3NLLA

Clostridium beijerinckii flavodoxin mutant: g57a oxidized
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMADEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nllA00
2QMYA 1CZKA 3NHRA 3NHKA 3OWHA 2RG1A 3NHLA 4N82A 4CF6A 1AZLA 5TGZA 3O73A 4HEQA 4Y7CA 3LT5A 1CZUA 3OVMA 2XODA 2WC1A 3OJXA 1AKQA 2BMVA 3K20A 5F51A 3NHJA 3W78A 4PTYA 3B6MA 3F6SA 1CZNA 1H66A 2M6SA 2QX4A 3GFQA 4ZVNA 2MOKA 5EAIA 4CETA 3FNIA 2FVXA 3KAQA 2XOEA 2X2OA 5LBTA 3FW1A 2FAXA 3QE2A 3ZHOA 3B6JA 3SVLA 1D04A 1D4AA 2MT9A 3NHSA 4QOJA 1CZHA 3G5MA 3NHFA 1KBQA 2OHHA 4LTNA 3F6RA 1AKUA 4Y9UA 5BUCA 2Q62A 3OWXA 4S24A 1JA1A 4QOIA 2W5UA 1AHNA 4R81A 5JROA 4FGKA 3RPEA 4YALA 4ICIA 3D7NA 4M0CA 2BN4A 3OX1A 2FDXA 4N9QA 1ZWKA 3N39C 1J9ZA 3W77A 1TIKA 5LJIA 4F8YA 4PTZA 1NNI1 5LMCA 3L9XA 1V4BA 1OFVA 4J8PA 1YCGA 3LCMA 3NHWA 3U7IA 2BZSA 4XDHA 3W79A 2AMJA 4FGLA 2MWMA 2Z9BA 4U7GA 3OJWA 1ZX1A 4GR9A 6NULA 1YRHA 2M6RA 1VMEA 1T5BA 1CZOA 5A4KA 2X2PA 4H2DA 1FVXA 3B6KA 3EYWA 4C14A 4LAFA 5EA2A 1YKGA 1AKVA 2ARKA 3L9WA 3OX3A 4HS4A 4ZVKA 1FLNA 4Y9RA 3S2YA 4D02A 4N65A 4FX2A 1RCFA 2A5LA 1C7EA 2GSWA 1WSWA 1JA0A 3P0RA 2D5IA 4C76A 1YCFA 3QFCA 3EDOA 4BMOB 3W7AA 2B3DA 1SQSA 2KQUA 2FOXA 1XYVA 4QOHA 1AKTA 1QHEA 4NLLA 3KAPA 4QOFA 1J9EA 5LBUA 2HNBA 3KLBA 4U7FA 1OBVA 2HNAA 3OX2A 3B6IA 1DXQA 2FZVA 2V5UA 5F4BA 4OXXA 2QX9A 1GG5A 1I1OA 4GI5A 3ESXA 2F1OA 1QRDA 3N3BC 4LA4A 1T0IA 3FVWA 1DX9A 1AG9A 1J9GA 1XT6A 1AKWA 3O2NA 3QFRA 1WSBA 5LJLA 4QOGA 3NHPA 3HA2A 1YCHA 4FGJA 3NLLA 4NULA 3ESZA 4LTMA 1XYYA 3TE7A 4YAUA 1FUEA 3ES9A 1E5DA 3NHUA 4DIKA 2FLVA 4YAWA 3GFRA 1D03A 5FUQA 4XDGA 3GFSA 4DY4A 5NULA 3FJOA 4YAOA 1DXOA 2ZKIA 3N3AC 1FX1A 5ULLA 3KEGA 3TEMA 1X77A 2R97A 2OYSA 3NHYA 1ZWLA 3F90A 1KBOA 4YAFA 3UXHA 2OHJA 3FX2A 2QMZA 3R6WA 4DILA 2OHIA 2Z9CA 2FCRA 1OBOA 1BU5A 1AKRA 1C7FA 5FX2A 3GAMA 2FZ5A 5LLDA 1AMOA 4YQEA 1FTGA 1J8QA 4PU0A 5B3KA 4BMPB 2HPVA 2Z9DA 3ESYA 2Z98A 1B1CA 4C0XA 2FX2A 2QX8A 3JSXA 2R96A 2QWXA 2QX6A 1QBGA 2BPOA 5B3LA 2KLBA 1QR2A 1YDGA 2QR2A 3K1YA 1RLIA 2BF4A 2MTBA 1BVYF 3HLYA 3UXEA 4U7HA 3NFRA 1F4PA 3HR4A 1SG0A 1RLJA 1XI2A 5F12A 1FLAA 4H6PA 3TZBA 4ZVMA 2V9CA 5FA6A 5LVAA 1CZRA 4ESEA 4QOEA 3F2VA 2N1MA 4ZVLA 4C0WA 5NLLA 2V5VA 1CZLA 1TLLA 1FLVA 1YOBA 1FLDA 4LTDA 2Q9UA 1RTTA 3U7RA 4QODA 1H69A 5EMNA 4GQIA
chains in the Genus database with same CATH superfamily
4BE7B 4JWKA 4LMRA 3A3YA 1OXMA 4XVCA 3SZUA 2WABA 1A04A 4MTLA 1TRHA 1Y6QA 3O2JA 1C2TA 1CR1A 2IYNA 3BQMB 3EXG1 4Q15A 3UAZA 5ES4B 2O0MA 1KH2A 1CUVA 1EG7A 3HR8A 3U62A 4EG5A 5FWXA 5JVDA 4L0DA 4UM8B 3WRYA 3UC5A 3ZE9A 4YR9A 1E7YA 3PQCA 1PWZA 4G2NA 4II3A 5E6UB 5KCMA 2CXUA 1Y37A 3V9AA 1I2AA 4EF5A 5HX7A 4GKJB 5IJ0A 2ZRIA 3JATA 3QUQA 4HNAB 3CUUA 4CQJA 2PPVA 4LXHA 3FZNA 1YS7A 5F5XA 3WI7A 3VDRA 2QIPA 1AZLA 1I2ZA 1KH3A 1P5FA 1QK5A 4MQMA 5E7JA 5TGZA 1AY0A 3PG5A 3TBFA 5AO9A 3Q7QA 2GEDA 4JSTA 4KXUA 2OPHA 4EKYA 1CE8B 4G9EA 4K0KB 2R6GA 3JQ6A 1FNCA 2XODA 2J6BA 4G89A 2I1QA 3TS1A 1Y1SA 3VR5D 4FB5A 3GP3A 3EGDB 1XCBA 1ZL0A 3CA8A 3K20A 3GWZA 4D99A 3T34A 4DSZA 4KQ2A 2XGSA 1YBFA 2JIBA 4R1TA 1TGYA 2DUJA 2Z1DA 5DW0A 5G0TA 2ZTVA 2IS6A 2QUIA 3TXAA 3HPRA 3H2BA 1ULHA 2QEQA 4LGMA 1USUA 1OIWA 1G55A 1C0EA 3OM8A 3BSFA 1RP7A 3V4LA 3MMNA 2BFEB 1DIAA 1CV2A 4E4YA 1TCUA 1ULTA 5ILQA 4DQ0A 3SQXA 1GFSA 1GYQA 2GAAA 5CDFA 3SR4A 2HA2A 3VPBA 1JA9A 3GAZA 3QE9Y 1GCAA 4PE5B 4L7QA 5IAJA 3PUVA 1POWA 3RYFA 1K89A 3AIKA 4JLOA 4YRKA 1WW8A 2ZAMA 3R7FA 1YZNA 3GUCA 2R8YA 2MYTA 3IV7A 4CL8A 2PL3A 3E5HA 1HURA 2I6QA 1TE2A 4C4OA 3U3DA 3ZHOA 2BV3A 4WZZA 5J63A 3AM3A 4CMHA 1SOMA 3JARB 3DLHA 1QGUB 3LQRA 5AUNB 2MT9A 4O29A 5BSEA 3RIMA 4LNAA 2Q0QA 2HYDA 3RFXA 1JF8A 4UPDA 1WG8A 1DKPA 4OHXA 5LZ9A 4G8JA 3MPOA 2Q49A 4PIPA 3EEIA 3HO8A 4TS1A 1VE1A 1GPWB 2DT8A 3OUZA 2QMEA 4GSLA 4CRWB 4YK7A 2ALJA 2Z2JA 1Y6RA 2ONZA 3ZOKA 4DSUA 4EX6A 2H9AA 5EWJB 3PDIB 1S6YA 4HEHA 2QVBA 3BIOA 4GI7A 3TG2A 1BS1A 2ECFA 3SIXA 1JLLB 3HCCA 4KI7A 1EE2A 3L7NA 4ACBA 1K08A 3H04A 3MK31 4UBNA 2ZJ5A 1Z17A 5HCIA 3GVPA 2YQZA 3KOUA 4L0CA 3SZMA 2J0UA 5CDTA 3TBHA 1AHNA 3N0TA 2JRCA 5LYJA 5ALWA 1WKCA 3VPDA 1PT7A 4JCOA 1PNTA 1KJWA 2RHGB 3O95A 4Y67A 4AJ9A 1LDNA 1R00A 2Y77A 3EQZA 4H3SA 5B3AA 5IVKA 4YALA 1SVUA 2CK3D 2QP4A 1DG9A 3ZR4B 1IIBA 5KSWB 1PEKE 5TV2A 1UKVY 1U7HA 1HH4A 2R4TA 2VAMA 4LC9A 4PHHA 1LVHA 1KOLA 4C88A 4EUNA 3HM9A 1QWSA 3FYDA 4TMZA 1EFPA 4IUDS 4D42A 2YZKA 5I7OA 1F0PA 1SVIA 2RKWA 4AJLA 3L8CA 3A9VA 5K3CA 3G0DA 4N5DA 1SHUX 4P5DA 4Q3LA 1F8FA 3EPPA 4RV9A 3TLGB 1CBUA 3FKQA 5FKJA 4HWRA 1SK9A 2EVWX 2VHZA 4GUAA 4AJIA 2ZPUA 2ASVA 2ZIXB 3P2KA 1ECBA 1GZHB 3F0TA 4EZIA 3E23A 4DG5A 2P40A 1K6EA 1RXUA 2G8NA 4NCIA 1I3MA 1COZA 3JASB 5AM4A 3E4DA 3PX2A 3D6JA 4GR9A 4IFTA 4MV5A 1UPBA 3O90A 3A3NA 1UQUA 4Q6BA 1E2NA 3M6AA 4L76A 5IK2D 2DUUA 1PWYE 1LS6A 4G1EB 4WZAE 5A4KA 4NZPA 3F3KA 3NAQA 4BKUA 2G5CA 1BMTA 3E5RA 3ED1A 3AIOA 1PT5A 1H6AA 3I9V1 2V7EA 4LISA 2VDPB 3JWEA 1UP4A 5ALHA 1IZYA 1G291 1BE6A 1E3DA 1X1DA 4DJTA 1BC5A 3GLUA 2J3EA 4ARSA 1YR9A 1GUAA 2A86A 4I5GA 5CX1A 2BMJA 3C43A 1K7CA 4YRBA 1GD1O 4G5YA 3OFSA 4V0LA 4ZO6A 5I47A 5C51B 4MK4A 2LDBA 3U7FB 1TF7A 4WSOA 2GCOB 3NH6A 4RDIA 1G3QA 2JJYA 2O4CA 3A1SA 5A7GA 2R6HA 3K9QO 3L9WA 3OE1A 2FE1A 5E9AA 1J21A 1F6BA 3NTOA 5JARA 3TECE 3KFLA 3KJIA 3LI2A 2JG3A 1T4DA 4ETNA 2Q4OA 1ST2A 5T4FA 2BGWA 3UXMA 4MXDA 1YVEI 2RIPA 4G1VA 5A7HA 1AT1A 1SKBA 2B37A 3EDYA 4RPJA 3K6RA 1ATZA 1QVWA 1YRYE 2DC1A 4LHSA 1U0JA 2IWRA 1CB7A 1Z5VA 4OCZA 1KEPA 1B26A 1NNUA 1VLZA 5DCUA 5A9SA 3CVVA 4ARCA 4WL0A 1YQXA 5CW1A 3ZTYA 2CLEB 4EL5A 1V5IA 2NT3A 2EAUA 1T36B 2O8VA 1Z0ZA 2TSYB 5DM1A 4CGYA 4UVIA 5E6SA 4R6XA 4Q18A 4BGUA 4G2TA 1H9BA 3FZGA 2IL1A 1J97A 1GRCA 1GPAA 2CDRA 1F3OA 2IIVA 1JZTA 1H8ED 4JDUA 4BO1A 1P9NA 3TQRA 5JEDA 3IXQA 2C4MA 2RK4A 1FFCA 4QOHA 5EY5B 3DBLA 1E58A 3TTTA 4WA7A 1YA6A 2XQJA 1TTTA 2ZBVA 1N2XA 3ANXA 4A2QA 4KGVA 1ZMXA 4RJIA 1L5LA 3WDLA 4QKQA 3AJEA 4RMHA 2HSDA 3E35A 3KAPA 3BAFA 1P7YA 2SKEA 2EF1A 4MP8A 1I1NA 3NC1C 4QOFA 4XARA 4Q3NA 4AJ4A 1L5QA 4IH1A 4RORA 1QS0A 3A9CA 3OEHD 3UK7A 3WBBA 1SIBE 4IRXA 5CNIA 1ENZA 2KMLA 2OP0A 1CCWA 4HB2A 4ZJYA 1XNGA 4O2LA 5AW2A 3PLNA 4R2MA 2X0EA 5J2TB 2ZUWA 1NVGA 1TCVA 3BFXA 3JQQA 4D3FA 3FVTA 3FSEA 3D81A 2FEXA 3RU9A 2IEBA 2DHDA 2J9FA 2FMFA 1ZMBA 3T3MB 3W5IA 1SPBS 5JJBA 4HDMB 3IJ5A 3MINA 3M83A 2YW9A 3B6IA 2P35A 3PCRB 3BWEA 1UC5B 2AYZA 4P5PA 4UU7A 3UFXA 1KZ7B 3GRCA 3WLQA 3N2IA 5DNCA 1XUOA 1IHUA 4MKGA 2BKUA 3EK2A 4O4JB 1ZQ9A 3E9QA 2XOKD 4G5SA 1SHJA 2CHQA 4JI4B 4P93A 4KRFA 2VDLB 2XA1A 2JAWA 3BTUA 3PQ4A 4O2BB 2IV7A 1QR6A 4MV1A 4M53A 5FV7A 3JAMA 2XUFA 3DVAB 1OA1A 3TF5A 1QX3A 3L07A 3T0IA 2QX7A 4EJ6A 2O48X 2V55B 1Y3AA 2DM6A 4B09A 1VE6A 1ZW6A 4MKXA 4UEJA 3TOSA 2FFRA 4NTZA 4BLOA 1JLHA 3OQ6A 1Z82A 4QPPA 2YIJA 3GNQA 3JTMA 1UBTS 4WE3A 4XWYA 2GZ3A 3ELDA 5B1IA 3RS3A 3BB3A 2ACKA 4AYXA 2HCBA 3R41A 2RGDA 4PX2A 2WPDA 5CT6A 3WLHA 3M6FA 2O7VA 3VPAA 3IAFA 5BN3B 2JHFA 1I7QB 4G86A 2QJRA 3CMCO 3OUUA 5JCOC 1AUXA 2YJNA 3HA2A 2FF5A 3QX9A 4HDRA 1H1DA 5EIAA 1O0BA 1H3EA 2VJMB 1LQUA 4MJXA 5UKDA 3SM3A 1EVQA 2JEOA 3WYFA 2B3TA 2O8DB 3CN7A 3VTAA 3KQOA 1ICEA 3Q40A 1Z3IX 1OFTA 1CVIA 5FJIA 2O5CA 4EA8A 2O8EA 4AMBA 4YT2A 1AS0A 2MIIA 3QLEA 2EGUA 2G9UA 2UVQA 4FGSA 3HCDA 4OU4A 5KJ6A 1VPLA 3NFYA 2C61A 3JPWA 3KD2A 2FRXA 2ONYA 2ZKLA 4PR3A 4KGZA 4KVZA 2OD9A 3RSSA 5LUAA 4M89A 5A3RA 1T1RA 3TIFA 1CETA 1E5DA 3NOVA 3MGAA 1TIBA 2DZDA 3AI7A 3IMEA 5KTYA 3HA7A 1SVMA 2OXEA 2FN4A 3PEVA 3HLTA 4IVRA 1A9SA 1GLVA 3SY8A 4BGDA 2XEDA 3QWIA 2OAGA 3ONWA 1N6IA 5DP1A 3DE2X 1WDTA 2QE6A 5DLEA 3H18A 5DMHA 1LD3A 3VR5A 2BMEA 1VP9A 2A33A 1P2TA 1B8OA 3T9AA 4ZIRA 1SD2A 5C18A 3GLVA 4V3CA 3HBJA 2VK2A 4NY1A 3ZE8A 1GUDA 1X70A 1BGVA 3FY4A 5AVTA 3VOSA 1MNAA 4GXNA 2BY4A 3DVRX 3PYMA 3MJHA 4JEIA 3WTBA 1Z0UA 4KXQA 5B6PA 3DLTA 3ACBA 4KR0A 2B8NA 1BRTA 4NBLA 2NP6A 4TYMA 5ILOA 1E2QA 3PF9A 1ZHOA 1QVVA 3ZHUA 5BSRA 1U8YA 3VJMA 2HU8A 3D1VA 1ZWLA 2HJSA 3P9QA 4XM2A 5SV2A 4LJ5A 4NDAA 2PXXA 2AQ8A 2V7VA 5CPBA 5ECWA 3CNBA 3H1TA 5J1SB 1DG3A 1KP2A 1NONA 2ZQ5A 3KBOA 5TDHA 3LO8A 2OHIA 5KHAA 3DB1A 3RS4A 5DHUA 2P0AA 4EENA 1AKRA 1C7FA 1KVTA 4WLVA 4PG7A 2RB4A 1TM5E 3HJUA 4EARA 2DHQA 2H4HA 1UBJS 3CGGA 3KB1A 2QN6A 1C30A 1EZ1A 3MTQA 4KTVE 1P5JA 2O8FA 2D3TA 3QUBA 2IPNA 1YDFA 1KQ3A 2YINC 4IDEA 4L50A 4C0JA 1SQGA 1V1RA 2ODPA 4D9IA 3T9FA 3ZJTA 3OIVA 2ZSDA 1F8UA 4US0R 1EUDB 3VVCA 1PZGA 1IN5A 1YUBA 2ZDHA 4HFMA 4YLGA 4ZJPA 3U4QA 1QSGA 4GICA 4IHJF 4TVBA 4LPSA 4HVAA 2XRFA 1YB6A 1Y1QA 1J0DA 1L3BA 4MUJA 3V8MA 1DKMA 3LYAA 3G2IA 4C7BA 3ZV6A 1M54A 2CXTA 1UDWA 3QFSA 4EHBA 4F38A 5TY0A 3HLKA 1AKNA 5EVJA 4C06A 4JJ8A 1WSAA 4BLPA 2XQVA 1YUMA 3CZMA 4JQCA 4WW0A 2CK3A 1NW6A 1KI7A 2O3SA 3IQHX 4TN1A 1K86A 3QVGA 4EKIA 5JOQA 5K0EA 1I3CA 5IW8A 2ON6A 1GPH1 4UZFA 3G02A 1P2DA 2YIDA 4AULA 1ZCAA 3WLKX 1WDLA 3OZUA 1R8YA 4B2PA 1YHNA 4EJMA 3ICQB 2FF7A 2EP5A 1FYXA 3HCEA 4J16C 1NGSA 5H16A 1UJNA 5EL0A 1V8OA 2XUHA 4QU8A 4JJGA 4EQ6A 4DLVA 1F4PA 2ORVA 3Q72A 3LDAA 4TZKA 2A3NA 1A9YA 3EVTA 1NDQA 3BFPA 2NLOA 4XEHA 4Y2QA 1PTJA 2GBGA 2VWQA 3MLBA 3JVVA 3DAFA 5EXEA 3WRXC 4PYKA 4UHEA 3IJRA 5KDOA 1N1DA 1QANA 4B9AA 1OXSC 5JNWA 2FXVA 2PYIA 3GVCA 3HE3A 3R7DA 3ETGA 2HMVA 4NV1A 2XECA 4JT4A 4BFYA 5IK2A 5LPNA 1JDVA 1GVNB 2ZQZA 2YICA 4KO4S 1U0OC 2LR0A 2QRVB 3IEVA 4LJYA 1SBHA 1L1QA 3LKBA 4XQ9A 4R7GA 3LFUA 4XVRA 3HABA 3EXEB 1DUVG 3AY7A 1I01A 4ZO4A 5FOXA 4ZVLA 3LUCA 3TH5A 3GLGB 3IT1A 4I6EA 1X7WB 1PEDA 1TQ4A 1YDWA 3E1GA 3ED5A 4IO1A 3SQWA 2HQBA 3AM1A 3ORYA 4AJEA 3Q12A 2C2BA 2GCNA 1QUFA 4IY1A 4YWJA 2CV2A 1EHYA 1DC8A 3AHIA 4Q12A 3MWGA 4PNZA 1F51E 3EXHC 4D6PA 1VMIA 1MRZA 1YZ3A 3DTTA 5SYNA 3PHLA 1VFNA 1Y3HA 2GRJA 1Q0SA 3OZRA 4NU0A 4OXIA 4N7MA 3JX9A 1DRWA 1O94D 2QI9F 3IDFA 3MJTA 3Q2OA 4JBGA 4RACA 1KR2A 4XIYA 4Y2SA 2Z09A 3WTCA 4EW3A 3VO8A 4B4VA 5BWOA 4GPAA 5JH7F 3J80A 3BMOA 3QTLA 2JBAA 2YWBA 3AVYA 1C3EA 1DIBA 2DWPA 4J90A 3W2TA 1KNXA 1FUUA 1W88A 4CEJB 2FWMX 1JHXA 1TECE 3PI7A 4RVFA 3MIIA 5CA0F 5JD5A 1EBBA 2CLIB 3WJ2A 5AH0A 3B36A 3OLYA 2R1VA 3COVA 4Q4HB 1WE2A 1JXMA 1QC5B 4BDTA 2EX0A 2XYHA 2Z08A 1Z4KA 1NBAA 5KINB 2IYWA 1H8EA 1CY7A 2A9RA 3JQAB 3WGHA 2D8MA 4FFNA 4U7PB 2W6ID 2DPHA 4CUKA 1D0SA 1VHJA 5ICMA 2ZYVX 1T2DA 2F67A 2JCGA 3BL8A 4KN8A 1U3WA 4AMVA 4BUJA 4DXAA 1NAIA 1RIIA 3OCXA 3R5HA 1KYVA 3OBIA 1S02A 1C9KA 3I0NA 4RD0A 1HYHA 2G1AA 2R25B 4OLJA 1ZJYA 1I30A 2I1WA 4PM4A 4YDHB 3TQFA 5FPKA 1QMGA 3RC8A 4KQCA 1YSCA 4UU1A 4ZYWA 5AW1A 1G4UR 2GBCA 2GK6A 2O2XA 4XQGA 1FSFA 4FFWA 4OGKA 2R7KA 4YJKA 2P69A 3WB2A 3IDAA 4IGKA 4R2JA 2BMVA 1N0UA 3I1FA 3SHWA 3JU3A 1YF3A 5JWHA 3ECAA 2O8CA 4Q01A 2D2XA 1YXMA 2JJQA 2QU7A 5FP0A 3UGQA 5MFPA 1G1AA 3RV3A 3OFKA 3RUIA 4F6RB 2O2CA 1S01A 2Q5CA 4TTTS 3TL3A 2B8TA 5DKFA 3UO8B 4GLFA 5EZYA 2C7QA 5B7QA 5GJBA 4YJ2B 1IUOA 3KQYA 2PRZA 1VKJA 1SBTA 2UXDB 2AN9A 3B8EA 1N2CA 2O2HA 5CYFA 1ABEA 1YNSA 2VKQA 2XOKA 2FMIA 2QMUA 3BB4A 3MMSA 5CAEB 1KE1A 1O96A 4MR7B 5D1NA 3TVDA 1O5OA 3WHIA 3HG7A 4B3IA 4DZZA 2CHEA 3VZDA 2XVZA 5D01A 1CNMA 2XWJI 3A27A 3GFPA 3QUAA 3E48A 3LXMA 4M0EA 1OXBB 5E9QA 3C15C 1D2MA 1AQIA 1TT5B 4U00A 4CIYA 5IU6A 2ZANA 2K7FA 3H6GA 1X80B 1XLWA 3FWNA 4QUBA 3DKRA 2XKKA 1FRVA 3SAJA 5LSAA 3WDSA 2J09A 3PI6A 4ETIA 1ZM9A 1PTKA 1Q77A 1R6VA 1T6BY 1XDBA 2OP1A 3N7UA 3WISA 1QGDA 4EL0A 4CEHB 5E2IA 3RKUA 2CLSA 4BNZA 1RVDA 2XUZA 5BXYA 5AVXA 1BFDA 1RVV1 1SZPA 2G4VA 4WPGA 3DH0A 2QJTA 5EVCA 2WHQA 1U99A 4YJGB 2Q62A 1WDKA 2C9DA 4DLLA 2IS4A 1TK2A 4R1QA 1X7XB 3IEKA 1QH9A 4MKFA 4UM7A 3A3KA 4YV2A 3WV5A 2F8SA 2XMCA 1SC9A 2FW6A 4XDZA 3WAJA 3KC2A 1JTFA 3QXCA 2V3CC 1X14A 1RLOA 3LUDA 3H8JA 4TL7A 4RCYA 3BHMA 5REQB 3VR3D 4CM9D 1ZK3A 1X7DA 2O20A 2P6PA 3QW2A 2VL7A 5CURA 5DWQA 1K66A 3IRVA 3SICE 1LNQA 3NM4A 2BFFA 3QBVA 2W8BA 3OU2A 3GBVA 3TPFA 3HACA 1TYEB 1EVLA 2WWFA 2EIXA 3BL6A 1R0BA 1GAQA 3KP1A 5A9TA 2HCTA 4YIKA 1PWEA 1JJAA 3JATB 4TSRA 3LSTA 5IJ0B 5HW0A 3L9XA 1IEQA 2P9YA 4WXRA 1XMSA 3ZCRA 1KFJB 1GO2A 1WUKS 2WF8A 2O3TA 1Y33E 2FQWA 2PSSA 2WFLA 1SAYA 2LVBA 1Z68A 4CMAA 3FF4A 2NYRA 1C7JA 4HQFA 1SWWA 3F5FA 4DLBA 1M5RA 1HETA 2V7PA 1W6UA 4Q47A 5C34B 1VJRA 2Z2YA 3QXSA 1PGOA 1NVVQ 3ZBTA 4W5RA 1EDEA 1NQUA 1G6HA 3DBVO 3IAXA 3VR1A 1AIPA 4Z1MA 2D5AA 1D1PA 3CURA 5DHFA 4OQEA 1QCDA 1HNNA 2NZWA 2D74A 4OJQA 2HSJA 3WY9A 4PONA 5C8YA 1PAUA 3COSA 5DNDA 1GNRA 2QN2A 2UZ4A 4QTXA 4AF7A 1X2EA 2ATXA 4DLUA 4PLVA 2M6KA 4HT3B 1GUBA 4KLCA 3AYXB 1MHPA 2Q9AA 4C14A 3M6MD 3PNBA 1FNBA 1WPXA 4LAFA 3KYBA 1FJXA 1JFRA 3KQNA 4Q5IA 4ZDJA 5IAOA 2VYNA 4TWIA 3RYFB 4GE3A 4NK5A 3L41A 5PGMA 3GZNA 1JEOA 4ZOLA 3A9SA 5DOZA 3SQLA 1FU8A 1YI1A 3UWOA 3VI4B 3Q9SA 1I2CA 1GNPA 4NPHA 1NRJB 1OU4A 3N86A 4BC0A 2B6HA 2DX7A 5H0IA 4PO3X 1DAKA 2WFZA 5FEMA 3PNPA 3PQ7A 4TYQA 4CTJA 1G41A 2C4WA 5EUBA 3S99A 1RCFA 2B2NA 2IP2A 4WLFA 5JS6A 4CMJA 3U60B 1L4HA 4OM8A 3SXUA 1CHNA 1EZZA 3KQQA 3QLTA 4Q24A 1C7IA 2KHZA 2ZIGA 4OBXA 4WDQA 5B55A 5IT9A 4XGRA 4KQMA 3DPIA 1NC3A 3F3YA 1RYMA 5FR2A 1TJYA 3BFJA 2P2CA 5DBIA 5KNCD 1IZ8A 4CKZA 3FNGA 1DEKA 2EARA 4BQEA 2ODNA 3IEPA 4KI0A 3LA8A 3ZYCA 2HW8A 4PG4A 5K0GA 4UAJA 4M1MA 2JKYA 1P39A 2WD8A 1P1FA 1G60A 3ILXA 1KK2A 5F3WB 5LYJB 1M7GA 3KJXA 4RKQA 4LJRA 3VNUA 1KRHA 2O7RA 2BEWA 2YUIA 2HC9A 1SK8A 4RF2A 2B9VA 4KE8A 4XGKA 2IZ1A 3G6WA 2R7NA 4LHEA 3F9IA 1KJZA 3BF7A 3QLUA 3U4DA 2I91A 3PWKA 1LEHA 1DBVO 3R23A 1Q7RA 4BJ1A 3BDVA 3NBZC 1QP8A 3PQ6A 3I32A 2ERXA 5LOVA 3V48A 4UHBA 2DRIA 4RZ2A 1WY5A 4UQOA 3ID6C 3PQ2A 3L4SO 3C3MA 1QHHA 3EGOA 3TEJA 5LZ7A 3IYLW 4L6CA 1A71A 3AFGA 4U7FA 2C8VA 3Q88A 4JBIA 1XTVA 1JR3E 4DQVA 3KWJA 1E1YA 1XCMA 3AWIA 4R69A 3E1KA 1S2NA 2RD2A 1BU8A 1L3IA 4K9KA 2QTNA 1JG7A 1NVXQ 2NXEA 3H6KA 1XKTA 1TFUA 5FBQB 1W1IA 1VHTA 4MAAA 4X0EA 3E8MA 2PBZA 3JAKA 1F1BA 4KL8S 4B6SA 4C0LA 3TK1A 4YJ3F 3FPLA 3BKWA 3QA3E 3WVNA 2UVDA 3RE1A 2PJZA 2Z5LA 3NGMA 2QX9A 2J1LA 4ER5A 1RM0A 1FVFA 3CLUD 3GIDA 3O91A 3SC2B 4RTOA 1KIFA 4WY2A 5CFOA 1NY6A 4UMEA 4BMYA 3Q8WA 4P5EA 4WXHA 3OUTA 3QYFA 4WK6A 2V8OA 3LIIA 4OMFG 2HADA 2KPOA 1YQ9A 1LZLA 3LOPA 4OFZA 1T0IA 1AMUA 3G85A 3ZEAA 4WKPA 4FCTA 1GQRA 5CX1B 2O2GA 1ZD1A 2JCSA 4TTJA 3M5WA 1DHTA 1CVRA 5G4LA 4AM8A 1NZJA 1O94A 1E4YA 1TA0A 4N6OA 2P6NA 4DMCA 3W9UA 5CDYA 1E3WA 3FROA 621PA 1VRVA 2WJGA 1DZIA 4MCIA 3TUJC 1II8B 3OEYA 3T99A 3OC0A 1MG0A 4N39A 2OGSA 5CEFA 4FCCA 1X7GA 2IHTA 3IXMA 3I52A 1TMOA 5F9HA 3EXIB 1NQ5A 5J5VA 2VHYA 2C29D 4U9IS 3E7FA 4I7EA 3G88A 3DXZA 1QZTA 2Y2VA 3JVEA 1A8IA 3UZUA 1E7RA 3DLCA 2H07A 2QRGA 2JRLA 5JU6A 1I0LA 3RS5A 2OV6A 5ECDA 1TJ3A 3S8MA 4NG5A 4Z86A 1ZMOA 1U7TA 1RI1A 3QMMA 4CFYA 2NNWB 4ZI7B 2W6IA 5A9SB 4TKVA 2VYVD 5K8CA 2L42A 3RW9A 4CDRA 1O0CA 3Q8KA 3HMKA 4BKRA 4BRZA 1T26A 2R5WA 1JG3A 4RZXA 1NP7A 3UG7A 3FWKA 3I1JA 3L3BA 4QQKA 4RLFA 1G1MA 4BNYA 3NHUA 2FLVA 3H5VA 4G09A 4B9EA 2OSBA 2PX0A 4I3GA 4X6YA 3S2EA 4MYUA 4M54A 4ZARA 5TGTA 3WLTA 4Y8VA 1EFRA 1XP8A 4BECA 3T5CA 4BO8A 2MSWA 3AUFA 3CWZA 1W9MA 2IYXA 5TR9A 3ELUA 3LBFA 5I7WA 4GLOA 1A7AA 1HE1C 2QGZA 2ZULA 4ZQCB 1N5OX 2Q3CA 4IEFB 4QG3A 4R8LA 1I5OA 1RCTE 3AKDA 4JL8A 2ZKIA 3CZ5A 5JQWA 4MDEA 3EVGA 3PE6A 4L51A 5KYUB 1I1QB 2GHRA 1RWPA 1RP1A 4BE4A 4EF4A 1QS0B 3BKXA 5BN4A 4XDYA 1MEJA 4TVSA 1VBNA 4IJ5A 2CHVA 1BDBA 2YXDA 2ZW9A 5JV5A 4QUEA 1KMIY 5JS2A 4RD6A 4KLAA 4FE7A 1JMKC 4GW3A 5CFPA 3VDQA 3G79A 1ZO8A 4EW6A 4LFAB 1ZR2A 5SYMA 3UXHA 1T5OA 2AXNA 2J9FB 3FX2A 1WB5A 2P2LA 1JPJA 2H54A 3I2HA 3MINB 4JL6A 1S0UA 4K3UA 1YV9A 3SQMA 3VU8A 2JFUA 3FDXA 4WADA 5D1HA 1DRKA 3ZHBA 1WB9A 3FLBA 3C5CA 2H00A 1SELA 4KQXA 4NHEA 1KQGA 2XCRB 1KWKA 2OG2A 5LLTA 2OGUA 4REQA 4RDCA 4LRTB 5I9TA 4MWDA 1GM5A 1ZXLA 4Z6KA 2CEAA 3TMKA 4RENA 3U40A 4L73A 5D6NA 4BY9E 4L85A 4R2KA 4PQGA 5EPUA 1DZ3A 1U4NA 4BNDA 3K5PA 1CQIB 3QVJA 4YP9A 4YRMA 2JFBA 2WJYA 3SYKA 1OZAA 1WXEA 4N7RA 4C0XA 2HYIC 3R3JA 1D2RA 4DJ5X 1K3FA 2D2EA 4OGLA 1M8GA 5CB4F 2P6MA 4IGAA 4W8HA 4OQ4A 1U94A 5D3ZA 2ZRBA 1FPQA 5KKCA 2G8LA 4UKDA 2WAYA 2WOJA 4XOUA 4F9GA 2AFVA 3DV9A 2R3SA 3CLRC 3FGOA 2BFOA 3GLIA 3D64A 1QBGA 3K0AA 4ENPA 1OCEA 5ICCA 5B3LA 1CEYA 2W6PA 5K6AA 4MRNA 1R9JA 3PZRA 4XKJA 4EUFA 5JXWA 3VR3A 3NV7A 4II7A 4CM9A 1PJQA 3TLEA 4H18A 4B3DA 5JAPA 4LVNA 1K3TA 3G9XA 4JP3A 3AUKA 2G77B 3LX4A 3Q3IA 5P8WA 3SE7A 1OH7A 4XGIA 4D56A 4OX9Y 4YFYA 4XRRA 3BSWA 5EMLA 4EHFA 4EDFA 4GOJA 2P9TA 4HXEB 2IFTA 2H1SA 1UKBA 5DLPA 3D7LA 2O8EB 4MUYA 3WJAA 3DE6X 3GK3A 4WKBA 2PYDA 1DV1A 3L0BA 3AU9A 4A8TA 4G6ZA 4XD7D 5F5LA 4QYMA 1E4EA 5FR1A 3TLZA 3DCJA 1LNZA 3OJCA 1VE9A 2Y99A 5DGTA 4ARVA 3EGXA 3KQVA 3OPQA 2QG4A 1BGWA 1DMSA 3ETCA 4BO5A 4RE6A 1I3LA 3IAEA 4I1YA 1QZ3A 3VR5H 4F4HA 3I6QA 1DCTA 2FDCA 1T9ZA 1JS1X 2N75A 4RKWA 1RBZA 2B20A 4P6VF 5IZ4A 2FVYA 3EOZA 2PLNA 1SRRA 3CGWA 4NDNE 4ZIRB 2JB9A 3Q9NA 5T5QA 3DMTC 4G01B 2C5GA 2BZ1A 4MV9A 4YMGA 2WJVA 2WJ3A 3UC9A 1P7ZA 2C58A 3PL1A 4JEMA 4CUZA 5A4JA 3K2IA 3C4VA 4CKEA 3HZRA 4G5HA 4BEBA 2X42A 3I8XA 5ALLA 4ALIA 1I4OA 1KVRA 3WGQA 2B83A 4UUQA 4O08A 4UHFA 5CLGA 1II9A 4X3CA 3NT5A 4ZALA 2N1MA 1DSSG 2PEZA 2BI8A 1K6IA 4IEIA 5F64A 3RIGA 2HU5A 2COUA 3OE7A 3IHKA 3THRA 4ZGWA 5IFKA 5LQNA 4F71A 3OP1A 1XOIA 1PZXA 1KFKB 3SMQA 5JZ9A 4D9HA 1YR6A 6Q21A 3ZDAA 4UJ5A 3ZKWA 1SCBA 5CU7A 3DE5X 2V5VA 5B3JA 1EFLA 3Q3CA 4YP7A 4NJOA 3CVOA 4MPTA 3UJDA 3SX4A 4EO4A 5AM3A 1NYQA 1EX6A 2XMPA 2VUUA 1EWQA 5EC8A 3N0VA 2KWIA 3PU6A 1C30B 1EGHA 2O8FB 2FP4A 1FCJA 1SBNE 1JPNA 1N9GA 1E9VA 1UXIA 1OXKB 4UREA 5DYNA 5FTMA 3LYHA 1ZH4A 4RVGA 1V1RB 3AILA 4FDAA 1MFPA 2IBSA 2PMWB 2X8LA 4Q9AA 3AR6A 2VR1A 1Z5GA 4IP0A 3VZCA 4B45A 2CNLA 3C8HA 3C7AA 5KNCA 2RKOA 2P3OA 3RJMA 1W35A 5HRUA 1P9LA 3N07A 1Y8QA 4IHAA 3ZCPA 1P17A 2XI4A 3HNOA 4DARA 3SOZA 1T8PA 2C5AA 3CUSA 1BCRA 5A0VA 1R5BA 3O75A 1CDOA 1NMSA 1WZCA 3UB4A 3VKVA 1Y6FA 1XTSA 1UPUA 5HGXA 5J2TF 3HH8A 2AWNA 3OJOA 3GD7A 3K70B 1NT2A 3KSBC 3ZWWA 1PT8A 1T9HA 5IAAA 4FQ8A 1DX6A 3F5QA 3R0JA 3B5JA 4HK4A 1SCAA 4B0OA 4CGZA 1U9JA 4Y2HA 1PK8A 3LT5A 2WU0A 1U2ZA 1FNNA 3ADOA 1NASA 3KPJA 3OMLA 4PYQA 4HNVA 4BC1A 3CZRA 4O4JF 4OA5A 1YB1A 2NYAA 3SLKA 1JI3A 1QQBA 2WC1A 2HV9A 2EF0A 1PJZA 3F8TA 3GGCA 4O2BF 2VAWA 1PZEA 4HDKA 4ZYZA 1ZVQA 4YMUA 3T1VA 3DJFA 4MS1A 1UXHA 2QRLA 5A3SA 2XMZA 1FUIA 4NU6A 5CDUA 5B30A 4QZVA 1LJLA 4YLEA 5LP6A 2IPMA 3FWPA 4GRAA 3BN3A 3F71A 3CG0A 4DLAA 3EZYA 2WNHA 4II2A 4GYYA 3RRXA 3T5AA 4DIEA 4AS3A 4N8SA 2G9ZA 5KX5A 3D3JA 3UKDA 3I4LA 3T7AA 1R6UA 2GS9A 2A67A 4FR2A 3VHLB 4R54A 1OD6A 5KTSA 1WHSA 1F0YA 2C5HA 3EJ6A 1BIFA 1DC7A 1YDMA 3FW1A 2TECE 3LK6A 4MUEA 3AMVA 3NO4A 4JOQA 5HFJA 3I58A 3V4ZA 3IUEA 4OJYA 4RHXA 1WXIA 4UCQA 3X1MA 4OXYA 4PZEA 4H7KA 1D1QA 4B3CA 5I7RA 2XUPA 3SYRA 3NHAA 1TM3E 2AOUA 2FZGA 1XEWY 3LY8A 1SQ5A 3UJ6A 1KBQA 3LZCA 3TJRA 3E3OA 1TVCA 2AHOA 1GEEA 4PLGA 3ZW8A 3MBIA 4BFZA 2VT7A 5C3UA 5GJVC 3UK1A 2W90A 4MKZA 4PPQA 4R2XA 4TTAA 4D4HA 3F6RA 3MT0A 4JB2A 1VJCA 1OWNA 2NU8A 2NIPA 1T2NA 3UQYS 2VVTA 1N4DA 1U8EA 3FCYA 3P9SA 3V3KA 1ADFA 3P0EA 1GZ3A 1KMHA 3N7AA 4GH5A 2NUPB 3TNLA 3UCFA 2XT9A 2ZTHA 2HT6A 3CXRA 1X8XA 4E7PA 1T10A 2X76A 1C9EA 2A1IA 2H5JA 3BMOB 4JFRA 2JBAB 3Q9UA 2A9OA 4FE3A 4R81A 1P2BA 4RNDB 4QXAA 1EA7A 3QEKA 3GFGA 3H5TA 4IUYA 4PBSA 5EIHA 1P2UA 4G63A 4OLAA 1W88B 2W2NA 3WL4A 2ZYHA 3VTZA 3IOEA 3IIMA 2RGRA 1F20A 4EMTA 3BEDA 1Y3CE 4S1NA 4HN4B 2BKXA 4MV7A 4A2PA 3MC1A 3DZKA 3Q7TA 2HA5A 1YRQA 3IVGA 4MP6A 2H1OA 2MJLA 3OZAA 1T8SA 2JJMA 4LY6A 4RL4A 4C2TA 4JYCA 1I5RA 2ZRPA 4LJAA 2CF6A 2GOYA 3UAOA 2BI4A 2PV7A 4HGRA 3WSTA 1UKZA 4YCAA 2X2FA 3JZDA 5EIWA 3ZGYA 1B2LA 5CB6A 3CEPB 5BT9A 4CMBA 3CZCA 1Y7TA 4HZIA 5DNUA 3RGGA 2BHTA 2R60A 3CH4B 4Q7MB 1BYIA 1MABB 1QMPA 1TD1A 4FYYA 1PV1A 2H1IA 2ZYDA 3WGUA 5JNVA 1KU6A 5EJ2A 3RU2A 3KPWA 2F8MA 3N75A 4UNNA 3U0VA 4A73A 4WAUA 4MGEA 3FIJA 4QEDA 1ZX1A 4AF8A 2BHLA 1Z7YA 5DEOA 4D97A 1V5EA 3QX7A 2VCYA 4AQ7A 4GSKA 2O8CB 3KKNA 4TQ9A 1VHLA 3NATA 4XWOA 5K0ZA 3WFIA 5FUMA 2C2MA 2G0AA 4ZT5A 4PSDA 3D3WA 1G6OA 4EW2A 4MVWA 3JQDA 4O8CA 3W8RA 2X2PA 3OZFA 1I7SB 2GBLC 3B6KA 4G0PA 2A4MA 3RKRA 3I5XA 3HFSA 4Y2VA 5F2NA 1BRMA 3WKDA 1T4BA 2XCTB 5ELXA 1NP3A 2VIIA 4IG9A 4WJZA 3V1LA 3MYYA 5EA2A 3H42B 1KPHA 2K6GA 3WK5A 4M8LA 1A7JA 1AKVA 1E63A 1O96B 1U2QA 2Q5LA 2P9FA 1I7NA 3E4CA 4AZVA 4DREA 3C4JA 2YMQA 3O3MB 1A2KC 1PX0A 3CX6A 2VNIA 1DRUA 3CW8X 3WLOA 1ISJA 2PD3A 5G0WA 2Q4DA 2CZGA 3I61A 1U8XX 3AF6A 1ID1A 1HE2A 3OAAD 2FU5C 2P9EA 3AJAA 1CSEE 5CIWA 1F60A 1NM5C 2H57A 3F5MA 3L46A 4X7PA 3X1ZA 4C1BA 1VMDA 3ASVA 3JTEA 3KEFA 1YHYA 1YACA 2PGDA 2D5IA 1T8WA 2B1RA 4O5OA 2CXPA 3LA6A 5HK8A 2PL5A 4HH0A 4GYJA 5CTAA 1J99A 2C95A 4KGDA 3BIJA 1YE3A 3WLSA 4CIDA 3RADC 4NCAA 4YT5A 3JAWA 1IM2A 3QXJA 4I08A 2GGSA 3TLMA 5DPMA 3ZZ1A 2IHVA 1SUCA 1G3MA 3B2NA 3A0RB 1L5HA 4DBLC 2AQKA 2CBGA 2VHWA 3NJ8A 4FR0A 4EHHA 1HDZA 3IPXA 4MGKR 3GJRA 3ZLVA 4AIRA 4B40A 4JYBA 2X41A 3KUKA 1EWYA 1J23A 5BV2P 2ZB2A 3LCVB 1LLDA 1LX6A 1QQTA 1Q3KA 3CEJA 4LNHA 4XD7A 1RI2A 4IDQA 4ZAFA 3B78A 5FLEX 3ER9A 5DX8A 2I87A 4BO3A 4JI2B 4M3NA 4M98A 2BFFB 2JGLA 5D5HA 3VR6A 4Y2TA 5FOUA 2VUSA 2W8BB 4W7HA 3OPMA 3RU3A 3PNMA 2FZ4A 2VFAA 4P83A 4R6WA 4JBLA 3H2IA 1VDZA 2UZ1A 5CHEA 4FFLA 3WQSB 3IR7A 3LWZA 1M2NA 4E07A 4ALKA 3MCWA 3R40A 1MB4A 3EVFA 3D7SA 5C1IA 4DLZA 1RKBA 5ITVA 2PSJA 1M6EX 4DTIA 3LUAA 1V48A 2WFLB 2P67A 3QPWA 4M0PA 2CUKA 5FL7D 1VCIA 3RC2A 3W5VA 4E5NA 2WW8A 4G0MA 4JI5B 4EY8A 4LOLA 5C37A 2CNDA 1ETHA 4JP5A 3QLUC 2ZDGA 2GN4A 3PT9A 1PWHA 1NHGA 3GCWA 4XFJA 5EHQA 4PG8A 2BJHA 1V8DA 1TM2A 4YCBA 4RABA 1EFDN 4WFKA 2AJDA 2YC2C 1I1OA 2JEYA 3V2IA 3OM1A 5C8YB 5IAKA 4FINA 2PZBA 5COQA 4G41A 4EBBA 4NCJA 4EMUA 4DR6B 5C81A 4X20A 4H77A 1O4VA 2O4UX 2X0JA 2A9KA 4IM7A 4ETWA 2CYBA 3B1JA 3ZVLA 4IWXA 4BJ3A 4NCBA 4JUDX 3VAZA 2QPTA 2WZDA 3ETNA 7AT1A 3S8EA 2VDMB 4G0NA 3QELA 8AT1A 2H7CA 4COKA 4L4RA 3JWIA 1BFUA 1NPDA 1R10A 1OWPA 4MI9A 2K4MA 3GZNB 5TRTA 2VQ6A 1PZNA 1R3UA 2XZDA 2APJA 1JLMA 3O7MA 4MQLA 5CYOA 3WBKA 5I7EA 1P6UA 1HFJA 3QMVA 3JQPA 2P0YA 1FDOA 3L4BC 1O87A 5DI9A 4D98A 5BT8A 1JYFA 2QM8A 4HXYA 2GTIA 2P9QA 5FIUA 4YRIA 4AJKA 1DOHA 2A0KA 5DX0A 4J2HA 5CH8A 1W29A 1F5NA 1W75A 2QHXA 1P3Y1 4E2WA 5KJ1A 2D4HA 1XK6A 2RI0A 4FGJA 3D9QX 1JQDA 4QT0A 5D7NA 1S4QA 4EGJA 3D5TA 3PNSA 5CCEA 5B6JA 3FOFC 1K5DA 5EE0A 2XDYA 4BZXA 4IQ4A 2HLDD 3GT0A 3D0OA 2IXGA 3UH0A 5G0UA 2OCBA 2C4TA 3IA7A 3IUJA 3HYLA 4CR6A 2OORA 3KYDA 3JPYA 4ASUD 2A14A 1KVUA 3ZZUA 1KZGB 5ISMA 4PCLA 1HYQA 1O94C 5KC8A 2JKZA 2WQ7A 2ORIA 4IV0A 2UYGA 5E1OA 4JI8B 2VJOA 1ZR4A 1VG0B 4Z99A 4PNHA 4YJ2F 4BIIA 1JBEA 2VZ0A 5ARDA 3R8XA 3II6X 3VC1A 5FUQA 1UC4B 3EIOA 2BEWB 1MAHA 3LUKA 2DTXA 2WDPA 1Z5OA 2XH8A 3H97A 3FPBA 3GFSA 2VSOA 3NJ4A 4EI2A 5IDQA 3HHPA 4DR7B 2DCUA 1RYEA 2EIHA 5IVDA 3NWJA 5CK5A 4BBAA 1HKUA 1U98A 3EUWA 4BP8A 1GQSA 2I8AA 1E4VA 1YQGA 3EQ2A 2QD2A 6LDHA 2OT3B 3H4VA 1MA0A 2EKLA 1H42A 3NETA 4I1OA 3G2OA 4NEQA 5JDCC 2I2CA 3NOQA 4UFPA 1E0AA 3TEMA 2MSCB 4AP5A 1JL3A 3PV0A 1AQUA 3N8GA 3TQSA 1RKVA 3REQB 1A4IA 2I8CA 1U7UA 3D7RA 5KTKA 4DQDA 3A6FA 1ISHA 1QCZA 3LLSA 4MO9A 4I4IA 4Y6QA 2HXGA 1PJAA 4ZVQA 3H9EO 1R9GA 5EMHA 2VOJA 4U7TB 4MHTA 1B0ZA 4X6LA 1XLVA 1Q84A 4Z4IA 2FK7A 2IKSA 1IVNA 3NBUA 2FQXA 4U7DA 3NP7A 4ZP1A 2GN9A 4CHTA 4ZQHA 3BD7A 1AH2A 3I4FA 4BLTA 4HFJA 3ENWA 1WCXA 4B2LA 3L0ZA 1HLFA 4RVCA 3IERA 5H59A 4BVHA 3SHFA 3RS8A 4D8WA 2ZI5A 2GLTA 3AW9A 5IRCD 4EG8A 1FYDA 3HTXA 3AJ9A 5JS8A 3WGYA 1JWAB 1LW6E 1G6KA 1GGJA 5DEIA 3PX7A 1X3SA 4WT7A 2CYCA 5IUKC 3B1VA 1REQA 2EEPA 4CG2A 4JP1A 4YRFA 2H4ZA 3G13A 5KB3A 1M76A 5LQDA 1NT4A 2AC2A 2OB2A 1U0LA 1S2LA 4LKOA 2ZIFA 1GIAA 1NDUA 2VSYA 4OBEA 3UAYA 3DC7A 4FOOA 2H7VA 3N6RA 3R0VA 4HD8A 4ABYA 2J0SA 3QWBA 1E3WB 2C88A 3OTIA 4WVLA 5G02A 3CM0A 5FNZA 5HPYB 5JXGA 2WAOA 3R7NA 5AJZA 1NL3A 3TLAA 5IDYA 2ZBPA 3VZRA 4IAOA 4CMKA 3BB1A 3TX6A 1UFQA 3EBOA 4D8YA 4AKSA 1UJMA 1W0JD 3IAS1 1JXQA 5BWMA 1I4LD 5JZOA 2OD7A 5BV0A 3OF5A 3IULA 5AXBA 3HXOA 2QLFA 1QOQB 2Q50A 1ECGA 1DQRA 2FW8A 2IE8A 2QLMA 4Q9DA 4DKXA 1JTVA 4GOND 3VSDA 3B20A 3HXPA 3LWBA 1U9CA 3NTRA 3IPAA 1IMOA 1RQ2A 5J59A 4E94A 4WRRA 5EKSA 4F2WA 4K03A 4RANA 1XDDA 4RIIA 4EKNB 2PRJA 5K05A 3NFRA 1MQ8B 2WUDA 4ME6A 4ND1A 4NAVA 4PSKA 2W0MA 4ZI5A 1KRXA 4MUFA 4XOIA 1CUAA 1UBCA 3OEWA 3QP9A 1C4KA 4BKOA 1AHPA 5K6AC 2H1VA 2BGIA 4JEHA 3BS4A 2W2LD 1H2HA 1N33B 1KO4A 2GD6A 3CR7A 2QDKA 2MHCA 3FUWA 2SECE 4FLEA 1UFRA 5GJWC 3ZIAD 4IUBS 3FYTA 2DR0A 3FPEA 3USES 1FLAA 3VYUB 4Z4HA 5C52B 3DEJA 3TOVA 3CN9A 3ELWA 3U7HB 1QGZA 1K5PA 4Q3CA 1QP0A 4E88A 1B15A 2QVLA 5FPTA 3G2HA 4WY5A 3H6HA 1C0PA 4NWIA 4D4GA 3ZWDA 2J9ZB 4F3KA 1OOEA 1FBNA 1X38A 1AS2A 2H0AA 5D85A 4D9KA 3WYNA 4WINA 3I37X 4NBKA 4ZO7A 1ZL2A 2A0WA 4AD8A 1E9AA 1DPFA 1D4ZA 5EIBD 5F21A 4WXYB 3P8ZA 4ER7A 1M2WA 4ZI2A 5KPDA 3AI1A 5JEEA 3BEOA 4EPWA 3GOQA 4TS4A 2H2WA 5AD1A 5A2QA 5KYTA 1QU2A 1DGQA 5HZGA 1OLSA 2IW1A 3PQEA 5H3CA 1JKJA 1MO4A 1YASA 1VIAA 3AEXA 5TB5A 4OKIA 2PGOA 3ZCXA 4C6TB 4MS3A 3UCEA 3ET4A 1WZ2A 1J39A 1TX4B 2PL9A 3A11A 4REQB 3UJ7A 3F4BA 4HMQA 3WLIA 1TU3A 1L9XA 5I7HA 4M8NE 1ZK1A 5LYJF 1XEWX 1RI3A 1HFWA 5ETJA 5SZIA 1XL0A 2R6DA 3WKBA 3U7RA 2X9NA 2C5EA 1H69A 2R2GA 4BNDB 1ZN7A 1EQAA 2WJZB 5EUCA 4DUYB 5K3SA 2RAUA 3HUEA 4DCNA 1RPJA 4QGBA 5F98A 2OUIA 3D7KA 1CRWG 1JEYB 4PTLA 3WYGA 3NWPA 5C2JB 2N47A 5K0CA 2C20A 4EYQA 4FOPA 3ZGNA 5FUWA 3FUXA 1QFZA 3I2JA 4TVKA 3G0OA 2ZUVA 2IU3A 3K0AB 2YOHA 4JMLA 4QHSA 3ONVA 1Y1LA 4R2LA 1PEYA 1S96A 5TS3A 2BISA 2VEDA 1G8JA 2HPZA 3Q15C 1CS0A 1BN6A 1RXYA 3MWEA 5A2GA 2MDTA 2YVAA 1XZIA 3CH5A 3KXIA 3S5JA 3X1WA 8OHMA 4AZ0A 5JAHA 1OYOA 1WMAA 1UXKA 2X1LA 2YXLA 1X92A 3U37A 1BXGA 1XVVA 2RK3A 4H35A 2FV8A 5I6DA 5JYDA 3WLLA 4QU5A 3U3OA 3WWDA 3HNPA 3O73A 1YJBA 3ZE6A 1MB0A 2ATIA 2FUCA 3JD0A 4LEIA 3FNHA 1LVGA 1B8NA 1WP9A 1XZNA 2W2OA 1BWSA 4HJXA 3RQSA 1ISFA 1J0AA 1E4EB 1E2KA 2ZU6A 4HX2A 3ZX5A 2PT9A 2NADA 1D6MA 4G65A 5ERYA 3ZCQA 3EGXB 1WSDA 1G21E 1S1MA 1FQOA 2GAFA 1GG9A 2D1QA 3PZBA 1RRPA 3OJ0A 2XMBA 1O9BA 5DBHX 4D0RA 4ZHQA 1XF1A 1RHJA 4MKRA 2QYHA 3BRSA 1YB7A 2WU4A 3RUCA 1E9CA 4IJQA 4XSVA 4KE7A 3IKMB 2IYVA 5FHRA 2H8KA 3WIUA 3ZV5A 5K3OA 3IAAA 1WU8A 3V4PB 1IK6A 2HMAA 1SC4A 4DR2B 3LX8A 4PC1A 3HKEA 4GE0A 4JSYA 4MQ4A 3V8PA 1SBYA 5HSGA 2R6AA 4LJLA 2IPOA 2IT1A 2Y67A 3RNLA 4LF6B 1U8ZA 3C1OA 3JYQA 5D5PA 4R1OA 4ZGGA 4CKEB 4KPEC 1S9DA 2X2OA 2BSQA 4GVPA 1E0DA 5AJTA 1JQJC 1E1CB 2YJZA 5BUSA 5C5DA 1GG2A 2EYQA 3D1LA 1CEXA 2HBYA 3CZ9A 3KSMA 4RLSA 3VKWA 1HSZA 3O74A 1D04A 2Q46A 4QREA 4UXJA 3HGQA 3D2CA 3AHHA 4A26A 2W58A 3PFWO 3PK0A 1OAAA 2J07A 1Q44A 2WKWA 4OKSA 5AQEA 1E3JA 1NLMA 1TK3A 2WUFA 4QHYA 5EQDA 3ZKWB 4ZI7F 3EUAA 4NXMB 1AC5A 1M2KA 5LP6C 2VXCA 2YQ4A 3EEOA 1FFSA 4UULA 3R3XA 1FS6A 1T2FA 4J76A 3FAZA 3LPAA 4MPDA 5K01A 2QUBA 5G1PA 3AWDA 3KR0A 4Z0HO 2FP4B 2WD9A 1E99A 2ZIWB 1M5UA 1N9GB 3CLUC 1TD9A 1RM3A 2KBFA 3G8YA 4LMAA 4BMVA 1XCOA 5KNCH 1ZHFA 3IESA 1V7QA 3K1TA 1PWXA 1O5TA 4TKLA 1WZEA 3HDQA 3A58B 2YOFA 1ESNA 1KMQA 3DG9A 3E9MA 4PYRA 2CB9A 3NUGA 6CHYA 4TZTA 1UQRA 4RZIA 4M22A 3SYTA 5CVJA 4CM5A 1DC4A 1QKKA 2P9JA 4Y2XA 5E7IA 2X0RA 4CZ2A 1ZK2A 3RT1A 1EWRA 4OMDA 1JQ3A 1JAIA 1Y8QB 2DR2A 1QUEA 1TYZA 3PC7A 5I7AA 4X1KA 2V1UA 1TJ4A 2FPLA 8ABPA 1UXGA 4UATA 3MT8A 1BCRB 1KO5A 3DFFA 5D51S 4RPLA 2WD7B 2QVXX 3UB3A 4KPFC 3PNOA 5DGCA 4DOMA 3VH4A 2XUAA 4RSHA 4UTOA 3ZGZA 2W2MA 1AGNA 3WYDA 3GMDA 4RGYA 1GTJ1 2V58A 4B46A 4EKDA 1YMQA 5K4AA 1P8JA 3R3VA 2AK3A 5HZHA 1JMVA 4I1SA 5DISB 4PGAA 5FOQA 2YWEA 2P3QA 3R5SA 4NX2A 4KR9A 4LZJA 2B92A 3UT5A 4X65B 1QG2A 3AG5A 3RRBA 1DQSA 1GGHA 3NHWA 4B81A 1M6VA 4QQFA 1TJPB 1UOQA 4TRRA 5C8VA 3T9CA 1C2YA 2GJKA 1QG4A 2YV2A 3W6UA 2V6JA 3ORRA 2MWMA 1EESA 2B82A 2O05A 2GHIA 4R40A 2K2WA 5HE8A 3BULA 3R7WB 1QJCA 5KIAA 1T15A 2J67A 1L0BA 3LNTA 4OQXA 3MUOA 6NULA 3KT3A 1PD1A 3DL4A 3DT9A 3SZGA 5FPPA 3CVUA 2PMDA 1QZUA 4HDKB 2ZYSA 2VWGA 1ZCBA 3EXAA 5EXXA 4QYXA 4MS1B 4CDNA 5JT1A 3KOWA 1EIWA 3QE4A 1EJ2A 1LH0A 1JEEA 2WTXA 1XQ6A 5ESRA 3P9PA 4YONB 1C5KA 1YZHA 4F0JA 3QWFA 5C7LO 1I6LA 1XHFA 2CBXA 4W5NA 2GPWA 4Z51A 5JAIA 4XYMA 2C0PA 3K71B 5ENVA 1ACMA 3V4RA 2X5JO 4U63A 4WERA 1VSVA 3PIIA 4R0MA 2PSFA 5BQPA 4OP1A 1NJSA 3RIXA 4HFRA 4DBLE 1R18A 1OX5A 1EP2B 2BGTA 2QTRA 5EJMA 5L4NA 1J7JA 4RA6A 5IXJA 1ZGZA 4IDBA 3ZWBA 1WHSB 2HZBA 2I80A 5FA5A 4CT4B 1P44A 4GRIA 4ZVKA 2ORYA 5T64A 1FLNA 3OIFA 1Z0AA 2R48A 2CLOB 3AFOA 2DERA 2H4FA 2O1EA 2VQ3A 4FBLA 3DEYX 1OLUA 1DC5A 4EY4A 2BEJA 1YBHA 4PFSA 2D0PB 2WKRA 4OXNA 3KLOA 1U2SA 2FFHA 3GXOA 3R5XA 1TFRA 3R9KA 3SI7A 1FTNA 1JE1A 3PYLA 5AP9A 1Z08A 2QRMA 2QW8A 5EWMA 5DU2A 1P0IA 2MYUA 3LZ6A 1DIRA 3UATA 2PUBA 1PZFA 1O8BA 2QNRA 3QBTA 4HDOB 4M6WA 2V3VA 5FT9A 3SSAA 5HNKA 2BGMA 3EIUA 5KAMA 3D4OA 3P2MA 5TT1A 3GEHA 1GPUA 4NYMR 2DE0X 4DY6A 1MD9A 4LV5B 1ESDA 3RABA 3HKDB 1T1SA 4NYJQ 3ESDA 2OK7A 1T5HX 1EVYA 1KMHB 1T9KA 3EDQA 5A04A 4E31A 2J4FA 2NZVG 2PZKA 3C6ZA 3U4IA 4G4SO 4YPOA 3PGVA 4CL2A 3LHIA 3DBOB 4ESHA 1E18A 4AYTA 2WP8J 3GBSA 4MWBA 3AXSA 4XCVA 2IPLA 3R6GA 4XEUA 3ZXSA 2EATA 1P7WA 2R7AA 2SICE 3HDHA 2HF9A 4YAGA 2DGDA 4ZVUA 1MA3A 5DXFA 4GOOD 4OHWA 5F52A 1PL0A 3UKJA 1T5IA 1IN7A 4JGBA 2Z57A 1NIJA 1XWIA 3Q7IA 3QEMA 4NLLA 5K9ZA 5JD3A 3B7PA 3DUFB 4MMYB 5TXGA 2F1RA 1CUZA 2HMSA 3O3OB 4JEUA 1NN3A 4JWTA 2GWHA 2QRNA 3I3OA 4N0MA 2FSHA 4GZ6A 5EKXA 4HNSA 2JGJA 1SC1A 3AH8A 1KDVA 2W2LA 2HNBA 3IPRA 4BNNA 3BOSA 2L0XA 1ZP6A 1XZFA 2WUGA 5JFGA 3SYMA 4MYCA 1H23A 1M34A 1MXFA 2GN1A 4CG1A 2A1TS 10MHA 5LQKA 1CQPA 2J3HA 5BOVA 3RRNA 4LYEA 1P33A 2QBYA 1W1WA 1LC3A 4K0RA 1UZMA 2XQGA 2A78A 3WA6A 3QHPA 4KOEC 2WINI 4LRYA 3HJTA 1JIVA 1CQXA 3AJDA 4LQLA 5IKOA 3ZWAA 3GFVA 4PZYA 1HEYA 3QOXA 1VE3A 3D3EA 2HF2A 2REBA 4RVNA 2IP1A 1Y0BA 3JQGA 1NJFA 4Q1CA 2NPFA 1Y7PA 3OZDA 1LK5A 1ZUIA 1IWOA 2DSNA 5HJ5A 2V96A 3UOAB 2Z2XA 4L5JA 4P31A 4PZLA 1OY1A 3WL8A 3L0IB 5HHTA 3M6IA 4R01A 4E2ZA 1NN0A 3BA6A 5JYBA 2B1QA 2RGAA 3KKLA 2G5PA 3GP5A 1GU0A 1FP2A 4KUGA 1ISMA 3FVWA 4RH0A 2W6JD 3O4GA 4TRMA 1YAJA 4KWCA 4NAUA 5KBYA 2GCGA 2XWPA 3MAJA 1XPUA 3VO2A 5JSZA 1AKWA 4NBSA 2PL1A 2QZ4A 1XALA 1AK9A 4FHDA 3BDIA 4RHUA 4XRGA 3U80A 3K5IA 1RKQA 3TLCA 4NATA 3EEBA 1PW7A 3O21A 3QJGA 4UBLA 2IOQA 1R5NA 1GQYA 3MWLA 3MRVA 2OCDA 1NOJA 2XF8A 3HL0A 4RFSA 3ZXIA 5AW7A 1FDSA 4GIBA 2IXFA 1QV9A 4G56A 4S35A 1P6XA 1BX0A 2AUTA 2CUTA 4CM6A 3MS4A 1V4NA 5K99A 4QJBA 2ID7A 3NEYA 3R4VA 4JLBA 1I32A 4DNQA 4F91B 1OGIA 1SZDA 3U6BA 3R09A 2UVPA 1Z16A 3GWGA 3EEYA 4BFCA 3TTSA 3LXUX 1XZEA 3ZWKA 2Y6VA 5IVIA 2OENG 2NWQA 4V0OA 4GZ5A 4G0YA 3JAWB 4C5AA 3L4KA 5JSKA 3MWDB 4KWEA 1HLPA 3P9ZA 1PGQA 1L5HB 3RYIA 3CRZA 1YR3A 2J0EA 1T4MA 1IJBA 2ZWAA 1OTHA 3AY6A 1XVUA 2IS1A 1VTKA 2PN1A 1P19A 5IUJC 4I9HA 1J7KA 3VR6H 1A69A 2FX5A 5KQPA 3QVSA 4PG5A 1CX9B 4QXPA 5C5IA 3IP5A 3GCDA 3KXLA 3NW9A 5NULA 1T2CA 4OXQA 1UBMS 1PSDA 1OXVA 2BR3A 2D4AA 3AESA 3D3NA 2ZREA 4FQ5A 3X2FA 4C1NA 2DOKA 3NX4A 3K2QA 2DH6A 2Q3FA 1Z6YA 3AY0A 1X8JA 3N3AC 2E5WA 1QFXA 1B4DA 3H1AA 4FNGA 5HCNA 1U0EA 2VCHA 2UZ1B 2AG6A 4OQZA 4XPIA 4FFMA 2N42A 1PBTA 3DGFC 2ZE8A 4UOQA 4WNIA 2PMCA 1OZ0A 1YA4A 2OYSA 3T7DA 2AMVA 4D25A 2NZJA 4MKIA 3BJEA 1DIHA 3VHRA 2JL1A 3T61A 4EPTA 5IT5A 1KYQA 1U4SA 3VYTB 4UDXX 3GP8A 1AZWA 2NZYA 3EY9A 3IA2A 2GN2A 3R6WA 5I3ZA 3NPMA 4D4JA 4AWAA 1MXHA 4B74A 5HOEA 3GFOA 3QX8A 3C3JA 2DCMA 3TZKA 3LIPA 1KEWA 4Q7KA 4Y3UA 4ZU6X 4DA0A 4A9AA 3RBZA 3GGDA 5AHOA 4CQNA 4TS9A 2BMWA 2PTGA 4L08A 3X43A 2FB9A 1NXQA 1JEAA 1CUEA 3F1KA 2DBVO 3P9KA 3WIVA 2HPVA 3ZXYA 3QVKA 4BMPB 4F9EA 2H16A 3QRWA 3RM3A 1PO7A 4K81B 1DWUA 3RF6A 2F4VB 3NORA 1HQDA 3OT1A 1GKLA 3RARA 1CUIA 3PX3A 4KQHA 2YV5A 1H0RA 5BWCA 2HMWA 3QELB 4QGSA 1UEXC 4G97A 4KR6A 1ZW1A 3O3NB 5JALA 3GEDA 2YV1A 1E2LA 2PH3A 4OFWA 1PL7A 4QSMA 1U63A 4ZDKA 5CCXA 4UXIA 1L1FA 3GQBA 4FHCA 1ENOA 4COOA 1VG9B 1RRFA 4NAHA 5CFLA 3NIBA 5KHLB 4DV3B 2WJJA 2X4GA 3M9XA 4KO2S 3STYA 1W0KD 5DHPA 1ZNYA 1ULSA 2J9GA 1YDGA 1YFKA 2OECA 3HI6A 4P84A 2TRSB 5BR8B 4Q00A 3WNBA 4CFSA 3JR7A 4MYRA 1B42A 2O9JA 3KBBA 1ZBDA 1CUWA 2PUWA 4RD4A 5EJ6A 4DNOA 2WJAA 2BGGA 5HQ3B 2BE7A 5E6RB 4CDGA 2IHUA 4I5EA 2HK7A 1BO6A 3C85A 3KYDB 3QWHA 3SP1A 5B4TA 3ZN2A 3N0WA 2VSFA 4YMSA 1JKMA 4JN6B 3GB9A 3TSOA 4CLEA 1XZBA 2WJIA 2Y76A 4OF4A 3BD8A 4ZI3A 4ZYXA 5A5FA 2QTBA 2EFEB 4Q37A 5DWVA 4XUCA 1TQ6A 1B7GO 2XUDA 1KAHA 3AKYA 2AKAB 3C4QA 2BKAA 3MJEA 5CM9C 4NDZA 1FK8A 4PS1A 3V8QA 5KSZA 1FU4A 2HL6A 3WGJA 5K0SA 2GFQA 2X5KO 5K3BA 1JJIA 3U7QA 5ITZA 4AZSA 1ZGCA 1R5OA 4POOA 3GRZA 1TO6A 3DOOA 5E4YA 5BYBA 2W7TA 2XMGA 3FFAA 1NVBA 3Q3VA 2BYTA 3ZDDA 3PUXA 2HJVA 4YIHA 4IZOA 5BNIA 5LVAA 3R9WA 1XR3A 3D2BA 4MUGA 3WQBA 1DBQA 3MEQA 4JASB 5KJCA 2VC2B 4NZYA 1LBQA 4ENRA 4Z4QA 2ZUDA 3R3HA 2Q5HA 5BYAA 1FDTA 2CL5A 1E7SA 1K98A 1EG2A 3JQ8A 3A6JA 4OKNA 1AUVA 1WVIA 4I9NA 2YJ4A 1S8NA 1DFHA 5A1JA 1Q21A 1AV7A 3TINA 5K2MA 4KFCA 1Q19A 1EKXA 1QRAA 3EMKA 3LQFA 4KWHA 5T7BA 2VJCA 4OGGA 1E2GA 3M7IA 3TB6A 1IPHA 3USCS 3OJEA 4Q7EA 2CNOA 3H17A 3KZNA 3LAWA 1HXHA 1DBSA 2ADFA 2R84A 4PLYA 5AJYA 3A2KA 1K8RA 4MB6A 4RQAA 1B0PA 4B3XA 1RTTA 2YV3A 4H6VA 5JNRA 4NZMA 1ODKA 2EERA 1IBMB 3C5WP 3G5TA 2QV7A 3FKSD 3NWBA 3P0FA 1QLHA 4NIMA 3IRUA 4G81A 3DXXA 4HGYA 1Y82A 3MRXA 3K9GA 5DN9A 1JHQA 1E6EA 1VRWA 2Z8XA 3ILVA 5HF5A 1WZUA 4XJTA 4JBNA 4Y1FA 3GZTB 3OCCA 3QGMA 3GLHE 1J2UA 3K8YA 3C74A 1B0UA 2V7BA 1ZJ5A 3B1YA 4BNFA 5J47A 3NMUF 2QVYX 1NY5A 4TYWA 2DFLA 3CW2A 1GY8A 1M2FA 1KYZA 2JH3A 2RG1A 1J8VA 4TTVA 1CJMA 1E77A 5ILGA 3L18A 1SUBA 3MBKA 3DV0B 3D5EA 2B35A 2DUWA 3JSAA 1FYEA 4EPVA 3AUAA 3F4KA 2XAAA 3EJWA 1SUPA 5G41A 2F4NA 3WMEA 5J4KA 1KSJA 1QK4A 2BHRA 3RAFC 3WDKA 4WBSA 3LVRE 3P4UA 3RGWS 3W6ZA 5GV7A 1XRJA 1YD7A 2QTVB 3KKOA 3ND7A 3P1JA 4TN5A 3VPCA 2C04A 4DTCA 5EZ6B 3RUAA 9LDBA 2ZK7A 4BQRA 1RWQA 1WCYA 2XUIA 3LC7O 4HDNA 3WNVA 4CU2A 1QRTA 2RHJA 4H4CA 2YJTD 4W63A 4FHGA 1E92A 5C8YF 4YJFB 3CUEF 1YZLA 1HL3A 3A05A 4QXMA 1KFEB 1ND5A 2AGVA 5EP4A 5KI6A 1UK6A 2ACVA 1U2GA 2HIGA 4KODA 3U81A 1NXWA 3WHKA 3PVSA 1UJCA 4PGGA 3V1KA 4E21A 4RMNA 2C7RA 3OA2A 1QHSA 4HY3A 2NNLD 4IDGA 3S28A 3TOXA 2UV8A 3INRA 3N0RA 4CI9A 3O3CA 3L5KA 1JLRA 4QU0A 3EZFA 5CIYA 1Q2XA 1W4ZA 3LOQA 5TX7A 1ZH6A 1B23P 3DKKA 1EVEA 1EFCA 1YONA 2F3UA 3PJGA 4QWMA 5MGNA 3WL3A 4EZBA 2A5DA 4C4AA 2IUYA 4LWPA 2LP4Y 2QPAA 5AKXA 3PCTA 4Y2GA 1IN8A 1K3UB 4M1KA 2HEIA 1ECCA 1GN9A 2VT6A 2XQFA 3C3YA 4MGHA 2O54A 4PHFA 4R84A 3KNZA 1GVHA 3CT6A 4LCJA 3OZTA 3K96A 1R64A 1V26A 3EBPA 4GC5A 4V24A 1FY2A 2Y1LA 1BJKA 1YUNA 4ZVPA 4KHPB 1DJQA 2A9PA 1TA4A 4GXTA 2BT4A 2ZTSA 1TQ8A 1FFXA 1OLSB 2OCAA 2RGBA 1JKJB 4I2VA 4C7MA 5GIPE 2PX6A 4MS3B 2C84A 2ZSFA 1CY1A 2E6KA 3ETLA 3FGNA 4CV2A 1IUKA 3EIXA 5I8ZA 2QN1A 3UA3A 4AO6A 4BX2A 1V16A 4EPRA 5TMPA 4RQTA 4BNHA 1QCYA 4J0JA 2EG9A 4X1YB 4KRGA 5JNUA 1OTYA 4XUGB 4CR7A 1CUSA 1L5MA 4JX9A 1HL7A 4US1R 4R8MA 3QHQA 3VZPA 2PGLA 2YN4A 2G4LA 3DD1A 1GPKA 4BV9A 1OSNA 3OA0A 3P2YA 3GI1A 3JQ7A 4LCEA 1U2RA 1IEXA 1OFUX 4LXTA 1CP2A 1W8IA 1IG0A 2I6SA 4EYGA 4KPYA 1ZIXA 1J42A 4BFLA 4G5XA 5KTNA 4GF5A 4OQDA 3ZCTA 3N39C 4QVKA 4UEQA 3ZWVA 2Z43A 3T7SA 2CVFA 4J49A 4UOEA 3HDGA 2B21A 1CS0B 3MWEB 1GDTA 5AM1A 3WGVA 5I7FA 1SKQA 1DKOA 1H4VB 1G3IA 2CKMA 2XCUA 3H4IA 4G9BA 1BHSA 3ZNQA 4AZ0B 5LP1A 2YKGA 1KOGA 1N0HA 3P94A 1BXGB 1USIA 1F8YA 3UICA 1EUCA 3L8YA 4JKYA 3ZY3A 3TMYA 4PSUA 1O03A 3KOOA 2PUHA 3O4RA 3P52A 3W79A 5FHQA 1W4LA 2Y1XA 4QA9A 5AVZA 2FR1A 1Y6GA 4CT0A 3OJWA 3E0QA 2FMTA 1C8VB 1TZKA 1GTVA 1XA4A 2PQ6A 1MNQA 3JVUA 3UQZA 4ANFA 1CJBA 2W71A 4YCNA 4LHYA 4ZHQB 1OBFO 1BYUA 1CR6A 4QNNA 1PZMA 1XZKA 4K6HA 2C31A 4N0PA 4HUQB 4JY7A 4Z2YA 3R7AA 2ZRGA 2JVIA 1POXA 4I5DA 4CV1A 3O8CA 4BKMA 4DUPA 1UK7A 2B78A 3ZHYA 2VJKA 3WNCA 3AFMA 4E7OA 2XT6A 4ESVA 2QL7A 2FWNA 4WASA 2ZB3A 1HOXA 3NTVA 2J87A 3QPDA 1Q15A 5C7OO 3LO5A 3EULA 4BFVA 1M7HA 1DNPA 3LHKA 3ZDYB 2V45A 2ZTMA 4RL6A 1LGYA 4YGXB 4LI3X 3COPA 2Q6KA 3QJYA 2XNKA 3GG2A 3L6DA 1IXSB 4NV0A 3JZAA 5LQMA 1KWGA 4KIGA 4N65A 3OT5A 2IEAA 3LQYA 3SJBA 5IXSA 2VQFB 3RT7A 2PAAA 4M1WA 4CG3A 3NEPX 4B3SB 3ENNA 4HDCA 2UUOA 1ONOA 1R66A 2YWCA 1LVUA 4ZRDA 3KPUA 3H2KA 1K7SN 1CJVC 2E0IA 1NUSA 2QW1A 2CXSA 3A04A 4OFXA 3G17A 2Y0DA 3QE3A 2HLPA 3F1LA 3R9IA 1K6XA 3LRXA 2JLXA 1TO1E 5F9MA 5DH9A 1XMJA 3I9V6 5ALVA 1W0KA 2G67A 5BSGA 4N5LA 5BN1A 2AOXA 5BRJA 1JHPA 1L5OA 4L1KA 2XCSB 5JXHA 1QOPB 4FDTA 1XJ5A 1G5HA 3DAOA 4MQUA 3V8BA 3COZA 2PWAA 2QM0A 2QN7A 1HDIA 1PL8A 4JVOA 5JCJA 1YR8A 3HQ4O 1MX3A 4DGSA 2RHOA 5AKGA 4B7UA 3A6EA 3CU5A 2PBRA 4PZZA 4BQQA 2WRZA 3KWFA 4IJUA 4MGYR 4RF4A 4HN2A 4UQLA 1W5TA 1E2MA 2FPWA 1LRJA 2JJ8A 2B5OA 2DFDA 2OM6A 4UD2A 3HUTA 1T0BA 1ZISA 4EDHA 1IQPA 4M1QA 4PW0A 2V74B 4X1KB 1I9CA 1QAOA 4IZHA 4LY0A 4A8JC 1NOKA 5HKBA 2VJNA 2EW8A 3MCZA 2FSFA 3UUGA 2GN8A 2VNAA 1JG4A 2HD4A 4CQLB 3R44A 3MWYW 2Q2QA 5IYZB 1IFXA 1PN3A 1E1QD 3DKVA 3GV0A 1AQYA 3DZGA 4MLCA 4WZBB 5M34A 5EXDA 4IZ6A 2WYUA 3BG5A 1OPXA 2DPXA 2BBWA 2JIZA 2X8BA 4F2GA 3AL3A 3GFBA 4QULA 5A4DA 4LGVA 4W5HA 4YAJA 3UUFA 1M6VB 1O4WA 2CLHB 4MRMB 2ASEA 3WGGA 3L7AA 4AFNA 4BP3A 4E09A 4ENSA 2QIOA 4LG1A 5JTTA 3OQ1A 1E1RD 2W2QA 4HRAA 5DSTA 5BV8A 1Y48E 1E9SA 2NYVA 1M75A 5IASA 3EQ7A 3OJFA 1DJPA 1V3UA 2QZSA 4P3XA 5KU1A 3HYTA 3AP2A 5BW5A 4WA8A 4GKKB 1E2BA 3LGXA 3KJEA 4TYPA 4C2UA 1E9RA 2IZZA 4FX5A 1AZSC 3UPDA 2PANA 2UZ0A 1J25A 1M2JA 2Q1SA 4J0QA 1BD4A 1D2EA 3PQ5A 4JA2A 4YNBA 4PLTA 3ZE1B 5LU8A 4LK2A 1P1HA 2W43A 2JFFA 1M6YA 2GBPA 4JS0A 5D84A 5FWAA 2ZJ8A 2XMSA 5I9NA 5LQJA 1V35A 1VBMA 3RCBA 1TMYA 1LRKA 4RA6B 4CV0A 1PQ4A 1MB9A 5K0FA 3EFHA 4B7AA 4FMCB 1JHUA 2XCIA 3CWCA 2PQ2A 1Y5LA 2PD4A 4LCBA 1L6RA 1QHYA 2ZJ4A 1DFIA 3W3AD 4DYDA 2ZLBA 2EBFX 3H5LA 1XXHA 5EIBC 4CM3A 3JCZA 3IDQA 4ZK2A 1O2DA 1VIMA 5E9JA 4WNAA 1DWOA 5EWMB 1Z0FA 4ILKA 3MXTA 4XQEA 3DDHA 2VCEA 3WHLA 3TIXB 3KVNA 1A3CA 4CU5A 4M6WB 3DHEA 1L4BA 2PH1A 1CRLA 4IDFA 1HMPA 4RSMA 3U48A 3N6XA 3K8ZA 2R47A 2LXNA 3MERA 5KWSA 1THMA 1UADA 2WMNB 2YDXA 1QYVA 3C3EA 4G5OA 4PLZA 3M33A 4B80A 2C77A 4RVDA 4BNGA 4UTVA 2PX4A 1T2EA 2L2QA 4DDKA 4DABA 3ANNA 4CVNA 3MJVA 4FEGA 1ZIDA 4K46A 5TPWA 4ZHSA 4E5DA 5IULC 3GLIB 2CY0A 4D92A 5FBLB 2IXBA 1WXGA 4P33A 1XZ8A 5IH3A 3UENA 4C9BA 3CZQA 1AF7A 1PR3A 3TQOA 3FJOA 1QAMA 2QN8A 3DCYA 4GOXA 4MVJM 3GJYA 5B2EA 2JLUA 1DDIA 4ZKEA 1M2GA 2OGZA 3CJTA 3DDWA 2DWCA 4WD3A 5K8TA 4BQFA 3PUHA 3AX6A 5E1MA 2PX2A 3KOXA 4NRDA 4KQ6A 2PUDA 4I4TA 1RQXA 5K5EA 4OHRA 2GEJA 2I29A 4URWR 5ALPA 5FTJA 2NSHA 3SE0A 1WXFA 3TTWA 3R2JA 2QBYB 5BO5A 5FOVA 2OHJA 1QX4A 3V4OA 1Z37A 2VOEA 2Y27A 4DN6A 1APBA 1C9JA 3BILA 4TPKA 1PS9A 3AB3A 1WW2A 3SFZA 5B58T 3FFTA 1ZI8A 1QFMA 1JXOA 4WCDA 4UBJA 3ZGLA 2ZSHA 2QMOA 1FC0A 3AI3A 3JQGB 4IUCS 3PQ8A 3SEAA 4DWVA 1E2UA 5MN6A 4DUZB 1EX9A 4RD3A 3TFWA 1ZMTA 3FZEA 1RPNA 2EBUA 3NI2A 3KKKA 2HHHB 2XB6A 3AP3A 2CXXA 5ITWA 2E2WA 2CCJA 2LKDA 3I4CA 4EG4A 2HJ9A 1YTLA 3KB6A 3G9ZA 3TQIA 3KL4A 1L8XA 1E2EA 4N3NA 2NO4A 4LDPA 1T1JA 3FCUB 3SDZA 1SA0B 1MBZA 5B53A 1A0OA 4WOKA 5DF1A 5JSZB 4RBNA 4HQ0A 3AF0A 5AK6A 2E55A 3ZQ6A 3N2YA 3CKKA 3WNDA 2JLVA 3GA0A 3NDJA 3T5PA 1GGEA 1VBKA 2O2ZA 1U1IA 3LCRA 4GKVA 4RFSB 3IKTA 4W7IA 3ITNA 2I54A 3EQ9A 2RGNA 4X7RA 1XZCA 3W5DA 4KR2A 2R6FA 2HDOA 3HA3A 1G8GA 3TI7A 4AT1A 1PU2A 2WSYB 3SXPA 1RBQA 4RO0A 4QASA 2UVPB 4OB8A 1G20E 4BIMA 3E70C 4RF5A 1U90A 1R16A 3N5CA 4FGZA 1YU9A 1IY1A 5HJ2A 1W87A 4JJIA 4A15A 3N0XA 5HIIA 3UXEA 4Q1EA 2C92A 3EWSA 2RHRA 4P08A 4EEKA 4WKNA 3CZPA 4BO7A 1MJNA 2ZI7A 1KBZA 2UUCB 2C5FA 5G0VA 1R4NA 3G1WA 4LYJA 3RYIB 1WULS 3HR4A 5FWDA 1Q1GA 1S3IA 3AEYA 4QPDA 2OQ2A 3GT4A 2VUIB 3P19A 4RZUA 2J5QA 4ZCPA 2C83A 1N2HA 2QK4A 2VPWA 5L3ZA 3FR8A 1QQ6A 1SIUA 4HLCA 3NC0C 4JBXA 3WOVA 1V7ZA 1NC1A 1NVVR 2P30A 1A95A 2WG0A 2PA0A 3AESB 3FLEA 2AA3A 3ZE0B 1JG1A 3L0PA 3AR3A 2OCGA 4Q9HA 2Q3JA 4ZVMA 2J3JA 3OLXA 1HRKA 4V2IA 5FA6A 3VSCA 3ZDZB 2CZQA 2PXAA 3QI7A 4Q3EA 2OA0A 4UE3S 3NBMA 1MC1A 1PFQA 1YQUA 4XXHA 4XPIB 5F35A 3EPRA 3ZX4A 3TKLA 3IL2A 2HRZA 3PS9A 3GLFA 3WQQA 1BAPA 2HWWA 4LDNA 4YS6A 2GNAA 4WEOA 3V1NA 1BWRA 4CNQA 2QRUA 3UWPA 3NH9A 4F9FA 3CF4A 4BTVA 2IQIA 1GLNA 4XB1A 1QTRA 2PKQP 4JT2A 2EKBA 5G1OA 1MAWA 1RNLA 5A1TA 1AGYA 1K5HA 2RHTA 2EC5A 4M46A 1P5HA 4OK6A 1JQLB 1JDSA 1RRKA 2CWDA 4G37A 3RHFA 4OOFA 3GJ3A 2VHCA 5HKOA 1B16A 3CMMA 5KYYA 1UBFA 4PN7A 3OFVA 4FI3C 4YUWA 1HI9A 1DE0A 1JHAA 3I12A 4KBGA 5AI9A 1CU1A 2ZR9A 3DDZX 1YVPA 3L40A 1UPCA 4RW0A 4ZZ0A 5JLJA 1ZM4A 3WLPA 1VL5A 2I6UA 4X84A 3T3EA 1MB3A 3UJNA 1ACLA 2BFDA 4OREX 1G98A 2I2FA 2QRKA 2ZYWX 2QP9X 3OT1B 2ZRKA 4F72A 3RLIA 9GPBA 5KKNB 1CIVA 3GN1A 3UUWA 1M1ZA 1TUBA 4WZAA 3MSXA 3DF9A 2Z3ZA 3THYA 2QRPA 1FNSA 2DKFA 3PHBE 5ESXA 1UMBA 1KU0A 2Q6OA 3TRFA 3TGWA 4A6DA 1Z5NA 5DM70 1T24A 1U1GA 3GQBB 2GXAA 2WV7A 3HJRA 4YHHB 3ANTA 3GBPA 2A88A 2SKDA 3QSGA 2DR3A 1NVDA 1OWLA 1DWPA 1JAZA 5FL3A 1ZINA 1ZOOA 4R3NA 2SHKA 3OTOB 3L8HA 4XX0A 3O4HA 1FFDA 1IBLB 2AFHE 1XDWA 2OAP1 4ID3A 2WT9A 4R2WA 2HA0A 4ZT6A 3BWXA 3DMFA 2GD2A 1TZ2A 2WMOB 2JS7A 1MGOA 3DL2A 3ZNPA 1P2FA 3U19A 1G0NA 1E1QA 2XHZA 3A2NA 3G2NA 4TZ0A 1D07A 4Q6WA 3OJXA 4RA9A 2XYVA 1PLKA 1AOXA 1SD1A 4TV9B 4I1VA 2F9FA 2GNOA 3D6VA 3KAKA 3MT9A 3UHOA 4H1UA 1LDGA 1PG0A 4ZWNA 5J4VA 1RC0A 1IQUA 3H5RA 4YXFA 4PTYA 3I3SR 1IHXA 3ND5A 4TUYA 2HH9A 3NT2A 4X7BA 3FMVA 3WKCA 4BEVA 4C6SA 5TQ2A 3PXUA 2BMAA 3K8OE 1J2JA 4ZRNA 2WT4A 3L8DA 5ITZB 4TOIA 4A0FA 1SXQA 4Q1FA 4JI0B 2OEPA 2AW5A 1YVDA 2X86A 3ZZMA 1U0BB 4RPKA 4DB4A 1DEHA 4CIAA 3IAUA 1Y6ZA 5M5BA 5FBHA 2HM7A 1K9SA 2B34A 1M2OB 3CNEA 3G7SA 3PUKA 4QNRA 2Z6VA 3LW7A 5B1DA 1UAGA 4DA4A