3NLLA

Clostridium beijerinckii flavodoxin mutant: g57a oxidized
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMADEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Clostridium beijerinckii
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nllA00
3QFCA 3NHFA 4YQEA 2Z98A 4S24A 1KBOA 1CZRA 3FJOA 3HLYA 3EDOA 3O73A 4R81A 2B3DA 3G5MA 3JSXA 2M6SA 2FVXA 4J8PA 2FLVA 3GFQA 1AZLA 4Y9RA 1E5DA 1AKWA 3OWHA 3B6JA 1H66A 4ICIA 3N39C 1TIKA 2W5UA 3KEGA 4ZVNA 4GI5A 2OYSA 5EA2A 1FLNA 3ESXA 4LTNA 3LCMA 5B3LA 1FTGA 3OWXA 3RPEA 4BMPB 1YCHA 3F6RA 3NHYA 1GG5A 5LMCA 3NHUA 4LAFA 3ES9A 2BMVA 2V5UA 1AKVA 2OHIA 3NHJA 5LBUA 3TEMA 1AKUA 1XT6A 1AKQA 3L9WA 2V5VA 3N3AC 4FX2A 4YAWA 2FX2A 3KLBA 4CF6A 2RG1A 5LVAA 2OHJA 2QX9A 4DILA 1FUEA 5FA6A 5FUQA 2ZKIA 4QODA 3B6IA 4N82A 3O2NA 3W7AA 1YKGA 2Q9UA 3U7IA 3K20A 1QRDA 3NHRA 1D03A 4U7HA 1XYYA 5JROA 2F1OA 1FLDA 4LTDA 1NNI1 4Y9UA 4C0WA 3W79A 4FGLA 2MWMA 2ARKA 1RCFA 3D7NA 3F90A 1KBQA 1B1CA 2BF4A 3OX3A 1AKRA 3K1YA 3KAPA 1C7FA 3NHKA 2FOXA 2OHHA 2FAXA 1FLAA 1WSWA 2QR2A 2HNBA 4ZVKA 5BUCA 3TZBA 1FX1A 1WSBA 1J9ZA 2MOKA 2QMYA 1CZOA 4DY4A 4OXXA 4XDHA 3F6SA 3TE7A 3R6WA 2D5IA 2M6RA 5A4KA 4C76A 2A5LA 2QWXA 4YAUA 4BMOB 3OVMA 3OJXA 1CZNA 2BZSA 5LLDA 1DXOA 4GQIA 4YALA 3L9XA 4FGJA 4HS4A 1YCGA 1JA1A 1YCFA 1CZHA 3UXHA 6NULA 3NHWA 1ZWKA 2HPVA 4F8YA 4LA4A 1V4BA 5EAIA 2Z9BA 1DX9A 5FX2A 5F4BA 2GSWA 5NULA 5B3KA 4ZVMA 4QOFA 1FVXA 1X77A 1D4AA 1F4PA 1SG0A 2AMJA 4QOGA 2FDXA 2KLBA 2HNAA 3W77A 4H2DA 3FW1A 1VMEA 2MT9A 1YOBA 3FNIA 3S2YA 5F51A 4CETA 4U7FA 4Y7CA 1CZKA 1FLVA 1RLJA 3ZHOA 2KQUA 1OFVA 2Z9DA 3NLLA 2BPOA 3P0RA 2XODA 3GFSA 2Z9CA 4YAOA 4XDGA 2R97A 5NLLA 1JA0A 3OX2A 3NHPA 2XOEA 1AKTA 2MTBA 2X2PA 2BN4A 2WC1A 2N1MA 4YAFA 3NHSA 2QX6A 2Q62A 1XI2A 1AG9A 1XYVA 4QOIA 1J9GA 1AHNA 3KAQA 3OJWA 2FCRA 4C14A 3NHLA 5TGZA 4N65A 3UXEA 1T0IA 3HA2A 3FVWA 1RTTA 3ESYA 1H69A 1T5BA 4ZVLA 2FZVA 3U7RA 1TLLA 5LBTA 1ZX1A 4LTMA 1OBOA 3ESZA 4U7GA 1CZUA 4ESEA 1BVYF 4QOEA 4NLLA 2FZ5A 4QOHA 3OX1A 4GR9A 3QE2A 1I1OA 4H6PA 1QHEA 1DXQA 4NULA 1C7EA 3SVLA 3EYWA 3W78A 1QR2A 1QBGA 4HEQA 2QX8A 5ULLA 4PU0A 2QMZA 1BU5A 5EMNA 3GFRA 3F2VA 3LT5A 1J9EA 1OBVA 1RLIA 3B6MA 4PTZA 1YRHA 2R96A 1ZWLA 5LJIA 4N9QA 5LJLA 1AMOA 5F12A 1D04A 3HR4A 1CZLA 4C0XA 4DIKA 4M0CA 1J8QA 2QX4A 4PTYA 3NFRA 2V9CA 3GAMA 1YDGA 4FGKA 3N3BC 4QOJA 4D02A 1SQSA 2X2OA 3FX2A 3B6KA 3QFRA
chains in the Genus database with same CATH superfamily
3GEEA 4XIYA 3M81A 1DOHA 4OL0A 4AKSA 1PYGA 1TZJA 1L4MA 4QU8A 4RXMA 2EX1A 4OLBA 4K8RB 4YQEA 3QH4A 1MUUA 1KZ6A 5DDIP 4KHPB 2FF5A 5MN5A 2Y66A 1N2GA 1GR0A 4MQ6A 1P1IA 4MW2A 4EFDA 4FM9A 5AVOA 2AZDA 1L1EA 2QGZA 1QYVA 4XCVA 1KJ8A 3BXPA 1KDZA 2HYDA 3T4UA 3KLMX 1V1MB 2JH8A 3F6PA 1P5ZB 2J6IA 1FRNA 3O26A 1FQKA 2O48X 3KVOA 1OUMA 2CUKA 4MR8B 4KV7A 3AETB 5KTKA 4LMAA 3AP2A 5EKSA 1FS6A 3C8ZA 4Q39A 3WGZA 3X1MA 4B3FX 1VBFA 2M6SA 4MVJI 1X74A 2C9ZA 3IE2A 5SZIA 2ATIA 3EXG2 3VU8A 1A98A 1MXHA 4PN7A 1J06A 3D81A 5HMLA 4MQEB 2H5JA 1SOMA 3DZIA 4QBTA 2X3UA 2ZAIA 5DYYA 2DWPA 3QBDA 4NE2A 1C8BA 3F6BX 2VDLB 3LXXA 4COKA 1XF1A 3QG1A 1I7QB 5DYNA 3M4YA 5JI3E 3GRPA 4TVSA 4FILA 3THXB 4DJ5X 1K6JA 1N5JA 4ZDJA 4EJSC 3GCGA 1P9RA 4FSHA 4U7TB 1ZP6A 1A5TA 5IEJA 4IOJA 4AMUA 5CBKA 1ADFA 1NM5C 3GNLA 3RYHB 5ADVA 2GJ9A 2PSJA 4DPKA 1KMHB 1KOFA 3DA8A 2V7PA 3V48A 2Y76A 1DJMA 1CQZA 5IJXA 1T9CA 1P2VA 1VJDA 1YBHA 2C1XA 2ZAOA 3LDFA 2QPOA 4G5YA 1GKYA 4BQIA 3ZD7A 1FTWA 1DADA 2EVWX 3TAUA 1M2JA 5DSZA 4B44A 1LI4A 4LYDA 5CAEA 1XFDA 1UUFA 2BONA 5DM4A 1A9TA 4WECA 2I6SA 4MQUA 2GZMA 2CJFA 1D8AA 4ZHQA 2E9SA 4WKGA 4HKTA 1Z4QA 3AFHA 4GC5A 3SF8A 4L51A 1KFKB 1TKAA 4C4OA 5JI2E 2PKQO 3FKSD 5J2UA 3LPMA 2DUMA 4EHJA 5IM4F 3QWAA 3ZD8A 2QT9A 1R9JA 1WR8A 2FN7A 4WBXC 4POOA 3LVFO 2N47A 3QG5A 4LKRA 3THYB 1VG0B 1Y3AA 4LAFA 4MZXA 4OP3A 4W9MC 4LJ9A 1FDTA 3ILHA 5D3ZA 4U6QA 2I3DA 2VUTA 3IB6A 1ECPA 4JLMA 4FTWA 3ML1A 2X6TA 3MUNA 3L1JA 4JLDA 4GBED 3HFGA 5AOBA 2BY4A 4OHWA 4ZZ2A 4I36A 3T3NA 3WKEA 3JWEA 4QBIA 3W9UA 2CLFB 3IA2A 3TM5A 1SIOA 3VJLA 1HR0B 2XVZA 1Y5LA 1UP6A 4ZIRB 3T1OA 2W83A 3PP8A 1RPAA 4FFVA 4NNOA 5CT8A 1PP4A 5JNWA 2CXRA 3WFIA 1Z7BA 1XAHA 4C5BA 2VBFA 3PJRA 3OOHA 4AN0A 3HY6A 2FR1A 2L82A 5EHQA 5GZ1A 1EVEA 4IGAA 1RLOA 4EYQA 1N8KA 1BWPA 1VG1A 3OTHA 4UMEA 3I83A 2ZM6B 3CNHA 4O2RA 2QVZX 2NSJA 4GMDA 4HOYA 3ZOKA 1JKMA 1N8NA 1RZVA 3GGCA 1C1DB 1E96A 1EUDA 4ANFA 3M3HA 4QNNA 4D4KA 3ROEA 4JI8B 1D03A 1OTHA 4EFNA 5C1BA 1KZ1A 2C7RA 5A05A 3LX6A 1DXYA 1T8SA 2F1OA 3IJPA 5JCOA 1KSGA 4PWYA 3ED1A 3HHPA 4YLYA 4MCAA 3IAXA 4Y9UA 1O6BA 1U9CA 2WJ3A 5ESRA 5BW8A 3OUUA 1F9EA 3ZU2A 4PHHA 4TL8A 5F7JA 1FDVA 5LXTA 2O5EA 1PS0A 1WZUA 2IEBA 1IB0A 2BCGY 1NFRA 3ITKA 3MOGA 4MRAA 2CZGA 2M2IA 1AGNA 4H7FA 2GA9A 1R1DA 5HEKA 2BF4A 4GKJB 1XAJA 2VBCA 1HE1C 4LBYA 5L8VA 1O6FA 4D4IA 4U2EA 1RYNA 1TM1E 1ZICA 3NG1A 3G2NA 2H4WA 4NATA 4PLPA 1ADBA 4TLEA 4P31A 2NNLD 4PC2A 1ESCA 4ZOLB 1QVZA 1I1HA 1FFXB 3QJGA 1V45E 3UY4A 4E32A 2NUTB 4WJLA 3DE1X 3WGYA 2QRZA 1X42A 3O3NB 5K01A 5K8VA 3JV7A 4X8MA 4RAQA 3MC1A 2ZIFA 3EVNA 4KH1A 4ND6A 5IWCA 4RTPA 2OUIA 2G7ZA 5FL3A 3VGJA 1E0DA 1EE9A 3C6YA 1F1JA 5IDYA 5JE8A 4FFNA 1D1QA 1XN1A 1YB5A 5D7NA 5F98A 4FOLA 1PF7E 4PGHA 3BDIA 3FHOA 2XUAA 4OYHA 2F1RA 2OMKA 1GNLA 1ZI6A 1ANKA 5ALXA 5JD4A 5DW0A 1Q84A 4US1R 1HT1E 3LLMA 4V0LA 3VO8A 4OHBA 3AEKB 4F9FA 4P38A 5J4VA 3LHKA 4ON9A 2Y92A 2RHCA 3VNRA 4ED9A 1VLHA 3VKUA 4XRGA 3DMTC 3L5KA 5DCWA 1HSZA 2W8BB 3IELA 2JJQA 3IIEA 4DLKA 1F6DA 3IMFA 5E7JA 3O3CA 2Y0DA 2DPGA 2Z2IA 2R84A 3IP6A 1KU6A 2FW7A 3SF0A 4E5UA 4REOA 3CH5A 3PXCX 1OTYA 3AUFA 2C0CA 5CFNA 4RD1A 5AM0A 1FMFA 1GUFA 4BNFA 1HEIA 2QD4A 2VG8A 1R5OA 1Y80A 3AUXA 3NVDA 1N3IA 3ZBTA 1EUZA 4UFPA 2HKIA 2XVXA 4DHEA 3CR8A 4UDOA 1SCJA 2PD4A 4W8GA 1N2XA 1BH2A 3PJFA 4F5DA 4CDRA 1P19A 4MVJP 1QIIA 3LK7A 4EA9A 3FUVA 3UYLA 4YXFA 3OJXA 3LO8A 1CZNA 2G1JA 1BIFA 2J46A 2YJTD 3W1VA 3FTEA 1HH4A 1TKRA 2BZSA 4NH4A 4MIYA 4C0BA 2W11A 5LOVF 4FE7A 3AYXB 4O4JA 3UNXA 1A5ZA 1C4OA 2IEGA 2REQA 3B1WA 1HDGO 3MAJA 4YBZA 2EHDA 5F2OA 3IQHX 3MINB 5H9WA 4BNTA 2X6QA 2A1UA 1WWKA 3EQ7A 4S1TA 4UASA 3RANA 5LP6A 5MN6A 1EFAA 2PUCA 2AD1A 4FGJA 1NZJA 4WK2B 1JG4A 2C8LA 3HN6A 1NATA 3L1VA 4PZEA 4BLWA 4H6XA 3C1UA 3FGNA 4DUGA 3KQWA 4FYXA 2QM8A 2EGUA 4CF5A 3I5MA 3IV9A 3NBUA 5TY0A 1ORDA 1G20B 1WU7A 3F5MA 2V5AA 4QHYA 4FS3A 4HLUA 2BLNA 2J0VA 4RPGA 5IAAA 1JIJA 4X93A 4DUGD 3KSBC 3E1GA 1DJOA 2A1TR 2Q2VA 4YXWA 4AMBA 5JXJA 2ILTA 2X13A 4DA4A 4TLMB 3VJRA 1B8OA 2J3DA 1TZKA 3MW8A 4BFYA 1C0IA 4Y2QA 5LR6A 5FX2A 3T4XA 4OLAA 4BGUA 4BNYA 4BO4A 4ZZIA 1XLWA 3SE0A 3SXUA 4HAVA 3EVCA 3T1VA 2ZUFA 2PAFA 3OO1A 2R6AA 3GIWA 4UNIA 2BFNA 2PLWA 2GPBA 3EHEA 2D0OB 2WV9A 3MTGA 1FU8A 2QN6A 1EXNA 3JXEA 1XK7A 2JFQA 1U0EA 1ESMA 2J9ZB 2K7ZA 3MT8A 4JOSA 1QONA 4MB2A 3ZDXB 1XLUA 1W73A 2GJ8A 3I9NA 4G6ZA 4WUTA 2C5BA 1XG5A 1ZNZA 2NU6A 3FPKA 1B41A 4ZYWA 3WIBA 4C2TA 4TS3A 1VL8A 1PQ4A 5JLAA 1I4WA 3GLHE 2BFAA 3L49A 5DF1A 1Z4KA 4ARBA 5KYYA 1AF4A 1JR6A 3CNQS 3O38A 2G9VA 3H8JA 1O0CA 1Z22A 2AUMA 2ZI7A 1RHJA 3TNFA 3AIIA 1T9BA 5EJGA 1U8ZA 3RYCB 1W88A 2R6JA 2QUIA 3UHOA 4C2AA 1BDIA 5I3CA 1SUSA 2ZYGA 4DARA 1XMQB 1V95A 1CUDA 2EG5A 3U0BA 1WKVA 5C3MA 3BA6A 3BULA 1KJJA 1VE6A 3GJ7A 2QYSA 1R6TA 3ILVA 4I8XA 5TQ2A 5IAKA 3B52X 4FKMA 3LUAA 3QK7A 3ZKWA 3ICOA 4C7OB 3FETA 3GMIA 2LIPA 3PC7A 1SXJC 2EV9A 4DNXA 1SKQA 1OFVA 1FFBA 2PANA 3HCDA 4E5SA 5CCEA 3I2JA 3UPDA 1HLDA 1I80A 3FPSA 3GNQA 1KY2A 3FPHA 3NKFA 4CIAA 5GIOE 4AF8A 3D6MA 5ILOA 3PC3A 1TF7A 4Q47A 4X91A 4GOOD 1IY2A 4LQLA 4MV0A 7YASA 3GUUA 4CXMA 2BBSA 2JGAA 1C29B 3NAGA 4EGJA 4H7IA 5ARDA 4HD8A 3VJMA 4R8RA 5DTEA 2P3SA 5ITSA 3ZCQA 2Y67A 2H6EA 5EIWA 3W6OA 2QZJA 3WBFA 3AHEA 4EGAA 4YMTA 1PGQA 3ZDCA 2ZB4A 1TNDA 3QA9A 3T54A 4C30A 1KXJA 4N0MA 4CHTA 1E3LA 4EF4A 2EJCA 4RJTA 4K1LA 2X7XA 1C0EA 1CD5A 1U4SA 1JPUA 1JVBA 2FCAA 2XWSA 1C4XA 3DJFA 3HNOA 4I4TF 4PYRA 1GFZA 4TTJA 3IIMA 1GGVA 2W00A 1AZWA 1QVRA 1YBMA 2VK2A 2Y4OA 2RBEA 3KR9A 4MIOA 5CX1A 4GPEA 1QE3A 2DQ4A 3VNAA 3PXXA 2G1UA 1MNQA 1QLJA 2H0RA 2WD7B 3R9IA 4C0AC 4EIWA 5KOHA 1F2TA 5HE9A 5JXWA 3O9MA 3ZS8A 3MUOA 4Y30A 4DNFA 2OKGA 1OXXK 1FDWA 4DR3B 2HRQA 1GLVA 1PG2A 1Y8QA 2EKBA 2HU7A 1NYLA 2RCYA 2W2OA 4WKBA 5C8YB 2FOIA 1T4GA 4RVHA 4IDFA 1FMTA 5HQ3B 3ZHXA 1TTTA 3WGNA 4LK2A 1FE8A 1XRQA 1I2BA 4U5XA 4OFBA 2FZVA 2E4YA 3R7AA 4QGSA 2F3QA 2JD0A 3X0DA 3C41J 1OXVA 1H94A 2OL4A 1JBEA 2IUFA 1RPNA 3CVOA 3GUYA 3PWKA 3KYDA 4HYTA 1ZFNA 1JDBB 3GJ4A 4K7JA 4BE9A 2Z83A 2RK4A 1N5OX 221PA 2VKTA 3EB9A 1UF9A 1X7ZB 3LC2O 3UHPA 2Q7OE 4C9BA 1B00A 3AF5A 1I2CA 1WDLA 3BD9A 1X1DA 3FXAA 3I32A 3KR1A 3VDMA 4AG6A 2IYVA 2AYZA 5DBIA 4D4JA 1PL6A 3FLAA 4FXPA 4MGIR 4X00A 5BW6B 1Q1ZA 3AHIA 4EG4A 4DM4A 3FD8A 4L50A 3Q3JB 5B2EA 5DNEA 1JKJB 5F9MA 5CFQA 5CLHA 4RIFA 5JWHA 5ITVA 4CLEA 2Q29A 1NJ8A 2BUAA 3K16A 3MWGA 4TMVA 2Q2OA 3NX4A 5SY9A 2HHJA 2HSJA 4Y18A 5EXPA 4BVJA 5AHRA 4H6PA 3BX1A 3PGA1 3AM4A 1JHYA 4Y9TA 1IM2A 1WETA 3CTPA 2RHGB 4O4IA 4JUAA 1YZ3A 2H8KA 5KUTA 2PSFA 1BE8A 1DKOA 3IODA 4GP6A 1MIOA 1XA4A 3ITNA 3CISA 4BJ6A 2I34A 4YGXB 5G53C 4BGIA 1E9EA 2E55A 1OXTA 2GM5A 4LDZA 1K8QA 2XE7A 3DYVA 4X6YA 1GNPA 2ZRCA 3KZNA 2VUUA 4GO1A 3V4PB 2UUCB 3OZTA 4BEJA 2FEWB 4RCZA 2X8JA 1PT8A 1TCAA 3RBAA 3RG8A 5K8LA 3KJQA 2OZVA 2FN4A 3PEFA 1YZTA 1CUBA 2HFJA 2XKJE 3AQIA 4YP1A 4KR6A 3OC6A 2ONCA 3OLVA 4GF5A 4Q3OA 4BMNA 3HO1A 2UYOA 1C5KA 2H1VA 1FNNA 2BTQB 2OP1A 3K0HA 3DE7X 1DKQA 1YUNA 3ZZTA 3GRRA 1P60A 2ZE8A 4Q6BA 2XMQA 5FPTA 1QQAA 1PV1A 1G8KA 4M87A 3DPSA 3UJAA 4Z3OA 1FTYA 4PRKA 1DELA 1N2CA 1VE9A 3DXYA 4BNUA 4HDKA 2O0LA 4RC9A 3ROXA 5JPDA 1TRHA 3G7UA 5JEDA 3RVPA 2V55B 1W36D 4B3TB 1MJHA 2AEFA 4EF5A 1PJ4A 3WB9A 2EFEB 2R5FA 2ZI4A 1C3JA 3G8DA 2WTNA 5AW2A 2QNBA 2CYCA 4K6CA 2J87A 2ZXEA 4J91A 4GKVA 3WXBA 4NZ9A 4QFBA 3OLCX 4OQDA 3WK4A 5JAZA 1QH1A 2QL7A 3BICA 1UP4A 3D59A 4ZARA 9MHTA 1NHWA 1V8ZA 2O0KA 4J29A 4UCWA 5HIIA 5EYPB 4FFRA 4JC0A 2XCSB 2R62A 1XCJA 1GRCA 1LRJA 5HS6A 1XZFA 1I0IA 1RKVA 3I05A 3MQ4A 1WUHS 3C45A 3O2JA 3WLTA 3HRIA 1YQGA 1UMKA 2Q5FA 4WCFC 4N47A 1QF9A 1JSCA 1Z5NA 3PIDA 4G4JA 4IIDA 4UEKA 2IPAB 3WHLA 1POXA 3FTDA 1BN6A 3GAMA 1QRTA 3GEHA 5CVUA 3B7PA 4M7WA 3OM1A 4US0R 3AOGA 2PGAA 5TF0A 3QFRA 1GL9B 2J9GA 2V9PA 4LKOA 1XHFA 4NU0A 5LFAA 5ADHA 4HVCA 2G1PA 1JHZA 4M1OA 4ZEVA 2O20A 2AIRA 1VRCA 1XRRA 3B1XA 3GMDA 2V8BA 5AVJA 3UOGA 1LBSA 2HY7A 4WLVA 3GLSA 4BV8A 4TZ6A 2FNAA 1BCSB 1CZRA 1OR8A 2X7JA 4YCSA 1N2OA 5DK6A 1Z37A 2WMNB 5DXFA 3BGIA 1WOMA 3P9RA 3MFYA 3DB2A 1HRDA 1HKHA 1ZGBA 3AGQA 2YFHA 2IXDA 4HMOA 4JXKA 1PW7A 1VZ3A 3FVRA 4LRYA 4JEMA 5DBFA 3VSDA 3AY0A 3O73A 2GR9A 4PHTA 2CNBA 1W25A 3NW9A 4FOTA 2WT8A 4Q82A 3U40A 4QX6A 3O4VA 2GEJA 1GCIA 5JAIA 5HQTA 2VI5A 3H9EO 1OXMA 1CUGA 2F3UA 1X1TA 1O96A 2BLLA 4X95A 2H2AA 1ODKA 2QAGA 1LLFA 2NLOA 2WVAA 1YJQA 4OSEA 4NU6A 4EI9A 2XXAB 2MR6A 1CVIA 3ELYA 3LQ2A 4UAGA 2REBA 3SYRA 3MT0A 3WHKA 2R60A 1J0XO 1E1QD 5CM8B 1CQWA 3OZAA 4DV5B 1QGUB 5J9FA 4REQB 4DSZA 1KNQA 3Q87B 4Q1AA 5DP1A 3VSCA 4OX9B 3FHJA 2ZRHA 3ZJYA 3UJNA 5JT1A 3QYPA 1PEAA 5DBGA 4B7XA 2WWXA 4PPNA 3PQ6A 3CFYA 5ECDA 1J56A 5AVUA 2RJ3A 5BYBA 2BGIA 2WJJA 4HFRA 5JCXA 1M72A 3AHDA 4PZZA 4M55A 2FP3A 3M6AA 4RV4A 5CJJA 3N07A 4F84A 1QB7A 4BX9A 4KU4A 2YUTA 4N8DA 3UATA 3GF4A 4M9UA 3RYFB 2GWRA 4KACA 1H1LA 4Q01A 5D84A 2XCTB 4TV9A 2J8ZA 2VATA 2OLEA 1IEXA 4IO0A 4PICA 3CLRC 4TS4A 3ASZA 4Z49A 1VOTA 5IYZA 1IH8A 2Q2QA 4CKBB 2VVTA 2O2DA 4LV5B 4WRRA 3KOXA 4P08A 1NVVR 3PU6A 1T1IA 3FDIA 4FC6A 1QKIA 2W22A 1LU9A 2MJLA 4X45A 3D3WB 2A5YB 4NZPA 2QD1A 1A3CA 1XRJA 4CQMB 1P4JA 1F0YA 1EUYA 2X0RA 2VEDA 1G8JA 2ZT5A 4LY0A 3RSOA 1AXGA 5G0UA 1ZHFA 2GCOA 4EZIA 1NOIA 3U7QA 4ZV4A 3A6GA 3G8BA 2BI8A 3VKWA 4BFWA 5KNBH 3P0JA 5KQMA 4HT3B 2OHIA 1O87A 3SS8A 2YWHA 1R18A 2PQ0A 4MA0A 4N3CA 3V42A 3GUHA 5LD2C 1V8DA 5T41A 5CFZA 2G09A 3CT4A 5JADA 3WYBA 1SHLA 1ZVKA 4FX2A 2VIIA 3JQ9C 2HI0A 2EBFX 2FX2A 2VHXA 3NU1A 1QTNA 4MPDA 2O3JA 3AR9A 4ACAA 2R8EA 1FNBA 2BGLA 3RUHA 2GLTA 1O94A 1YZQA 4UU0A 4ZQIA 2H59A 4MV3A 1IHPA 1U94A 1NRXA 5F5NA 2C82A 5IVIA 3DXZA 521PA 2PH7A 4UE3S 1D5WA 2WG0A 4MI9A 3MJVA 1SFRA 3H3XA 3T9DA 3GP3A 4IH4A 2BD0A 4YCAA 3VSAA 1JXQA 3C7KA 4RA6B 1XYYA 1M3SA 3JYNA 5EMJA 5JMPA 4G09A 3W7BA 3H86A 5KTRA 5L4SA 2BEUA 8LDHA 2FPUA 1I1QB 1UBMS 1Z9BA 4C0WA 4AROA 1JECA 1TECE 1IXSB 3FUXA 5BRJA 3VVLA 1N2EA 3UENA 5EE3A 2FEAA 1DE0A 4G2TA 3M6WA 1J0CA 3F90A 4EBFA 1RJDA 3QBJA 4DLZA 4F60A 3K0CA 2C00A 3D7MA 4UBOA 1FIUA 3BL8A 4EK9A 4HB3A 1VKNA 5ERYA 5F9HA 5TRTA 3NAMA 2LBPA 2B20A 1LA2A 1DTSA 3HFJA 4HC4A 4MYUA 3HP7A 1HOTA 4IH1A 1RRGA 5K3EA 4KNYA 3SQXA 4FEEA 4Z0NA 3K0KA 3HCOA 4KLAA 4KPUA 1A71A 4EYKA 1Y9JA 1AN0A 3RTDA 3B2NA 3GJTA 1V7ZA 3K0BA 3LY7A 4RJJA 4WZBA 1SUPA 5K2OA 3LXRA 4G0MA 1M6YA 1OTXA 2ABWA 2GN4A 3RLIA 2ZRNA 4CMCA 2GX6A 1HLGA 1EHCA 1K7CA 4ZVKA 1JSXA 3RD5A 2XBLA 4A0QA 2OOSA 3JQEA 5SYMA 4E3WA 1ZJ5A 4OHYA 2JI4A 1FMLA 2IHNA 1T5TA 2Z6AA 1USWA 1J9ZA 3HU1A 1DAGA 1JHXA 5ERGB 1XXHA 2JLSA 3V34A 1I5RA 4YJ2A 4TMWA 1PR1A 3KQUA 4YIHA 1FP4A 4TSFA 1Z25A 2QZ4A 1E9FA 1GRQA 4B3IA 1K7SN 1MJ5A 1M8JA 1PL0A 1GIAA 2V54A 1NGSA 3FVQA 4L22A 5B7QA 3K0SA 4N5NA 4RA9A 2XI4A 4FI3F 3ZXUB 5FOVA 1P4HA 5CFLA 1BA2A 3SZRA 4YUXA 5DNUA 1I14A 3P4YA 8ATCA 4DR5B 5BYJA 4Y1RA 5I45A 1RQRA 3L8MA 1R5JA 4URFA 1X7GA 2FU5C 4EA6A 4BVAA 2AN3A 1KI9A 2JAQA 3L0ZA 4HH4A 5B4UA 3HR8A 4KQGA 3VDQA 4ESHA 4XD2A 5H16A 1D6SA 1Y82A 4BVEA 2NM0A 1BDMA 5ICFA 3KHSA 2D5LA 1KAMA 2CDAA 2ETXA 2FUEA 5KNCA 2EXXA 3LUKA 1H6AA 1ZMBA 5DLQC 2PS0A 2OBXA 1R9NA 3M34A 1I7NA 4ZXFA 3H84A 1UMBB 3O31A 2ZPTX 4YP0A 3LO5A 4GUAA 1U7HA 3RFTA 3EULA 4PX3A 2B9VA 2Y1OA 4YMSA 2JLAA 2W0SA 1YL6A 2F17A 2YDYA 4RQBA 4CWAA 5ADUS 4C4TA 1OZGA 1LSOA 1R27A 1ETHA 4GQIA 3B5JA 3FRHA 3HVHA 4FKZA 4G23A 4NCXA 1U0HC 1JR3E 1NIPA 3P9PA 3I5XA 3SX0A 1G6HA 1HG0A 1Q7CA 1XTSA 5FBQB 4EO7A 1DMRA 1A50B 1Q2UA 3AR2A 1HK7A 2GFHA 3NOOA 4NRDA 4RETA 4WADA 5U4QA 4KOEC 4HTFA 4HH0A 2WSLA 5KTTA 3D3EA 4DM7A 5G4LA 1PZGA 2C7QA 1OIWA 1RXUA 3NH9A 4IDAA 1SY7A 4ZVRA 1UPCA 3IOCA 4WXPA 4RAOA 3HH8A 1NU8A 2PLNA 1B0PA 2IZ0A 3NHWA 2BJWA 3R7WB 3ZGXA 2VLIA 3BTVA 1QZZA 2KPOA 4QG7A 5AJWA 1JTFA 4BGDA 2QW8A 1EGAA 1MKYA 2HA4A 1YB7A 3KUXA 2PV7A 4LHWA 3UV3A 5A0VA 3HSKA 4MWTA 3II6X 3DT9A 5IRCD 2FK8A 4X44A 1A2KC 4OUDB 2XTNA 2NU7B 5HM8A 1KJYA 3FVVA 4DQUA 1JTVA 1PWEA 2OTCA 5ALQA 3NDIA 2IEAA 2F6RA 4GQAA 1PQYA 3AILA 4BNDB 2C1EA 3S1LA 1L5LA 5FOUA 4E3ZA 3H17A 2OXCA 2DC1A 2VBIA 2VXYA 3TNYA 2OV8A 3ZQUA 2AR7A 2EP5A 5BOSB 1DBRA 2OAGA 1G21E 1SUCA 2DQYA 2EYQA 2PRYA 1SIUA 2ID9A 2X6RA 3CYFA 3LSYA 2ZEJA 4N7MA 3T06B 3Q7PA 2PUGA 2RFLA 1DAHA 4A6DA 5MDHA 3TVYA 2IOYA 1D8TA 3CZ4A 3DAHA 5IS2A 1E2IA 3KVNA 4F1WA 3VXKA 2OBYA 1NTOA 3PENA 5IN5A 1MP0A 1JAIA 2KLBA 3JAWA 4ZD6A 1SRRA 3CF4A 1BGVA 4OMCA 3W77A 2MMCA 2SBTA 3QFHA 2L0XA 3RC3A 2I9KA 1NNSA 3IVMA 5LCXA 5CG1A 1QGED 2B82A 3QP9A 4MKXA 4BBPA 4B5KA 4KE6A 1YJ8A 2AZMA 1PFUA 3VM6A 1OHHA 2H54A 3NPMA 4ZAWA 3IOBA 4R2KA 4DQLA 1JFFB 1Z3CA 1K2VN 3DJYA 2AS0A 2X9VA 2P2SA 2ODNA 3ITEA 3L41A 1AQYA 4BC1A 1WB4A 4QATA 4AS3A 2C2GA 4EMUA 5J1TB 5AM3A 5KTOA 1E7SA 2YWBA 4J0FA 5LQMA 2A7XA 3H5NA 1MRNA 1G5PA 3NLLA 4F71A 3AHHA 4DVGA 1EWRA 2D7DA 2XT6A 4RQAA 1L5FA 2QJTA 4RD4A 4MV1A 4Q4AB 5IDVA 3K9WA 3ENKA 2WY2D 3STUA 1OAOA 2EU8A 3CUUA 4YB8A 2JDIA 1FCJA 3IUQA 4BHTA 5KS2A 4I66A 1U0SY 4FYMA 4L7VA 1J5PA 4J1TA 2GH1A 1A1SA 4XW2A 4EYOA 3TPFA 1C4KA 3H1FA 2HADA 4TKZA 1OBHA 3CN9A 2FEOA 1C30A 3I04A 1TUBB 4EEKA 4PQYA 2JDID 1GAEO 1ORRA 1WKBA 2FPPB 3Q1KA 1BKDR 1MAHA 1AXRA 5I48A 1QO0A 1R4AA 3I2KA 3IALA 3OPMA 3SE7A 2QLMA 3OKFA 3C70A 4I4TB 5KAMA 1L8QA 2FG6C 1UWKA 3ANSA 1JWLA 4RTQA 1PWXA 4JSYA 4A8PA 4JVSB 2BHLA 4IJQA 4TV8F 1KI2A 1P74A 4IHJA 2G9ZA 1Z6YA 3F7NA 4MS4B 1T9GR 3EIEA 1FMCA 4QECA 3TWOA 4DLTA 5KDOA 2ZR7A 2XF8A 4EA7A 2QRKA 3PVZA 1K8XB 1RXEA 4JJEA 4NPCA 5ALTA 2IS4A 1NV8A 1KPGA 1KFJB 3M33A 3L06A 3D1VA 4RUKA 3ZX5A 2W2LA 3WLIA 3HB4X 3JZDA 5T8KA 4NESA 4EHLA 1EFCA 2DWQA 5FKJA 1CEYA 4LCJA 5WRFA 1ECBA 3OOWA 4GSLA 4KVZA 1P7CA 1U1EA 3DBLA 3EXFA 5SY4A 3AESB 1OBOA 1GCAA 1PGNA 4G0YA 1M74A 1WHSB 1PD0A 2W6PA 1STOA 3RAEC 2HLHA 3L6UA 5EY5B 1XTVA 5MFPA 3T5PA 5E1DA 2D6FA 3B9BA 1B14A 1JU3A 4QOHA 4DRYA 1B2RA 5H5JA 2GZRA 2XZOA 4AN1A 3RBVA 1PNRA 3CZAA 3EVTA 5CA0A 4B35A 1U7XA 2AL7A 2FJ0A 1EJ2A 3QV2A 1MB4A 4JYCA 1LD3A 4HZUB 2QNIA 3L1KA 4LDAA 4LJAA 4PY2A 3DCNA 4WZAB 4PG7A 3SKXA 3WRYC 4P7JA 4Q34A 4WCVA 1NDUA 5D2CA 5FUYA 3WSWA 5LYJF 4HEA1 4JB0A 4JT2A 1I3KA 3OF3A 1WPXA 2G80A 3AHFA 3QTBA 4F85A 4HNHA 2CLHB 3TF5A 1SR8A 1OH8A 4AP9A 5K3CA 4D8UA 4YO8A 4X71A 1VSVA 3R44A 1R7RA 3OEED 4A91A 2F8SA 1PZHA 3KSDO 4UMVA 2PFGA 3D4NA 4JR1A 4RTSA 1PX0A 3COWA 5KYWB 4H3HB 1E9RA 4BGVA 4O08A 8OHMA 2OO7A 3QNUA 1EX7A 1EIWA 1XCOA 2V6JA 1KP3A 1V25A 4ND7A 5EE9A 2B94A 4C4XA 4YMLA 3QVVA 4A4DA 4PG8A 5DTJA 4QKQA 5BURA 2VAVA 3S27A 1TJYA 1L7PA 2TMGA 3NHAA 4EJFA 4DT1B 3B8EA 5IG2A 3EMKA 3OZ7A 2OGWA 1TYAE 1FEZA 2ZR9A 2H2GA 4KE8A 4MNTA 4OXKA 4IZOA 4D45A 2H11A 3P9IA 5EP2A 4X3CA 4WEQA 4PM4A 4PHGA 3I39X 3OZSA 3PHCA 1ZH0A 4ADSG 4XGIA 4Z4QA 2B6HA 3LV8A 2YJGA 3HJNA 2FW9A 4ALLA 1QGAA 2PGLA 2P6RA 5SYAA 1E1CA 4F5YA 3JVDA 3L7LA 1HE2A 2FRDC 3UH0A 5DT9A 4U0JA 1EU1A 5AXCA 4KYVA 4HAUA 3KE8A 4CLOB 3FAZA 1USVA 4A8JC 1TVEA 2BFBA 5ALZA 3BYZA 5A0FA 4G1UC 4JAVC 5KWIA 3P4UA 4L15A 2HO5A 4PC3A 3H2KA 4NEHB 1JEAA 4MPRA 5TVGA 4TWAA 2W6JA 3W6PA 3MA0A 1HQYE 1WVMA 3L07A 1KZYC 3HI6A 2IXTA 3GIDA 2AXEA 3DEZA 3AIOA 3HR4A 3LOPA 3QEJA 1C50A 4LJ6A 5DEIA 4E31A 4FUTA 5JZVA 2BMWA 4AL4A 4G5SA 2I6QA 3KWFA 2X22A 4B3XA 3MLBA 5EP1A 3P9KA 5KJEA 1IHOA 2UVPB 1S2GA 2SHKA 1RWNA 1G8HA 1ZQ9A 3QBTA 4OU5A 5I9BA 3T9EA 3NDRA 5CXUA 4U2CA 3ZLBA 2CDBA 2DKNA 2V9CA 5FYQA 2FPOA 3KALA 2ASEA 1E9DA 2KSQA 1NT4A 5BRNA 2F3RA 3RSFA 3GY0A 2QVBA 3JPWA 3CZ9A 1ESNA 3OU7A 3KLNA 1J09A 3MWEA 4F3CA 5BN3A 4XWKA 3R4CA 5FTLA 9ATCA 4DR2B 4I46A 3LC0A 3EVAA 1N0IA 1RVV1 1YC2A 2XXJA 3D6JA 2M1ZA 1NUUA 3HY3A 4ZI7F 5IF3A 1VMAA 4P83A 3B1KA 1U2GA 3M4JA 3V4VB 3M9WA 3USES 5FLXA 1Z34A 5A4DA 5IAGA 1XTKA 2NX2A 4M8IA 4OJNA 4Q3CA 4CCYA 4M0LA 2FLWA 5DGTA 3OQPA 1IUOA 4QT0A 4DMMA 4GWKA 2H4HA 1U63A 3P1JA 1LTHR 1JDUA 1ML4A 3VH3A 4X20A 2B3DA 2W8ZA 1PUIA 1E5LA 1QO7A 1OLUA 2P4SA 3I6MA 4KR3A 1NQWA 3CUVA 4Q00A 4M22A 4EGFA 3DKPA 3Q98A 2OV6A 4L9AA 4ZQHA 3LXUX 3MGKA 3H8SA 1PWZA 1X7HA 3RWBA 1OT3A 1Y1SA 4LY3A 4KEAA 2JIRA 4K9MA 3OQVA 3GLQA 3D02A 5AKEA 3HBFA 2PGXA 2RHWA 5DK4A 5K7SA 621PA 2XTAA 1E5DA 2MSKA 3QY0A 2B0JA 3ZQKA 1B1AA 4PQFA 1R64A 1UMDA 2JC3A 4OV6B 3O91A 1JG2A 5JDIA 1R0ZA 2CV1A 1UKZA 3RNOA 1XQXA 1SQ6A 2JAXA 5UKDA 4XWGA 4TLAA 3ZHVA 2IYWA 1MDFA 1P62B 1LDGA 4BLOA 3OTOB 5CXQA 2J5BA 2SKCA 1YBAA 2QM7A 3D6FA 3AEQA 3U44A 4B3DA 1O57A 1CLUA 1QOZA 5FHQA 2OYSA 3HJCA 4EQ6A 2ZQYA 2NO1A 2Y8EA 4R84A 1XPUA 3K2EA 3ZGOA 3F1LA 1N8TA 1KP9A 3GRVA 1OI7A 1PSWA 3P2YA 5K09A 4QYIB 4M4SA 1HDEA 2WILA 3MXTA 3U3OA 4IVRA 4G36A 3COZA 3TSZA 1JEYB 1ZEJA 3DMGA 4BKPA 1KVRA 3JQAA 2W2MA 4UQOA 4OHUA 3FPGA 3P2IA 2OCKA 4M9QA 1E1RA 1M1YB 1W47A 3EOZA 4GUDA 5IC4A 2CFCA 4JK3A 3IXQA 4JYBA 4KX5A 4XLZA 1SOAA 5AXDA 1GM5A 1CUAA 2XJ4A 3Q7TA 3SXJA 3B1YA 2RHDA 3DAPA 1EX6A 4JSRA 4CLXA 3CG4A 3RHFA 4YRIA 5C9ZA 3BSYA 4JUFA 1SUIA 3JQAD 5KCMA 1W6RA 4ZHSA 4AKEA 4BNKA 3OQBA 4YTEA 3W5CA 3MTAA 4FT2A 1QVAA 4QTYA 1UJMA 4AQDA 1ZBDA 2WA1A 3AL3A 3C3MA 3DDOA 5KWSA 3IEVA 4Q93A 4OVKA 2FZKA 3TMKA 1RT9A 4BOYA 1VBKA 2QOEA 2RCNA 3MIIA 5JCJD 4A7PA 3PHHA 1XTRA 2M32A 3BE6A 1L3BA 1ULZA 3MM4A 2Z8YM 3SFTA 1TU4A 4FHDA 3AERB 4ZVSA 3F8SA 2X76A 2JD2A 1X9IA 2OK7A 2PGOA 3I34X 4P3PA 4FDLA 3UAZA 3KQQA 2GNAA 3T7EA 3GYBA 1YVEI 4P3NA 2GB4A 3BB1A 5FNVB 2VJBA 3BSFA 1U2ZA 1UBLS 2QU7A 2ZUUA 3H11A 3Q6MA 3QX9A 4J1NA 3DP9A 2R6FA 2H5EA 2G76A 3O3OB 1TIPA 2V6GA 2G0TA 4WLOA 5CMLA 4F6CA 3O2SB 1NU6A 2DLNA 4LRSB 3RRZA 3ME5A 1CRZA 4WL0A 5KC8A 2IYLD 5ITZA 3GNTA 2X0KA 5AW9A 1Z0ZA 3OTQA 1NYRA 4I1UA 2CHVA 1YZKA 2J3LA 2F4VB 1R4MA 3DBOB 2XQGA 5KREA 1BSVA 3WFJA 1U7DA 5IMSA 2RBKA 2ZT7A 3KPWA 2JGKA 2O8EB 4EECA 4DPMA 3WQRA 4IM7A 4A23A 2WAAA 3ACCA 4G67A 2Q6IA 2JGNA 5HJ2A 3AV0B 1VHWA 3L8FA 4C6TB 3D8UA 2RAUA 2HMWA 2VPZA 4LMBA 1YR8A 3CC8A 3CXUA 4KMSA 3WNVA 1PNQA 1T29A 2DB3A 1EBUA 3CRVA 3PE6A 3CKYA 5CT6A 1OSNA 3E53A 4IMJB 3V1UA 4OP2A 4B3CA 3INGA 1Y98A 2WM8A 1OE0A 2VPTA 3WGTA 1MH1A 4C6TA 4R0NA 1C7FA 2I8LA 1KDVA 4YJDA 1LNZA 1OLXB 4PZAA 3WICA 3PDHA 2AEMA 3H1BA 4NVRA 4D97A 4ENRA 3D3KA 3A2KA 1GDDA 2QP4A 3NIFB 4DIEA 5JRJA 3NHZA 5CVJA 4DR1B 1DQSA 1DCKA 1YFLA 3BF8A 3GLRA 1QF7A 5DPMA 4ESOA 2IHVA 2BFPA 2P5UA 3L1UA 5IBRA 3WIDA 3G1TA 3RG2A 1NR7A 1SGWA 4URWR 3T5TA 2QPAA 2TS1A 3F7OA 2CNWD 3K1AA 4J3FA 3BHNA 2P7IA 2XTJA 2AG5A 3S55A 4OBBA 3T61A 1HWYA 4WDQA 1PJQA 1GARA 2Z4SA 4DJDC 2DXIA 1B8NA 4L4SA 4GZ3A 4YBRA 3U4AA 4UUMA 2CXXA 2BELA 5DSTA 1AO0A 1M5RA 2XYQA 3DTVB 3DO8A 5KQPA 1EXVA 3ETHA 3EVDA 3MAAC 5G4KA 3TUIC 2PUDA 3IUPA 4FYJA 1N6IA 2DFDA 5FXMA 3SSMA 4D4HA 4F2GA 1DTWA 2AD5A 4YYEA 2AXPA 1H6DA 2O8CB 4RDCA 4PAGA 3PXBA 1AMUA 1M7GA 1Q22A 2BP7A 3A2LA 4RABA 6PFKA 1QK5A 5FUVA 4K0KB 1E2BA 4HNUA 4PSCA 3C4VA 4PYOA 4PQRA 5JAPA 1NXTA 2WUDA 3H65A 4WEOA 3VKFA 1NVAA 3CNEA 4K2AA 1EGMB 1BEUB 2M6RA 4UFNA 2BW0A 3ZVLA 2FHPA 4FD2A 3RFVA 3CMCO 4CKCB 2QWXA 3LDGA 2ZAMA 3LSTA 5I9MA 3W2IA 2Y6UA 3Q3IA 4IG9A 3D4BA 4MP8A 1KO7A 4AJJA 5JECA 2VHYA 1D3AA 2X0JA 3R6LA 3E05A 4OQFA 4L6AA 3RB8A 4EPVA 4CEIA 2PKYX 2GD0A 4OIMA 5G2OA 5KNDA 4KJZA 1K0FA 4H4EA 1HLPA 1TQ2A 5EOVA 4EPXA 3LA8A 3CX4A 3O8OA 4AYTA 3WBKA 1KDPA 1BMFA 4K6FA 1ZM9A 4OMDA 1WCYA 1AC5A 2B9EA 4LXUA 3CVXA 1VL2A 2WKQA 1R6AA 3L9XA 3E1KA 3W8DA 5DU2A 1ZR2A 4QWMA 3DHYA 3DZFA 2HRCA 4OKNA 3B82A 2V0NA 4IDQA 4JA0A 5E6RA 4QQKA 1JJIA 1JL3A 2A4MA 3PHGA 3P0IA 3UWSA 4TKUA 2B25A 4LXHA 4ZREA 2XF2A 2Q0XA 1Y1KE 3HACA 3FPEA 3PXEA 2QI9F 4IQGA 1CJCA 1CR4A 3I9OA 4RWZA 3LX4A 4RVCA 3JATB 1ECCA 3SKYA 3ZW9A 5IKPA 1UBTS 2JPDA 1L7VC 1E6CA 2PG3A 3FYSA 4W7IA 2HCTA 2H18A 4O1MA 3VOAA 4EKYA 4ISBA 4X60A 1KF0A 1RMTA 3PX2A 1ENOA 4IEEA 1HLFA 1OREA 1NP7A 2OO5A 2X5OA 3QUSA 1ODCA 1P2GA 4PZYA 3WWOA 2J30A 2JJMA 2I3GA 1G3IA 2GSWA 3I3OA 3ID6C 5CHEA 5AJYA 3VHLB 1TYBE 4M89A 3QSGA 3F0TA 5DT2A 1TPZA 1RRPA 1XBTA 4DB2A 1G16A 1Z5VA 2FSVA 5B64A 3VR1A 4BNLA 3N2GA 2YJ6A 2E48A 2WHYA 3W3AA 2W6IA 3OE7A 4AJ9A 2AVDA 4HJRA 3FVTA 3KQNA 3KQVA 2Q27A 1A7AA 2VSXA 2J4CA 2XV1A 1M34B 2DKOA 1M1NB 3GMTA 1LJLA 3KOYA 5AO9A 4LVOA 4CU2A 1T2AA 4DSNA 5L53A 2WT4A 3S1AB 3IHTA 1RYYA 3M82A 4K3UA 4XD7D 1R10A 3PR3A 4YR9A 1G5QA 3QEBZ 2XD9A 1DBPA 2JH3A 1LEHA 2VH1A 3MB8A 5HDBB 3BMCB 1A4IA 1OPRA 1ZG3A 3SJUA 6ABPA 4G5GA 1QKKA 4IQ4A 2Q5JA 5IK2A 1NQOA 5IBPA 2ZVQX 3OFKA 4UEJA 4AMYA 4DBLE 1F4LA 1K5GA 1W34A 2XMGA 1EK5A 3LXMA 4R8KA 2H9AA 5KNBA 1ZVJA 4ALMA 3AG5A 1BN7A 4G9EA 1MABB 4IP0A 4P58A 4QC2A 7ABPA 3PF8A 1VGQA 1LRKA 3EGCA 4KIUA 3V33A 2VHUA 3RAFC 3KKOA 4IVNA 1JEQB 2DFNA 1G60A 3H5IA 3RK4A 4KIJA 4BYGA 5CB8A 4YPVA 2KQUA 2P2CA 5KNBD 3TX2A 1AKMA 1S2LA 1Y34E 2WD9A 3QLVC 5DNVA 5TX7A 3TLAA 4B31A 4EHHA 2R6DA 4MUJA 3E23A 3BXEA 2B7LA 1FSSA 5K6AC 2AI3A 2ZYUX 4IEIA 1IZYA 1E79A 5BWMA 3G89A 3CCCA 1AKEA 2F90A 1FUIA 4P4LA 1AMNA 4HGZA 1Z75A 3E9DA 4HZGA 2HQ1A 3ZY2A 2XLCA 1WXGA 2IV3A 2HXGA 4K9PA 2HK9A 1PG0A 2JK1A 2VWQA 2NW6A 2NQ8A 4NECA 3R3VA 4UVHA 4JT9A 1AX9A 3ZLUA 5BNWA 2DR2A 3LHSA 4YREA 5LQJA 4A15A 2A1IA 1ST2A 2O3UA 4ZVQA 4Z5XA 1ZEMA 3V32A 3IUBA 5AW4A 4CM3A 4EW6A 4FGUA 3TLEA 3ANXA 4AS2A 1OWNA 3LQKA 3OQNA 3TSCA 2EIHA 5GJVC 2JFBA 4ZV7A 5K0JA 4PZ9A 2R7LA 2ZYWX 4EKGA 2ZGVA 2VQEB 2VJNA 5EIOA 4EVIA 1Y4AE 3SIXA 2E85A 3M4ZA 3ECSA 3QJYA 2BWJA 5C80A 3IIKA 4CLRA 1XDUA 1H22A 1EK0A 2QRMA 5C5EA 4G1MB 4TV8B 5BW4A 3K0FB 3N6RA 2B1IA 3BWYA 3IHKA 1COWA 3CEJA 2VNIA 2A0XA 3B7GA 3LPAA 4AQ7A 1ES9A 5HE8A 1TT5B 1SH7A 4RX1A 4V02A 3PC6A 4CN9A 4JITA 3ROQA 1JQ5A 3KIPA 4UNNA 5F1YA 3T3IA 4E7OA 3T7CA 4ERXA 4YCMA 1NF3A 4CDMA 2FQQA 1G7RA 2C5EA 4GXTA 4OCZA 1UXKA 4KQKA 1JIIA 1XZKA 2EKLA 3WGUA 2A0WA 1Y89A 3L6RA 1U28C 2P9CA 1S2IA 5K5EA 1T5BA 3CCBA 1OFUA 1Y63A 2YL2A 4TZ0A 1Z0AA 3INRA 4R1OA 2QR3A 3L4EA 3S2IA 1YA8A 4N4AA 3RSZA 4AYXA 3IVRA 4YMWA 4C43A 4EZBA 1ZX1A 1JQDA 3PCXA 1IK6A 3EAFA 1THGA 3K5PA 1Y6RA 3MNFA 4DMLA 2GPSA 4O2AA 1H2YA 2O52A 2ACKA 4MDYA 4FK8A 4P82A 4AD8A 4AVYA 5JOQA 2AQKA 2FUKA 5JMOA 1CERA 5KIAA 3GT4A 3TW6A 3FYCA 4BVFA 1D1TA 4MV5A 3TRIA 2WWFA 2ZULA 4LS3A 1Z5PA 2I2WA 3DCIA 2D5CA 1UODA 4AJKA 2H7CA 1FPMA 1PFVA 4LDQA 5AW3A 3U6KA 1CUSA 1JKIA 3ZDAA 1LC3A 4PNEA 4P5EA 3BDVA 2C29D 3R5FA 2I1VB 3M1YA 2R9VA 4Q3DA 2I2DA 2WU3A 4ND8B 4X66B 3OM0A 3F3KA 3R0QA 3O5AA 3SZGA 4HNTA 5KJ6A 3ROFA 2XA2A 1X6VA 3CBGA 4MTCA 1K88A 4E07A 5AFSA 2V7VA 4HP8A 2REOA 1L1QA 3SS7X 2BC9A 2QYTA 1KE2A 1A04A 3WWCA 3R76A 1WNTA 2EP7A 2O23A 4PSUA 2PT5A 4KQFA 1QR2A 2ILVA 3BRQA 3LUFA 1LPBB 3TSYA 2FH5B 4HDSB 4PCAA 3EUAA 1JJBA 1FU4A 2A78A 4F5EA 3AF2A 1CDDA 2RGNC 1TTQB 2VQSA 3K2QA 3NS7A 4M8NE 2PQMA 1LF5A 3EQ6A 5BN4B 4MLCA 1UC8A 2H4XA 2YY5A 4MB0A 4N3NA 3LGAA 4Q9DA 1QUEA 3IEXA 5EMNA 4JLBA 5A7HA 3UJBA 5I7SA 3LBHA 2OZLB 5JO9A 1GQFA 5ARBA 2B8NA 4HGYA 2MHCA 3DVQX 1Q7TA 1A8UA 3HG7A 3UCXA 4PFSA 4CR7A 5HUHA 2HK6A 4HQFA 4IIJF 5A9RA 1W76A 1EGQA 3Q5DA 4JB8A 5L3SB 2FUG1 3HCBA 1I3NA 1G8GA 2HHCA 3NC0C 2ZYTX 3OETA 4Y6OA 3B6MA 2H16A 1IE3A 1DIAA 5CU7A 3L6BA 4LQCA 3V2HA 1IOZA 2GILA 3MRXA 4YRBA 1E9CA 2C2BA 2BR4A 1YKFA 1QIGA 1G2PA 4G84A 3FUWA 5B6JA 5IDXA 3JVVA 3NTXA 4FVTA 5CLJA 4QVIA 1M2VB 2R68A 1Y7PA 1DP4A 3L7MA 4BQFA 3FRIA 1U9IA 2I67A 4JYPA 4UM9B 4UBKA 5FPYA 5FWYA 4CR6A 2BFMA 2E4VA 1E9BA 4D9NA 4YEDA 3UTDA 2PX6A 3THWA 2Q6KA 3HCRA 3AC0A 4LC9A 3GBVA 3T12A 3IUEA 1ZM7A 1VSTA 2XUIA 3W8FA 4A6PA 5KOIA 4HNSA 1IWBB 4UEOA 4QUEA 5EJ2A 4GPBA 1N5LA 1U1GA 1GZ7A 3NVMB 1L5RA 1OVMA 1IZZA 1GCOA 1DU4A 2H4JA 1MBZA 4J6FA 4FGKA 2O7VA 4LGCA 4WOJA 3SGLA 4D02A 4HUTA 2I55A 4G0WA 3AEUB 1SCIA 5JD6A 4RCVA 4JBXA 3FDXA 4FNGA 1TIBA 5L6LB 4JLPA 3F78A 2WMDA 3IAS1 3QE0A 3OIYA 3EPRA 3HZOA 5JBQA 3PTLA 5EINA 3QLUC 4Q9LA 3U3KA 2DCMA 1Q14A 3VYTB 1OWMA 4EPRA 3TQCA 4KQEA 3MGGA 1P7WA 1T10A 3BMQA 4FYIA 2GZ1A 3KV1A 4O5OA 1LF0A 4JJ8A 4OHPA 2GF9A 4P93A 1KEEB 1MV8A 4MVJA 5H02A 2WIBA 3ZNOA 2UVDA 3K73O 4TXLA 4OQMA 2HJSA 3IV7A 1LPOA 3O90A 4CIVA 5FDFA 3ZIDA 1U2QA 2JHGA 2P3OA 1G5RA 3Q7IA 3NYWA 2O05A 1E7WA 1SIWA 2Y6VA 3FNEA 1Z4IA 4PS0A 5KNLA 3U4MA 4BFSA 1J21A 2IQ5A 4TS1A 1NVEA 1N0WA 1P5FA 2OG2A 4H7KA 1BQ3A 4QTTB 5AW0A 5KVAA 2G71A 3WVNA 1H3FA 1W5SA 1PFQA 1UDBA 1I7SB 4B5LA 2HQBA 3ELDA 2SCUB 2XGSA 4H18A 3GPCA 4X1OA 2BUBA 3PFKA 1UWLA 3T1YB 2C3YA 3P45A 3WRXC 4Y9RA 1UANA 1E2EA 5IHPA 1UBEA 4PYMA 1TADA 2XQKA 4UJ3A 4Q9IA 3NC1C 1A9ZA 4CTMA 2R1VB 2VHVA 4CQNA 4LRTB 3IOEA 1WX1A 3QEOA 1FSPA 2XB4A 1H93A 3B60A 2O7NA 4GLBA 2BEVA 4AY4A 1FFDA 1F38A 1QOPB 1ZSYA 3E18A 2HIGA 3KB8A 1B3BA 2D1RA 1P31A 2WWTA 3HSSA 2AFIE 2E5FA 1TIKA 4K87A 1LDYA 2O7QA 4GI5A 1IPFA 1OAAA 4GU5A 4H3SA 1HE5A 2FPIB 2XMPA 1LK0A 1X70A 1GTVA 4MW7A 4BP3A 3LY9A 3RC9A 2ZIAA 4M1SA 5CTAA 5CW1A 4E4RA 3F71A 3HKEB 1VLZA 1ZK3A 1XDZA 1W85B 1N6OA 2WIGA 5G3YA 1K27A 1DSSG 1WNFA 2DMRA 2OHGA 2JFPA 3FFXA 1SEVA 2V98A 3K0EA 1GPNA 4RD6A 4BLTA 4V1CB 3CNOA 1IDOA 1GVHA 5J59A 4DCUA 1UAAA 1NXXA 1Z2OX 4YACA 4YRFA 1E7QA 4HAWA 3VZBA 2YXBA 2R6HA 3VH2A 4D56A 4JY7A 2GEDA 4JNCA 4NMHA 4MYSA 4TOIA 3ZWCA 5K8TA 1A7JA 2QN7A 3QWFA 3K94A 1V2HE 3WOHA 5ELXA 2CEAA 1NP3A 1Z8NA 5HKBA 2CXTA 3L77A 4QJBA 5LMCA 3I4FA 1E6KA 2RI6A 1V1MA 2PUVA 1SAYA 2JGDB 4Z2YA 5I01A 1HV8A 1NYQA 1VE3A 1XC7A 2EJBA 3NETA 4CCWA 1CIPA 3NBZC 2BFCB 4Q6WA 1SHKA 2CNKA 3DUFB 3QE4A 3AETA 4MR8A 4AB1A 2WPDA 3L82B 4Q9KA 4QG3A 4OI0A 4OXNA 2V8OA 5DZSA 4IGEA 1YDEA 3UJ7A 1H3NA 2YYYA 2RG1A 4WQMA 4CF6A 1YVRA 4IOKA 4RZ3A 2VJQA 3FMIA 3H2HA 1L7QA 4RH0A 2AR9A 4MQEA 5AM1A 3T35A 3UGTA 5FUQA 4QJ3A 2IZZA 3OZCA 3IDSA 3G8YA 1OWOA 4J16C 1GFWA 5TS3A 1K75A 4AU1A 5JWOA 3LUJA 3O6VA 4P22A 4S1PA 3I1JA 3JD1A 4KN6A 3THXA 1ZR4A 3K20A 1M2EA 3RVMA 3FCAA 1K6MA 1UK7A 2HJGA 4OHXA 4YRCA 3JQBA 4JVMA 2ORED 3DVAB 1DINA 3A4VA 4KNWA 5D01A 1KMHA 3HP1A 1IYZA 5E7MA 1FDRA 1NC3A 1IY8A 2G0NA 2G1KA 1VLVA 1VP9A 3G2JA 3BHJA 1W2HA 3CO0S 3ISTA 1TQDA 4IDEA 3ZY6A 2ZXUA 3IAUA 3HRKA 4UTRA 2AFRA 4ZVTA 1NBMD 4RV9A 1YO6A 1T6ZA 2DRIA 4MMYB 1CFJA 4GYWA 5LA6F 5A5GA 3FZEA 3IB3A 4BFTA 4AXXA 1QPZA 1RCFA 4FBMA 4G24A 3KRTA 4HB0A 4R5MA 1P39A 2R6GA 1GYQA 3UK6A 3CURA 4ABYA 2C5HA 2GEKA 3LJKA 1NZFA 1XO1A 3PGJA 4C4YA 2UYGA 4TRMA 3GOQA 4Z6KA 2GUWA 2XRZA 2ZB7A 1QK3A 5JALA 4XIIA 1PLJA 2JJ2D 1RPJA 2XQIA 2YXPX 3LUDA 4GM1A 4JUDX 4PE5B 4E12A 3S3TA 3HM9A 3CJRA 5LWQA 4LE1A 2CVPA 4V1CI 3N75A 2AZXA 3THYA 4RYLA 4S04A 4JYZA 4NOKA 3JTMA 3RSLA 1EDBA 7REQB 1PR4A 1BCRB 4AUEA 4ZK6A 4YX9A 2OGSA 3AVQA 4OHCA 4NZMA 4F1KA 1IMOA 1XD2B 3RC1A 1KK1A 4OGFA 2WE8A 3FWKA 2GFIA 3GD5A 1R0CA 3UW1A 2A88A 2IYQA 2R8ZA 5FQNA 3TZBA 1SULA 2C3MA 3I0MA 4MJXA 2FWAA 2PJZA 4ZIRA 1K3TA 1CVRA 2YDXA 1GEGA 2ZBPA 4LECA 1ODSA 4M7PA 3ZN2A 2IW3A 4Q3LA 5AHXA 1ISMA 3RUDA 1UBOS 1NI3A 1VYHA 3UJPA 1PO7A 2IDKA 2XE8A 2GGSA 4CIDA 3JWPA 3X2EA 1EK2A 1L5OA 3AF1A 5T3YA 3T38A 3UFXB 3WNCA 3ZK7A 4FB5A 4PO1A 3C2QA 2WVJA 3E15A 3U1VA 5GIPE 1V96A 1XTJA 3N5CA 2VQDA 3F6SA 3MLEA 4XPZA 1GQSA 2D06A 3PT5A 3Q8KA 4ZI3A 4HHEA 1C1DA 3PUZA 2WFAA 4YDRA 1GGFA 4R05A 1ISGA 4LDJA 2VK1A 4EB0A 2XWPA 3T7SA 5HZGA 2GN2A 1CHDA 1YI0A 3M83A 1EESA 4D4GA 2YC2C 1V37A 3QVKA 2DGDA 5D7BA 3ZWYA 2QSZA 1YRYE 4JR2A 1C1HA 1W5EA 4MUYA 4BWFB 1KSFX 1YRQA 3IBTA 1IFXA 2ZI9A 4DQ0A 4MWZA 3GHYA 1W8IA 2GQ0A 4N01A 1YXMA 3G23A 3UANA 2QRUA 4RJLA 2RGCA 3L1HA 4U6SA 3BH6A 4CG0A 4RL6A 4CL0A 1HZZA 1JSLA 1JQAA 3QUBA 1R5NA 2R7KA 3WK9A 5AVQA 5TLSA 3UXMA 4ZOLA 3EHDA 4C4SA 1ZISA 3BKWA 1BXRB 4NPHA 1FFXA 5ANRB 1CQPA 4RZIA 4PSAA 3EWNA 3SN6A 4EFMA 2PYDA 3R6DA 4L6CA 2UXDB 3CJQA 3QZUA 4M98A 4TROA 1TLTA 1RWPA 4A0FA 1KVUA 3NIDB 2X77A 1MQ9A 1IAVA 3GZTB 4XJXA 5IXJA 3UXHA 2L69A 4Q7KA 5TMDA 2TMKA 1E8DA 1XX6A 3AUSA 1E9AA 2G5PA 1B76A 1YIDA 2QA5A 2QNRA 4OQZA 1V4BA 3PIRA 5BV2P 2B7CA 3BS4A 4JC8A 1SVIA 2YOHA 2CLSA 1WMFA 3AEKA 2IPXA 1BU8A 1SVWA 2QG4A 4YT8A 3DGEC 1X7YB 1ZD9A 5BMVF 2KWIA 2W8BA 3QI2A 4DLPA 5AXAA 4EX6A 4ZVMA 2PBLA 4RF3A 1ZBQA 2WZCA 1KERA 1FQWA 3CF2A 2GYUA 4L08A 1NI4B 1YTLA 2X8LA 3C3BA 3K09A 4NKRA 1VBMA 4QEDA 5IULC 1UJBA 2AN4A 4IGFA 4ZMSA 1F17A 1PLLA 2A57A 4LJKA 1EX1A 3CIFA 4P3YA 4S2EA 2YWEA 3C5VA 3I64A 1QPBA 4W5WA 4KQ9A 1SG0A 3RRJA 4CTJA 1S02A 3IO3A 2LP4Y 5EGNA 2FFHA 5JAQA 4F06A 3HZHA 3FZQA 4A6EA 5BW5A 2IH5A 2XQJA 1EMDA 1YL7A 2IELA 1SXHA 4U2DA 4YASA 4BFLA 5EJ5A 3ZJVA 4UHEA 3X1JA 4H77A 1WIWA 4MUEA 1T9AA 2C9CA 4YP9A 1IBMB 2IC5A 2MT9A 2YN0A 3OJCA 1EFVB 5LLTA 1P9NA 3EZ9A 5HPYB 1KR5A 3G0CA 1BYIA 4Q1DA 5ALGA 1T43A 4EFLA 5C5CA 4YAIA 3GJ3A 1WS6A 3GJRA 4DKXA 1JJAA 3MINA 3NBXX 1P5JA 4RPCA 3U5ZB 4DRXB 2I66A 3SDZA 1E6UA 1PT9A 3FN4A 2HGZA 3TZLA 1C3VA 3WFZA 2P41A 4PYIA 1VSQA 1W581 4MUNA 5J3JA 3OP4A 3C5CA 2Q2NA 2DEUA 3D3NA 5L9AA 1H1DA 3C3KA 1T8PA 3LPNA 2ZRAA 1R4NB 4RTRA 2YFQA 2O0HA 4QHTA 2QW0X 1DQZA 1N75A 1TKBA 1YJAA 1W0JD 4JP8A 1G20A 1HYHA 3COYA 3QU4A 3BAZA 5SZKB 3U3RA 4XDGA 2OILA 2QG6A 3RVOA 4WY2A 1VFNA 2VYVA 3KJFA 3V4FA 1G6KA 4IQFA 4MYRA 5AI8A 2CXHA 1QHIA 2RH8A 1NHGA 5CDFE 3VA7A 4CTNA 4B3SB 3G17A 2YV1A 3BM5A 1LBTA 4LNHA 1OVGA 4YQYA 1YR3A 3JALA 5LZ2A 3NUZA 4G8DA 4PSKA 1KEKA 4CYMA 1CQIB 2H63A 4LCBA 2C4TA 3SF8B 1ZK1A 1A9RA 4IAOA 3KEMA 5F2EA 2E0IA 3Q2IA 4AS1A 4DMCA 4OQEA 1WCXA 1XZCA 3MGBA 1C7ZA 2HF9A 3PWTA 2X0EA 3FYHA 2XHEA 2XYVA 3A6FA 3OPNA 3OJWA 5EKUA 4MEBA 3X3HA 3ZVNA 2IITA 1GD1O 2CLKB 5GINE 2E4ZA 1PHPA 4IYJA 2VF2A 1MPXA 3L8HA 4CPDA 3KS9A 3UKOA 2Q6LA 2GTPA 4W7SA 5FV7A 1WO8A 1LKZA 3NJ4A 1PJCA 2GJAA 3JYPA 3RYCA 1S4MA 4EPYA 1PS9A 2AR0A 2B35A 1QHGA 2QP3A 3L7KA 2GDJA 2VP0A 3FSGA 2CJWB 4FSXA 4KWIA 4XX0B 1L5NA 4BVHA 2Z09A 5L3VA 2QL9A 3UICA 4N0QA 2M1XA 4ZCTA 2FG7C 4I8DA 5FR2A 1ZONA 5CFRA 2CYAA 1SXJA 2YWFA 3IP1A 4MB6A 2ZR8A 2C04A 3WG9A 4C04A 1LLCA 1OIVA 3FMVA 4C7OA 4PHCA 3CR3C 1YFKA 3FE2A 3K7EA 2I2BA 3PYLA 3FSGD 4RKFA 1Q17A 5AUPB 5HOQA 3BHIA 5MHTA 1TVKB 2CXSA 3FPCA 3RRBA 3VR5A 1GR1A 4F45A 1TVMA 4HQLA 3BXXA 2FW1A 3WLSA 2GAAA 1SXJD 2VUIB 4HJXA 1USIA 2BGJA 3DOFA 4OFWA 2BSAA 4Q1EA 5HRUA 4KBFA 2BF7A 1DVRA 2IDJA 4O63O 5ESDA 1RLTA 3NV7A 4B09A 1QQ5A 4FMDF 4W5RA 1NP6A 5CYOA 2C3PA 2Q28A 1GV1A 4MRSA 3HM2A 2IEYA 1SWWA 3G8AA 3KWLA 2Q8NA 1I1OA 4RKYA 3SQNA 4AUMA 3CUKA 2BGWA 2YH2A 3HCEA 4IMIB 5DHPA 5GJBA 1SIBE 1AGXA 2J48A 3SG0A 1WG8A 2JKYA 4YMVA 1Z4LA 3PX3A 5KO2A 4LZJA 5KOJB 1EK1A 1JRLA 4BKMA 1RI1A 1MA3A 5BQFA 3VNQA 2ETVA 4LBVA 2GBFA 4P6VF 4DCMA 4F72A 3SVZA 3FUCA 3ZV3A 4JI1B 3M1AA 1R9GA 4PC7A 4RY0A 4EHBA 1YT5A 4S3MA 2JFGA 3IKMB 3OE1A 4KVFA 5E8RA 3I9V1 3ED5A 4PX2A 1NE7A 2WD7A 4N54A 2HGSA 3GVPA 1KH2A 4KCGA 2XDQB 5D00A 3VMFA 2IHTA 4RHTA 1S3SA 4WFQA 3R75A 3H16A 4ZAFA 3EXHC 4BZQA 2JGEA 5F73A 5TJ9A 4CM8B 4L0DA 2I4MA 1MD9A 2J31A 5TB5A 5C8YA 1NQAO 1F14A 4R2XA 3QU9A 4DLSA 5HQ3A 3NAZA 3UYKA 1W0CA 4R7TA 4IIJB 1XVAA 2HFKA 2QDKA 3BKXA 5A5FA 1PYDA 1RMYA 1GDTA 2DF8A 3PUIA 1W9MA 3N58A 2VDPB 3GJXC 1M2OB 4R8VA 3HJTA 4R0MA 1ESZA 4L75A 1X7ZA 4LXQA 4PAOA 5JH7F 2O7RA 4JBWA 4J94A 1ST3A 5GZ6A 2WJAA 3JZFA 3BWEA 4IJVA 4AZ3A 5LIRA 4HGOA 5C8VA 1JIUA 3AJ8A 1EIZA 3OZDA 1PQUA 2OCLA 5FR1A 4A2WA 5A03A 2HM7A 2PRJA 5FLEX 1JGTA 3E2MA 4BO2A 3Q3CA 2H1OA 1W48A 3R5HA 3T9AA 1D04A 4FNMA 1SNYA 5BYKA 4JU8A 1JKJA 3IEPA 1L4EA 3WQBA 3BIFA 3IHWA 3K30A 1NMYA 3G2KA 1FC0A 1X19A 2VNHA 3ABOB 4FE4A 4XFKA 1SCUB 1KWGA 2GARA 2K2QB 4XUGB 5CNMA 1G3UA 1QFXA 2PKCA 1EQ2A 3O8LA 1Y8CA 4NP6A 3W5JA 1NPYA 1UT6A 2ZWMA 1Z62A 2IP1A 2XADA 2YHSA 2EX0A 3AFOA 4K46A 4KI0A 4B84A 4I1VA 3P9NA 1W87A 3CW2A 1MXFA 2V74B 3V9PA 4R7GA 1K7FB 2K5UA 2NAFA 1B2LA 2GZHA 3FIJA 1B26A 1J42A 1XZEA 3RYIB 3IPLA 5AIAA 2QQFA 5BV1A 2J3KA 1IXZA 1WZ2A 5EL0A 1SXPA 3OHSX 1B6TA 3HVKA 3OZEA 4PLZA 1XROA 5F4ZA 3I1YA 2IWHA 2YVKA 2L17A 2PZ8A 5K6RA 4CF4A 1QNFA 4IW3B 2FWBA 1EQAA 1P1RA 4EABA 1AA6A 2H1LA 1G1AA 2C3UA 2ZSJA 4TWBA 4HRAA 1LK7A 4PLCA 3EA0A 1PK9A 2VJOA 1USGA 3KL2A 2BTQA 2FXVA 3PGVA 2C5AA 4HDNB 3U7FB 4YRGA 4LE0A 1EI9A 1BAPA 1ARZA 3JSAA 4QVGA 4K9QA 5KHLB 1KY3A 1T6BY 2BCEA 1LV7A 1ZAKA 3H18A 3DNPA 3EGWA 3R41A 2A0YA 3JQQA 4MOWA 3DBVO 3K0AB 3R40A 4C6RA 3DTYA 5EC8A 5EZSA 5TDHA 3MWFA 2F43B 5B37A 4KK4A 1B73A 4M76B 2FY8A 1ULUA 4L27A 1SUEA 3FBWA 2VF8A 2QE6A 1XKTA 3ISJA 1P8AA 3JU3A 3QMVA 3PDJA 5TT1A 3TW0A 2NU6B 1P2FA 4JC4A 2XXBA 1UBFA 1VLLA 3K9NA 1QDLB 1ENZA 1FUKA 5KYYB 4R9NA 5EYPA 3SNHA 2GYVA 1YI8A 1SBIA 1I33A 1UJNA 3F3SA 1UZAA 2ZK7A 5CVVA 1TYEB 4MKGA 1J97A 5E1OA 2R66A 3EEIA 1E99A 2GAOA 3UUEA 1YZFA 1S0UA 1VIAA 3VYRB 2B8TA 3SNKA 4BO3A 4Q3KA 4FR5A 1X7WB 2E6UX 3LBAA 4C05A 5IZCA 3MSXA 3E3NA 4XQCA 3B53X 3T8YA 4P3OA 5TT0A 4BNZA 1GXSB 2PNFA 4MLZA 2Q21A 5LYYA 2FPGB 5E0KB 2EBHX 3F6RA 5B53A 4E94A 3O3MB 2QPLA 4AMVA 1Z4JA 2COUA 4YAKA 1BCSA 4BC0A 4QASA 2V0CA 1MF7A 2GFQA 5I3ZA 3V8EA 5JANA 2CD7A 2ZRDA 3KDPA 3HJBA 1G6Q1 5JC8A 4BNHA 2YWDA 1IC6A 4YLGA 3JQGB 3WKCA 1EBBA 1LVHA 3N0WA 1CR2A 3WYEA 5B58C 2AVNA 3GEMA 4O3FA 5BR4A 5TJHA 4KZKA 1S9DA 3MOIA 1T5OA 1Z08A 2JIZA 3MCZA 3A6KA 4QUIA 1A9OA 3AVUA 3NJ8A 1SD5A 4FNOA 4KH0A 4XFJA 4ZODA 1T2FA 4OK5A 3PGKA 4TRNA 3PNKA 3M9XA 4BBJA 3DDHA 1WB9A 1U1IA 2YVAA 4DILA 3JWHA 1II9A 5ECGC 5HW0A 1RQGA 3SK0A 4AJ4A 3PQ3A 2W2PA 2XDAA 1QGUA 1OFHA 2PPLA 4REQA 3REQB 1LPSA 2EGGA 3W9BA 1S5PA 3H9QA 4CT4B 2NUBA 1H2EA 1OFUX 3KB1A 3UWKA 3GCZA 1E20A 5CX1B 3ETCA 2FSUA 3AJEA 3KXKA 3ODGA 3OSZA 2YNMC 3N2IA 4WERA 4TX1A 5HGJA 4Q4CA 5DYGA 3E9EA 1UWCA 2W58A 3SU8A 5A5EA 4F3YA 3AMVA 5B5SA 3UIEA 5EWLB 3CE6A 4PS1A 5CGZA 2VSFA 2IDZA 3I61A 1J99A 1F8GA 1PDWA 2KS6A 3B3JA 3FZYA 1I01A 2MSCB 3M3PA 4WBSA 4EJ0A 1NONA 5MN4A 1FPQA 1TLFA 2Z1MA 1D6NA 1RWXA 1XCMA 4ZYYA 4I9NA 1E4OA 4MIKA 5I8PA 3PC8A 4MVXA 3T3GA 3EPHA 5LA6B 3RYFA 4TT3A 2CHEA 2C9YA 3I09A 1MU0A 1O95C 3RREA 1KBQA 3OHMA 4EY4A 4MS1B 3OZWA 1J24A 1YVDA 2HLNA 4QXMA 4D46A 4UPEA 5A3QA 3D8TA 2ZCVA 4CKBA 3S99A 4BVKA 1AKRA 3DWIA 5JTUA 1AQ6A 1OX5A 1RXSA 2DWOA 1DG9A 3PHIA 3CLRD 5CYFA 3M3DA 2F9LA 3S28A 3AVPA 4LWPA 5K1ZA 2FEMA 3PCTA 1RIIA 2FOXA 3D3WA 4CKEB 5LB2A 2DFTA 4CQMA 1A9SA 1HDRA 2HIAA 2HWXA 5SZHB 2V58A 3Q3EA 4MX8A 4F21A 1XNQB 4Z1OA 1YR2A 3SR3A 4D57A 2E87A 3WKDA 3JW8A 1LZLA 3N8GA 4MHTA 4EP1A 4Y0AA 1QG2A 4LN1A 1ID8A 1JH9A 1WD7A 1Z68A 4OHVA 3WSVA 4E4TA 2D1TA 5EMKA 2VF5X 4WH0A 3PI6A 3NHMA 3VPGA 2JD1A 4R9UC 2JI6A 2PLRA 4J03A 2JIPA 2X58A 4DNQA 1EA5A 1N1DA 3DP7A 1I30A 2ZTLA 3DWGA 3SHVA 4CMEC 2QROA 1CZOA 1ONNA 2HX1A 1T4CB 2EFGA 2JFVA 2P5YA 2PZBA 2CF6A 3M6LA 3ROKA 4F92B 2IPLA 2ZYSA 4E03A 1YS6A 1VJ5A 1GN8A 4AXBA 3E9NA 1DC6A 1P0QA 3GC6A 3VH1A 2IEZA 1XQYA 5L6MB 1TEZA 4IIXA 2B4RO 1DCMA 1VPEA 5EXTA 2OD7A 4I9UA 2WAXA 2XKBA 4MYHA 4ZP1A 3VU1A 2DWCA 4RA6A 2QRHA 1ORTA 4RL4A 4CEJA 2YQ4A 2C7BA 1UDCA 3RGWS 3FOCA 4II7A 2DQSA 3NBKA 3WKBA 2ZXFA 5C35A 3RJ5A 1BFKA 1O97C 2O5CA 3LX8A 2NU9B 1W36B 3KTAB 3RT1A 3EQ2A 1XR3A 2MYUA 2YRXA 3LP5A 1XJ5A 3GA7A 2AMYA 4ZFNA 3GAAA 3IBYA 4EKEA 4JGGA 3BZWA 2XBUA 4CN8A 1JLHA 2H29A 3Q2KA 2ZBFA 4KE7A 1RC0A 4OHFA 5JS8A 1Z07A 2VDWB 1XEWX 3M0EA 4R1QA 1N2BA 2XYGA 4O33A 1QAMA 4O2LA 5KHAA 1DC3A 2XMZA 1JI0A 3DR5A 1NUAA 1U0NA 3EBPA 3MJTA 5BNIA 1PS8A 3QBEA 3KJHA 3QLTA 3N0RA 4C07A 2H8GA 2D4HA 1JA1A 1LSUA 1PFGA 1U04A 2QIOA 3DMHA 4JJZA 4TWJA 3Q3VA 1DHRA 1VYVA 2OHFA 3Q5EA 3UC5A 3HV0A 3L0DA 5FI0B 4ND4A 3HPQA 2GD6A 3DO6A 2BKVA 4GOJA 4WOBA 2X7HA 5COQA 1QGDA 2FE1A 2D0IA 3K71B 3GGDA 1CVLA 2XRYA 1RYEA 1CHNA 2BHRA 4W8HA 2V7UA 3S5JA 1J8FA 3TI7A 1E1NA 3SIPA 3QKUA 1DX9A 1UBKS 1Y1LA 3OPXA 4ETMA 5BMVB 1L1FA 2GK4A 4ZAXA 4ECAA 1T4BA 4DA0A 4LOJA 4B80A 4X1YB 1L5HA 2QL5A 4FHCA 3A06A 1R00A 2X40A 1TW3A 3B12A 3F9RA 2CNDA 1QH9A 3WQSB 1NW6A 2I6GA 1Q7BA 2OP0A 3D2AA 5AKZA 3MHPA 1P5RA 2PIAA 5E2BA 3VOSA 1ADJA 2D2IA 4P81A 2IF2A 1AS3A 1NLFA 3DBIA 2PT7A 4GEKA 2G9NA 3V7WA 2QTGA 1Y5NA 2R1TB 5J5AA 2Q4DA 3EPPA 3SJCA 3TIGA 2O1WA 3QU7A 4W5TA 3R24A 1X86B 2B99A 3ZNQA 5I4KA 1U7PA 4TL9A 1JF8A 1UMBA 2YXLA 3LL4A 5CD1A 2GPJA 1NX9A 4YRJA 5FOQA 2GO7A 3DL0A 3NIWA 3VYUB 1T3HA 2ORVA 4ZGGA 2B21A 4DWVA 5LOVA 3B3QA 3C3WA 2LTAA 4Y1GA 5E6SB 2GZDA 4JI7B 1LY1A 1W93A 3Q0IA 4G25A 4TT8A 5D8DA 3VNVA 3PE3A 4QLAA 4AY5A 3GBSA 4BWGA 1AY0A 4P33A 5F9FA 3UMRA 4G01B 1YOVB 1XCLA 1XIVA 3L02A 4Y6PA 3GV0A 2IVFA 3Q15C 5KNCH 3LCVB 5FJIA 1L7DA 3VPSA 2OSBA 1ISIA 2YRWA 3JYLA 2KB0A 3SWWA 2G1AA 2BDTA 3DMRA 3DFZA 1D1SA 4WPGA 3CV3A 4RVSA 3R7WA 3VR4A 4EOGA 4GOLD 5KYVA 1XZAA 5CDUA 4XOUA 4IDBA 4DLXA 5CA1F 1MO2A 1VCNA 4HNQA 1Q1EA 3QSYA 1PTJC 1GPH1 2PUHA 3E81A 3RS9A 4RIGA 3VU9B 4XASA 5K20A 1C80A 2IXAA 2XITA 4PR0A 1FNCA 3T7AA 3FOWA 3ZEAA 5DV9A 4D79A 1SU4A 2NU7A 1E5XA 3D3JA 3W4IA 1DAIA 4DADA 4Z7JA 3FBGA 4M83A 3BWVA 3B3FA 1WZCA 3TLZA 4YAFA 4KWCA 3RS3A 5FL7A 4BNDA 3OIFA 3NYQA 1BJTA 1N34B 1I2MA 3TW4A 5JNLA 2ATEA 5BOSA 2HWUA 2CSXA 3NASA 2KI5A 5ALHA 3LYLA 3KR0A 3KAQA 3V3TA 2JEZA 1GDHA 4NS1A 4I55F 1MRSA 1M6EX 1NSYA 5DHQA 2J3QA 5KINB 4M8SA 3FPJA 4M38A 3ICPA 4PGAA 2E4XA 3DLHA 1VRWA 5ALEA 1A2QA 1SKYB 1VCIA 3ECCA 3HKBB 1B43A 2VZ8A 2K6GA 3OAAA 1DAMA 1L7XA 1NY6A 5DIFA 4UBLA 5DOZA 1GG8A 2YZNA 1DARA 2WR8A 1HL7A 4BLQA 1UKBA 4MMZB 4LPKA 4GX1A 2Q3EA 3NP7A 3LUCA 1QG6A 1Z2CA 3OAAD 2GEBA 4OH7A 4AZTA 2HW8A 3RM3A 3MRSA 3PK0A 2O9JA 1G5FA 3BZBA 2ZJ3A 5TPWB 3PCRB 5DMHA 5EHGA 1NDHA 4RENA 2VJDA 1DWUA 2PN1A 1EUCB 2GZ3A 1UH5A 2OORC 1LTKA 3IVCA 1U2DC 4NLLA 1JE1A 3I28A 4TRJA 3VQTA 2W37A 5IH7A 4Q4AA 2WFZA 1OQAA 3FY4A 4M0EA 4UBJA 3RFXA 1XRLA 3NCHA 3PFNA 4JGIA 2HBZA 1SG6A 5FTKA 2P0AA 4FMDB 3PQCA 3GFFA 4TSKA 3RE1A 4HN9A 1LQ2A 3ZD9A 4DJJA 3J7AC 4IRMA 4WXYB 3LLCA 2PZFA 4DSOA 5LSAA 4D81A 4MO9A 3WE7A 2XNHA 3KVVA 1QHEA 1DXQA 1TUBA 1NNUA 2C2ZA 1XA3A 2P6NA 2WU8A 3O8BA 4K5QA 5GY7A 4MVJM 3SQOA 1PT6A 2FMKA 2VPIA 3EFBA 2FPPA 3ONDA 3TIFA 2YXEA 3N86A 3U49A 3SEAA 4XOIA 4F8EA 1NASA 3M5DA 3WIUA 2XMCA 4C7XA 2Z56A 2XCQA 4UTXA 5KSWB 2ODPA 1C2YA 4M0KA 4KRXA 2VP4A 5EWMB 3WQHA 4I4TA 4F2HA 4OQQA 4FEGA 4AJ2A 3ZHCA 1ONOA 4ZCQA 1XNJA 1HDYA 4Y6LA 4XDZA 3MYYA 1P73A 4YMIA 5KYNA 2VK4A 4MS4A 3VVMA 2BR3A 1WXWA 2GESA 1YQDA 2QMZA 2CXPA 1KRHA 1KDRA 2YIVX 5KU7A 3I3SR 1GFSA 1H2BA 2V45A 2X1HA 2ZWAA 3I8XA 4QQ8A 1GTZA 3JQFA 1EFKA 1WJGA 2IDMA 5AVWA 1P5HA 4KQ1A 3N8HA 2BSXA 2V7XA 2AN1A 1RXYA 3OQJA 3WA7A 1U4OA 1TK9A 2DKFA 3FDZB 4WNAB 1HDXA 2VXBA 3O4FA 1UKYA 3C4QA 5AJVB 5IJAA 1PBNA 4IO1A 4I5FA 1K6IA 3W2GA 4MQMA 4OKSA 4Q1FA 4E7PA 3GP5A 4LIPD 1Y5IA 3PQ2A 1T1SA 3AESA 3ZLTA 4BZXA 4R71A 4X62B 2ZITA 1G3MA 1ZWLA 2XIQA 3FR7A 2NZUG 2I0FA 3KQOA 4FR0A 1DJLA 2PHZA 2OR3A 4KYIB 5DLPA 1N4AA 5JH7B 1WHSA 1XMPA 2FZGA 1V7PC 2G40A 5D51S 5JSKA 1CYEA 1RYBA 1U3VA 3HN7A 2WRZA 5GVSA 2XCOA 2ZU6A 4RPHA 5IBQA 3TSWA 4BQNA 1E92A 5F12A 4H4DA 2JHPA 2P2YA 2XAUA 4M46A 4WFIA 4AW9A 2ID8A 1MJGM 4NFHA 1THTA 4KKVA 5EQJB 5HKOA 1CZLA 4HY3A 4HZUA 1MT3A 4H59A 3KJZA 2QZ9A 3BXOA 1QFSA 4U0KA 5FEMA 1J8QA 2OCDA 4GLJA 1J4AA 1W0KD 2Z8ZA 1T4MA 3OMLA 2GN6A 5JBIA 3EZNA 1C41A 1EFRD 4PNZA 2W98A 1WEKA 3EGOA 4QUJA 5BSRA 3RIHA 2R11A 4UVDA 3K1JA 2Y2UA 1FYEA 3TBKA 3B6KA 1IATA 1NMQA 1NR1A 2QN9A 5H80A 2EEZA 5HP4A 5HJ5A 3PQ4A 4CV3A 1KEVA 4YLEA 3ZD6A 3FFBA 5KYWA 2ZRBA 3JQPA 3D4OA 3DBRA 3HZZA 5E2AA 2Z98A 1XZMA 2HXSA 1KBOA 4S24A 4DCCA 4YJHB 1TEHA 3VKGA 2C5LA 1KXZA 2RDMA 3G0BA 5AT1A 5IWAB 2IS2A 4I50F 3HGQA 1ZIYA 1UT5A 1SBZA 3BWXA 5JG7A 1XDBA 1L4BA 3TAXA 2P79A 1NOKA 3E5NA 3BSWA 4E33A 2WQ6A 2V1XA 3FB1A 2I71A 3U62A