKSB 3V9PA 1DVRA 1ELOA 2NZJA 2CK3D 1AQUA 821PA 2ZRIA 4PPGA 1UPTA 4RZ3A 2XAUA 5KSPA 4Q4JB 3HYRA 4C0BA 1OB2A 1N0WA 4DLWA 3Q85A 2CCJA 4Q1FA 3ETLA 3KTAA 2O8EB 2IC5A 4LV6A 4OHXA 5JZVA 4BUJA 2WBLC 3E2IA 3U3JA 1XXHE 3NEJA 4Q4HB 1UF9A 4BZXA 1U94A 3REFA 2DFLA 4PQFA 3OIVA 4GSYA 3ZDQA 3FOZA 3NXSA 1A2BA 1QZXA 3FHTA 1E0KA 3O8DA 4OL0A 4D4MA 1VTKA 4Q1BA 2NO1A 3FFBA 4PPFA 2J0SA 4B6FA 2G3YA 2YWFA 3RRMA 1IJFA 2IYVA 1S2MA 2YC2C 5GJCA 4HB3A 4DWJA 4LJ8A 1IY0A 2P5TB 2QT1A 3V4RA 5L3SB 1YRBA 2ZJ5A 4WAUA 3KXKA 3CX6A 1AGRA 4OQFA 1GDDA 3QXSA 2CJWA 3DM9B 4M1WA 3UG7A 3A1SA 1EESA 2FH5B 1W47A 5K8LA 5FI0B 2F43B 3R20A 2CCKA 4RFSA 4JL5A 4IOLA 1E32A 1ESNA 4DCUA 1OSNA 4S2EA 4IJMA 1Q3TA 2GNOA 3IEUA 4HYYA 4I4LA 3T61A 1SXJD 3KJGA 2RGAA 3J81k 1WA5A 2CK3A 4F4JA 1VIYA 4BLSA 2B7CA 2O8FA 3CX7A 2E9SA 1ANKA 2ZPTX 4TLEA 3OIUA 4LBYA 1KK2A 1Z8FA 4TYPA 2ORWA 4EPXA 2CDNA 1WCV1 2FEMA 4V03A 4QKQA 3KKQA 2GAAA 3W6NA 4E09A 2C99A 4UNSA 1OH6A 3U7GA 2ZI5A 2QG6A 3TLXA 3UK6A 5FOXA 5FUYA 3QKSA 1RC8A 3QBVA 1FOEB 4ESVA 1NVWQ 2JJ1D 1DADA 1UJ2A 2OFXA 2ZREA 2ZE6A 2QAGA 4A8JC 1M34E 4P0TA 2CCGA 1NF3A 4JBWA 2IYLD 5A0FA 3PUWA 3SJCA 3K70D 2GCNA 3SYNA 2CHQA 4PFSA 1FTNA 2HV8A 3CNLA 1XD8A 1YU9A 4TL7A 5SZKB 4MKIA 4BEJA 2AX4A 1CJKC 5B2ZA 3B5JA 2VSXA 3DPUA 3GFOA 4LDJA 1P6XA 1RIFA 1ZJ6A 2CBZA 2IS2A 3FMOB 4A0GA 1FUKA 1QG4A 1G8GA 2JLYA 4B2LA 1X86B 3X1ZA 1UAAA 1DARA 2Z4SA 5D3MB 2G6BA 1W4CA 2W0MA 1M6NA 2ODBA 3CRMA 3IPYA 3BB3A 1RKBA 1EFHA 4IRUB 4LV8B 4MA4A 5FL3A 1TQ6A 2NO7A 2REBA 5AJWA 3JVUA 1TMKA 2QTVB 1LVGA 2Y8EA 5LD2C 4CEJA 3ONWA 4JIMA 2ZJOA 4RD2A 3A58B 1D2NA 4CT5A 2D74A 1OH5A 1EFUA 4Q21A 2JJ1A 5DN6A 3QJYA 1JJVA 5JRJA 1G7TA 3MUFA 1D2EA 2H5EA 1P2UA 5HCNA 1E4YA 2A5YB 1R2QA 2IUUA 2QROA 4TWZA 1W36D 5GJVC 3GJ8A 2NO6A 1CRPA 4RJLA 2CLSA 3OFND 2XEXA 2A5GA 5E7MA 2C9YA 1JQLB 1XMSA 4QM6A 4KFUA 5EXPA 3GJ4A 1IONA 1XF9A 4NE2A 5DI9A 3U6BA 2REOA 5SZIA 5ELXA 1BYUA 2WPDD 3IBYA 5CDFA 3I61A 1W4BA 2GZDA 4DDWA 1JEDA 1Z2AA 2ORIA 2WWWA 4UNRA 1P2TA 1T8TA 4KYIB 2H16A 3GQBA 5P21A 4EJSB 2RGCA 5FTMA 3MFYA 3B9PA 4G01B 4BFTA 4GMXA 2ZVQX 2HF9A 1EFRD 2BJVA 1UKZA 2QZ4A 4FN5A 2J0VA 4EUNA 4ERNA 4RY2A 2QPTA 1MO4A 1A2KC 4LWZA 2OZEA 4B44A 5CK5A 1DE0A 1NMYA 1WBBA 4X8LA 3D8BA 1EGAA 4IDHA 4Q66C 4YC7A 2Z83A 2ZRNA 1VYVA 4D0GA 2WJVA 4P4SB 1OFUX 2G1JA 4DC9A 1UFQA 4DLYA 1KI4A 3LX8A 5KNCA 1Z47A 3MWKA 4DCVA 3UPUA 3LA6A 4DSUA 2GWHA 2A5JA 4FMCF 1AZTA 2GCOB 3L0OA 2G83A 5CDFE 2VLIA 1EK0A 3QY0A 1Z0FA 1HT1E 2A3RA 2BBSA 3C8UA 4GBMA 2IXFA 3PUXA 1P75A 1P73A 4NL4H 1JI0A 1S96A 4LYFA 4BFUA 4AG6A 1GL7A 4AC9A 4EFNA 1IAQA 4Y0VA 4JVMA 3IO3A 1LW7A 2AFHE 3RC3A 1AZSC 1PUJA 1SZPA 1KDPA 2DWQA 4Q19A 4IVRA 1VECA 3A4NA 5SZJA 4A0RA 4DIEA 1YZGA 1R7RA 2ZI3A 3B7GA 2O8BB 1EFRA 1GL9B 3QE0A 4C4PA 4ZCLA 1CLUA 1E1RD 4US0R 1QG2A 4MGYR 3B85A 4QHYA 3Q8XB 1HURA 3EIHA 3TSWA 1DEKA 1FP6A 2GCPA 3MG9A 4QNRA 4WZ6A 2J1LA 3HPQA 3I62A 3X2SA 1G7RA 4D4KA 5B30A 1T9HA 4B33A 1D2MA 3LQQA 1ZD9A 1NJFA 4GP7A 2FPKA 1KDRA 3BH0A 3FKQA 2QP4A 2R2AA 3I1FA 4DDTA 4WW0A 1CF4A 2PLFA 1OXVA 3THXA 3DZDA 3RS3A 1ZCBA 1M7GA 3HU1A 3Q7PA 5DO9A 4M53A 4XTCS 2Q6TA 3ND8A 4EJSC 2OBLA 3GFTA 4NCHA 3O8RA 2NQ2C 5JBQA 1L8QA 3AKCA 3L0SA 3N5CA 4IDNA 4Q4AB 1G4AE 4NCNA 3L2OB 3ZD6A 2QTFA 2WJYA 4HUQA 4EPRA 3W90A 2C2HA 5ANRB 1XBTA 1G16A 1X1RA 2TMKA 4LK2A 2W2XA 1T0JB 3U44B 2QAJA 4MUBA 2FG5A 4TMVA 5KHOC 5TMPA 1T4GA 1U0LA 4DLTA 5BXQC 3VHXA 1ZRHA 5JI3E 1TTTA 4W5JA 1Q1BA 4WXRA 1QHHB 3LO5A 4UNPA 1HE8B 2RCNA 5H70A 4O25A 1OE0A 1CS4C 4LJ5A 2RHMA 1WP9A 5FPTA 4LHWA 1FZQA 4Z8YA 1E1RA 5KNDA 1XWIA 1Q21A 3IPXA 3ZS8A 5BYJA 3V4FA 4GL2A 2RHDA 4PXAA 1CR4A 1E99A 4DEXA 2OEPA 3RS7A 4ESHA 3FFAA 1LS1A 1XTRA 2NPIA 2KBFA 2P6UA 2ZE7A 5BQ5A 1R5NA 4A4DA 3IGFA 2O8BA 5KYKA 1GSIA 4I1OA 1OKKA 3FYHA 1ZD1A 3SOPA 3WMFA 3NBFA 4NYJQ 3D6TB 1Q57A 1XRJA 4JYCA 2WJGA 3QQ5A 1G41A 2WWHA 1TL7C 2R6FA 3CNOA 1NKTA 2GEDA 4WIAA 2CLDX 4IKEA 3U6KA 4TQUS 4QJ4A 2VHTA 4CEIB 4AKEA 2JJ2D 3AVQA 4B75A 5IDVA 1IJEA 1YZTA 3BOSA 1Q1QA 2Q0HA 2YVUA 3NEYA 3VR6A 2ZRLA 3AVOA 2LCFA 1OYWA 4TLDA 4NDZA 5FI1B 2OXRA 1IXSB 3RNLA 4URXR 4D6PA 4KHZA 3VNVA 1W4AA 1N6PA 4IDOA 1Z6XA 5EE1A 2K5UA 5EUMA 1PLKA 1OF1A 1R4AA 2W6JD 3C14C 2FSGA 2VP0A 1E94E 4B74A 5BN3A 2GETA 1FUUA 3SYLA 4WBSA 4TMWA 1AS0A 1J99A 3GP8A 4HLQB 3QEOA 5FOWA 1CP2A 2WWFA 4Q4LA 4DCNA 2KE5A 4BASA 2QORA 1Q20A 3K9GA 2ZR0A 5LPNA 1MOZA 3BRWD 4RZUA 5A4JA 3U44A 1OH8A 3X1DA 1VCMA 3I8XA 2YWGA 4PC2A 1NVXQ 2JLVA 1YR6A 3SBEA 2JIZD 1RE0A 2VQSA 2FFHA 2GRJA 5FBLB 2B21A 3BK7A 5FUXA 3NHBA 3ZH9B 1F2UA 1ZINA 2REXB 4I1SA 4PX9A 3B9QA 3R8CA 1FP7A 3K0SA 3VR5A 1RJ9A 4DT1B 3RWOA 3GLIA 4IVPA 5GADl 2CHGA 1C9KA 2EFHB 2R9VA 4FMDB 4I1VA 4EAQA 1TEVA 4MRVA 2IWRA 5JJIA 1CJVC 4JL8A 3CZPA 5FUVA 4WZAE 3ADCA 2QT0A 3GPLA 2JJ2A 1FMLA 2VHJA 2RGNC 1D9XA 4KLNA 4A15A 3FHOA 4YMUA 1CRQA 1P72A 2PT7A 3TAHA 2GKSA 2GF0A 1J8YF 1Z6YA 1S8FA 3R8FA 1H8EA 1IHUA
chains in the Genus database with same CATH superfamily
2KBEA 1QKKA 2YY6A 3SC3A 5TGTA 2ZIZA 4IIYA 2QGZA 3GLTA 1ZZEA 2PS1A 2W6JA 5M2QA 3GT4A 4YEDA 2EF0A 2PT9A 2WV7A 1I4LD 5G53C 5B12A 3WLQA 1SWVA 1VFPA 5IPFA 3JRXA 4DVJA 1MDBA 3FWKA 5A7HA 1T4CB 3IO5A 4AF8A 5JJ5A 2EG5A 4HZGA 3PK0A 3N53A 5KNBD 1PJAA 1QP0A 1UBJS 4Q3LA 4XUCA 4Z9YA 2O7VA 4COOA 1EJ0A 5FLYA 1FZTA 1PQUA 2Z9CA 3PRHA 3KQNA 5E1BA 2BBTA 3BB4A 5GVSA 4H15A 4XA8A 1DRJA 4F9TA 5E1DA 4JITA 1K5HA 3PGLA 3T0FA 3V7WA 1N8KA 5KWJA 1LC0A 4FHDA 4Z4FA 3LUAA 4GLJA 2AXQA 3G2NA 5EXSA 3OJLA 1DQNA 4Y1FA 5JAIA 3HA2A 4RD6A 1EWRA 3BORA 4DCOA 3D1VA 4TV9F 4YAUA 1YQTA 2F7SA 3HLKA 3U3DA 3JSAA 2VYND 2OAGA 2SICE 3G23A 4X1KA 2YS7A 4DQUA 3GHHA 1NUPA 1JYSA 1PAUA 2P65A 1ICEA 1P0IA 1E6UA 1H2XA 2OG1A 4GOND 2R1ZA 4CLHA 4E15A 2W4QA 3T3IA 1Y8AA 1M54A 3P27A 4EX7A 3SJAA 3ZWMA 4MIKA 3ZK7A 5EXEA 3TI9A 3VKWA 4CLDA 1D4FA 1E2IA 3CLUC 3OFJA 5CLIA 3GAFA 1SBIA 3WGLA 4AROA 5HKKD 4ZANA 1Z2CA 3CF4G 2E5LB 1JQ3A 1O7JA 1TCAA 1WCIB 1OIXA 5AW1A 1U7TA 2VXOA 1LFAA 3AOEA 3N2LA 3WIBA 3TR6A 3HNOA 3AFHA 1GHTA 1M1YE 1VHWA 1EFTA 4A0FA 4BNNA 2QTNA 4F9EA 2QOEA 2IA5A 3WQSB 2IUSA 2ZYHA 1RM0A 2GJ9A 3GD5A 1IQUA 1T9GS 2CJYA 1J9EA 5CLHA 1YKSA 2QZPA 2V96A 1G3IA 1GTMA 1J24A 1D2CA 3CX3A 5FV4A 2A8YA 5LDDC 3HVRA 2AZ4A 4COKA 2QMOA 3TW0A 2P1ZA 4PAWA 2XNSA 1OI2A 5H3CA 5F9FA 1XZPA 3T7IA 4GM0A 2NSHA 2Q8NA 3IAEA 2OGUA 4MVJD 3PEUA 3E2MA 4OV6B 5J2UF 3ZD7A 1M2VA 2NUTA 1WB6A 2Q21A 5ADUS 4JODA 2I65A 2QRVA 3WV4A 2PGAA 5JZOA 2V7XA 1B8PA 1N2HA 1U3DA 2BBWA 3NH6A 4L4ZA 3P7MA 4NBKA 3CZCA 3QZUA 4E1BA 4DIDA 1A71A 1C1DB 4RZ2A 5IYZA 4R3WA 2FSVC 5CM9C 2UYHA 4K9SA 1CJTC 1JQKA 2Q4DA 4KVFA 5SYAA 1K06A 4URUR 5LQAA 1XDZA 2G9QA 2VR1A 3BWMA 3EG9B 4NY1A 2DSNA 3PX2A 3R9WA 1TW3A 2BY4A 3OZDA 4ZXPA 1XN1A 1W2GA 4P4LA 1WKVA 1YL5A 2V8OA 1T13A 3UB2A 2WHYA 4QT0A 3OQBA 2AZMA 5SY4A 2I6GA 3AEKA 4O59O 3LCVB 1LU9A 4DY4A 5JZSA 4EUKA 3TD9A 4KSCA 3RJ5A 4X66B 3L07A 2PUEA 1QC5B 1R3UA 1CZHA 2OV2A 4JSYA 5TT1A 1QYCA 2BE7A 1DRUA 2VKQA 1Z2OX 3B3QA 4CR6A 4F1KA 2A9PA 4FFWA 5DSZA 5EXTA 2H4XA 1DLIA 1XQYA 1A95A 2FJUA 3F46A 3A3PA 3OOJA 4IUCS 4KR9A 3ED1A 2YN0A 4OHKA 3PXDA 3FN4A 2FJPA 1GZ3A 5DNEA 3AI1A 3INTA 4GVPA 5EJIA 3TLAA 4HV4A 3E18A 2VHUA 3RCBA 3RYHA 3AYZB 1JEOA 1F0YA 2XVYA 3MRXA 3KV1A 2QRUA 4BX2A 1ULUA 1B7GO 1E6KA 2DHDA 1SJ9A 3VO1A 3QG1A 4XGRA 3QTBA 1GTL1 3H4IA 1T1GA 5K9ZA 1O95C 5YASA 2KYRA 4NATA 1N6NA 2Z4RA 3BBLA 1SY7A 1CT9A 4HQNA 5FULA 1ZXBA 1G7CA 1E3TA 1DXYA 1I01A 1QORA 3LVFO 2XB9A 4Y2UA 1VMIA 2OHVA 4L50A 2ZZKA 2H1CA 1KIAA 5BWOA 4QYMA 3CO5A 3EG5A 5U4QA 2PGNA 3CTPA 4YRTA 4AY4A 2PUBA 5BR1A 4I1YA 3DMTA 2YJZA 4WBNB 1UPFA 2WOOA 3WJAA 5HJ5A 2FQYA 4BMXA 1M34B 3NNDA 1LBHA 4KQCA 4RKRA 4B6RA 1VGQA 3P19A 3CH4B 3CIFA 1BCSA 1XSEA 2HQSA 3W2IA 2YN2A 3DF7A 4YUYA 4RPLA 3RTCA 5E7QA 3F1LA 3HPRA 3ZQUA 2UUBB 1CDOA 2J3IA 5AK5A 3N5KA 2B25A 1P2BA 1V43A 2OBNA 1O6ZA 2VDOB 1OU4A 2X9GA 1NQWA 3TOCA 4LCBA 1A0OA 3FZGA 1QS0A 1YR7A 2BUAA 1N32B 2YN4A 2IXDA 3D4LA 4LPKA 2OCGA 3QU2A 16PKA 2BFDB 3KUCA 4V3BA 1IHOA 3VU9A 1PIWA 1BH2A 3L8FA 3DAOA 3OY7A 4MULA 3B6IA 3SN6A 2CLOB 3IA2A 3UOGA 1FJHA 4A2WA 1MPTA 3THWA 4EG3A 2HNAA 2ISQA 5CBKA 4ZI3A 5LXTA 3TRJA 1OLOA 1W9MA 3M49A 4YRCA 4O2AA 4FVTA 4UTOA 1FJXA 4OG2A 1RHRA 1RMQA 1C30A 4E3ZA 2EFEB 4AIRA 1FFXB 4AJOA 2IKSA 1KQFA 3LY9A 1GZUA 1RWQA 4HS9A 4DMUB 3MGCA 2Q2QA 4XUDA 1MRSA 2RGYA 3LPCA 3Q5EA 3ZGLA 4UOZA 4G4SP 1UBMS 4JUBA 5KYUB 1B0AA 1WDLA 1U2TA 1QPZA 3BBPA 3MK31 1Z28A 1QQAA 3KXDA 4GOJA 4C5CA 3M34A 4PG7A 2WFAA 3HCOA 3NWPA 3AEQB 3QITA 1IDOA 2JFPA 4BCCA 1CR0A 1GGEA 4RF3A 4ZYTA 621PA 3GLHA 5AJYA 4OBWA 3TM5A 4B34A 2LDBA 3C41J 4D9FA 4S1VA 4DZZA 1I1NA 1U6JA 3DL2A 4Y2JA 1FNCA 2JB9A 3QLTA 2DY1A 1C4KA 1PL6A 2JFXA 1UANA 3VUEA 3ZUPA 3C85A 5DI3A 5LBTA 1O6BA 1PHRA 4HDNA 2IYWA 1PS8A 1KPGA 4U7GA 2C77A 2J6CA 3V80A 4ENRA 4B32A 1EH5A 5CB8A 2HJSA 2VNHA 1KTIA 4BKOA 1XQXA 2D1FA 2QW1A 1N3YA 3Q6NA 3EQZA 4Y6RA 5HR5A 3T9EA 2N3ZA 2HA0A 3K0EA 5FNVA 4YYZA 2PLWA 4DR2B 1K7FB 3H1FA 1M10A 1P4HA 3QK7A 1TQ8A 2AGVA 2IHYA 2R65A 2G5GX 1QLJA 1R6TA 1PWXA 1TJPB 5D51S 1A82A 5DVZA 4A16A 2Q1SA 3QXGA 1JW9B 2Q5CA 1X19A 4WSOA 2FEPA 4ME6A 4NV3A 5IG2A 1ZNXA 3FYDA 3U4IA 1W52X 3B6MA 4MO2A 5K8TA 3VKGA 4HDOB 1F5NA 3GU3A 3PGMA 1WNTA 4CEJB 4FYPA 1GKIA 4GPTA 4N0QA 4WINA 2AMJA 1NC1A 5CLJA 2ZTHA 1MIOB 2XB4A 4LTDA 3HSKA 1E5DA 4Q12A 5JD5A 4FC6A 1U3VA 3G6KA 3VSCA 4NFYA 3O1IC 5GM1A 4IZOA 2X2EA 2RAUA 5H8WA 3IQHX 1M7BA 1SIOA 2AKAB 2AUNA 1P77A 3NAGA 1XHFA 1YQXA 4JR2A 3V4LA 3BWXA 4E08A 4JEHA 3RK1A 3WLOA 3ZX4A 4BGEA 1QJ4A 2C5GA 1TEXA 2BSXA 3PX3A 5A2GA 4BNDA 2IXEA 4WLEA 1RYHA 2G63A 5HFNA 2QMZA 4IXWA 4ZAXA 1VLJA 3A6GA 4BE9A 2H2FA 2W9XA 2F1OA 3NALA 4QEZA 4RAOA 4OJQA 5TJ9A 3DCJA 3CZ4A 1PR2A 4IFBA 3FKJA 4IWXA 1XMVA 3IVGA 1XA4A 2AXPA 4CYMA 4GAEA 1EWYA 5J9FA 4RPIA 1H1LB 1AQJA 4BLWA 2ZIAA 2B78A 2FW0A 2YXEA 4M1TA 4GS5A 4PAGA 5FOSA 5CG2A 4BZWA 2XZLA 1EGHA 2UYOA 3AH8A 3VDRA 1VHTA 3DV9A 3T06B 1VKZA 3S68A 3S4YA 2GK3A 1BJKA 5LOVA 4DV1B 2VHEA 3EXEA 1A5TA 1HL3A 2BLLA 2Q2WA 4E88A 4QUDA 4ARVA 5LQUA 2CMKA 1N8SA 2IYRA 2VS1A 4F84A 2X4GA 4HDKA 4TYYA 1C7JA 4MHSA 3Q7EA 3SC2A 2UV8A 1RI3A 2X1VA 2JC3A 4FD3A 1ADGA 1KETA 1X7ZA 2EKZA 4TZKA 5HRAA 3H8VA 2OO5C 3MJEA 4MVJI 4NJEA 1SKMA 2P9QA 2ZJFA 3B5IA 1CVIA 5AR1A 1MN6A 3LBAA 3Q3EA 3L7LA 1UPAA 3S1AB 2C5LA 2XCOA 4F7WA 4UOEA 4DILA 1NLYA 4DMLA 1SPXA 2BEUB 2YWEA 1W1IA 4QXQA 3PCRB 4X95A 3WLLA 2ZXUA 3JRWA 3ZVKA 4ND3A 4ETWA 3W5UA 5BWLA 5EMMA 3NGMA 1FFBA 1Z4JA 3KQSA 3LNCA 4ID3A 4QFDA 3ZZTA 4J49A 3NNNA 4EZBA 3HCNA 1JEAA 3KO8A 5CVJA 1O94C 1YZ3A 3OMXA 2OLJA 4CLEA 4J94A 5AHRA 4B3BA 4J4HA 2WMYA 1JVBA 3ZHRA 3EPHA 3IUMA 4D57A 4RETA 2GJ8A 4F7DA 5IF3A 2HDWA 2G70A 5IUKC 1JSZA 2BJHA 2A9OA 5DX1A 1GRNA 4KXQA 2COUA 4LVCA 3E9EA 1E2EA 3NTVA 4N65A 1PO7A 2AC7A 3L8EA 4M0LA 4L78A 3N6RA 4YGYA 4K86A 4B87A 3ER9A 2PWZA 1A5AB 1OXSC 4IHQA 4C7OA 3LVRE 3KETA 3QPBA 4XCXA 5F7JA 2KLHA 2LCQA 1NNEA 3UC5A 3KOZA 2JEOA 2FFQA 2ZJ8A 3GMDA 4PHFA 1TVKB 3UFXB 1SURA 4FNOA 4D5GA 1YJ8A 2ZRMA 5LBUA 1PL7A 4BMSA 1RBMA 1S2IA 1DG1G 1VSBA 2WILA 2WYVA 3MJFA 3DW1X 1J56A 3NTOA 5TPWB 3D7NA 1ZAKA 1EXWA 2ERYA 3M4XA 3UAZA 3WSTA 1KY3A 4TLBA 2WHEA 5C1DA 1IL0A 4DV7B 1OB5A 1SELA 1SXJE 4UHEA 4A26A 4CTNA 5A5DA 121PA 2PX3A 3TLGB 1Z6TA 2CNWD 2E5WA 2O2HA 5B3LA 4J0EA 2YY5A 3OZFA 1CF2O 4CTOA 5EIWA 3SMVA 4DBVO 1UT5A 1FP4A 1EUQA 3ZXUB 2XB8A 3ZY2A 3HJGA 1EB9A 1XHLA 3RANA 3ETHA 3NZEA 4L4RA 1WMDA 1V5GA 5HZKA 2P2YA 3AEXA 3TMAA 2B94A 1GUBA 4L74A 4FWTA 1Y3FE 1ORTA 2HCBA 1TJ4A 1KDTA 2PGJA 3SPXA 2XUGA 3HXKA 2M1ZA 3V9AA 3BGSA 1VCIA 3AXTA 2BI4A 2HHHB 2ATXA 5JMWA 2BFEB 1E7SA 3IFSA 2C8KA 4DIOA 2PT5A 4HUQB 1EFPA 2WW8A 3FDZB 3GJSA 2BI8A 4O4HB 1GFZA 2ZAGA 1K7CA 3MWDA 1NY6A 2GKGA 5B5SA 1IFXA 3ZWPA 2I29A 2DPMA 4WBNF 1CY7A 1C1XA 3AKDA 4B4DA 4MV6A 5J59A 3VUFA 3WHLA 2DBRA 3ZBPA 3D02A 3STUA 4A8HA 3UH0A 2ZAOA 5DW0A 4I8DA 4JXJA 4P82A 1P39A 4IS3A 4YMSA 2RHWA 3VVCA 2YWRA 2B4RO 5ARBA 5CPBA 3WX0A 3CCCA 3KPUA 4XARA 1CZKA 1NZJA 2ZUDA 1ZNZA 3NM5A 4KTVE 4LYHA 2AMLA 4Y6GB 4DQXA 2WG0A 1Y9AA 4UBOA 2VP9A 4RE5A 3KSBC 3GLUA 1DPGA 3G2LA 3JYOA 5IMBA 1LDGA 1IVNA 1GAQA 1NAHA 3OJ0A 2J3LA 2NTJA 4KQJA 1MOPA 1Y9DA 5JDCC 3T7DA 1PW7A 1E0AA 1VI2A 3GZ4A 4R9NA 1DAOA 4ETMA 2X0RA 3WGTA 2WMDA 1IEWA 3R4CA 5A06A 1JXAA 2WPDA 4URVR 2GVNA 4O08A 4PIMA 2QZZA 1EUCB 1VE3A 1Z08A 2D8AA 2BMDA 3DEJA 3N86A 4YY3B 4MWGA 1PQYA 4P34A 3DLAA 1PJ4A 2R96A 3KXIA 3FHLA 1I14A 1EM8A 2HCTA 3BPSA 4MH0R 3CGWA 2PRKA 4V0MA 1FLNA 3JAKB 1GNPA 4EG8A 1AC5A 5TDHA 2G72A 3LG2A 1RIIA 3T7KA 2ZT6A 3KJHA 1AKVA 2NXCA 3D43A 3P9XA 3PENA 4BNKA 2XNKA 4IHKA 4NBNA 2RHCA 3PDIB 3HCAA 2ZVPX 4FWIB 4M8LA 2X1MA 3DC2A 2C9OA 1KO8A 1ZIPA 2PKCA 4HNGA 4IIJA 2J41A 3MMXA 1A5ZA 4KK3A 1G60A 4XYGA 2OP1A 2DG2A 3LRPA 4BFYA 1V1MA 1XZAA 1W2HA 4JBHA 4D92A 4YMGA 1N0UA 2I6FA 2B8WA 1WABA 4JENA 3CUUA 5FPSA 5FR2A 4LWPA 1GPAA 3UWDA 2R6DA 3ROKA 4TLCA 4TT3D 3L8MA 1UXHA 2YYSA 3QKRA 3VO2A 2EAUA 1GZDA 3WMRA 4RTKA 4TV8B 4IZHA 2G9NA 1GQRA 3K71B 4CDRA 2FFBA 5KYVA 1P9OA 5CA1B 2HGSA 4CIAA 1VRCA 1O6CA 5KNCH 1C9EA 1E9BA 4FR5A 4LZLA 4F21A 3UQZA 3NPAA 4O3FA 5HPYB 3HR4A 1PD1A 5LL6P 2AOTA 3LXXA 4RSHA 3L79A 1SIBE 2KS6A 4MAFA 2IW1A 1A9RA 3B1XA 5H1YA 4AJPA 1D7AA 2H00A 4Y9DA 2AJTA 4OJMX 4R1QA 1U5BA 1JKJB 3SSMA 1T26A 3E7DA 1E2JA 4EHLA 4QFBA 2NVWA 2WIKA 4TWAA 1BXRA 4G1UC 5CB4A 2W2MA 2UVPA 4AP9A 5JJLA 4EPRA 3LK7A 1OOEA 1OC2A 4RMJA 1M74A 4D56A 3B8EA 2VIIA 3T54A 4WXEA 2W83A 1LSUA 2Z6QA 1AA6A 4LKOA 3RG2A 4CM4B 2VNAA 3AUTA 3ZCVA 4MW6A 3K09A 3W2GA 2G0AA 2X22A 3RQSA 3OT1B 4PANA 3GLIB 1ZOSA 5C5DA 2QRPA 3LQ1A 2J0EA 2BBOA 4R05A 2D06A 1UJMA 1YDMA 2I6SA 4K2HA 3TI7A 1E4EA 1RW4A 1H66A 2C9CA 3FNGA 3P9IA 5EE9A 4HXYA 3I8SA 2PS9A 1TA0A 4YP7A 5FUWA 4ZQFA 2R8PA 1HYHA 4NYJR 4JI1B 3SHWA 3SFTA 2DKOA 3LC2O 1QWOA 3LYUA 2ORVA 3JY6A 4YECA 5K4AA 5THXA 2BGGA 3GJ7A 3MBOA 3QOYA 4BV9A 1VYHA 1K2VN 4NMHA 1EVIA 3D81A 2EL9A 3QNWA 2C1ZA 1Z4IA 5F7ZA 4C6SA 1RD4A 1VL0A 1R10A 3OWOA 3G8DA 2DX7A 4DDVA 1CQPA 2VDUE 3B1YA 3M2TA 2NMVA 1FFAA 4MW4A 3B36A 2EV9A 3GA5A 2FN4A 1BD3A 1Y3CE 4J75A 4EDHA 1WF3A 4Y9SA 1SXQA 1T1RA 3K92A 5JROA 1QAMA 2GTIA 4QU8A 3UK2A 2JLBA 4LE2A 1ONNA 2QUAA 2OYCA 3DZJA 3EVFA 3K31A 3ASYA 1TE2A 3JQQA 5LU8A 3EGVA 1GU0A 1W5FA 5LLTA 1DQZA 3N2IA 4P3YA 4R1UA 3OX2A 3FBWA 3R44A 1HV8A 4N5IX 2PZEA 4OM7A 2C3UA 4F9GA 4NU6A 4AZ0A 4Z1OA 1HG1A 4M7RA 1KO4A 3AX6A 4EKYA 2WSSD 3LQ2A 1RRMA 2WM9B 3A1DA 1WD7A 1T36B 5DGXA 5K3AA 5C0OE 1GDTA 2G77B 2NV0A 1MV5A 2BUCA 2P4UA 3A4IA 4L02A 4NE9A 4UCXA 3VR1A 2YQ4A 3L1JA 2IU3A 3TQCA 1FVHA 1PFQA 2D2EA 2WP0A 3MRVA 5DLEA 3JZMA 4N49A 3KZMA 2FUKA 2LBPA 2J6BA 2ASVA 2OCAA 3A11A 1N5MA 3DB2A 3HBAA 3KSRA 4HB4A 4TSKA 4EFLA 1ZBDA 1R0XA 4PAMA 4EQZA 3EH2A 3SE0A 4LHXA 4HGNA 4PYNA 4X1KB 1JEYB 1I10A 1Q6YA 3H3FA 3THYA 2CXNA 3T3NA 4IO0A 3NEPX 1AKNA 4Y1GA 5CT9A 1P1KA 1NDQA 4F5WA 3JYNA 1KI6A 3DM5A 3BGDA 3NDJA 4HGRA 1TI7A 4UHFA 2OFPA 1O08A 1MB4A 4ND2A 1DJMA 4ROTA 1XKQA 2PWYA 3H2BA 4IEIA 2JAWA 1P1FA 3D64A 4NDAA 4ZT5A 1WD5A 3W8DA 1KEPA 3RSGA 5J58A 1MKYA 2VA8A 2VBCA 3K8OE 4KE8A 1LA2A 2XYHA 5KDDA 3KDSE 2NZYA 3FB4A 3LP6A 3B60A 1Z88A 1MNQA 2HBQA 3OZSA 4FS8A 1E7RA 2FCRA 4I3GA 1C3EA 4L08A 4OQNA 2OZVA 3PDUA 5A9RA 1JPNA 2JASA 2VRCD 1CIJA 3GA0A 2IVZA 3LT4A 4HN4B 1UUFA 4XOUA 3T5CA 4AYWA 4RVNA 5IUJC 1CJSA 2W2LA 1II8A 3EGWA 4XSHA 4GI7A 1QYXA 4BDTA 3TUJC 3LI2A 3MCTA 3ROXA 1KI1A 4UBKA 1KZ9A 4B6SA 2FOLA 1CR2A 3BKXA 3N76A 1ZAYA 3CUYA 3C15C 2YWHA 2AN4A 3V6LA 2ILVA 1XTKA 1N8NA 1E2FA 1U0RA 5ALUA 5EUQB 3FM9A 4KJXA 5GMOA 1JMKC 4Q01A 1SCBA 3BXOA 4IOKA 4RCYA 2YXBA 4ZOLB 5E0KB 4POOA 3L46A 2X2PA 1ADCA 1UFRA 1H5UA 1V95A 1Q83A 1YS6A 2OV4A 1B3RA 2PKRA 3HY3A 4U7JA 1EG7A 1Z16A 2AOWA 1ZH0A 3C6KA 4HH0A 3UJ6A 3ZLTA 4DLNA 5IYZB 2KB0A 2OWDA 5HRCA 3QVUA 1C7EA 1XKLA 2FZGA 1W93A 3T6KA 3EYWA 1TYAE 5FO0A 3IEKA 5FPPA 2JBHA 2X77A 2WNHA 4UASA 4OFWA 5COBA 4NK5A 1NQAO 4PRYA 2FZEA 1DTEA 3A1CA 4MOWA 3ICEA 3AERB 1ZKMA 3OQOA 2JNWA 3CH6A 3H84A 3QI7A 2PXXA 4FFRA 2HJ9A 2QNIA 2RHGB 4GZLA 4O4HF 4X3CA 3RLFA 4YRZA 1E6LA 1H85A 4B43A 1XCMA 3VNAA 3LTNC 2L2QA 4DR1B 1ABBA 1VJCA 4IICA 1NVUQ 3O7MA 2WTEA 3KEOA 3LCUA 4EO9A 1AN0A 1QIMA 5DM2A 1SQFA 5F52A 1GPDG 1QHXA 3ZYZA 2AQKA 5FP0A 1M5RA 4MARA 2Z2KA 1LX7A 4DAEA 1AB6A 1QE0A 1P6UA 1G7SA 4QXAA 3P20A 3I5YA 3DE7X 4YN3A 3SU8A 3SHFA 3RRFA 3RYHB 1ZQ9A 1XZQA 2DE0X 3NI2A 1NL3A 1U0BB 4K81B 1NYQA 2YV1A 4WLVA 1ZH4A 3OECA 1DQYA 1ZJJA 3WNDA 5EXXA 5K0GA 4BNUA 3NDPA 1GLVA 1BWQA 1JLRA 1MVNA 2E4VA 3ESAA 4PBRA 1NIJA 4WXYB 5T4BA 5C53B 1DAIA 3R3VA 4MQ4A 1WQ4A 5AKHA 1CKEA 1EBFA 3O9ZA 4QZVA 2V5AA 5JXHA 2EKQA 5L6MB 2CVFA 3V8PA 1R0RE 3VR5H 3W2EA 4A1OA 4L5CA 3SR3A 1IBLB 4UUPA 1YQ9A 1HETA 1G8AA 4U7WA 3CO0S 2RHBA 2HX1A 3QHAA 1A4IA 1D5WA 1HDCA 2AR9A 3UMMA 1R74A 1I2ZA 1B0PA 1QKJA 4RTMA 2L17A 3K0CA 1EWTA 4YQFA 1SC6A 4C0AC 1E2LA 1TC1A 2NU9A 2NZ8A 3ELDA 4J16A 4B3XA 3GK3A 3V1LA 1Y6QA 3E23A 4AZTA 4C6HA 4EYQA 1XZBA 3AOEC 2A33A 4M22A 3ZXXA 4EHJA 2AOXA 3RFUA 4DHEA 1XZMA 1SK9A 3UUFA 4KPYA 1TXGA 3S70A 4ZALA 3ZKWA 5BQXA 3BEOA 1WL8A 3I05A 1NNUA 3QXCA 4MUXA 1S3IA 4CMKA 2E6KA 4EH1A 2BYTA 4X1YB 3PR1A 3B70A 1MEOA 4P38A 3VU9B 1A9ZA 3EZXA 2GSWA 1YNSA 3BSFA 3RKRA 4DM7A 5IHPA 2I6QA 1VHJA 4F93B 1K9SA 4I46A 4ARAA 4QICA 4FYKA 3WHKA 2A86A 5EQDA 3ZE1B 1FSPA 4X97A 5J3JA 3THWB 1LNQA 3DV0A 3FMVA 5ENZA 4TV8F 1IHXA 3B3GA 1A97A 1JALA 1MXHA 3WDLA 4PFJA 1Z0DA 3CEHA 4L8YA 5IZCC 4BB5A 1RM4A 5CA1F 3PIRA 1FC0A 4JSTA 4O2AB 4EG6A 1ZGHA 5JO0A 1C30B 3OM9A 4UMFA 1ZI8A 4F5EA 3W5DA 4BVKA 4UQLA 3N8HA 3L1VA 3Q5GA 4LX0A 4GG1A 3I45A 4AMZA 4QASA 4EPTA 5FTNA 4BXOA 1KIFA 3NYIA 5KYYA 2FMTA 1L5MA 1RWPA 4F8JA 5DJ5A 721PA 3SHQA 4RANA 2IRWA 4NC9A 3RPEA 5EKUA 4BNGA 4JQZA 3REGA 1MC1A 3E5NA 3GLHB 2EW2A 3T5PA 2HWXA 1JWAB 3Q3JB 3HLTA 3U1TA 2E5FA 1C7FA 2FV8A 1RE1A 2PD3A 3FPSA 4IUYA 1QCCA 3UMRA 3KQYA 1E2HA 3TPCA 5JCJD 5IABA 1PGOA 2MSEB 3ORRA 8ABPA 2QX6A 2C2OA 3CWQA 3D8HA 1AOXA 2VF7A 3DZBA 3KSZO 1K6XA 4IM7A 1ZMOA 3DVRX 5DI3B 4HDNB 5JCPA 1B6TA 4FYWA 5EP1A 1E96A 2CL6X 4KXVA 4BP1A 3X43A 4XYMA 2DUWA 4QSHA 3EHEA 2B9VA 2XBMA 1ATIA 2OK8A 3GAMA 3PNMA 4JT4A 4MUJA 4RVSA 5IVIA 2DR3A 1NRIA 4FDMA 3E53A 1P60A 4QOSA 4YUWA 2V7TA 3SQXA 1RLOA 1H5NA 1U0EA 4J91A 3MTQA 4GP9A 4Y98A 5FNVB 1CY8A 2WE7A 2JCGA 1BIFA 4F96A 5K4HA 4YUXA 3KB1A 2F3UA 3EOBI 3RS4A 3KJNA 1FW8A 2PRSA 3HKDA 3ZV3A 2B1QA 1ZA1A 1FS6A 1XD9A 4OMDA 4DJ5X 1N3IA 3VR4D 1R8XA 3L6OO 4P3XA 3HMKA 5A4MS 2AG0A 3BERA 5LMUB 1KQOA 1VE9A 2FP4A 5F4ZA 2IUYA 5AQEA 2FWPA 1NXWA 2YNMD 1EWKA 1SVKA 1TD1A 1NVBA 2YJ4A 3DZIA 3NC1C 5BYBA 5H59A 3ZE6A 2WAXA 4HT3B 1W5SA 2FE4A 3UAVA 4B47A 4YV7A 1CUGA 1OFIA 2W2KA 1PT9A 4PAOA 1YS2X 4MA5A 1YQEA 1MC4A 4EKGA 5CW1A 2I2FA 3OHPA 3M4NA 3UTDA 2GLTA 2JFVA 3BJZA 1PBNA 1D6SA 4TWBA 4CT0A 5FKJA 4EY8A 3O2SB 3PQ7A 1EZZA 2JARA 3A7EA 4F4DA 3WWDA 3Q2IA 4I1UA 1NN5A 2BRUA 2QN6A 3NBXX 4EF5A 4GGMX 3T5GA 3IA7A 4ZVMA 3WQQA 2IOQA 3AC0A 4MQUA 2VZ0A 2ZBGA 1N4AA 1XLWA 4RORA 1Y48E 4MVJE 5ALFA 2J46A 4TXMA 4BO0A 3LWDA 1GUFA 4OI4A 5MFPA 1ADYA 4KH0A 1R6XA 1KMHB 5ERYA 1Y4DE 3ORHA 4AMGA 2ZCUA 3ZIDA 5IJXA 4BJ3A 3ZCXA 2IZ7A 3NHUA 2R00A 4FHZA 4RHXA 4RKWA 2FF7A 2IHJA 3ZI4A 1XU4A 3IUJA 2QVGA 5LOVB 3EXEB 4XRRA 3HEAA 3RRNA 3SS8A 2C9ZA 3WWOA 3BGVA 3VO8A 5CLQA 3F5SA 1U9JA 5EL0A 3I32A 1ENZA 5DTJA 1P81A 4Q48A 4ZVKA 4HDKB 1A1VA 2UVQA 3C3JA 3SC2B 1XRMA 4RD4A 4C2AA 3FTNA 4NJMB 4EIWA 3CA8A 4P9NA 2BWJA 2G8LA 1ECBA 1HOXA 1TO2E 1X7ZB 2HB6A 3CPSA 4RM2A 5WRFA 1D1SA 5FDFA 1IK6A 1DIAA 2CW5A 4NJEB 5FPKA 4WXMA 2O2IA 1QHEA 1SH7A 4KV9A 3I0MA 2ZIGA 4GI5A 3TQFA 2VDMB 3M1YA 4LVOA 2ETXA 3ZHVA 1Z0IA 5ADWA 1Y1TA 1KXZA 1XMOB 3L82B 4DARA 3IOEA 3X0DA 2DOKA 2EW1A 4I4TA 4PHHA 1F9EA 2FN8A 2ID8A 3G1UA 3ZNQA 4MYRA 3IEMA 2J3DA 5E4YA 1M9NA 2N75A 4ZOLF 4C7MA 2J59A 4JLNA 5AH0A 4GKBA 2JLXA 1Q7BA 4DLZA 4G1FA 4XPIA 4Z0PA 1X8XA 4ER0A 4TLAA 2JG3A 1XCJA 1W0JD 2I3ZA 4RJJA 1P5HA 2QD3A 4HADA 4Z7QB 2PUVA 3CJRA 4J90A 2AI1A 4P31A 2IX9A 4LDQA 4PEVA 3CNNA 2JHCA 1W36B 1A4RA 1G5TA 3K1JA 2O8NA 3VA7A 1YZNA 4DLUA 4WKNA 1WBJB 3C5VA 2QRLA 2WDZA 4IEFB 4MUYA 3NBQA 5JWHA 5JPDA 3SQNA 4MHTA 3N3BC 1EIZA 1AUQA 3GIWA 1E1MA 3RIXA 4CGYA 5KDOA 1U2RA 2QR5A 3F71A 2ZEJA 2VP2A 4R0MA 1U1EA 3UKOA 4ZVRA 5LD2B 3L7KA 1OXTA 1IRIA 3OAAA 2FZLA 3CT4A 4AY5A 4FM9A 2AEMA 3OCXA 5HF6A 5KTNA 4ZI5A 1UDCA 4LY9A 1WMBA 4G23A 5AFSA 3AIMA 1L5LA 1QZTA 1F17A 3CRNA 4LYAA 5AOAA 1CQJA 1PKXA 2A9VA 1SGWA 1NY5A 1WNFA 3NIDB 4Q02A 1NUTA 3URKA 3BILA 4F3CA 5B2FA 4QQRA 2RG1A 3RREA 1FPMA 4J0JA 3GY0A 4E11A 1FP4B 1P61B 4G9EA 4M7PA 7GPBA 4LHSA 4FGKA 3QVOA 2HLDA 3IKMB 1Y1SA 4Y7DA 5B2EA 4D7AA 1HEUA 1N7GA 3HUDA 3ZYCA 1JDPA 4UBLA 3LOQA 4C5AA 4Y1RB 1FXWA 2H1FA 2R8ZA 2EFGA 3A1VA 3G1TA 3PBKA 5JS8A 2XUHA 5HCIA 4H6VA 2JFFA 3CF4A 4JBLA 5JH7B 5AM4A 2XKKA 4PRLA 2HWKA 5FLEX 1QHFA 4KX5A 4RA9A 5DBGA 3HV2A 2YOGA 4AVYA 5ICCA 2Z09A 3QPAA 3UWKA 2CWDA 2OBMA 3F8SA 1WXHA 4W9NA 3ZWNA 3Q10A 5ICMA 4R6WA 3P1JA 4URYR 1UDAA 4ND5A 5TS2A 1HGXA 3H1BA 3DKRA 1C1XB 3DTVA 1WZCA 5DWVA 5H4GA 3OD1A 5KJ6A 4KLRA 5H82A 2WSMA 2V6BA 4IDEA 4Q4JA 4X45A 4GZ3A 2CLMB 5JOQA 1THZA 3T35A 3DVLA 2H9IA 4XCQA 1XQWA 1A9XB 5B6IA 4CNQA 1M6WA 5DPMA 2O8EA 4LQ4A 1GJRA 4HAYA 1QWSA 1S2OA 4DA8A 5C8XA 4LF5B 2PH1A 3ZIAD 3R6DA 4Q4HA 3ZK9A 1LDMA 4OAOA 4KZPA 4MICA 3BA1A 4E03A 1ESMA 3KCQA 1ISFA 3VPXA 4P33A 1Z15A 5HTKA 1OXMA 1CHNA 5KJCA 6Q21A 4JEUA 3U09A 1BGWA 1LPSA 3FAKA 1XEFA 3MB8A 5CK4A 1NVKA 3EWNA 4FEEA 4JZYA 4MW9A 3U4MA 3HO8A 1WPXA 3C0KA 4NRDA 1PFWA 2DGDA 2HT6A 4GWKA 3MUOA 1EZ4A 4JT2A 2HF8A 3PI6A 5DTIA 4CL3A 2YWBA 2R47A 4YMTA 1Q0LA 2W6NA 5L3SA 3K4HA 3E35A 2EEZA 1YBHA 3A2KA 1MABB 4QG3A 5LYJA 2P30A 3S28A 1B00A 1K7SN 1X1SA 3BTSA 1DIOB 4CR8A 4ZTBA 4X41A 2HEIA 3VZRA 2QM0A 3ETGA 4KWTA 4RHEA 1HUQA 5KQLA 1RYDA 1AXGA 4A8PA 5JFGA 4ML3A 3FGZA 1DT3A 4O33A 4IIJB 5DLQC 3VR0A 3HJBA 3HCBA 3AM1A 1ZO8A 5BXYA 2BZSA 1V1MB 1O4WA 2IP4A 5BOSA 1H6DA 2O0JA 2P9JA 2P5SA 3FYUA 4YB8A 2VEOA 5TV2A 5CFMA 5LQCA 1WXFA 2FPPB 3WBKA 3EARA 1WG8A 1NF2A 3U3RA 3VPSA 5IWCA 4AQ7A 5KC8A 1RAEA 2HW8A 2EVWX 2JCSA 4Y9RA 3ONEA 4EITA 5IKXA 2PJZA 5BN4A 1G8PA 3HVHA 3PEYA 1ZDMA 2CXXA 3P5SA 2JGFA 4G65A 4FLFA 1I2MA 2IZ5A 3BVPA 4HDSA 4KI0A 1N9GB 2Q3EA 4ZYLA 3W6UA 4L5JA 4DYDA 4EL5A 4RGYA 4GXRA 2HL6A 3N0VA 2PIDA 2WB4A 1PLJA 3AHEA 3ZHBA 5AVUA 4D26A 1MFZA 2AOTB 3TLBA 3LKBA 1CIPA 4PC6A 4F6CA 4NJOA 5EJAA 4N5MA 2I1WA 3TAUA 1O03A 1U5BB 3KYCA 4PR0A 4WXPA 1SQSA 3EFBA 3WKEA 4CL8A 2IH5A 3ERCA 1COWA 2YHBA 3QELB 4OHZA 2UVPB 5K0TA 1XE3A 3DEKA 1A76A 1I6WA 1OYVA 5D1HA 3Q72A 4X24A 1E66A 1ZCAA 2GT1A 5J5VA 2FEXA 1CQWA 2O20A 2EWVA 3OX3A 1TPZA 3Q7QA 4XJXA 5DNWA 4Q9JA 3EFEA 4HNUA 4V1CA 3QVGA 4KVGA 1AKRA 3AM3A 1WY5A 2QMUA 4MS1A 3LPAA 2D4HA 4RK6A 2NIPA 1R9MA 4A2CA 1XK6A 3U7FB 1E4EB 4TKMA 4ZAYA 5FR1A 4JDUA 1L7EA 2CLEB 1AJEA 4G0UA 4V0OA 3TW6A 4AXXA 1P4JA 2Q8QA 3DHEA 1Z17A 4FOTA 3VKHA 3IDSA 4IV5A 3IEXA 1H4VB 1G18A 1XTSA 3IS3A 1P4AA 3COSA 3H5LA 1GNTA 2G6TA 3KZVA 1XMQB 4EB3A 2XCRB 3BSYA 1RI4A 1TZ2A 3GL9A 3VSEA 2XGSA 1XEWY 1QIKA 1E2UA 2I03A 2N47A 3VBEA 3QP9A 4DREA 1TADA 5LUAA 4ZIRB 4D9GA 3B9BA 4D9KA 4FGUA 1J0DA 4H7HA 4ZZ2A 3TUIC 4BKMA 2UAGA 4Q05A 4MS3A 5BUQA 1JR3A 5DXAA 2WJJA 4AY3A 3BD6A 2Q45A 3FBTA