3NKVA

Crystal structure of rab1b covalently modified with amp at y77
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-1B
publication title The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nkvA00
2CCJA 4BZXA 4E22A 1X86B 2SHKA 3RWOA 1VCNA 3K9HA 2IS4A 2FA9A 3K0AA 1SVLA 4P33A 3W6NA 5GJBA 2J0UA 1D9XA 4QHSA 1SHKA 2RKOA 5HCNA 1R2QA 1S1MA 3CBQA 4YXWA 5KSOA 1KNQA 1N6OA 1N0UA 4WZBE 2WWFA 4JLJA 4PO9A 4R98A 1AS0A 2RH5A 3OF5A 3OAAD 1TX4B 1Q1ZA 1M7GA 3H1TA 3TR0A 3TUJC 4TT3D 4XVUA 4AI6A 1KO8A 1G3RA 1N6KA 2CE2X 3KXKA 2RGNA 1NY5A 1OHHA 1MH1A 4RZ2A 2IWRA 3CX6A 3M0EA 3BFKA 1T3HA 1NSFA 3LLUA 2QMOA 4JL8A 3FGNA 2CHVA 2NPIA 3AP2A 4Q1DA 1NI3A 3RS5A 1W4BA 3ZVMA 3MMPA 5GVRA 3WBKA 3B85A 2X8AA 4D6PA 4DCTA 3B9QA 3V9PA 3H4MA 1VYVA 2A5FA 1TL7C 4HB2A 4MGYR 4HSEA 5J4LA 2YV5A 4UNSA 1GSIA 1KAGA 1MO6A 3WYAA 1MKYA 2E1RA 2ERYA 4IVRA 2P2LA 2QM7A 1ZRHA 4UJ3A 3JZAA 2XGJA 3DOFA 4ACAA 3QJYA 1X8KA 2LKCA 2G3YA 1YR7A 1VPLA 4YXWD 5JMTA 1D9ZA 1R10A 2XNDA 3GEIA 4A8JC 1OB5A 3AVXA 2ZJZA 4QG7A 1JBKA 2J45A 1N5JA 1KY2A 2ECKA 3H0KA 1Q3HA 1VG0B 4QBIA 4DB2A 3CRMA 1N5IA 4KO8A 4HLUA 1OHHD 1W0KA 1G41A 1AKYA 2BM1A 3QPVA 3WHKA 1N5LA 1Z0IA 4OJKA 2C78A 5DIFA 1U9IA 2H5EA 3CPEA 4G5OA 4DZZA 1P7CA 2HJVA 3C4JA 6Q21A 4C0LA 4N3NA 2FFQA 1VCMA 3FYHA 1GRQA 4M9ZA 1KYIA 5F2EA 4MGZR 4OK6A 4PHFA 4AIIA 2MMGA 3PITA 1ZU5A 1GP2A 2C96A 1YR6A 4CGZA 4WIAA 4L15A 1JEDA 3SEAA 1GILA 1XPUA 4MKIA 1KKLA 3JVUA 2ZJAA 3GLFE 3OESA 4PX9A 4HI0E 5JWHA 4A8JB 2IS6A 1TF2A 1LTQA 4W9MC 1L7VC 1XD2A 2OHFA 1IXSB 1YJ5A 3OEEA 1HT1E 3TLXA 1G17A 3GLGE 1T5IA 2QT1A 3KB1A 2RGBA 2HF9A 2IEYA 2DFNA 4OKSA 2H17A 1UJ2A 1ELOA 1U2RA 3TNFA 1JEEA 3B1YA 5H8WA 1P60A 4MYCA 1Z28A 2J7KA 4NKRA 4B76A 1W0KD 4TYYA 1G9XA 2EYUA 5EXXA 1VG9B 4DXAA 2ZYUX 4RCZA 4QBGB 3IIKA 3LBHA 5D3MB 1NLYA 2ZROA 2PBRA 3IKJA 4CF7A 1EESA 4RD3A 2AXPA 2GXUA 5DYGA 4LJ5A 3ZYCA 3PUVA 3SBEA 2KBEA 2ONJA 4PANA 1EWRA 4EPRA 3J81k 4JKYA 2UZIR 4LPSA 2AK2A 1KOFA 5FPKA 2BBTA 4MRNA 3KJGA 1OXSC 1E96A 1N6RA 3GLHE 2ZJ2A 2GBLA 3ICQB 1KZ7B 1R0YA 1NSTA 3DHWC 3SHWA 5CLQA 5AUNB 1A82A 3KQUA 4LOAA 1UKVY 5D3MA 3W3ZB 3OEED 2GKSA 4C0KA 1KDPA 1CR1A 1UEIA 4A6XA 4MDEA 1A4RA 4FMCF 1TNDA 3WNCA 1UM8A 2YC2C 3MWJA 4E09A 4KSBA 3CNOA 4OJQA 1FTSA 3A4MA 2TMKA 2AN9A 3P26A 2ZREA 1NLZA 2OCBA 3SJAA 5BWMA 5LDDC 4BFXA 2PX0A 1IJFA 4J0QA 1MO3A 3PUZA 5AJYA 2W58A 4BFVA 4AKHA 3LW7A 4G5RA 1G3UA 2W6JA 3HYRA 2ZAOA 5FTMA 4HAUA 3RSLA 2FFBA 3CRRA 3GLFA 3RS2A 3L0SA 4KHZA 2Q3FA 3BB4A 3SU8A 2QP3A 1S2MA 2J7PA 5GJCA 4HDCA 1E9SA 2UZ3A 4XWKA 4NDZA 2I1VB 2ZRMA 4I81A 3GLGA 1DAHA 4GMDA 2BKEA 2GK6A 1T3LA 2HXSA 4A9AA 5L3SB 2OCYC 2IYUA 3U7EB 2Z4SA 5A0FA 4YMVA 4F92B 4EPWA 1SKYE 1PUJA 2A5DA 5C2JB 3GLIB 4V0ME 2JLUA 4M1MA 4M21A 2IYZA 2ZYWX 3AKCA 3K53A 3MWYW 4CEIB 1K5GA 2MSEB 1SXJE 2NO0A 1E1QA 2FSHA 1G3MA 4PAOA 3AQ4A 3VQTA 2FJUA 1KI6B 1ZC3A 1LFDB 4KLNA 5JZVA 4BZQA 3CH4B 3U44B 4TYQA 3CH5A 1I2MA 1E2DA 4PFSA 1E9CA 1DVRA 3OE7D 3QKUA 3QPWA 3WY9A 1KI8A 5L3SA 2YHSA 2JLZA 2PT5A 2VF8A 2IYXA 2OCAA 2OILA 3JZMA 4UKDA 4D26A 2FH5B 5C46F 2F43B 1FMLA 4TWZA 3TVDA 1E0AA 2W6JD 5G3YA 2J41A 4AYWA 1YRAA 1NNEA 5DI3B 3ADKA 4BLOA 3QXCA 2J7PD 4FMDB 3K0CA 3QEJA 2GK7A 3P27A 4Q9KA 3VX3A 1Z2CA 1G3QA 1T0JB 2X19A 3V4RA 1JQJC 4POAA 2QSZA 4LBZA 2BMDA 5FBVB 2IA5A 4ITRC 2F1RA 4LGMA 5CYPA 1SKQA 4Q1AA 1D2NA 3E2IA 4JVSB 1W47A 4TQUS 5JEEA 2C95A 4C0JA 3VKGA 2H16A 3A1UA 4JL6A 2F43A 3QY0A 4D2IA 2GJAA 4DLRA 4FXPA 5FBWB 3KTAA 5CDFE 2CEAA 3WP1B 1NRJB 1M7HA 1E1QD 2BVNA 2YOHA 1ZP6A 4P3YA 5KNCA 1DADA 1Z83A 3IHWA 1E9EA 3I5YA 2C8VA 3DEFA 2ANBA 4W5JA 4TL9A 3MCAA 2R8RA 3M1IA 3D8BA 3R20A 4PQYA 1KK2A 1NVXQ 2H57A 1TQDA 5HCIA 2G1JA 4L9WA 1I4TD 2OXCA 1W7AA 1B23P 3QXHA 4TMXA 4C0QC 4HAWA 4ZO4A 4KSCA 4IW3B 4PZZA 5KPJA 4TLAA 4TMZA 3UG7A 1DO2A 1XFAA 3NC0C 3AUYA 1VECA 2PLRA 1TUIA 3CWZA 4YMSA 2HUPA 3QVUA 5H68A 4DBLC 1OYWA 4TMTA 1XRJA 1NBME 3U5ZB 2ODEA 4JVNA 1OIVA 4TMWA 1XB2A 1XD9A 2IUSA 4O3MA 3UWOA 1LW7A 3LBNA 3M6AA 2VP0A 1MRNA 1SVKA 2GXAA 1I2DA 4V0OA 2VF7A 3AF0A 4PO8A 1XEWX 1Z2AA 2BHRA 4JLMA 4B2IA 2F3RA 2EFGA 5AJXA 4K81B 3HU2A 3BRWD 4AK9A 2W2TA 2ZPTX 3CF6R 2PCLA 4B71A 1LS1A 2V6JA 1UKYA 1E32A 2DFLA 3GJ6A 1XF9A 4X8HA 3EG5A 3EA5A 4N0DA 3RVBA 2Z5FA 1CTQA 1R8SA 3UANA 1RRPA 1P2TA 3NBXX 3BH7A 4BFWA 1E98A 2BKUA 2IHYA 5EP1A 4JT2A 3EWAA 2WKPA 5EZ5A 2RHMA 3SJZA 2VIIA 4GMXA 5B58C 1E2PA 1LY1A 1KMHA 1CJUC 3K1JA 5JECA 1NJFA 3IPXA 2X77A 4Q4LA 721PA 4ZDKA 4TZ6A 3QBTA 3HR8A 2FF7A 3I5XA 2HYIC 1Q3TA 3X1DA 1G8FA 4RD0A 1KK1A 3QKSB 3WMGA 3W90A 4BPBA 1N2CE 3AVUA 3QENA 2OV2A 2VL7A 3NEJA 1P2SA 4JYBA 4WXRA 4YC7A 4D4LA 4UXHA 4P31A 1E3MA 3X1WA 2VTKA 1KO1A 3EW9A 4QRHA 4ZV4A 1N0VC 1NF3A 1ZD9A 2PJZA 4GP7A 4MYHA 4OQLA 3T61A 5BN5A 5EJEA 4TTRA 1IAQA 5UKDA 4TL8A 5JHGB 1U0LA 5DLQC 2HT1A 2G6BA 5E7MA 3KDSE 4DJTA 2VP5A 4QFMA 3CW2A 2VH5R 2AK3A 3TW4A 1SULA 2YNMA 4PPGA 1Z29A 4JLAA 1KTVA 4JT4A 4RVCA 4W5HA 1XTSA 2JJ1D 4EKDA 4HZIA 4MRRA 4ESVA 3SQWA 5KOYA 1AQUA 4QHYA 2Q21A 3TUIC 4BEJA 4B3CA 3KB2A 3A4LA 1E2QA 2WJYA 2XTMA 1R7RA 4WAUA 2IW3A 4Q1FA 5BN3A 2F9LA 2FE4A 3FVQA 2IX3A 4A2QA 1ZM7A 4Q9IA 1XEWY 1OFTA 1A1VA 4F7WA 4AKGA 4UNNA 1EGAA 5EP2A 1GL9B 4H1VA 4JVMA 1E9DA 2A5GA 4WBSA 2D2EA 2ZRIA 2GETA 3CKLA 1CJMA 2PZGA 1GIAA 3WRXC 1IOZA 2WJJA 3K8YA 3NEYA 3QKRB 4Q19A 1ZJ6A 1ZUHA 2XZLA 4IOKA 1YHNA 4QKQA 4NU0A 5KU1A 1VTKA 1FOEB 3RS0A 3DDCA 4KU4A 1X8JA 2AKYA 3FFBA 3TQCA 3CWQA 4X8LA 1E2HA 2WPDA 3BXZA 3K09C 5JS8A 2OEPA 2IYVA 4OHWA 2JLQA 1Z8FA 2FZLA 4N0EA 4Q4HA 4JBYA 2KI5A 1TQ6A 3QKRA 1NMZA 4XSHA 3U7FB 1IN4A 1EFCA 4DCVA 1Q44A 1E79D 2PEYA 4PSKA 3TKLA 4Q7MB 4WA7A 3VU9B 1KHTA 2J0VA 1DO0A 2FSIA 1W36D 3ZIAA 2QSYA 3BJIC 3I8XA 4HB4A 4TLBA 3BFXA 4IJMA 3SC3A 2O8FA 1XTQA 2DPXA 2WAYA 1BO6A 4LSGA 4DDWA 3IIMA 4WZAE 3U3OA 4FMBB 3NTUA 4Q9JA 2R6FA 1U8YA 1FP6A 2IYQA 4Y0VA 2OCPA 2ZUDA 5H70A 2CE7A 2P67A 2WM9B 4PPNA 4B43A 4M22A 4HZUB 5BQ5A 1KSHA 3G0HA 2JDIA 3ZQ6A 1FUKA 4GP6A 4NCJA 4CW7A 2O8EB 5G40A 4G1UC 1II8A 4DDUA 3AGPA 1UDXA 4FI3C 4EQ6A 2WJVA 1ZM9A 2FGKA 5SZJA 2C5LA 1FFHA 1NJGA 3PG5A 1W1WA 4F4CA 3KKQA 5JWOA 2Z6VA 2A7QA 1FX0B 1EFRA 5DISB 5FR2A 4A1FA 4RKFA 2VHJA 3AVVA 2ZQ5A 3KQLA 1XCPA 2O8EA 5K8LA 2PT7A 4NCNA 1CR2A 3ZIAD 4PC1A 2VA8A 5EXPA 3H2YA 4XD7A 4OBEA 2QPTA 3FE2A 5J4YA 4C2TA 2NMVA 2OT3B 2ZS9A 4PC2A 4Q1EA 4H9GA 4I4LA 3KJIA 4LJ7A 3BBPA 2OUKA 3C7KA 2EU8A 1CLUA 1XTKA 4Q02A 2D7CA 2JDID 1BYUA 5GJVC 1G1MA 5E7JA 2ODBA 1GVNB 2QMEA 3QEOA 2R6DA 1ZM3A 4JLBA 1HE8B 4NONA 1XMVA 3A58B 3UATA 5F98A 2JLWA 4C0SA 3CZQA 2ZAMA 4TSFA 1R5NA 521PA 3ND9A 3UK6A 4BRUA 4ZCMA 2G0TA 2ZUCA 1Q0UA 4EJSC 4LHYA 4M1YA 3SI7A 3TIFA 3SJBA 4PXAA 4B3BA 3ONWA 3AF3A 4R71A 1DAFA 4HEJA 4RD6A 1KAOA 2DCUA 3QSYA 3MUFA 1YRBA 1HE1C 1IBRA 1COWA 1GL7A 1K6MA 1BS1A 1H8HA 2OAP1 1V43A 4FD2A 1VHTA 1AKEA 4XD7D 1DPFA 1M8PA 5FOVA 1G7CA 1KJZA 2QAGB 4B47A 3FHTA 2JLYA 3AP3A 4GZMA 5FL3A 3QG1A 3EPLA 3LFUA 2F55A 4QHTA 2V7QA 4OYHA 5JEDA 4KBFA 2FFHA 5L3RA 1RE0A 4JZKA 4GOJA 3Q7PA 4UQOA 1ZNWA 3C14C 2OO7A 3BD9A 4NE2A 4EJSB 2VYFA 2J5XA 2OE2A 1E2JA 1NG1A 1E9BA 1UDWA 1YZTA 1Z6YA 2PX3A 4DT1B 1RKBA 1E69A 3DMDA 4M1TA 4TSFD 1MO4A 1TTTA 1EK0A 1XEXB 1JR3E 2LWIA 2QAGA 1KSFX 1XMIA 3LAWA 3DO6A 5CITA 4BFUA 2B21A 2GF0A 1HA3A 1LS6A 1SVMA 2NO1A 1KJYA 5TY0A 2IYSA 1U90A 4JIMA 4KFSA 5IRCD 2XXAA 4D4JA 1KI1A 1VDZA 2BEKA 1F2TB 1ZC4A 4CYMA 3LA6A 2RGNC 5D3QA 4Q18A 3UXMA 5JRZA 3QXXA 4XIGS 2P65A 3REFA 5AUPB 4AURA 3KUCA 3B1VA 5B64A 2P5SA 4LY6A 4LYFA 1SVIA 2RB4A 5JFGA 4FCVA 1OH8A 3RYTC 1IY0A 4KVGA 4PC6A 1XEXA 2FG5A 2HLDA 4LWZA 3AKEA 3K0AB 3TSOA 5KYKA 1EXMA 2JATA 1AJEA 4LC1A 2V7QD 1P61B 4OL0A 4DCNA 5JI3E 1OFUX 2CL6X 2BCJQ 4MRPA 1YQTA 2REOA 5DYIA 2W6IA 4N1AA 4NCIA 1NN3A 1QDEA 4DLZA 3W6PA 3B5JA 3RRZA 3TSZA 2EYQA 1QVAA 2XZOA 4JJZA 4IOLA 1E9FA 421PA 4XVRA 1JALA 2OBLA 2HCBA 3BWDD 1BMFA 1FP7A 3SFZA 1YZQA 2ZI5A 3HU3A 1W49A 3B82A 2YINC 4HLUC 4PZYA 4KCGA 3NDPA 4XSGA 3T1OA 1XJCA 2FOLA 2FPMA 2ZE8A 4AKIA 5C4MA 2ASEA 2FEOA 1IXZA 3CNLA 1U9IC 1S96A 2XNSA 4O25A 3VKHA 1SVSA 2V1UA 3NIBA 5GADl 4PC3A 4P4SA 3QKTA 2HLDD 2OLJA 1MO5A 4BUJA 4IHQA 3EASA 3DZDA 3TMKA 4TTQA 2V55B 3CX7A 5J4VA 1WRBA 4DRZA 2A30A 2AWNA 2QMUA 2WJHA 1WB9A 1IY1A 5FR1A 4OK5A 3KL4A 1IN8A 4IFBA 1E2NA 5CYOA 1FMJA 3I8SA 2W6ID 4P32A 3EZ6A 1Z07A 3EZ2A 3C5HA 3GCGA 2ATVA 5C1BA 4OQMA 2WZQA 3ZVLA 4Q7LA 1XBTA 1ZMXA 5FPHA 3CO5A 2ZSBA 4HYYA 4URVR 3LVRE 3TGPA 1CULC 4CVNA 3QI2A 1BMFD 2BDTA 5FFMA 4BWYA 5F9FA 4O2LA 2IK8A 4B34A 4JKIA 1E2GA 3U61B 1HQYE 1T8UA 3T12A 4BZPA 2QPOA 5AR1A 1PV4A 4R2IA 1AA9A 3JVVA 1Z47A 4URYR 1XD8A 2P3SA 1T0HB 1G3IA 5C18A 3PQCA 4G0NA 3GQBA 3PFIA 2GWHA 2R65A 2D3WA 3UMRA 1WMSA 4TL6A 1XD2B 2BV3A 1UFQA 2IF2A 2QMHA 4ZCLA 1OXXK 1ZNZA 3EC1A 4DC9A 1S4QA 2QTHA 3DOEA 2MMCA 2UVQA 4G5GA 2GBLC 3PEYA 4V0KA 4XWAA 1PZNA 1YU9A 3CRW1 1NKSA 3KKPA 1GG2A 4QJ3A 2O8BB 3QVVA 2G1KA 4MA4A 2XAUA 2XZPA 5BYKA 4LHWA 3UPUA 1AIPA 4DIDA 2IUUA 3UKDA 2BEJA 4M9QA 5FBLB 3R9IA 3K0FB 2RGCA 4Z54A 1E2FA 2LCFA 4LRWA 2XNDD 5F3WB 1MRSA 2GTPA 4GBMA 5KSZA 1P9RA 1AZSC 1X1SA 4PSAA 4TYPA 1EG7A 4MUBA 3W3AA 2O8BA 2GJKA 5FOUA 4NZYA 2WWWA 4CEHA 1Z0AA 1W4RA 1ZM4A 2CL7X 2EWVA 1W4AA 3K0EA 2VHQA 4LUCA 1LF0A 1P9NA 3THWA 2CHQA 4DLSA 5CB8A 3L82B 1HUQA 1W5TA 2O0KA 2CJWB 3EPKA 2Q3HA 3F8TA 1Z0DA 4P0TA 3K0FA 5JS7A 1GRRA 1G5TA 3I62A 3D3QA 3K70B 1DOAA 3T1QA 1S9HA 1KO5A 2V9PA 5AJVB 4TMVA 4GSYA 2QBYA 3Q9LA 2JASA 4Q9HA 3WBJA 5AUQA 3F0TA 1JJ7A 1GTVA 221PA 2FGJA 3GLFB 2OESA 5EE9A 4DWJA 2V8OA 4BECA 3AVQA 4BEBA 3R9WA 3T35A 1TQ4A 3FHOA 1G7RA 2CJWA 2D7DA 3BB3A 3LX5A 3WMFA 3SYLA 1G4UR 1E4YA 2GHIA 4W7SA 3GLGB 1F60A 3CPHA 3THXB 2C2HA 1M6NA 3GEEA 1G64A 3ND8A 3QPUA 4F93B 4LX0A 4B73A 1JXMA 2GJ8A 1CIPA 3K0CC 1NP6A 1DAEA 3R7WA 2EFCB 1A7JA 3O47A 3SOPA 4D81A 2WOOA 4YMUA 2DWOA 1E4VA 3EZ9A 2PMKA 2K5UA 1R8QA 1P73A 4MH0R 1MT0A 1XU4A 1G6HA 2B7BA 4MKGA 1OFHA 3VR1A 3DZ8A 5EXSA 3WHLA 1NMYA 1FPMA 3F5FA 2NO9A 1KI7A 3THXA 5FUXA 3U7GA 4P4TA 2C9YA 4IRUB 4ZDIA 4E03A 2HEIA 4I1OA 5EQTA 4EPXA 1G291 1PUIA 5AWFC 3SBDA 3PEVA 1F6BA 2BMJA 1R5OA 1AS3A 1NMXA 1DG3A 4NYMR 1XZPA 4HB3A 5CK4A 1P6XA 3TAHA 1M7BA 2XJ4A 4PAMA 3FDIA 3VMFA 2J0SA 2DBYA 4IOMA 5A5GA 1J8MF 2OLKA 2QQ0A 2ZRHA 3HP1A 4PSVA 3ZH9B 2J1LA 2WVJA 3WXMA 3A1TA 4DKXA 5FH9A 1RYHA 1QBKC 1GITA 1VIYA 3K70D 3PENA 1J99A 4JLDA 2CCGA 1OSNA 3Q8XB 2JJ8A 4MKFA 4RD1A 1G20E 2Q9BA 3W8RA 4AYTA 1DAKA 1QRAA 1E0JA 4NYJR 1XNJA 2ZRFA 3ICEA 2WTUA 3GLHA 1US8A 3BC1A 1QVRA 3KTAB 2QL6A 5ANRB 3EPJA 2Q9AA 2IS1A 3H84A 1G19A 1OXTA 2GJSA 2N42A 3B7GA 2YC4C 4WZ6A 2N46A 2VP2A 1JPJA 4IEEA 2EFDB 2VRWA 5IHPA 4HDOB 2N1BA 1NVWQ 2KBFA 2WKRA 5KUTA 2QP9X 4TMKA 4QGGA 3IQWA 3EA0A 4C0BA 2GVDC 1G8YA 3HDTA 3SQXA 2ZI4A 1KO4A 3B78A 3LW8A 2ZE6A 4FIDA 4DDVA 1SKYB 2W2XA 2AX4A 4LJ6A 3PEUA 1IN7A 1AGRA 4KAXA 4KXFB 4NCKA 1GWNA 1X8LA 1TU4A 2O8DB 1DAIA 1SXJB 3UG6A 3ZVRA 3R8FA 3DM9B 1QG2A 2NG1A 2ZS8A 3RC8A 1KKMA 1U94A 1Z22A 1T91A 2JLVA 1G21E 4IXMA 3ZZTA 4KI0A 2D74A 3THOA 2ZRBA 3H86A 3VHXA 5FTLA 4ARZA 1IJEA 1HTWA 3OHMA 2H18A 1CJVC 3EIQA 3BK7A 4DLWA 1JR6A 4V0MA 1LVGA 2IF0A 2ZRCA 2YVUA 3IO5A 2ZR7A 3QUSA 4RZUA 1CU1A 2VO1A 4II7A 2ZJOA 1G6OA 4IDNA 2O8DA 1GM5A 1SXJA 4WVFA 4IVPA 1EWQA 1NLFA 3NBZC 2GXSA 4M9SA 3CLVA 2J3EA 1N25A 2O5VA 3PV0A 1YR9A 1VIAA 2QU8A 2ODNA 3RAPR 3N2IA 4KFUA 2WIBA 2ZTSA 1KI2A 3BFVA 4B3XA 1VG8A 1KMHB 1JXOA 2YJTD 1TF5A 3HR7A 4YMWA 4URXR 2J59A 4JLVA 2C99A 4PPQA 2JLSA 5M04A 2QGNA 4BFTA 1Q1BA 4NH0A 4Q4AA 1ZUNB 3QIAA 4Q7JB 5FPTA 2ZRGA 3VR6A 4EFMA 2PMDA 1VHLA 5AJWA 3I1FA 1WCV1 4ZIRB 1FTNA 1NY6A 1AGPA 1D5CA 2RGAA 4NBSA 5HKKA 2IWHA 3AVOA 1KI9A 3QE0A 3L0OA 5DO9A 4DDTA 4B75A 2O52A 1OH5A 4RY2A 1XDBA 4NMMA 2ZSDA 1KI3A 2IUTA 5CDFA 1SXJD 1YR8A 4CDGA 4EFNA 3WYFA 1GNRA 2FZ4A 2DFKB 2Y8EA 4LHVA 1T8TA 3LXRA 1S3GA 5DE3A 1N3BA 3LVQE 3W34A 1UPTA 3UWKA 3SS8A 3IO3A 1FUUA 4PQRA 4U02A 4FMCB 4F91B 2IS2A 4LV6A 1E2LA 4ZIRA 1Q1EA 1OYYA 1ETUA 1XP8A 1Q57A 2Z83A 5KDLA 5JJKA 2CMKA 1T9HA 1NKTA 3DKPA 3PUWA 1HV8A 5J5CA 3ZGXA 4B48A 3LQRA 2AFHE 4AY2A 1WQ1R 2EFHB 3MFYA 2CXXA 5C4GB 5E3HA 5CIWA 3GPLA 4OK3A 3QF4A 5DHAA 1NBMA 5EP4A 2IXFA 1KJWA 1X1RA 3TVTA 1OXVA 5A4JA 4ZI2A 1KSGA 2BBWA 4ERNA 2J46A 4LYAA 4B3DA 1OB2A 2AD1A 2NQ2C 1PLLA 2FX3A 1OFIA 2DFTA 1W36B 2F3TA 5HKKD 1IONA 3KJHA 4B33A 4QOSA 3W8NA 4U00A 2HXYA 1CP2A 3EARA 4HATA 3SDZA 2CL0X 3PXGA 4PC7A 4QJ5A 1KGDA 2XITA 4LV5B 1Q20A 1J2JA 3A37A 1IY2A 1S3SA 2GDJA 2P6RA 2O0JA 3MWLA 5CJ2A 3R8CA 3BAFA 5KSYA 1PLKA 4OI4A 3KFVA 1OJLA 1T6NA 1VKJA 4M1OA 3C16C 4ASUA 1Z6TA 1U98A 4RD4A 1RIFA 3U6BA 2X2EA 821PA 3SJCA 4XH9B 5AK0A 2ATXA 1U0JA 5JBQA 4HLCA 3L2OB 1DTSA 4K46A 2OM2A 2P6UA 5EZ6B 4Q4HB 2BBSA 2W2VA 5JSZB 3U4QB 2C77A 5J47A 1NBMD 1XJ0A 3NC1C 2F1IA 3D6TB 4QNRA 5JCPA 1KSJA 3NBFA 1YE8A 5SZHB 2CNWA 2ORVA 4Q01A 3ADCA 2GJ9A 4G5QA 1A2KC 5BXQC 1XZQA 2IL1A 4LV8B 4A2WA 3SYKA 4QGHA 4BASA 2F7SA 4A92A 3O8CA 5HE9A 2FSGA 1HEIA 5CJPA 2O8FB 5EXTA 3V4FA 1CR0A 3G82C 3EIEA 3U3JA 2ZYTX 3WMEA 5JSZA 3U4QA 2BC9A 1P62B 4D4MA 2O8CA 2VEDA 3A8TA 4NYMQ 4RJLA 4KJZA 3LLMA 1OT3A 2QNRA 2R62A 2ZANA 3LX8A 4ASUD 2IYYA 2XTNA 1K8RA 1VYUA 2NTYC 3NVAA 1II8B 3LNCA 3AF4A 4A4DA 2ZM5A 2WOJA 4EQ6B 2ZUBA 3LWNA 3RDPA 1D2EA 1GKUB 1QHIA 2JLRA 2WV9A 1KK0A 5EE5B 2ZVPX 3F3YA 5FTNA 4NYJQ 2G88A 2BMFA 4I1UA 2XJ9A 4I1SA 1WA5A 5EUMA 2CNWD 4YQFA 4V0NA 2JEOA 1ZCBA 1ZD8A 3W5IA 4RFVA 5EE1A 1JB1A 5BN4A 4KYIB 3T06B 5LBIA 3RC3A 1W4CA 3Q5EA 4Z1MA 4UXIA 2WPDD 3KQNA 2VBCA 3MG9A 1P75A 2DR3A 1IHUA 2AKAB 2QG6A 2YWEA 5E95A 2R44A 3WRYC 3P4XA 2R9VA 5JWRA 4QM6A 4D4KA 1J70A 2RMKA 1Z0KA 4MDFA 4RKEA 3AF1A 4M53A 2WSMA 3IUYA 1CKEA 4FN5A 2ONKA 1E2MA 3DVLA 2CHGA 4KITB 2ZJ5A 1S0UA 3FOZA 3ETLA 3VR5A 2H1LA 3IEVA 1DG1G 1HQCA 1GNPA 3OFNA 2EFEB 4Q1BA 5DI9A 3W6OA 1MOZA 1T5LA 3DMNA 1J8YF 1TF7A 2ZRPA 3LH5A 2Q6TA 4PTLA 1KIMA 3T15A 1HT2E 2QAGC 3FWYA 1M1YE 1X6VA 2GCNA 3SFVA 2GILA 4TL7A 4I99A 1Q22A 1W48A 2WMNB 2GEDA 1YZKA 5FL7A 4S2EA 2V6IA 4Z1MD 4CEJB 2FSFA 1RYFA 4TQ9A 4XOIA 3KKOA 4HAYA 4Z8XA 4DEYA 1XXHE 1FQKA 121PA 3AB3A 1E1RA 4URUR 3OEHA 5J4KA 4KFRA 4EAQA 3ZJYA 1W44A 3TAUA 1CJTC 4NTZA 4TYWA 4XJXA 2KJQA 3DL0A 1EFRD 1CEEA 2HDNB 4A0GA 4MRVA 3PJRA 3VHLB 2AWOA 1NVVR 1NN0A 4OQFA 4Q4JA 5FTKA 1E6CA 5SZKB 1F2UB 2AR7A 3N70A 4FCTA 1KZGB 4IDOA 1XJQA 4CEJA 3RRMA 3OFND 4MYUA 4LBWA 1OLOA 3BH6A 4B32A 4EUNA 5J40A 2XXAB 3KFXA 1QHGA 2JIZA 4C2UA 4BE7B 3IQXA 4X8MA 4JLNA 5JJIA 2QPAA 3N2EA 1ESNA 2Q0HA 4G5SA 1EFTA 2FEMA 5B57C 3ASZA 3KJEA 3I92A 5FL7D 2CLDX 1F2UA 4M1WA 4KLZA 4R2HA 2QROA 1L2TA 2ZI6A 4DEXA 2W00A 1G4AE 4LJ4A 2G0NA 1FW6A 4DLUA 3EPHA 1E1RD 2DY1A 3AH8A 4EIWA 1D8TA 3OEHD 2H7VA 3AVPA 4L4UA 3VR3A 2GCOB 4DCUA 1N6IA 3TRFA 2EWWA 3K9LA 1GAJA 3FHCB 4D0LB 3GJ4A 1COWD 2OBMA 4LJ8A 4M8NE 4MRSA 1H8HD 4HAXA 4HAZA 5TDHA 4GOKA 4FW9A 1E99A 1SVOA 1UBFA 1W0JA 1F5NA 3ADBA 1E9AA 4Q00A 1RJ9A 4OQNA 3ZZUA 1N6NA 3OIUA 1G8GA 5G53C 3VKWA 3SN6A 1E2EA 1JAIA 1XXHA 3AUXA 2GVZC 2JIZD 1GUAA 4XVQA 3UMFA 2ORIA 3A1WA 3CM0A 5KNBA 2IEZA 3I4LA 2GCOA 4K8OA 4WXPA 3CX8A 2AHOA 1TU3A 5IK2A 1NVUQ 4JLPA 1E2IA 3RS7A 1Z6AA 2WSSA 1OIWA 3GFTA 3GJ5A 3CF2A 4Z8YA 2GESA 4OI1A 1RPZA 3Q5DA 3NBYC 1FNNA 2IT1A 3PCRB 4JYCA 4LJAA 1TQ2A 3SNHA 4P4SB 3U7HB 5LPNA 2GAAA 3A6PC 3Q72A 8OHMA 4FINA 2O0HA 2RAPA 3TW8B 1DAMA 2ZI9A 2VSXA 1E2KA 1W2GA 2F1HA 2QAJA 2QZ4A 3EXAA 3KX2A 3QOFA 4AG5A 4OI0A 3EZ7A 1C9KA 1UADA 2EVWX 2QA5A 4NP6A 2C98A 4RFSA 2EW1A 1G8HA 4NHOA 3OZXA 2I1QA 2FNAA 2ZRAA 3A1SA 3GJ7A 4GRAA 1G8PA 3FMPB 3X1XA 3ZLJA 3KKNA 1W0JD 2ODWA 3U3KA 1S8FA 4NCHA 1P3JA 3C15C 3B1ZA 3X1YA 2YWFA 1ZCAA 1JR3A 1WE2A 2NPFA 3U6KA 4NPHA 2BM0A 3CF0A 4ABYA 4TLDA 2F1JA 3VAAA 5E7IA 2DWQA 4O2RA 3P20A 4IFEA 3KUDA 4S35A 4ZPXA 5LB4A 1E0KA 5IK2D 5TMPA 4F4JA 4PPFA 2IXEA 2WSSD 3PUYA 2GCPA 3MJHA 3PVSA 1Z63A 3HWSA 4XTCS 1ESMA 3QG5A 1CS4C 1WBDA 2WAXA 3MAAC 4JLKA 2PH1A 1Z6XA 3PR1A 2R6CA 2ZEJA 2ZIAA 4DSOA 3B8HA 4OHYA 2A78A 1U8AA 1U8ZA 3NH6A 3NKVA 2AL7A 1PVOA 4RD2A 1Q1QA 4C4PA 2VLIA 1FNMA 3IDQA 3CNNA 1KI4A 3VFDA 4EPYA 4UJ5A 3IPYA 5FTJA 3T1VA 3FKQA 3L8ZA 2IYRA 3A1VA 3WYGA 4C7OB 3GFOA 4QXAA 4GDFA 2ZRNA 4HUTA 3O8BA 4WW0A 2PJRA 1JR3D 4E07A 5HE8A 4FMDF 1GOTA 1LNZA 5FPYA 2D2FA 3W5JA 4TLEA 2QRNA 3KQKA 2FPKA 3KZ1E 4E5UA 4B44A 3B60A 1QHNA 2C04A 1MR3F 4F4IA 1OF1A 2BJVA 2YWGA 1AM4D 1ZUIA 2GXQA 4HUQB 5CK5A 2CCKA 3RNLA 3VR2A 3U2QA 2EQBA 3ADDA 2YZ2A 2ZRDA 2OFWA 1EX7A 4C7OA 3B9PA 4AG6A 1N6PA 5DH9A 5FBRB 2Q9CA 4QGFA 4U7DA 5P21A 1RC8A 4CEHB 3OIVA 4IDPA 3GP8A 3K70C 3NDBB 3THWB 1KDRA 4M4SA 2ZRKA 1NG9A 3U3RA 4U5XA 3CRVA 4LYJA 2QRZA 4ZKDA 4TLCA 1IN6A 4QJ4A 1FZQA 4JBWA 1O87A 3TE6A 3LXXA 1BYIA 1C1YA 1U99A 4ZKEA 5HR5A 4HUQA 2QBYB 4ILEA 2HT6A 4WOPA 3C8UA 4HAVA 5HTKA 1GFIA 4H1UA 1EX6A 2WWXA 2YOFA 2CVHA 3HU1A 4GFDA 3I72A 4JLOA 2DB3A 3FMIA 4JVLA 2V4ZA 2ZI7A 1M74A 3MWKA 4QGAA 3I3SR 4DLVA 4NL4H 1I4LD 1QHHB 5KDDA 4Q47A 4QBHA 1Q21A 4LPKA 2E87A 2RCNA 5TXGA 2C9CA 3VX4A 2XB4A 3FKSA 4TN1A 3IBYA 2IHBA 4JJKA 4CRWB 1J90A 2JLXA 1G16A 3ZZ0A 4BFYA 2P5TB 5CM8B 1ZBDA 1NVVQ 3R7WB 2BCGY 3I61A 5TV2A 1WP9A 2ZSAA 4JSTA 3TSWA 5BW8A 4A8JA 2ZE7A 1RRCA 2YWHA 3Q7QA 4GPTA 4B6FA 3D31A 1QHHA 1R5BA 2H8KA 1N6HA 2OSBA 4TZ0A 4DUGA 1BH2A 1G18A 3FMOB 4BGDA 4DSNA 1CJKC 5FPSA 2BMEA 4QNMA 2PLFA 3KXLA 2HYDA 3T5GA 1RW4A 3GLIE 3LV8A 4A6PA 1TAGA 3ZD7A 1JI0A 2I3BA 4M1KA 4DSUA 2FMXA 4AD8A 1Z0FA 4OHZA 4QBFA 3NXSA 1OXUA 1XMJA 2ANCA 2IYLD 4V02A 3BH0A 1WBBA 3FKSD 4LBYA 3I32A 2X1VA 1L4UA 3B1WA 1AK2A 1R0XA 2J87A 3TR5A 4QL3A 1DELA 3OE7A 3D7MA 3VNVA 1FQJA 4OQXA 3WNDA 5TB5A 1TMKA 3LRPA 5HPYB 2HF8A 5JCZA 3VR4A 3L0PA 4JBXA 3GLHB 1US8B 2VHCA 4MITA 2VHUA 1P2UA 4B2LA 4ZDJA 2ZR0A 1Z0JA 4R7ZA 1ZNXA 1NL3A 4Q7KA 2P6NA 3AVWA 4DUGD 3NH9A 5LD2C 1FL9A 1HYQA 4XWOA 4A36A 1QF9A 4ACBA 2I4IA 4JMPA 3IBGA 1JECA 3ZVNA 1ANKA 1SXJC 1ZM2A 4KYUA 2B8WA 5FUVA 3DKVA 2C9OA 3TQFA 1SQ5A 2QGZA 2RGXA 4Q1CA 3FTQA 3TK1A 2PZFA 2A9KA 2WMOB 4GNKA 2JJ2A 2OZEA 1WDTA 2Z0MA 3X2SA 5FI0B 3IGFA 2QI9C 1W5SA 3GD7A 1E94E 3QXSA 4PZLA 3LD9A 2ORWA 3CR8A 4EDHA 1UAAA 1YVDA 4C0AC 2GF9A 2NOAA 4US2R 5FOSA 2GAOA 5F9HA 1ZNYA 3P1JA 5CIQA 3W9YA 1CRPA 4DB4A 4ARZB 4ZI3A 3P32A 2CLCX 3CIOA 1Z06A 4X8OA 1XPRA 4M2LA 4US1R 3Q3JB 3BIFA 2GA8A 4G01B 3GLIA 5LD2B 2WICA 5EUQB 4ZDWA 2W0SA 3GFPA 4W5WA 4L16A 2IBMA 4MYTA 1VCIA 5B2ZA 1KDOA 1CXZA 1KI6A 3QXJA 2FWRA 3EC2A 2V54A 1TEVA 2RGGA 1JJVA 4LBVA 3U44A 2NGRA 3AF2A 2RGEA 1XWIA 1XX6A 4FWIB 4RZXA 3REGA 4EPVA 1CRQA 4CT5A 2GZHA 1WXQA 3TH5A 1II0A 4XTRA 2J0QA 2F9MA 4A2PA 1KDTA 5FOXA 5CB6A 3IILA 1M34E 2WKQA 2RHDA 4RCYA 3RANA 5K8UA 2JJ2D 1U81A 1G7SA 5DI3A 3B1XA 1W46A 3MGCA 4LJ9A 4O0MA 4Q4AB 4BQSA 2WWGA 1OW3B 3EZFA 3AEZA 4IXNA 1AZTA 5FUYA 3CZPA 4D0GA 3R9XA 3TJZA 1F3OA 5AJZA 3RRNA 3Q85A 5GVSA 3MLEA 4AWXA 4DSTA 5J4HA 4Y0AA 5HZKA 4GOXA 2ZRLA 5KHOC 1GRNA 1R0ZA 4Q5IA 3E70C 1ZIOA 1UF9A 1VMAA 2DYKA 5FI1B 1RRFA 3PUXA 3KQHA 2UKDA 3HPRA 1CR4A 1II9A 4TQAA 2VP6A 1XTIA 2XSZA 4MKHA 3E1SA 2QTFA 1R6BX 1YZGA 4LI0A 4BRWA 5IT5A 3NWJA 5KTYA 4DHEA 1OH7A 1TPZA 2ZE5A 3FPAA 4C30A 1W36C 4NYIR 2YYZA 4URWR 3RABA 2XB2A 4PHHA 4PHTA 5CLLA 3BB1A 2FPLA 2AD5A 2OXRA 2OFOA 3RHFA 3CR7A 4KFTA 2PZEA 2Q3MA 4L8GA 4Q9LA 2NIPA 1YZUA 2QENA 3KKMA 1Y3AA 3QF4B 1X3SA 4MUAA 2XX3A 4BLRA 5AUOB 5FOWA 1EFUA 1U0HC 3CPJB 3OIWA 2MSDB 2NZJA 2ZU0C 1E0SA 2REBA 2ERXA 2QN6A 4KVAA 4EPTA 3CONA 1ODFA 1H8EA 3WNBA 3OIYA 2V1XA 2CBZA 3PEWA 2JGNA 5JRJA 3ZQJA 2G77B 1ONBA 3M4YA 1QHYA 1B0UA 2HCJB 3E5HA 3A4NA 4PO1A 3V00A 2B92A 2JJ1A 5KPDA 5KO2A 4YONB 1XCMA 2ZSFA 2VPPA 2MSCB 4RZ3A 3SYNA 3AV0B 2W0MA 2XSZD 3MRSA 3ZDQA 4BLSA 2ZVQX 3RWMB 1UBGA 4LC0A 3VTKA 2ZJBA 3L0IB 3EX7C 3SR0A 3SHFA 3VNUA 3K9NA 3AM1A 4CT4B 4IKEA 4PAQA 1UEJA 4IDQA 3ZS8A 3LBIA 3IIJA 2D62A 3LQQA 3CUEF 3N5CA 2GZDA 4LJYA 2A2ZA 1C4OA 1P5ZB 4DLYA 1BIFA 2G9NA 2XEXA 4FCWA 5JI2E 2WBLC 3QKSA 1Y63A 2QTVB 2RGDA 2PL3A 4A0HA 3UMSA 1H8ED 1G5RA 4ZCIA 3U3MA 3AGQA 2BWJA 2WJGA 3K0SA 1M2OB 1F48A 3ASYA 4C0HA 3MSXA 2FU5C 4B74A 4EFLA 3HPQA 1V5WA 1LF5A 3HYTA 3GMTA 1DARA 1R0WA 1SZPA 2KWIA 3LO5A 1QG4A 4M9XA 2KB0A 1MV5A 2IYWA 2R6AA 2O8CB 3AKDA 4YMTA 2J9RA 4Q48A 1TADA 1YZLA 1E79A 2B6HA 2GZAA 2ZRJA 3MJRA 5K8TA 3P4YA 3AKYA 2DWPA 3C41J 2OG2A 2VP4A 1OV4A 2AXNA 4M0LA 1ZIPA 1GZSA 1NIJA 1W2HA 2D4HA 4YLGA 2F6RA 1NIPA 5JJLA 2P0EA 2WWYA 2IC5A 1VYTA 2KSQA 4Q66C 2H92A 4A82A 4DCSA 2D06A 1LV7A 3DM5A 5IDVA 5L3QB 4HLQB 4OHVA 1DE0A 2GRJA 4ON9A 4C9BA 1T4GA 5EE3A 5G41A 1NN5A 2FV8A 3EIHA 4LK2A 4KV9A 5CM9C 1OH6A 4B2PA 1BOFA 1D2MA 4AYXA 5K8IA 1DBSA 4URZR 5SZIA 3G5UA 1UKZA 5E4FA 3AP1A 3MD0A 1Q12A 4JL5A 2VSOA 1UBCA 4PR0A 5FOTA 3O8RA 1A2BA 2QM8A 1PJRA 3T34A 4BLQA 5L3QA 5ELXA 1P2VA 4MQBA 4UNPA 5KDOA 3SZRA 1HURA 4V0LA 2WIAA 2VQSA 3FFAA 4G3XA 3RS3A 1Z3IX 3GJXC 5L3VA 2BIFA 1BKDR 1G7TA 3O8DA 3A36A 1SHZA 4HB0A 1GKYA 4A0RA 2HV8A 3L43A 4L9SA 1IXRC 621PA 2NZ8A 2WWIA 4UXJA 2LKDA 1ZW6A 1XTRA 1IQPA 2VP9A 1OKKA 1MABB 3RSOA 2XOKA 1SVWA 1P72A 4CZ2A 2G83A 3QQ5A 3L8YA 4P4UA 5BYJA 4ESHA 1Z5ZA 4AKEA 4BFZA 1AS2A 1VG1A 1N6LA 1E9RA 2Z43A 3GEHA 1P9WA 3HJNA 2B8TA 2ZJYA 1PLJA 2ZR9A 5TVKA 2ZS7A 3VU9A 4V03A 5DHFA 1ZYUA 4DLXA 2NO6A 1CBUA 2ZI3A 4LDJA 2C03A 1IM2A 3T1TA 2FDCA 4MGIR 1SGWA 5LB2A 2BBOA 4KODA 3CB4A 3GJ0A 1MABA 2PEZA 2V3CC 3UIEA 4IEIA 1GDDA 2CK3A 4UNQA 1CF4A 2NO7A 4TTPA 5JHHB 2REXB 3C5CA 2PCJA 2ZU6A 2KE5A 5G3ZA 4HZUA 3K09A 3DPUA 4Q4JB 1XCGB 2QP4A 3BGWA 4YDHB 2GEVA 1L8QA 2OAQ1 4GI7A 1XMSA 1OPXA 1T3SA 4A15A 3TBKA 2W83A 2VHTA 2ZXUA 3ECCA 4D0NA 1JQLB 4LHXA 5DN6A 1QHXA 2GEUA 5KSPA 5JLJA 4HLDA 1OKKD 2WWHA 2XOKD 4OI2A 1Z08A 2JCSA 1DEKA 1O3YA 1XTJA 3BORA 2DHRA 1OE0A 1HY3A 1QHSA 3B13B 2CDNA 2X2FA 4JS0A 1ZVQA 3GJ8A 1FX0A 5TARA 4AC9A 1RFLA 1RRGA 3NHBA 4B35A 2OFXA 3IEUA 4IDHA 1JAHA 3T5DA 4DLTA 1GKIA 1Z6GA 4L5BA 1R4AA 5DGXA 4BLTA 1AQYA 4LZZA 1HH4A 2AFIE 3B6EA 2A5YB 3EWSA 4C3ZA 2R2AA 4B6EA 1K5DA 2A5JA 4BLPA 4Q03A 1KMQA 1A5TA 4NYIQ 3SE0A 4Q21A 2ZYVX 5IF9A 4FWTA 3GJ3A 4DIEA 2JA1A 3CRQA 3FMFA 1N0WA 4Z51A 2ZJ8A 2QE7A 2CK3D 4M1SA 4OHXA 2QUZA 1VCOA 4IOJA 4UNRA 1XEFA 3ZS9A 3BERA 2XTZA 1QZXA 3K9GA 1ZINA 2ZETA 1DAGA 1G5PA 3IHLA 3LY5A 2BOVA 4DVGA 4RSGA 4QC2A 1LB1B 5DN6D 1RJ9B 1ZU4A 1XXHB 3RS4A 3FB4A 1N5KA 3RLFA 1WF3A 2FN4A 4A0FA 1RZ3A 4GZLA 4LHZA 2IXGA 4JSYA 3AVTA 2CLSA 2WHXA 3B2EA 4IVQA 2QT0A 5HZHA 3BE4A 1DS6A 3LDAA 1KO7A 1YKSA 4LCBA 4D80A 3THYB 4B3FX 1UKEA 2CVFA 1S1CA 4YDSA 3I73A 1J7KA 3X1ZA 1L4YA 4QM7A 1GL6A 5H1YA 4B3GA 1NN1A 1IN5A 3AVYA 1RVDA 5FUWA 1XPOA 1S9DA 3RRYA 4D25A 3BOSA 3U60B 4HDQB 4PHGA 2QE7D 3S1AB 2L0XA 3NHAA 1H65A 2HJGA 3EAQA 4GT1A 3TUZC 3KXIA 3WP0A 1TUEA 1GNQA 1AN0A 1UBEA 1EFHA 2GNOA 2WJIA 2ZSEA 3NG1A 4RFSB 4R9UC 5DSZA 4BFSA 1I4DD 1YZNA 5L8VA 1ZAKA 1P4SA 2E9SA 1KK3A 1OIXA 3OAAA 4I1VA 4EJSA 1JPNA 3ZD6A 3THYA 1JNYA 4F38A 4DT1A 2B7CA 4TT3A 3QBVA 4PQFA 5EP3A 1ZD1A 3BS4A 1D6JA 2ZITA 4GL2A 2YKGA 3QNUA 2JAQA 2QQEA 2BJWA 4LYHA 5B30A 3QF7A 4D82A 2QEQA 2R6GA 2FFAA 2J0UB 5EE0A 3S1AA 2QORA 1KY3A 1F2TA 2Z4RA 5FBQB 2A3RA 4TYNA 1TEXA 2IYTA 4KBGA 5GJWC 4CIDA 2YOGA 4MGKR 2QY9A 5DNYB 4CEIA 2VSFA 1KNXA 5KNDA 2OBNA 3PIRA 4US0R
chains in the Genus database with same CATH superfamily
5I7WA 4BZXA 3BF8A 5TQ2B 4IXTA 2RHWA 3BXXA 5HIAA 1E3SA 1X80A 4ND2A 4KV7A 3K9HA 4UAGA 2FA9A 2ZAYA 3OPMA 4N3BA 3W6NA 1LDEA 3W8FA 1D9XA 1JEQA 2MHCA 2PU5A 4QHSA 1VB3A 1R2QA 5HCNA 1N6OA 5A3JA 4N54A 3F7NA 4N6GA 4ENSA 1HDOA 4JLJA 3KOMA 4R98A 3R41A 1MVNA 2RH5A 4H7KA 3U56A 4Y2JA 3SF8B 2H2GA 4H0NA 4QT0A 4TT3D 3TR0A 2R86A 3EQ9A 2Q1YA 1Y37A 2UZAA 4G0XA 1GCIA 4Z3OA 1JI3A 1G3RA 4QPNA 3KXKA 1U7WA 5CW2A 1NY5A 1OHHA 3IUSA 4RZ2A 2ZYAA 4RESA 3AEYA 4JI7B 1DB3A 1Z82A 3L7NA 2OZVA 4ND4A 1NSFA 3B12A 2WUGA 4CR6A 1HG1A 1FP4A 2GX6A 7GPBA 2BUBA 1KS2A 2Q3EA 3FGNA 3IVXA 3N76A 3Q0TA 1H0KA 2RH9B 3LKZA 4H7EA 1KR5A 2R8PA 3OM0A 4Q1DA 4IGAA 1NI3A 3RASA 3RS5A 5LP6F 1T0BA 1V9SA 4D5GA 3I6BA 2AN1A 3OFJA 3WBKA 1EWVA 2X8AA 2ZCJA 1UXOA 1OTXA 3WGOA 1XQXA 3RT1A 3S28A 4AJIA 1WDLA 2P2YA 4OYRA 1K97A 5KNDD 3K1AB 4LF9B 3H4MA 3IAXA 2A5FA 3NHUA 3HBFA 5J4LA 2YV5A 4IVRA 5COBA 1CRWG 2FUG6 1I1NA 3EOZA 1D6NA 1I0LA 4CV1A 5CXSA 2XGJA 5CTJA 1X8KA 1C29B 4OGWA 1N8TA 4S24A 4OLFA 1YA4A 1S6YA 2CXRA 2PYIA 3OQBA 4KPUA 3TL6A 1AV6A 3SBOA 2BI4A 2XNDA 3GEIA 3AVXA 3D59A 2O2IA 4AB1A 1NBAA 4PLPA 4JHXA 1IZZA 3S2GA 3HUFA 5IDWA 4QBIA 3DUFB 1XZCA 2JCGA 4LVOA 2BSAA 2APJA 3RIGA 1OHHD 2ERCA 2HC9A 2XEDA 2ZIVB 3V1MA 2VK2A 4MJLA 3QPVA 5KYTA 4YGYA 1N5LA 3DHNA 1Z56C 3CPEA 3K7EA 4RMNA 5IKEA 1M1NA 2O7NA 2B2CA 3C4JA 2OY0A 3DTNA 4NR0A 3SSOA 2FFQA 1UJ6A 3OQPA 4M9ZA 1N9ZA 5SY4A 4PHFA 2BKXA 2ADMA 4GLFA 5GONB 4RKWA 1R9JA 2R1VA 1QTRA 3ECSA 2GBGA 2PUWA 4MVJF 3KFLA 5FWYB 4FKZA 2V7UA 2XQIA 5KAMA 3W2HA 4CQMA 4E5PA 2QRPA 4JXXA 4DY4A 3SQMA 4MQ6A 3ZLBA 3IULA 3AKZA 2OCLA 3MNFA 4JROA 3K9CA 2BTOA 1LTQA 1FFXA 1L7VC 1WCXA 3IE2A 3P2YA 4D0SA 4W9MC 3OTOB 3G2JA 2IOHA 5KX5A 1NVMB 1XKXA 2B78A 3UJ3X 3DMYA 4OQ4A 3NUZA 1T5IA 2AMVA 2RGBA 4GLLA 1NQUA 2RH8A 3R5HA 4MWZA 1ZH6A 2X5OA 4OKSA 2H17A 1G8JA 4PRZA 2Z30A 4J3NA 1U2RA 2CL5A 1L8XA 2I2DA 4QOFA 3S55A 4A8HA 1K0UA 4IFIA 1K3TA 4JNCA 4X9XA 3UMJA 3UT5B 3B1YA 5H8WA 2CYBA 1GZ5A 2UYYA 1VSVA 4Q12A 1X94A 1XZDA 2Q50A 1HOTA 2EYUA 4DXAA 1VG9B 3ETJA 2J48A 2J5RA 2RHTA 2ZYUX 4FC6A 4QBGB 4XFDA 3ADOA 1KMCA 1JQKA 4WN9A 2QM0A 5DPMA 3RJZA 4CV2A 4P80A 3N8DA 3HWX1 3P2OA 3BBLA 2GXUA 4G9BA 4NEGA 2X0DA 3NALA 3WLNA 2JGEA 3IUBA 4HL6A 4YJ3B 2M9MA 5IJZA 4IDCA 5CCBA 2O50A 5EPUA 1V16A 2B30A 4M98A 2ONJA 3RQIA 3LP5A 1UMCB 3L9XA 4BO8A 1FB5A 1QU2A 4I46A 3HB1A 1VHJA 1ORVA 2CV2A 4CQMD 4EYSA 3BGSA 1N6RA 5BQXA 4BRZA 3EXHA 1Q17A 4KQ1A 1BNCA 2B20A 1CYDA 1QRTA 3DHWC 3SHWA 5CLQA 2P1DA 4GVLA 3KQUA 4LOAA 4RSMA 4ZAGA 1UKVY 2GYUA 5D3MA 5DDIP 1SOWA 2IE8A 1H69A 2QRVB 3WE7A 3BTUA 5BUZA 4MDEA 3SYTA 1EFAA 4UBNA 2ZRQA 4L02A 1NPTO 2H1HA 3MWJA 2WIGA 4AXXA 2YXNA 3L8MA 4E09A 4YO8A 2WHQA 5CA0F 2ZBPA 3K5PA 3AO0B 2QQGA 2GN0A 4Z4EA 1DIRA 2DWUA 5TS3A 1NLZA 3GRCA 4F9TA 1IVSA 2F8LA 2PX0A 4HN2A 4J0QA 4BATA 3MK31 2ZUTA 4OGGA 4AKHA 4GL2A 4OG2A 2W6JA 1G8MA 2ZAOA 5FTMA 3OMXA 2FFBA 4MGHA 3CY6A 3L6DA 4LDNA 4FZJA 1J0EA 4KHZA 1KC1A 2J7PA 5GJCA 3DMRA 4XWKA 4NDZA 4I81A 1CB0A 1IJKA 2NQTA 2R7KA 5ALFA 4B7ZA 1VPWA 3HNOA 2B4KA 4G26A 3SLKA 1T3LA 4A9AA 5L3SB 1DINA 4XM0A 3GUHA 2Z4SA 2YRWA 4IG4A 3RC7A 2PGNA 4EPWA 4JDPA 3ZDAA 3IAS6 2P9JA 2C58A 2CXUA 2JLUA 2HSZA 1AUPA 4M1MA 2VDPB 4ZYXA 4TM8A 3DDWA 2O1EA 3R6LA 3AKCA 4Z4IA 3M34A 4C3UA 3GH1A 1GARA 1ZGHA 3MWYW 3NZEA 2BM9A 2MSEB 1XZMA 2NO0A 1HDGO 3ZV3A 3VQTA 4PAOA 4G1CA 1KI6B 2I2CA 2PKWA 4D0RA 1XRQA 1U8UA 3FRHA 4BZQA 4G81A 4TYQA 2Z8YA 2OYSA 5FAXA 3WLKX 5DXAA 1BCRB 3QV1A 5IN4A 1EBUA 3OE7D 3ND7A 3WY9A 2D1SA 1FDTA 2YHSA 3EH2A 5JARA 2WSBA 4MS4B 1Y9AA 1YQDA 1OC4A 3UKOA 1JTVA 3ROZA 5A05A 5DT9A 4E2WA 1YFJA 3DWFA 1DDIA 1XOIA 4XEHA 4YRZA 1MB2A 3G1WA 2BP7B 3B3QA 4TWZA 2IODA 1U7OA 2W6JD 4E11A 1PX2A 4DLPA 5IFKA 1QNFA 2C0PA 1EGHA 3RGWS 2NNLD 3NO4A 1BU5A 4MUYA 4US0R 4Y9SA 4AYWA 4BLOA 1NNEA 2I9PA 1ZX1A 2J7PD 1PJAA 2GK7A 2P69A 2J09A 1C7JA 5DYNA 5KAPA 2P4SA 2AN5A 3U9LA 3KOWA 3H11A 1BXGB 2XCSB 3ZHYA 1TD1A 3P2JA 4G2NA 3VAZA 2X5NA 5EIHA 1BTOA 1P7WA 4YMGA 1ZGJA 3E2IA 4QBTA 2A9JA 4BMSA 1ZGGA 2BTQA 2P4UA 3AY0A 5LJLA 1USWA 2WG1A 3A1UA 3FTNA 3LLCA 3PGLA 3EC7A 3PIIA 4D2IA 3W79A 2RHBA 3ENQA 4BNFA 1FYWA 1R18A 1PQUA 4H4EA 2RGYA 4LGYA 4E7OA 1SCUB 2H4WA 2PQ6A 3CEJA 3G0CA 3R24A 1J9ZA 3ZDYB 1SVNA 2BLLA 2NZ2A 2BUCA 3D81A 3KVYA 3D0KA 4P3YA 5FV7A 1Z83A 1L0BA 2ONYA 3I5YA 2MINA 2C8VA 3DEFA 3RSSA 3LUCA 3ZNNA 5K51A 3MCAA 4ZAFA 1PD0A 5CEEA 3NFRA 3PEEA 1W85A 2AZ4A 3V48A 4DYVA 1JXAA 1E7MA 1UWVA 2OXCA 4JC4A 1E4EB 2AMYA 3JR3A 3N0TA 4TMXA 1W7AA 1MQ9A 2P3LA 3VR0A 3HXKA 2C7RA 4ZO4A 1XQ6A 2OZLB 1QE0A 3DNFA 3M9LA 4TV9F 1Q14A 5CH3A 1DO2A 1K9SA 4YMSA 5AQEA 3UG7A 2Z2XA 1N2OA 3IHKA 2HUPA 4DBLC 4RDXA 2BM8A 1PV2A 2QRMA 2YJ3A 1A7AA 1GGJA 4NDNE 3UICA 2B4YA 5C8VA 4ZRMA 1XD9A 4PZAA 5DWQA 3UWOA 5CX1A 3IQIX 2VP0A 2FFRA 3IP6A 4RWZA 1DHRA 1SCAA 1WDKA 4V0OA 3AF0A 3RC2A 5CG2A 3SKXA 2BHRA 2EFGA 4I4TF 1O6ZA 4IP0A 5AJXA 3HU2A 1JU4A 3BTVA 1UXGA 4YRQA 4G67A 2ZPTX 2PCLA 1XZJA 1N75A 5ELMA 2PWBA 4R1UA 5JT1A 2PMWB 3RKUA 3GFSA 4BIMA 1E32A 4XDHA 3MIZA 1BXKA 1D2RA 4U9UA 1SXPA 3RYIB 2ID8A 3ETNA 2WD7B 3IPRA 3JWEA 3ZDBA 3KHKA 5HILA 1BOOA 2PGLA 1Z5UA 2H51A 3PNVA 3UANA 3KAQA 2RGRA 3VKFA 3ECAA 3NBXX 3BH7A 4BFWA 4RTSA 2BI7A 3MC1A 5BR4A 1OFUA 3EWAA 3SJZA 3ZWYA 3ZCQA 4YJHA 3IUMA 3TEMA 1YR3A 3MRTA 1OA1A 2F8TA 5B58C 4UDOA 5EL0A 3AFHA 4KRFA 1KMHA 3SX4A 4HXEB 1DKPA 2Z95A 4EBFA 5JECA 4TVKA 4XM2A 3R5TA 4U2DA 1M34A 3IPXA 2X77A 4IIJA 4Q4LA 1P3Y1 1Z36A 2ZKIA 4PXSA 4UHHA 5EA2A 4KR9A 4D46A 4CTOA 3I5XA 2HYIC 1IOLA 1QH9A 2XRYA 2ZOSA 1KK1A 4KDCA 3WMGA 1PE0A 4XIIA 3ROMA 3D7SA 3GEMA 3FNEA 3EZYA 2ZIXB 3QENA 4EAAA 3U09A 1THMA 3AVUA 2OM6A 3NEJA 4WRRA 1Z2EA 4WXRA 4YC7A 2M32A 4RC9A 3SCZA 2IZ5A 2ONCA 3KPWA 3HA7A 4G4SO 3FLMA 4RXMA 5BVGB 1ZAYA 4TLLB 5A4KA 4BLUA 3VNAA 3EW9A 3HSKA 4ZV4A 3GCXA 1DQSA 3V7UA 1MV8A 2ZTHA 3ELYA 5EPOA 5E6UA 1P1BA 1NF3A 1ZD9A 2O7RA 1XZLA 4GP7A 1QFYA 3VZQA 4TTRA 4KNYA 1E1LA 1K7FB 5TLSA 4JJAA 1CVIA 3RVLA 1Y34E 1DUVG 3KKEA 3KUXA 4JP1A 4U7WA 1Z7GA 3IJEB 5DLQC 5IMSA 5FNZA 4WGFA 3NHYA 2DG2A 1SG9A 2G6BA 3BRSA 1PQ4A 1YMQA 4OYLA 3KDSE 1YRYE 2X3FA 5D1HA 4MS1A 3W1EA 5BV2P 2VH5R 1PR5A 1Z16A 1SULA 1Z29A 3QM1A 4UU0A 1VJGA 1TVMA 3L6RA 2BAGA 1XTSA 2OHVA 2Q2WA 2YHAA 5JAQA 5KOYA 4OL9A 3FFTA 3WB9A 3I2KA 4BEJA 2HSEA 1ULAA 2YQZA 3L6BA 4B3CA 3PRKE 3PE4A 1S2OA 4Y8VA 1JLKA 2XTMA 3AUJB 1R7RA 4F11A 5BUSA 3GPBA 3ZU3A 3ODGA 4XYBA 3FCCA 3HCRA 3FVQA 1WO8A 5KYUB 2YDYA 4FZ3A 1NNLA 3KEQA 4UZFA 4AKGA 5HIMA 5KYWA 1GL9B 1A71A 2JJYA 4H1VA 2CWDA 3PCTA 2C4UA 2AF3C 2CXQA 2ZUUA 5FWAA 4CCYA 3SE7A 1NW4A 2IXDA 1CJMA 1JDJA 1GIAA 1AC5A 2PZGA 3GLKA 2OBBA 4ZT2A 5FAKA 3BHNA 4HNUA 2XBLA 4C7VA 4R1QA 4B4KA 1PK7A 4CL8A 1HE2A 3LHSA 5KU1A 2ZB4A 4OTZA 3IV6A 4GKAA 3B7WA 4CN8A 1FOEB 1DOZA 4ZHSA 5HJ7A 3DDCA 4JLUA 3PPYA 4I3GA 1TAUA 3FFBA 3VC2A 2FPOA 3TQCA 2Z1NA 3ZCUA 4R8VA 3CWQA 4X8LA 4DAEA 1E2HA 2VSQA 4K88A 1Y6JA 3IKVA 3ELUA 3K3PA 3MWDA 3L8EA 3O9MA 1JQEA 3BXZA 4U7PB 5FDFA 1AUVA 2IYVA 2HZBA 2I4TA 4DLAA 4DY6A 2JLQA 2X4DA 4LGVA 1KFJB 1S7GA 4KLCA 1K63A 3V7WA 4NIMA 5CXUA 3G9QA 4Q4HA 3DMHA 3JAKA 2GEKA 3QKRA 3QEMA 2DFVA 4EEKA 3WMWA 3QWAA 4OMUA 5GZ1A 3JQGB 1EFCA 1MXHA 2L19A 3DE0X 2PEYA 3IP5A 3ZWCA 4JASB 1EUDB 2X3UA 3HNRA 3JAWB 4OQYA 2BFWA 3B52X 4RIFA 1D1SA 3O4VA 3RUIA 3W6ZA 4KHPB 1OMOA 3Q15C 3KPVA 4UDNA 1Y1LA 3ESQA 4AROA 1SHLA 2QQ5A 5T8KA 3I8XA 3UH1A 1EYZA 3N8GA 3BFXA 4LMAA 1M6EX 1ECJA 3SIPA 2A5LA 1I2BA 4U2KA 2C8KA 4DDWA 2FPPA 3VPGA 4FMBB 4GAEA 4V1CA 10MHA 5JV5A 4Q9JA 2EEPA 3JD4A 2ID7A 4QREA 1X14A 2HDOA 2CE7A 2P67A 2OXEA 4PPNA 2VQEB 4M22A 1OZFA 1F8YA 3BD6A 1KSHA 4N0PA 5DGIA 5ED0A 1YQXA 1Z6PA 1Y81A 4AO6A 1DT5A 4GP6A 4NCJA 1H9AA 4R69A 2FMTA 2ENWA 3R0JA 2NO5A 1NTOA 1XJ5A 3AGPA 1OXMA 1UDXA 2Q1WA 4CLOA 1BEZA 1TZCA 3TSAA 3SPXA 5JH7F 2QJRA 3ST7A 1T5SA 1F0KA 1JDSA 1ZM9A 4NBLA 1GFWA 4EA9A 3O5AA 3Q87B 2HPAA 3ZTWA 3KKQA 2VPTA 4IHJF 5TQVA 2Z6VA 2O2YA 4QVKA 1FX0B 5AP9A 4DM7A 4RHFA 4LVUA 4V1CI 1EFRA 1ZY2A 2PVCA 5I4KA 2JK0A 4C4AA 3OJWA 3QU4A 5BSKA 1NVTA 1XCPA 2AVNA 3WRWA 3KQLA 1HZZA 2O8EA 2HL6A 2YVKA 1J0XO 2ZIGA 4GYYA 4CL2A 2VA8A 3NT2A 1AN9A 3IBCA 4Q6WA 4X7BA 2QPTA 3H16A 5JZBA 1XRLA 4X7RA 2OT3B 2X5XA 2H5IA 3ZWKA 1C3JA 1RBYA 2V7EA 3M9WA 6PFKA 4ZZ3A 3KETA 4BJHB 1WHSB 2GR9A 1T9ZA 5J2TA 1H2XA 4NBUA 2NO4A 3IAFA 1BYUA 4AF7A 2Q1SA 3W9SA 3SLRA 2DUWA 1GVNB 2DSNA 3C8ZA 5ENDA 4Y2QA 2HJ9A 1OASA 1P33A 1PG5A 2R6DA 3QEOA 4NFYA 3HVUA 3ZJUA 1LI7A 4UPDA 2JFWA 3DXYA 3QSGA 3OTHA 1K3FA 4NAUA 2G71A 1E5LA 2JLWA 4C0SA 2XD4A 1TJ4A 3PD1A 3WLHA 4JQYA 3JASB 1QO9A 3EWIA 3FTPA 1AXEA 4MB0A 3CIFA 4MRAA 1WLSA 3UK6A 1DPGA 4ZCMA 1Q0UA 3UUGA 4PYLA 4LHYA 3SI7A 4PXAA 1ZOPA 3FOFC 1QXSA 1NDUA 2FSVA 4MDYA 1DAFA 1M75A 4HYTA 3TL3A 3FCUB 2Y0DA 3VZPA 1MEJA 2DCUA 3T4PA 3QPAA 3D02A 3ZTTA 3FVRA 4WI1A 5KYYB 1GL7A 3WRYA 5HW0A 1TI7A 4NV0A 4UARA 3HVJA 4FD2A 4TTIA 1DJMA 1C9EA 4XJVA 1TM4E 2EJWA 1EVIA 1DPFA 2QXUA 3AR4A 1KJZA 5C5CA 2VDWA 4O4LB 4DILA 1Z7WA 2H48A 3KJZA 2CSXA 1WSDA 3L6OO 2A4KA 2W93A 3F6PA 4X6LA 2IYPA 3OPYA 2H2AA 2YQ5A 3YASA 4KAFA 5LSAA 2F55A 4Z9BA 4NVRA 3NM4A 1W96A 4G0MA 5JEDA 4W5OA 4KBFA 3LKDA 1RWQA 4JZKA 4AXBA 3Q7PA 3G0DA 2BFEA 4H17A 2RONA 1ZNWA 4FYYA 4PGMA 4F5YA 5BWBA 1CZNA 3BD9A 4NE2A 4BMDA 2WUWE 2HTFA 2VYFA 3VR4A 4A7PA 1Z6YA 1NG1A 2E18A 1YZTA 4DQ0A 5JAMA 3UAOA 2C3YA 2DVMA 1QK3A 2FTKE 3R40A 4M1TA 1TTTA 5J2UB 1KSFX 3T38A 3WMRA 2NYRA 5EMLA 2NSDA 4PG4A 5A3SA 2IYSA 2XXAA 4KFSA 5EZYF 1V8DA 3OTWA 5JRZA 1KI1A 1Z8NA 1K7SN 1ZC4A 1H0HA 2QL7A 4ZOLF 2VXOA 4FXOA 1Y8AA 3DLCA 1HLFA 3CEMA 3BL6A 3OPYI 3PQ7A 3QXXA 3RYHB 5KYXB 3V1KA 2ZJ1A 4JR2A 4UQPA 3KUCA 3N28A 3ROQA 1JG6A 2P5SA 3Q0IA 5IC5A 1ORRA 3I6IA 5JFGA 4FCVA 4OGKA 1H9BA 1PAUA 2PKQP 2R1TA 3JRWA 5AKHA 3W05A 3PXBA 2V5VA 2WSLA 4IIDA 4OIMA 1XEXA 5GPBA 3ZGVA 2FG5A 4D41A 3NP7A 3IQHX 4K05A 2HLDA 3ACBA 4GWLA 2GNAA 1PFKA 2FKAA 5AESA 1EJ2A 1Y3BE 3C8MA 4C6RA 2JATA 2O8NA 1POXA 4WACA 4LC1A 3CVXA 1BN7A 1YDGA 3LWZA 5KJ1A 4UZEA 3FWHA 4ND6A 2CL6X 5JI3E 5K3SA 2BONA 1YZHA 3E84A 1YQTA 3O90A 4MRPA 2F17A 1D04A 2LR0A 4NXMB 4RV9A 1D07A 2PUHA 3G2HA 4WGGA 4RJJA 1G8SA 3IXLA 1HDZA 5ETJA 4RQUA 3L0ZA 4DLZA 5HGXA 1TKRA 3P0IA 3U7QA 3W6PA 4F04A 4AIRA 1SEVA 3TSZA 2PXXA 3DC2A 3TQQA 1QC5B 2HCTA 4ICIA 1ZGZA 4IOLA 1UXIA 3ZV4A 5CDUA 1SC6A 2HCBA 1Z7YA 4NC9A 4E2XA 3EDRA 1FUEA 1NQ5A 1FP7A 5HSGA 1AMOA 3HU3A 2H8GA 2XT9A 1W5BA 2AMFA 3N0WA 4GI5A 3TOVA 1JH9A 4MS3A 3AY3A 4V2IA 4M0KA 1M0WA 4GX5A 2ZE8A 2PX8A 1B74A 2XVXA 3DMFA 4BJ6A 5DT2A 2ASEA 2BR3A 2XIQA 3CMMA 3LFHA 3FGOA 3PDJA 4O25A 1SVSA 3EBPA 3LYAA 3BQNB 3F4BA 4JB0A 1QHFA 2WM3A 3H0EA 5HIKA 5C1IA 1UUFA 1EM6A 2HLDD 2PSEA 4QDZA 1N1EA 2O2HA 3JQ8A 8ADHA 1KBOA 1NUAA 4N03A 3MTDA 3PVCA 3HCWA 4I5DA 3HB0A 4C07A 3UN1A 1IY1A 1FDWA 3IQZA 3FVVA 1E1MA 3GA7A 1FMJA 1GG8A 5IC4A 2YXBA 5EHXA 3OKAA 4WADA 1D1PA 2O2XA 3FZYA 3HDJA 1FQWA 1HPLA 2C5EA 3C5HA 3EXFA 4WY5A 4ETWA 2N3ZA 4ENTA 3OX1A 3PKZA 4WCDA 2AZXA 3E3MA 3IR5A 2J3KA 1DIOB 5P8WA 1RQRA 3ZN2A 4URVR 3LVRE 4MVJG 3TGPA 4II2A 1WW3A 1D4OA 3FBTA 3BULA 5FFMA 1D7AA 2WA2A 2YXPX 3RAGA 3C6ZA 2IK8A 4B34A 3FCXA 1HQYE 3FZGA 3PF9A 4P2GA 2IV2X 4AZ0B 1PGOA 2JNWA 1ZPDA 4RBNA 2XQGA 3FWKA 4P3PA 2II6A 5KOHB 1AA9A 1HETA 3TW0A 1JGTA 2AYXA 4ZAZA 1RKQA 5FEMA 4IJ6A 1T4BA 2O2SA 4KR6A 4OFWA 1RXEA 4AS3A 1G3IA 3E6AA 3THRA 1XZEA 4BV8A 5C18A 3TIGA 1VKZA 3IEKA 3IT1A 5AM4A 3GQBA 4ZEWA 3VYVA 2GWHA 4JR1A 2GPNA 3UMRA 2Z2ZA 4LYGA 1P9LA 5DJ5A 1ZJJA 3R3YA 1KQGA 1RLJA 4I9HA 4O8CA 5CEJA 1KDVA 4ZCLA 1EVQA 1D1QA 1X8XA 2CVZA 3PQDA 2OA0A 3EXHC 4LIPD 3OY2A 5HGJA 5BV8A 3PEYA 1IH8A 2C2YA 4V0KA 3CRZA 4ZVVA 1PZNA 4WVLA 4WZBA 2D2IA 2OYRA 3KE8A 3P9PA 3RF6A 3UCFA 1ADBA 1NKSA 3KKPA 4HUJA 3NHSA 3TNDA 2LE0A 4QJ3A 2OZPA 2PL9A 4Z9XA 2OGSA 4YRKA 1QE5A 4RADA 1L3CA 1FMFA 2X9VA 3I9V1 3GPIA 5BYKA 4EZBA 3DDNA 3SAJA 4LHWA 3GLUA 1MA0A 4NV1A 3JALB 3T8YA 5KJCA 2Q07A 3WLFA 4DIDA 3UKDA 5ESXA 2BH9A 2HMAA 4G07A 4CKBA 1KIAA 2X8JA 1PHPA 1T1JA 2VSNA 4Y2VA 4OM7A 2PKCA 1EX9A 3BA1A 2RGCA 2GZSA 1RAEA 1UJ4A 3I01M 3PJGA 4RJ2A 4AMYA 4J91A 1JDUA 5LLDA 4GLOA 3BWEA 2G36A 3ANYB 1ACJA 2I0FA 2WAOA 4Y6LA 1RYBA 2PD3A 5KSZA 1AZSC 2LTAA 1YT5A 3OM1A 3LG2A 4N12A 4O02B 4RTJA 2O8BA 2PS9A 4P0QB 5JC1A 4X0EA 3VKVA 2YN0A 1YKFA 4BVAA 5KTKA 1CJCA 1W4RA 4YAFA 5FNVF 4N7MA 1H2BA 2PUDA 1AKQA 4ECEA 2ZLBA 1A69A 1GQOA 3ONVA 4R0NA 3PD0A 1W5TA 2O0KA 2P79A 5DMHA 4FR5A 4W1RA 1M2WA 1NVFA 4B0OA 4ZYWA 4FFLA 2LDXA 1XHLA 2GM3A 1WCWA 2EG9A 3UV3A 4TMVA 3D2CA 1EGVB 1XNQB 2DUJA 4LDZA 4MK4A 3MB5A 3ZWDA 3WBJA 1MU0A 4AJ1A 3PPVA 1L6IA 1VSUA 3F0TA 3UH0A 2CJPA 2I4MA 1JHAA 5JATA 1GTVA 2XIJA 5EE9A 4O4HB 3RFTA 5IAGA 3N9IA 3WGQA 4CTJA 1WJGA 1RWMA 1A8UA 2Y2UA 1ECCA 2D7DA 1R8YA 2B9EA 2BSXA 5JDIA 2AXEA 3LX5A 1SPBS 4J29A 2GHIA 1E4YA 1P6QA 1MLDA 5DNUA 3CPHA 3GEEA 4F93B 1Y1KE 2G1AA 3A31A 4GOOD 2I1WA 3I6YA 1JYEA 4FHGA 2GJ8A 4HMQA 4KO3S 4ND8A 1Q7CA 4HJRA 1U4NA 1PFGA 1K2VN 4HEHA 1QR2A 3VOTA 3R7WA 5AW0A 3I0MA 1LK0A 3C4VA 4PSUA 3AMVA 5DWDA 5CXXA 1KEEB 1M2FA 2GA9A 2PG3A 2B82A 3KZVA 1RMQA 4HDRB 3ZNQA 2VTDA 2PMKA 3UGKA 2BZ0A 4IJUA 1OLUB 3EA4A 4I55A 1P73A 2WHRA 5BP7A 1DV2A 3SK0A 3U26A 2QD1A 2GZRA 2MTBA 5EXSA 5G4KB 2I3AA 4HLNA 3WHLA 1ABBA 2CMFA 1K3UB 4J1TA 5DIZA 5FUXA 2NSYA 1FRNA 1IB0A 4TTJA 1WP4A 4IRUB 4FP9A 2A86A 3O03A 3RI3A 5I51A 2YRXA 5CFOA 5AWFC 2BR4A 2ZBUA 4OHOA 2PX2A 4DR2B 1EWTA 1AS3A 2RBEA 3MT8A 5IABA 2J3HA 1XZPA 4HB3A 3EJ6A 3JYNA 5LXTB 3CFYA 5EZQA 1C7IA 1N3IA 4Z53A 1M7BA 2O07A 2ZYIA 3FDIA 1JRLA 2I5PO 3GR6A 4RA9A 3E9QA 2C9DA 2HX1A 5E2BA 4GRDA 1J8MF 1KAMA 2OLKA 2WF9A 4PSVA 4PZEA 5A5GA 2WVJA 1QBKC 1VIYA 1CSEE 3AWDA 3DF9A 1J99A 3HXPA 3NCTA 4G23A 1OSNA 3TRKA 3K70D 1NAIA 1T4CB 3KYDB 4OMFG 2MWMA 4RD1A 4W7HA 2Q9BA 2ARKA 1CDZA 4PSDA 1ONPA 3W8RA 1DAKA 4AYTA 3DO5A 3ICEA 1XNJA 3Q2IA 2R97A 3C39A 5K3AA 5TS2A 2B83A 4IWYA 3E2MA 5A03A 2QL6A 2ZB7A 5JSKA 3EPJA 2BY4A 2FQQA 2XODA 5HQJA 3I42A 3B7GA 3QFRA 1N1MA 4EGQA 1TOAA 2VP2A 1JPJA 4IEEA 2EFDB 4WLEA 4MINA 4UQLA 2N1BA 3BMQB 4DFDA 5KUTA 5IJ9A 1ENZA 1WXEA 3R9IA 3IQWA 1WXHA 3AFOA 2EP7A 4R1MA 3ZOKA 4C0BA 1T2NA 3IQFA 4BNDA 1G8YA 3HDTA 4P34A 3TPFA 1F38A 1U8FO 3B78A 3KHTA 2MIIA 1VOTA 1XDUA 1NBWB 3I2HA 1SUFA 4L4ZA 2WFLA 1Q2XA 1U9ZA 2IXBA 1AGRA 2X76A 1QDUA 1JZQA 1X8LA 4EGCB 3HSSA 1J5XA 3N05A 4HRAA 1IQUA 3ZVRA 1IN1A 2PH7A 1XZBA 4PONA 2K2WA 3R77A 5HOQA 4RDHA 2XWQA 1ZQ1A 1DKNA 2JHAA 3PFGA 1G21E 4IXMA 4MWBA 1P77A 1QFMA 2NVOA 1T6XA 1U7UA 1W4ZA 4YT4A 4NENA 1I13A 3CVOA 4IICA 3VHXA 3WGJA 3KQVA 1ZGAA 5DHTA 2PRSA 3WDSA 3ZWOA 1HTWA 2W48A 2H18A 4ARZA 1C41A 3BK7A 2WSYB 3G89A 4BCCA 4H3HB 5IYZF 4PG8A 4V0MA 3B6IA 1I24A 1LVGA 1V96A 4MPTA 4LNUB 2YVUA 1KE1A 2ZR7A 4CM1A 5JZSA 4RZUA 2QUJA 1JDBC 2PZMA 4II7A 2ZJOA 1G6OA 1UJMA 3ZNPA 4UPEA 5EUBA 3TIIA 3VVLA 1GM5A 2B2NA 1SXJA 4R8RA 4WVFA 5PGMA 1KMNA 1NLFA 4RABA 1BWPA 3OLQA 1M3SA 4MUEA 3A14A 1RP1A 3D6VA 3DL4A 4DZTA 1U3UA 2Q8QA 5TMBA 4LSMA 4NV3A 2XBUA 3ZKAA 4K1LA 2WIBA 3O8OB 4I66A 3IB6A 4LMBA 3TS1A 1UXHA 1TPYA 1K92A 1DKQA 4YI5A 3DLHA 2AQ8A 1X2BA 5HM6A 2OV1A 1USIA 2Q46A 3X1JA 4IYJA 4E5KA 1TF5A 2OPHA 2ACVA 2J59A 2C99A 2PWAA 5M04A 4EY7A 3A4IA 1Z75A 3IRVA 3R0XA 1IU9A 4WECA 5EJ7A 1Q1BA 2O59A 2WD8A 2GZMA 4E12A 2XE6A 5CX4A 4RTRA 1ZUNB 1THTA 4IFTA 4TUYB 4CWAA 3GUVA 5FIUA 4GM4A 4ZANA 2B1RA 1SIUA 2PMDA 1GXSB 5C8ZA 1WCV1 3R3HA 1A96A 4BVJA 2G9RA 4RJTA 4NBSA 1V71A 2IWHA 2N1MA 3AVOA 1KI9A 5B4TA 4LECA 4DUZB 4DQLA 5T3YA 5KHAA 1LZKA 4EABA 2WI8A 3QVKA 2P27A 1XDBA 1OH5A 2ZSDA 4CDGA 2IUTA 1SXJD 1YR8A 3PRJA 2GO1A 2JAPA 4J0JA 4PW0A 2DFKB 2Y8EA 4QDOA 1CUUA 3TBFA 4F46A 5DE3A 1N3BA 1GAQA 1ZS9A 2NVUA 2O3JA 3KWJA 4IMJB 3W34A 1J24A 4BTVA 3SS8A 4LYDA 1WIWA 3C7TA 2M6LA 3V1TC 4L6AA 3STYA 4U02A 4C7KA 3O94A 3SWWA 2E7ZA 3A2KA 2IS2A 1GGMA 1QHEA 4NFLA 4ZIRA 2J4DA 3DCIA 3GMIA 1UAGA 3PIDA 4M89A 4YAEA 4EGSA 1PS9A 2Z83A 3DKPA 4JFRA 1HV8A 4OVKA 1U04A 2GPTA 2IP2A 1EI9A 2WTXA 3HXTA 2WK1A 3FCAA 3O8QA 2CXXA 3GWGA 4YI3A 3PGMA 1YQUA 5K4HA 1HDYA 4PAWA 2PGIA 2I80A 5AT1A 1X3LA 4KQWA 4DTCA 2P40A 3K32A 4M37A 4OH1A 4QU0A 2FUG1 4ZV7A 1NUSA 3PC2A 4OXQA 4ERNA 5BN3B 1N36B 4OJYA 3CGWA 3NRBA 1NX6A 3E1KA 3FYUB 4PZ9A 4BKPA 3WKEA 2GZ3A 2PO7A 2NQ2C 5F7OA 1W36B 3AZOA 2GF2A 4ND3A 1XZ8A 3TZBA 3AR9A 4B33A 3OZDA 2DTEA 3LF1A 4U9IS 1MMFB 3WK4A 2HSDA 3SDZA 4X20A 5B7PA 4KEAA 1EUCB 1KGDA 1ODJA 4IBOA 4LV5B 4ZGGA 1E77A 4QELA 1J2JA 5T8KC 4B3MB 1IY2A 1S3SA 2QTTA 4RMIA 2ZB3A 5KSYA 1W29A 1L7DA 2PPVA 3OOJA 1ULZA 2UDPA 3SIWA 4L95C 4QYIB 1DTWA 3C16C 3R5JA 5D3ZA 4XR9A 2F4VB 5DXFA 1SKBA 3USZA 3ZW8A 1MT3A 2WZDA 1UXJA 4CU5A 3GZNB 3UMCA 3NYIA 2C2OA 3JQBA 1GPUA 3SJCA 4F3RA 2WNIA 4JU9A 2ATXA 5JNWA 4DNQA 1G8KA 4K46A 1R6AA 2NU7B 2P6UA 2HHHB 3L1KA 2BBSA 2W2VA 1MW9X 3W7VA 5C5DA 2V74B 4ZEXA 5H80A 4R16A 3WK9A 1PJ8A 1XJ0A 3KKLA 3NC1C 1N8KA 5BSVA 1KH3A 4MROA 4QNRA 3HBLA 1NHWA 1ZONA 3I01A 3MRXA 4YRRA 1YE8A 3L7AA 2CNWA 4X1KA 5EVCA 1AKRA 3PHBE 1MNAA 4X95A 1UWCA 2G17A 4A2WA 3IAHA 1TCCA 4HSGA 5AW1A 5I45A 2Q7OE 1V41E 1M2OA 3AR2A 1NFFA 2OHOA 5CJPA 1KYVA 2YWCA 1PT6A 4WESA 3WK7A 4CUKA 1TMOA 1CR0A 1HZZC 4EBBA 3G82C 1TD9A 4EHDA 1DC7A 2XMCA 2ZYTX 1CY0A 3KLPX 2BC9A 3HCFA 4IQGA 1MBZA 4ZVPA 5I4CA 2O8CA 2VEDA 1RLUA 4RJLA 3VO2A 4B09A 2I2XB 3KJNA 4QJBA 1SIOA 2CYAA 2ZANA 1ZXXA 1A9RA 3LA8A 3SC2A 2XTNA 3H5VA 4TSKA 4JENA 1K8RA 1VYUA 2J5QA 2IUFA 3A04A 3NVAA 4MV7A 1II8B 5DM2A 1VFNA 2O23A 2ZUVA 1IDOA 1FSSA 4B0PA 4OJTA 3S27A 4A4DA 2C2MA 4MV8A 2JFBA 4EQ6B 2HB6A 2W98A 4C78A 1O5IA 3CN9A 1BHSA 3HB4X 3BGDA 2PIAA 3T5AA 1D2EA 1GKUB 1LDGA 1QHIA 5DHRA 5EE5B 3F3YA 1T2UA 1UPCA 3RSGA 5DBEX 4BRSA 1T9GS 4JI5B 4GM0A 2GAIA 5DNVA 1SWVA 1O4WA 4I1SA 3ZV7A 1WA5A 3L3BA 1JJFA 5EUMA 1M2VA 2CNWD 2ENUA 1BE1A 4YQFA 4MP8A 1DQNA 2VPYA 3AHHA 2QLBA 4V0NA 1ZCBA 3PQFA 3FZNA 4XVCA 3F7TA 5CDYA 4KYIB 1U63A 1FDRA 1SUPA 4X24A 4RPGA 4YN3A 3Q5EA 2FSVC 1DXHA 3P0FA 3NRJA 4FGSA 4UXIA 1ADJA 3IV7A 2WYOA 3OUZA 5HJ5A 1P75A 1XQWA 2C54A 2DR3A 1IHUA 3WRYC 2ZUFA 3GRUA 4MV5A 4D42A 4LAFA 5DNCA 5JWRA 3A4TA 2BEVA 5HNKA 1J70A 1UPUA 3KAKA 3ABSB 5EIFA 4Q05A 1H2FA 2A1UA 4FJ1A 1H2AS 2E6KA 4QFDA 1I6WA 3IUYA 1B3RA 1DDOA 4UEOA 3I0ZA 3WWCA 4C43A 3CN7A 5C0OE 3KQSA 1BXRB 4MP3A 1S0UA 5C8DA 5F52A 5IJ0A 2JFUA 2PL1A 3DBLB 3UNXA 2GTHA