3NM6B

Helicobacter pylori mtan complexed with adenine and tris
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
229
structure length
229
Chain Sequence
QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme-ligand interactions that drive active site rearrangements in the Helicobacter pylori 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
total genus 86
structure length 229
sequence length 229
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nm6B00
4DA8A 1WTAA 1XE3A 2QTGA 4JWTA 1ECPA 3KHSA 3TL6A 3GB9A 4WKBA 1RYZA 1CB0A 4WKPA 1Y1SA 4MCHA 2QSUA 4H1TA 4KN5A 5FAKA 3O4VA 3DPSA 4G8JA 2QPLA 2AI2A 4LKRA 2GUWA 4IP0A 1SD1A 4DA7A 3K8OE 1A9RA 3KVRA 1JYSA 1JE0A 4BMZA 3ENZA 4TXJA 1YQQA 1RR6A 4QATA 3EEIA 1PK9A 4LNHA 4YJKA 1A9TA 1PW7A 3IOMA 4OGLA 3MB8A 1OTYA 4QASA 4TS9A 1TCUA 3UAYA 1PKEA 1JE1A 4OF4A 1OVGA 2HN9A 4TXHA 4F2PA 1YQUA 2ISCA 4OEHA 1OUMA 4QEZA 3OZEA 4JP5A 1A9OA 2IQ5A 4GLJA 2Q7OE 4TTIA 1SD2A 1K3FA 1K9SA 1RCTE 1PR0A 1QE5A 3NBQA 2QTTA 4D8YA 1VHJA 2OC4A 4D8XA 5CYFA 4EARA 3FOWA 4DABA 5F7JA 1TD1A 1G2OA 4I2VA 1OTXA 1LV8A 1PR5A 4DA6A 4K6OA 4DA0A 1JP7A 4DAEA 3LGSA 1RT9A 1RFGE 2I4TA 3OZCA 2P4SA 3INYA 4L5AA 4BMXA 1Z5NA 5C80A 3PNSA 1ULAA 3LBAA 1A9PA 3FNQA 4UC0A 1B8NA 1ZL2A 4TTJA 1M73E 1Y1TA 1Y6RA 3OOEA 1U1GA 1ODLA 1V48A 2HSWA 4F2WA 4M3NA 1RXSA 4NY1A 1YRYE 1YBFA 5B7QA 4X24A 4G89A 5I3CA 2I8AA 3BSFA 4E1VA 3KVYA 3NM5A 3KU4A 4L5CA 4LZWA 1PR1A 1PBNA 1JDZA 4TXLA 4R2XA 1A69A 3BL6A 3UAXA 3KVVA 1SQ6A 1V41E 4YO8A 1U1EA 3LA8A 5F78A 5EUBA 3U40A 5B7PA 3IEXA 4QAQA 4MCIA 1ULBA 3PHBE 2OXFA 1JPVA 1CG6A 3OCCA 1PR2A 3F8WA 3UAVA 5IFKA 2A0WA 1JDVA 4D8VA 1PR6A 3OZDA 3P0EA 5CXSA 3OZBA 3FWPA 1A9SA 2OECA 1SJ9A 2AI3A 5JPCA 5F7XA 1T8SA 4L5YA 1Q1GA 1NW4A 4BMYA 4D98A 4DANA 4M1EA 1YR3A 3NM6B 1ODIA 1ODKA 3SCZA 3UAWA 5ETJA 4BN0A 4ECEA 1N3IA 1U1DA 5B7NA 1T8YA 1T8RA 1Z35A 1TCVA 3E9ZA 2ON6A 3NM4A 3BGSA 4DARA 1Y1QA 3D1VA 4M7WA 1FXUA 1B8OA 1RXUA 3OOHA 1JDUA 5CYGA 4DAOA 1PR4A 3O6VA 4WKCA 1T0UA 1RXCA 4P54A 3ODGA 1C3XA 1JDTA 1Z39A 1PF7E 5B7GA 2AI1A 3PNPA 4NS1A 1ZOSA 3OPVA 1Z5OA 3DJFA 4TXMA 4TS3A 3E0QA 4GMHA 4OGKA 1T8WA 1Y1RA 4PR3A 1VHWA 1JDSA 1I80A 3E9RA 4F3KA 3OF3A 2HWUA 3FAZA 4EB8A 1Z33A 1V2HE 1V4NA 4YMLA 3EUEA 4LNAA 5CXQA 4MARA 3T94A 4WKOA 4JOSA 4U2KA 4OY3A 2BSXA 5F76A 4F3CA 3DF9A 2HRDA 3FUCA 3KUKA 1VFNA 1NC1A 1Y6QA 4TYMA 4R2WA 2AC7A 3QPBA 3FB1A 5F7ZA 5EFOA 2PGAA 1NC3A 3C74A 5K1ZA 5IU6A 1Z38A 4FFSA 4NSNA 2H8GA 4R31A 1Z5PA 1Z37A 3ONVA 2QDKA 2OC9A 3EMVA 5EPUA 4PNPA 2A0XA 1OV6A 1V3QE 4QARA 3UT6A 5F7OA 3DDOA 5DK6A 5F77A 1U1CA 4RJ2A 4GKAA 4OJTA 1RXYA 2XRFA 4YNBA 1A9QA 5F73A 5KB3A 4G41A 4LDNA 3UAZA 1K27A 1U1FA 1V45E 1LX7A 1VMKA 1RSZA 1ODJA 4D9HA 3DP9A 1Z36A 5CCDA 5CCEA 4GLFA 3P0FA 3BJEA 1PK7A 3GGSA 3PHCA 4L0MA 1TGYA 4L6IA 2A0YA 1TGVA 4QFBA 1OU4A 3MMSA 1Z34A 1LVUA 1PWYE 3K8QA 4TXNA 3EUFA 2RJ3A 2A8YA 4TTAA 4WKNA 2B94A 4F1WA
chains in the Genus database with same CATH superfamily
2YJTD 3ABZA 4NKRA 3WL5A 2XI4A 4HDNA 3UN1A 3PRJA 2WT8A 3WNBA 2GK4A 3EX7C 1JDJA 1UMCB 2P5YA 4Q9NA 4W5WA 3DEFA 2FLKA 3HV0A 2P0EA 1KK0A 4J0QA 5B2ZA 4HC4A 4QTZA 2E85A 5FWXA 1UK6A 1X3LA 1EFRA 2REBA 1KDZA 4ZI7A 3S55A 3A3NA 1W2WB 1WXEA 2NACA 4N5LA 1ODTC 3H9GA 4DPKA 3SDSA 3I6QA 1H0RA 5FI3A 5CMLA 4DMMA 1X8LA 3EC7A 1NUSA 5SYMA 3UWOA 3CVJA 1XQYA 2VDOB 3A2LA 1CUZA 2C4NA 3QTLA 1Q14A 4NZZA 4RSRA 4J7UA 1ONSA 1U8ZA 1HZZA 2XOKD 1G7RA 3A4IA 4AMBA 1CUAA 2BEWB 2HO4A 4ND3A 2YRFA 1EKXA 3HUUA 1SCAA 1BXRA 5FI1B 2RE8A 2C7RA 3Q5DA 5ALIA 3IT0A 1HSOA 3QU4A 2QPLA 4B82A 1JIVA 1FS4A 1SA0A 1N3BA 2D7JA 1C1XA 1QYIA 3A4TA 3DMFA 4IQFA 3UB4A 4EHAA 1ZN2A 1QK3A 4C7BA 1IY1A 3LLSA 1YAJA 1XQ9A 1U98A 1P1IA 3W8EA 3WK7A 1ZD9A 2B5OA 3ND8A 2H2FA 3A1UA 2ILVA 1PQWA 2D13A 1U0GA 4A10A 2AS0A 3JX9A 4EHLA 5A4FS 3QHQA 4OTZA 4CKCA 3HSYA 4P3XA 5AK5A 4TLEA 2YXEA 3CLRC 2FSFA 4P7KA 1NAHA 4DWOA 5C37A 3VPFA 2R85A 3SOPA 1L7PA 4URYR 4H7IA 3BGIA 4KYTA 2YQZA 5EFZA 3VNBA 4BQEA 4BMZA 1UMCA 4UXJA 1ZISA 3UUWA 3KXDA 5JCOA 2B7LA 3RVMA 4C0HA 3A3OA 1ZCBA 1ZJJA 2VH5R 1RAGA 1PW7A 4PG6A 5DM60 3G2IA 2IELA 2H4YA 2WRZA 5J4KA 3KQKA 2ZSJA 4FKMA 1B2RA 3WSWA 5A62A 3C5EA 3IKTA 1XPUA 1RMTA 5EJ9A 1XNQB 1KYIA 2X0KA 5CEFA 1W59A 1G5PA 1M2OB 3R7FA 3U16A 3ICPA 3NVDA 3QELB 1WMAA 4GGMX 2AXQA 1ISGA 5KPDA 3AXTA 1JJVA 1UKEA 3RBVA 2PKEA 2PD3A 2M32A 3IEKA 4UBNA 3C15C 3LBHA 2HREA 3L0PA 2P5SA 3OI7A 4G1BA 1L5QA 2CVZA 2A5FA 1G5FA 4I1UA 1QRUA 1YBVA 4MV3A 4JKYA 2P8SA 1XU9A 1CP3A 3CO5A 2JG3A 1L8OA 1EE9A 2GPTA 1T0HB 4QXQA 2AEJA 4YCCA 2CY0A 4NECA 3UA4A 2CGEA 2GRJA 2P75A 1EZ4A 1PSZA 1UMDB 1A8QA 2OLEA 3CZCA 4YDRA 4A73A 1P7CA 2HWYA 3HI6A 3Q0IA 1P0MA 1NDUA 4LF9B 4TZKA 2MMCA 1RACA 2F8SA 1KIAA 4U8HA 5F5NA 2OXTA 1K9SA 1A2BA 5G1OA 2E6UX 4F72A 3GLIA 1Z56C 3BCUA 3PT9A 1DPGA 1F2VA 1YQTA 2OD9A 2Y4OA 4NI5A 3RIGA 5A5EA 1KKMA 4OK5A 5DX8A 1TQHA 3VDMA 4D0RA 4EL5A 2ZWOA 2FGJA 1YZFA 3GJ7A 2QTTA 3R6DA 3LT5A 5ARBA 5EHZA 2H1CA 2UDPA 1GAWA 3E9EA 3CR7A 1FDVA 4IUCS 1OIXA 2CDNA 2GQ0A 3Q11A 1F2UA 2O1SA 1WKCA 1XEFA 4FMCB 4MPPA 4MYHA 3R75A 3M89A 3P9QA 3LVBA 4ZT6A 5KVVA 2D8MA 3E7DA 4DY4A 4M88A 1E32A 4WN9B 2QPAA 4B3IA 4NZNA 5KYWB 2P41A 3DMTA 4HADA 1K0FA 1TD1A 2H5JA 2GCNA 4WZBE 2HPZA 1WF6A 3I9V1 2OORC 4ER0A 1ZD4A 2J3LA 1XMIA 2WVJA 3KQMA 2GRAA 1T4CA 4W7IA 1NW7A 4OIFA 3JV7A 1M8JA 4PX5A 4MKIA 3A0RB 1PL7A 4MZXA 4A91A 1EAYA 1BGXT 1PZGA 3DA8A 3HJHA 4OQDA 1P80A 3K2BA 4QEDA 5JWHA 1VRWA 3ZVMA 1XCGB 3T1QA 3BYZA 2GPWA 2XCTB 5HRUA 2YC2C 5ITSA 4X1IA 3ABIA 3ZDDA 4PX2A 4EMTA 1QGUB 1ZXXA 4F4HA 4KQ9A 1UBFA 3I0MA 3TGPA 3T5TA 2W6MA 3CEAA 3D43A 3UWSA 1YGYA 1Z6GA 4ZAWA 1N77A 1O6ZA 1M1UA 3VVLA 2HMYB 2VXYA 3PI7A 2BEJA 2RI0A 4LOLA 5G1NA 5JOQA 1SHLA 5J5AA 2PWYA 2NU6A 1CRLA 1CRZA 1YUMA 1DFIA 4YRIA 1O8CA 4BRUA 5I7OA 1O95A 1UBOS 1C41A 5SY6A 3FLBA 3TQOA 2EZ8A 1QPZA 1WMDA 2GEVA 1R88A 4F12A 4LFAB 3T7KA 4BFVA 4K88A 4X63A 3VTAA 3K70C 4G3XA 5CCBA 4M99A 3JYPA 5JG7A 3E8SA 4QC2A 3PV0A 4S3MA 3AI2A 1LS1A 4W7SA 1WE2A 3BFXA 4D3ZA 1YBFA 1KQ3A 3DFFA 2FX2A 3FNIA 4NK5A 4LWZA 1IHYA 4PO8A 3V8QA 1C3OA 2ORIA 3TXXA 2BKLA 3BF7A 5DSXA 2JFGA 3Q6MA 3ZOZA 3KPVA 3G1TA 4DRZA 3FDXA 3FDFA 3E82A 2X42A 4POOA 2JLXA 1H6DA 1OV4A 3BWVA 2DQ4A 3KWJA 1IZ0A 2YBDA 3H4IA 4MEJA 1JAZA 3C8HA 4ZANA 5JCJA 2RJNA 3I73A 3KVYA 3TTWA 4EJ6A 4F6RB 4W7HA 4WINA 4LJ9A 3C7TA 3AG5A 4FWIB 2ODQA 3G2QA 1KYWA 2A0UA 3H17A 3N58A 4EY5A 2P77A 1HV8A 4DSOA 3NRJA 5HPYB 4HUTA 1SCQA 1FEZA 1A69A 3QEMB 4HRXA 2K6GA 3ZHBA 4B6FA 3PQ5A 3WYDA 1NYLA 1QGDA 1TYAE 1Q16A 2TMKA 2XNHA 3G9ZA 2IP1A 4TV9B 1K7YA 3ITEA 3KAQA 3E23A 4DMCA 4K46A 4CTOA 1VPEA 4A1OA 2JVKA 5LYJB 4Y6LA 2ROQA 2WWHA 1WXQA 3DBRA 3N0WA 3FVQA 4AUKA 2J9RA 2YXBA 4ZQCB 4ZRDA 4ZYZA 1GUZA 4HWGA 5DGHA 5I7WA 4FNAA 2YV2A 5C4IA 5CG2A 2O3JA 3ZU5A 3DUFB 1OX4A 1SCKA 2G77B 2HBYA 2OHJA 2WWTA 4R1OA 3KR0A 3WMEA 4B73A 1GNVA 1U3FA 1OIVA 1WP9A 1Y7IA 4JXZA 4L8FA 1IU9A 3BT7A 3O38A 3ZQ6A 3W6UA 1DC7A 1KEWA 3A27A 4EO7A 4OOEA 4YAWA 4F93B 2QW1A 4O2LA 3A9VA 4A8JC 1DO0A 3M6LA 3MRTA 3S70A 3A4VA 3QU5A 4K1LA 3T7EA 2QMQA 1X1BA 5FTKA 1YA8A 4V1CB 3FMIA 3WKCA 5FT9A 4IKEA 3F5DA 3KC2A 3VNQA 1I51A 2JATA 4C4ZA 1AQ6A 2QZJA 4LZLA 2IPAB 2FPRA 3I28A 3U3ZA 4BU1A 3CHYA 3D8RA 3ZH2A 3JWIA 4G5HA 4OXRA 4L5YA 4HBGA 1RWKA 1XLTC 1DCKA 4RH0A 2F2TA 3EIFA 4IZIA 3JTEA 2A5JA 1SXPA 4B71A 2NXNA 2JZOA 5MFPA 2OCYC 1U3WA 3DMTC 3FLEA 3NV7A 3C6QA 4G4IA 4H31A 3HY3A 4Y0VA 1UP7A 3OMWA 3U48A 4CM3A 9LDBA 4DBLC 4XZ3A 1DHTA 1PV4A 5LZ2A 3PC6A 1OXUA 3K0FA 3N6RA 2WLSA 5ENDA 3BTVA 3I2GA 3TG8A 4KYUA 5EIFA 1QYDA 5T4BA 2NU8A 3DE0X 1PJ3A 4FC6A 4H60A 3IQFA 2DMRA 4G26A 4GL2A 3UTCA 2PZKA 1DO8A 4NCXA 5AH0A 3TOSA 3OFKA 3KKEA 4XQGA 4M0EA 3VJKA 4DSTA 4DXHA 5FWDA 4TTTS 1V6CA 1RZVA 3C87A 4B7CA 3WYCA 2BR5A 3RAFC 3IP1A 5F1YA 5A0TA 3C5CA 1RXUA 1L5RA 3HPQA 1QHSA 1Z25A 2BDTA 1DIHA 4M22A 1Y4DE 1XEWX 2HMSA 2ZRJA 4ZVTA 3CJQA 2F9LA 2XTZA 5F3DA 4R9RA 3KB6A 4F60A 1YC2A 1G42A 2VUIB 4N7BA 2M6KA 1E5LA 3RC8A 4CFZA 4YALA 5ALMA 1N1DA 2FDCA 3E9MA 1E5QA 1NNLA 1T6YA 1VIDA 3NTRA 3OHPA 3B1JA 4PN7A 2D1YA 2L42A 3LLCA 2PHZA 2BF4A 1GNQA 3T7TA 4C6SA 3VUEA 3IMEA 4C7XA 5B2FA 1JLRA 5AXCA 4CKCB 2C7PA 4ZEVA 1JA9A 1E7QA 4L57A 5AICA 3RS0A 4F3NA 2V8BA 3Q3EA 4RXUA 3WQHA 5ITWA 5KYXA 4NBRA 1DFGA 1WSAA 1XLVA 2BGLA 3HR7A 2FW1A 3JAKB 3OPVA 5EKSA 3AKYA 3NI2A 4QICA 1NN5A 1PYGA 2B4AA 1TT5A 3ZVKA 3L6BA 4OKSA 3TSZA 2NLOA 1Z0AA 1N8KA 1Y1RA 4JH0A 1EP9A 4BCCA 3WOHA 1ZNZA 2A9OA 2FPXA 1L4MA 1BVHA 1K75A 1KMMA 4BHTA 5LBIA 2I1LA 5AK4A 4QA9A 5ER9A 4JL6A 3HJRA 5DGDA 5H16A 1SAYA 5F9MA 4EBBA 1XJ5A 1XYYA 3E70C 1JEYB 3QMMA 1C9EA 3CN7A 4W9NA 2QBYB 3T94A 1GR1A 1JU3A 3WNZA 3MHTA 3L92A 5KNCD 1ZJ6A 3FFTA 2BSXA 3HLKA 4Q3OA 1QHFA 4K81B 2IXTA 1TJ5A 2A14A 3C6BA 3BCSA 5B2EA 2V7XA 3P9SA 2DWCA 4KE9A 5JZOA 1XNHA 1KVSA 3TQHA 1XB2A 4TT3D 3EIEA 3I04A 2XF2A 4XJXA 2A1UB 3M6VA 3QW2A 4YRDA 3D7LA 1Q0RA 4PAQA 1MNAA 3PB3A 1N0IA 1S02A 3F98A 2ZJ5A 2GN4A 4MS3A 4PRZA 1BH6A 5C8YF 2FN3A 2WT9A 4LUCA 1QJ4A 2E4VA 3GPLA 3EDQA 3MGGA 4GP6A 1N2XA 1NC3A 5G53C 4G5QA 4HVLA 2HLPA 2G4LA 5IU6A 1JAHA 4BMDA 2XVXA 2FWIA 3RVNA 1H2FA 1CHDA 1CQIB 3JQFC 3ETEA 4NCHA 2P6MA 2CE7A 4XH9B 3EWAA 4I9FA 3ZGVA 4BIIA 4D9KA 1G16A 3KPYA 5AO9A 3SF8B 2YZGA 2WJPA 3A9TA 3S2IA 1GCIA 5T6BA 2Q3CA 3REGA 2B1QA 2RDMA 4YPOA 1PR9A 4Q9JA 1E6WA 4P4GA 1NVGA 3QVJA 5AESA 1VTKA 1DOHA 1IMJA 4YHHB 4BVHA 3WP1B 5EHGA 1CIVA 4MROA 5I5GA 3HDVA 3OCXA 1RPAA 1VKZA 4AULA 2FZLA 4QU5A 3PNKA 2UYQA 3VVCA 1BW9A 1D04A 2FUCA 2MINA 4AKGA 3BA6A 5FI0B 2F9MA 4WV3A 1BFUA 3R4VA 2YS7A 3B52X 1X42A 5DN9A 4KG7A 3SZMA 1NUTA 2OBLA 1IH8A 1F4VA 1BX0A 1XEWY 3EAGA 4OBXA 1I7NA 1SVLA 1VCMA 2Q5LA 2XTMA 1GVHA 1QGED 5EJ7A 3JQPA 3NTUA 4DWVA 3B9PA 3KKQA 2JI8A 1HMPA 3F6YA 4N4AA 2GCIA 5CA0F 3CN9A 4XIJA 4IW3B 4UVGA 4D9HA 1ZICA 3F5QA 2J5QA 3D3WB 4EF6A 4O8CA 1Y82A 1AOXA 2BJHA 2VP6A 3DBRB 3HB5X 3NWBA 3GLGE 2J0SA 4KFTA 1JT9A 1J2EA 1HX7A 1J7KA 5AKIA 2BCGY 1Z4MA 4KQMA 4JYCA 2NAPA 1PK7A 1T5SA 3QUBA 5LYYA 1MOSA 2Q41A 4KWHA 4D26A 1I8TA 4FZ5A 3M2PA 4MUNA 4REQB 3UMSA 2R8PA 3O4HA 3B82A 1IOZA 3UWDA 4ER5A 4KRFA 4V0LA 1SRQA 3ZE0B 4S1TA 3BHNA 1UZMA 5T8KC 4EZIA 1QRTA 2M6RA 4XCQA 1CNFA 4HS9A 2W43A 2HDHA 3IXMA 3A3YA 4IZ6A 1I6KA 4UEJA 2NVWA 1DXOA 3WKEA 1NY5A 3WHLA 1SCDA 3THOA 3BQMB 2DFPA 2WWXA 2ZYRA 4FINA 3OOYA 3QF7A 3WMRA 4LRSB 1MHPA 4I66A 4LSZA 2BZGA 4EEZA 1L7MA 1Z4LA 2WWGA 2VP5A 3IE2A 2A30A 2QMEA 3NDIA 5J4YA 3C4QA 3DEJA 1DC8A 2MSLA 4Q6WA 2P1DA 3JPYA 4Z3KA 3P2MA 1ZJYA 1A4RA 3ORQA 1P4AA 3OFND 2OYSA 3OEWA 5TY0A 4O0LA 1QKIA 2QA5A 4R8MA 3RC7A 5JVDF 4K9SA 3PXEA 3WGNA 4DV4B 3MCAA 2Y9MB 2ZFUA 1PGJA 4US0R 5JS2A 1VL5A 3O4VA 3DTYA 1PT7A 2P4EA 3ILSA 4KV9A 4WOCA 3SDBA 3ZWKA 4S05A 4DV2B 1NU8A 4NPHA 2X0RA 3AP3A 1Y8QB 3N0RA 4MSUA 4S1OA 3K1YA 3E4DA 5BMOA 3LGAA 2PS0A 3TQSA 1E9EA 4HG2A 3QKRA 2E49A 1SWVA 2XV1A 4FOOA 3WMXA 5LOVF 4KR6A 2Q6LA 1ZGGA 5HIMA 4EMBA 5LPNA 2QHXA 4Z9FA 1AMUA 1MQ8B 3GT0A 3FWYA 1RWQA 5AOVA 3P9YA 2E3JA 2IBMA 5HGXA 2O48X 1BW9B 5I8ZA 4CNBA 3RVRA 3RFXA 4G0QA 1WBDA 3N8IA 4D1YA 2JJ1D 3W3AA 1FZQA 3BS4A 4TOIA 5ESRA 3SYRA 3VH2A 5DCLA 1JHOA 4B4VA 1P1BA 1AC5A 4J7AA 3BRCA 4MUJA 4F2GA 1TJ3A 3WGOA 1K6MA 2GJAA 1CYEA 1QYVA 4CM4A 1H8ED 4CYMA 4EG8A 7MHTA 1RR6A 4ZGBA 2QRPA 1WA5A 3D59A 3WZMA 3PIRA 3Q41A 4LNHA 1R37A 4YJKA 4FDVA 2WQ6A 4JOCA 2OQ2A 1W5FA 3MB8A 4HQFA 4MYDA 1GPKA 1A9ZA 1KAEA 1KP9A 2A5YB 2NW6A 3JQQA 1RJWA 2A9FA 4IH1A 4N1AA 4O2BA 4KAAA 2HLHA 4AF8A 2V5UA 5AOAA 5ALLA 1AKEA 4CN9A 3UK6A 3DVQX 2IY7A 3UAYA 4AY3A 5CDUA 5K0FA 4DV5B 3RAEC 4G67A 1SCNE 4JI2B 1FXWF 3KB2A 2IUTA 3WIVA 2Q1SA 1X1EA 4AP6A 4BVGA 1W47A 2X40A 2X1LA 2GN2A 4O6VA 4PS0A 5ITZB 4DGSA 1CUHA 5FA5A 1X0VA 3DMDA 1R4AA 3AOEC 5CH8A 2WWVD 5H3LA 2C5SA 1XMQB 5JUWA 3WK5A 1GGHA 4YRMA 5C8ZA 1EVKA 1NVUQ 1XMSA 1RKXA 1KMHB 3GYBA 4Q3DA 5AW8A 3ENNA 3VSBA 1M2KA 5BV2P 2A59A 2OK7A 2XH8A 3WRVA 5ESXA 1QIDA 3PCRB 1MB9A 1RAHA 2CFIA 4L5JA 3JATB 2BY4A 3RUFA 1EX6A 1CQXA 4XX0B 5HGJA 3SEAA 5KYGA 4IFIA 2V9PA 4DDHA 1E77A 2FJ0A 4BNIA 3RG8A 4AXXA 4WY2A 1R6XA 5FUYA 1J33A 1E1RD 4BB9A 1GZUA 1FQJA 4LZOA 2YJZA 4ZCIA 6Q21A 2XDQB 1PL0A 1IHDA 3JYOA 4HDKB 5SZIA 1CZKA 2NO6A 1WPXA 1G1AA 1TECE 2CUTA 3QENA 4JLSA 4MUXA 2OCBA 2NSJA 1ADJA 4OQNA 1JH9A 5GIPE 1JUDA 2XAAA 3DDWA 1A27A 3L8FA 5F1KA 4ALNA 4EITA 5B4TA 1VHJA 2OCLA 3ICWA 2H52A 3HYRA 4WBNF 3A7EA 2HSGA 1C50A 4FBMA 5JYBA 3SZUA 1K68A 2XA1A 4HYTA 5HFJA 3V2IA 1TTQB 3WDSA 3OU6A 2MT9A 4BBJA 2VQEB 2YKGA 2G0NA 1FP2A 6YASA 2CDBA 5D51S 1R8SA 2FPIA 3C7KA 5T3YA 3DTNA 1EFPA 4HLUC 1TQ2A 3LL7A 3SDZA 4MRSA 5HA5A 1UKYA 3GHHA 3GWGA 3PT5A 5EZSA 3V6MA 4YMIA 2QRGA 2JCSA 1E2QA 4XEUA 1DZ3A 1QC5A 1LKZA 4P0TA 3BWEA 4MV1A 4J16A 3K2QA 4COKA 5HUHA 2GTPA 1M66A 4MYUA 3JWJA 2Q4TA 3HN7A 4QXAA 5JZSA 2HWXA 5FCDA 5LDGA 1SIUA 4CL8A 1TU0A 1YZHA 3B8EA 5DX1A 4EUEA 5EUMA 3D8SA 4J4TA 2C96A 2DY0A 5KSPA 4DA0A 2Q3BA 4KWEA 3DEAA 3LCMA 3CT6A 3LX4A 4TMVA 4UBJA 3WDLA 4C01A 1JU4A 1V0JA 3RRFA 4I6JA 2W6IA 2F3QA 5H3CA 1YZTA 3C0KA 2EQ5A 3E53A 3O91A 1QCZA 2OGWA 1JHPA 4AO8A 2KE5A 3CZMA 1CULC 3IKJA 5CJ2A 4CCWA 1VSQA 3LF1A 2R00C 3P2IA 5HZHA 2JHAA 1GQ2A 1E8MA 4HLQB 3FYHA 2CJWA 3UICA 1V1JA 4QECA 2DECA 3STXA 3EARA 1KSJA 3FRIA 2YR0A 3JYLA 4HVAA 1R64A 4UDYX 4TRNA 3ZCTA 1K0UA 3QVMA 2YJNA 4Q1VA 3RF7A 6ABPA 4C9BA 1QRSA 3VR4A 2GTHA 3B36A 5JY1A 1PNOA 4DPMA 1E89A 4QOSA 4S0XA 2O54A 1G1MA 2JAOA 4DNXA 1KQFA 3AKZA 2VNHA 2D62A 4ENVA 4X54A 4NICA 4Q6BA 3V7FA 1S7CA 4C4YA 5TQ2A 3KWMA 1YK1A 5EEGA 1KC1A 7YASA 1KSGA 3TQFA 4XVUA 2O8BB 3UC5A 1C7EA 3ZJTA 2WKQA 4XWTA 5SICE 2BM9A 3I8SA 2XGOA 3LF2A 3D6MA 3IR7A 4OMUA 2WM3A 3M6UA 3ZHXA 1KWKA 1AH2A 4XQ9A 2ZIXA 1UKCA 3BSFA 1QIKA 5HJ5A 4MJLA 4MV4A 1I3CA 1ZIXA 4P83A 1X1RA 3GRUA 4JSTA 3INGA 1OZAA 1G7SA 1HFKA 3K30A 5HZKA 3TNYA 3E27A 2VC2B 1NU6A 3O4JA 1J5EB 4KQWA 3KU4A 3PVCA 3ROFA 3WJ7A 4LZWA 4RHFA 13PKA 1DKUA 4CFSA 3SY8A 5EIEA 2GJKA 1YTLA 2GZAA 4QQRA 5FPYA 4XUEA 1XZCA 2J9FB 3ILHA 4KQKA 4W8OA 3IP3A 1DEAA 3QUSA 5FLXA 3DGEC 4TKUB 2WVGA 4R4JA 3U4QB 3NJ8A 1DINA 4XB2A 5IC5A 1MHTA 3HKCA 1CNEA 5JDIA 1QR6A 5L95A 1VI2A 3IPYA 2BGWA 3HKDB 1PIWA 1HDEA 4YWJA 4ZCPA 5HW0A 4B6QA 4DEYA 4Y1RA 3ZJ5A 2LNDA 1IATA 1W4RA 1P81A 1C7IA 1N2ZA 1B26A 3MLAA 4H7EA 2HQ1A 2P5UA 3FKQA 3ZHSA 2DJ5A 1P5JA 1D6MA 1WXGA 3G1UA 1Z4NA 4ZO8A 1K8ZB 1V71A 3WR5A 3RSFA 2XNKA 1WCXA 4FGZA 4OQFA 3TVYA 4AN4A 4C04A 1GUDA 2O7SA 3WQQA 3Q9NA 3ZEIA 4EL0A 4E14A 4DWJA 1NT4A 2ODAA 3FGPA 3QBJA 4I2NA 5CDYA 3UAVA 3BIOA 2VTKA 3FD8A 2A0WA 3C5WP 3IAM1 4IICA 5EHIA 1JG7A 1VSBA 3W5IA 2AZXA 3B53X 2LR0A 3LUDA 3HLTA 1J1IA 2ORYA 3LPDA 4QBFA 4Y2HA 5GP1A 3SSAA 1OU0A 5FOWA 3K0EA 1KJIA 1DBIA 2JCBA 3KKMA 4RKRA 1GO2A 1JTEA 4WJZA 1NOKA 3CYFA 1I4DD 1O95D 1LNZA 4WLFA 2CV0A 1KDPA 3IAS1 4XCVA 3RF6A 1X2EA 2GWHA 1DT3A 5JPCA 2W4QA 1HDIA 4L4XA 1NW4A 5DV9A 5ANRB 5DI3A 1B6SA 4M54A 2BF7A 3L46A 2VCYA 1YDGA 3KXPA 1PQYA 1ZFNA 1MPXA 1YNOA 2ZBUA 3AB7A 1P44A 3PGVA 3PJEA 5E7IA 3AY0A 2VNSA 3WE7A 3CMMA 1GHTA 3GDOA 3W4KA 1KOGA 1LI4A 3AW9A 4O4LB 5DBEX 4DB2A 3TR0A 1AQIA 1MEEA 2AC4A 1KFKB 5FWYB 1G8AA 1CY4A 3MIZA 5B7NA 3RT1A 4IGFA 3GLRA 3HO6A 2WYHA 3QEOA 4G5SA 3RVDA 3JQ6A 3WL8A 4IQGA 3QJ5A 2RBGA 1CX9B 1LPBB 1T9ZA 3E9ZA 3OPYB 4FGLA 1NBAA 4MUIA 4OHPA 4FSDA 4BIMA 3OLCX 4J0KA 2FSSA 2H7VA 4EUSA 1KERA 2O4CA 1G4AE 821PA 2HMWA 3OQIA 1E2EA 4YAKA 3DAGA 2EJVA 2EJUA 2Y6UA 1IQPA 2VDMB 5CYOA 3L8YA 1I3NA 2M6SA 4DAOA 4EPRA 1JQLB 4U7JA 4K28A 2BSAA 4OHMA 2JL1A 2QD2A 4AJOA 2QROA 2EEZA 2YRXA 2N75A 3NUGA 4FS3A 3STUA 2N0SA 3FG9A 3VR3D 4MHOA 1PL8A 4PQFA 2ACEA 1EGVB 2QP3A 4X20A 1A77A 2MJLA 2ZCVA 1U7WA 2OO3A 3LIIA 5IWAB 4Z1OA 1EVQA 1OA0A 4IJMA 2EFEB 5DBOA 4GMGA 3I37X 3OEHD 4HCJA 3WP0A 1FW6A 1JR3D 3MHPA 1QIJA 1YI8A 1D4ZA 2YFYA 4L76A 2Q0XA 2KLHA 2WU8A 3H9EO 3LCRA 2AW3A 4MHSA 4ZVPA 3UK0A 1RCFA 3QE9Y 1ZP6A 4N3NA 2IPNA 5TDHA 4EGJA 3HCDA 2O8DB 2BOVA 3Q12A 4X6YA 5TF4A 3E6AA 3VUFA 3E0QA 4ZDJA 3UUGA 1QAQA 2QSYA 2ZTUA 4I9UA 4RE5A 1PRYA 3GRYA 3INNA 3VC3A 1A5ZA 3M33A 4J4BA 4M8LA 3PA8A 5A71A 4N48A 3LUJA 4NAUA 4RKYA 3KK0A 5FA6A 2C9DA 4QX6A 1YE3A 3HSSA 1G8HA 1U7PA 2GM3A 2WKSA 5BQPA 2EYQA 2XMZA 3D0QA 4OP2A 1KVRA 1MAWA 4XFJA 1HLPA 3T3PB 3MMNA 1M2WA 5CXQA 4OFZA 2NU7A 5GMOA 2P3QA 3B6IA 1P0QA 1W76A 2W0SA 3GFPA 4HDQB 3CSDA 5ALFA 1T9GS 1E5DA 4CG3A 2V3VA 1T2AA 4IVQA 1ZX1A 1W581 3CCBA 2VPQA 4R81A 1I32A 4JP3A 4RK6A 1X7YB 3SHVA 3WLMA 2ONYA 4R69A 2Q3FA 4DLXA 1GA4A 3PA6A 5IK2A 4A8PA 1GL7A 3N07A 4D4MA 1JMVA 2MSNA 2EERA 3U37A 5LQMA 2BMJA 4I1IA 2PH1A 1WCV1 2DY1A 3PDCA 5HWSA 3C41J 4ITRC 1Z2NX 2YW9A 3UJ8A 3X1MA 1Z2PX 4CKEA 2RHBA 4I5IA 1W1WA 2QRVB 5JAHA 2CV1A 1R6UA 1UC8A 2A1UA 3DMPA 3G2MA 4W1SA 1P4JA 2JLAA 3NJ4A 4YRTA 3LTNC 1Q1QA 3G88A 4PN3A 3OBIA 4RZXA 4XCXA 5DCWA 5K1ZA 1GZDA 3I01M 4ZU6X 1F0NA 3HXPA 1QC5B 3EA0A 3SP1A 4J49A 2PQMA 4M9CA 4M8SA 5EJ8A 3GZ4A 3WWYA 5HP4A 3E5HA 1SU6A 1TQ6A 1PJZA 1ISFA 4KFRA 2ZJBA 2CFCA 4RY9A 4TSFA 5D3MA 1XC7A 4BX0A 4MDYA 2FPPB 2PUHA 4FFVA 1ZM2A 4KRXA 3EMVA 2IS4A 1PJ4A 4OK6A 3D0KA 2VSNA 2V6GA 1XZPA 3GLHA 3I4CA 4Z86A 5DYWA 3M6MD 4B6SA 1Z2CA 5IEJA 5AW1A 1REQA 4UZEA 2BI8A 5TR9A 1MJHA 3Q3CA 2ZAYA 4RIIA 4RJTA 4RZIA 4EY3A 1N6OA 1T1GA 2YN0A 4BY9E 1K86A 1LVGA 1PT5A 1VCIA 2QW8A 2VWGA 3EVBA 4Q3LA 2QV7A 4RJ2A 1PFQA 4Q00A 1OFTA 1PAUA 3LDHA 3ISJA 4GM1A 4U2CA 4MULA 1CV2A 3KZMA 3QKSA 1ZUWA 1KFJB 1JKFA 3IAAA 3F2IA 3GT4A 2MR6A 5HFAA 4UBKA 2O59A 2YYZA 3ZU2A 2H2HA 1N2JA 2Q29A 2CDCA 1C9JA 1XA0A 2Y05A 3I6BA 4XM1A 3KOMA 5U4XA 3MBIA 3UAZA 1K27A 1WSWA 2PX4A 4Y6OA 3HDYA 2GA9A 4DMHA 2ZCJA 5JD4A 2P3OA 5KNBA 1DDGA 1TM7E 4YMHA 1UIRA 1KPGA 4NABA 1TO1E 2I65A 4RDXA 3L6DA 5GONB 2R6JA 3HGQA 3KWLA 4Y9UA 3PGJA 5T4HA 3VOBA 1JBKA 2C2ZA 3K6JA 2RB4A 3VV3A 1RAIA 1KU0A 1OBHA 4HGZA 1XV5A 5BMVB 4N7RA 3ST7A 5FBQB 4UAGA 1E5TA 3IDQA 2RHWA 1MV5A 1KEPA 2ZTVA 3R44A 3S1AB 4EGCB 5CDTA 1YXMA 5KDOA 4EJSA 3CNEA 4XUGB 1NG1A 3HVJA 4AYXA 1II9A 4OA8A 1WP4A 3N70A 1P0CA 2CLHB 3CINA 1G59A 1JDPA 3LK6A 3L8ZA 4L6IA 1FYVA 3U7JA 1GL9B 4Q4LA 3IQIX 2J30A 3NHKA 1FNNA 1LPMA 2HK7A 1WPRA 2NZ2A 3TLCA 2O3UA 3WGYA 3ZK8A 1S2GA 4BMPB 1RXEA 3CPHA 5JROA 1RBYA 2EEPA 3L8HA 4MIOA 2OTCA 3O3CA 4KOEC 2XTAA 2Z5GA 1W49A 4OSOA 1BD3A 3IAUA 3N59A 3NGLA 1IB0A 1WMEA 5ICFA 1G2QA 1FDWA 3F4BA 4QU9A 2PUBA 1YCDA 3L1KA 4W99A 2AFIE 1NBOA 4JWTA 5IJ0A 1PFVA 1EVEA 1ORRA 2J3HA 5KAPA 1EM8B 3F49S 4RSHA 3TTSA 3HA2A 3DLIA 1NY6A 3HL0A 3KT0A 3M9WA 3MIIA 3UWKA 3CLKA 2W2LD 3PL5A 4OXIA 3NATA 3RV4A 1UK7A 1Y5MA 1E7RA 2BFBA 1G4UR 1X1DA 2YIJA 1IXRC 1ZOPA 2PLFA 5JNSA 4BWGA 1V47A 4LN1A 5JAPA 1FZTA 1VKRA 2PUDA 3GLHB 3MF4A 4M0DA 1JEOA 1RRCA 1AKTA 4JXJA 3DQZA 4WUVA 4CU5A 1Q91A 1HC7A 1YR7A 4GI5A 2XVZA 2GYYA 3KCNA 1HRDA 2VSYA 3SBDA 1M6VB 1O77A 1XAIA 1M8KA 1E94E 2LIPA 1QWSA 4MB0A 2HXGA 3P20A 2XMRA 4G5GA 4MA0A 4RLHA 1R4NB 3MTBA 3DHNA 4Q19A 3VR5D 3A6FA 3BK2A 1ZINA 4QUJA 4YXWD 4IOLA 5LMCA 2GUWA 4IP0A 3RKUA 2IXBA 4LXHA 2QRJA 2N47A 2EP7A 3CLRD 2RB5A 3DZIA 1SUEA 1JLLA 1K8QA 4CKBB 4RGQA 2CVQA 5HQJA 2D2XA 4Z3DA 3TEMA 3WNQA 4AQDA 3NIBA 2W6ID 2PKXA 4NAHA 2H4HA 1UBGA 3KZNA 5DLDA 1WUIS 4UCFA 3KJQA 4RJJA 4WZBB 3RHTA 4PPFA 3BHJA 3O84A 4XIYA 1K7SN 2VT2A 2C07A 3BCHA 1Q1BA 1SGWA 3BFJA 3BN3A 3PGMA 5AVSA 1X39A 5HE9A 4CV0A 3E61A 1ZH0A 4KIJA 4UUPA 1WV0A 3HP1A 3ENZA 1A96A 2VPTA 4LBYA 2BJWA 2NVOA 4WXHA 2ZUEA 4KSYA 2B8TA 3EEIA 2H7CA 1AHNA 2ZUWA 2F8MA 2EARA 1M83A 3R5KA 3L8MA 5DXJA 3L4EA 5FV7A 2XRYA 4C78A 1HA3A 2GBLC 1Y9AA 2V7PA 2G17A 1CY7A 2O5VA 3C98A 2OA0A 3V4ZA 1BDBA 2XT6A 3C3BA 4ZZIA 5LLDA 4JSYA 4LV5B 4MUYA 5D7NA 3GUVA 3BILA 2QVXX 3PRHA 4IOJA 4C43A 4RACA 4MGIR 1UT6A 3EF3A 1G60A 4L85A 5LQUA 2X6RA 3P2EA 5HCIA 1GPYA 4HXGA 3QFCA 1OVGA 4G1UC 1VBKA 3F9IA 4PFQA 3HRIA 1LFDB 3T41A 4I99A 2P1ZA 2PSSA 3HCRA 3JSXA 4EGQA 2F55A 3DLAA 4XDYA 3P0HA 4HDSB 4D80A 2PGOA 1E3WB 1OXKB 2OG2A 4KNWA 4DUYB 3L0CA 4HXFB 3QZUA 3RVQA 3TUZC 1X92A 4KRYA 3F7OA 5FL7A 3ZXSA 2WG2A 8ABPA 3FBWA 4A8JA 4TWAA 1GSHA 1ZONA 3MJSA 1O96B 3O8QA 1Z29A 3RC3A 1DBRA 2BLLA 1OLSB 4IYRA 5DGIA 2PS1A 5IJZA 2VRCA 5M29A 2O2SA 2WIBA 3N05A 2MYUA 3GH3A 4HFJA 4LZPA 3Q2IA 4N12A 1AZTA 3IR6A 4L78A 4CDMA 1HGXA 3Q0TA 1FFYA 3A58B 1O57A 4GS5A 3VH4A 4Z3OA 5J5VA 1VCHA 1X7WB 4YFYA 3KP1A 1UK9A 1QHEA 3HHEA 3VYUB 1TPYA 4JYMA 1SC3A 1V9LA 3AJRA 4FPXA 4BEBA 4HX5A 1XROA 3D1LA 4MKGA 4RHCA 2IZOA 2DFKB 1J0DA 2ZRAA 3C43A 1YKGA 2C92A 3DUWA 4WN3A 2YNMC 2ZBEA 4QFMA 5L3QA 4IIJB 2LKCA 5AKYA 4NH0A 4K2HA 5ALWA 3G89A 3FUVA 5LQCA 4RENA 3KSBC 2E21A 5HKLA 2J3QA 4GPAA 5KWSA 3H13A 4D8YA 1EWRA 1MIHA 2B99A 2I7XA 1YRHA 2YV5A 3FB4A 2E1PA 2H06A 1LWOA 2BHSA 2NYAA 2O2IA 3QOFA 4OXXA 2GF0A 5C35A 3LLMA 4P80A 1SOUA 1CJUC 2CEKA 4LCJA 2IPXA 2WU3A 3DFKA 1QDUA 2X8AA 5EEHA 4IIFA 2X2EA 3QPUA 2QVBA 1ESMA 4E33A 1MORA 1C1DB 3HU5A 3UMBA 1GRQA 2CL0X 4FYIA 3AEYA 3UQYS 2PSJA 2EVWX 4E51A 1A4UA 4JLWA 2ZSDA 1WV1A 3VYSB 2GA8A 4UQLA 1ZGJA 2K5UA 2Z2XA 2P62A 3F6SA 4I2VA 2G9QA 1U7XA 4KJXA 3NYIA 4RMHA 8MHTA 1H94A 2ERCA 3TZEA 3AEKA 1JLLB 1UODA 2J6BA 4BV3A 1NBHA 1G3QA 3B60A 2NV2B 4BUCA 1E3DA 1S6YA 2OXRA 3L6EA 1E3JA 4N9QA 4Q4JA 4QOHA 2QAGC 3E22A 3D4LA 3VMMA 3PYMA 4H7FA 1Y1KE 1WG8A 1WM1A 2ODNA 5HEKA 3T9CA 4N0QA 3ICQB 1LK7A 2OV3A 4JY7A 2BFWA 1U2PA 3UH1A 2VTDA 3U62A 1DAEA 1EXNA 3QTBA 1NULA 5AKGA 1QG6A 3ENWA 3C3AA 3UK2A 3ZDXB 1DDOA 1S7GA 2FEMA 1EVIA 3SN6A 4NU6A 5IHXA 1Q0LA 4MS4A 1NFQA 2JEYA 2IYLD 3L6RA 4WLNA 3TLYA 1ULAA 2IUUA 1IC6A 1MFPA 2YHSA 3TTVA 2ZBPA 4EATA 1P73A 3LY7A 4R2IA 5K3CA 3OEEA 3PUZA 2AOWA 4PQGA 2JFYA 2IYAA 1AHHA 1GLGA 2OK8A 4JBWA 2X8LA 4BFXA 4KJZA 1Z73A 1XSEA 1CUGA 2VJDA 1UR5A 2HSWA 3GCWA 1QDLB 1AKNA 2BP7B 4JYPA 1R5BA 1O7JA 3U7QB 1MP0A 2OZLA 1L7QA 2PMEA 2GILA 3TQQA 3L5KA 4GMXA 4JFAA 2C7VA 4UBLA 2P7IA 4ZRNA 1CIPA 2AN4A 3OEHA 4MO9A 3RVLA 4DLZA 5A4KA 3K5PA 2HW8A 2OCIA 1NQAO 1W44A 1C0KA 4ZYLA 4HI0E 3V1LA 1L4BA 2ANCA 2I80A 3EXIA 2NUBA 4ZJPA 5J4HA 1E2FA 3PHHA 3AEUA 3IUNA 2DBYA 1N7GA 5ELMA 3VHLB 3L4BC 2ADMA 3M49A 3QSGA 4Z54A 3D0RA 4W9NC 1UDCA 2ZBRA 4UBMA 1JXOA 3RREA 1ADCA 1BU5A 1A1SA 1QH0A 2W2PA 3KYIB 4HDAA 4O4IB 4MKHA 2ATVA 5EKXA 1UEXC 2RSLA 2OHOA 5I9MA 1L7DA 1DRKA 3B1YA 2BRUC 3R24A 1SD5A 3WMWA 4GZ6A 5CVJA 3U9SA 5DI9A 4KSCA 1NJ5A 3WGLA 3NHAA 3KR9A 2VCHA 2IOYA 2Z1MA 3NASA 3OT1B 3ND9A 3OTGA 1IB6A 1SO8A 1UM9B 1YHYA 4BB0A 1AGYA 2B7CA 1SQ5A 3DO6A 2C2XA 2AXPA 3ZBPA 4CV3A 1QTQA 2RIPA 3U40A 1AB6A 3DR3A 3KDAA 3MTDA 3CBGA 4TLAA 1KETA 4XPIA 3SIPA 1QF6A 2VF5X 2ZIAA 2Z83A 1ZI8A 4URHA 4MI1A 5EA2A 4HB4A 3W2EA 2IHKA 2PUFA 3WWOA 3O95A 1R1DA 2X76A 1U28A 2CHFA 4KR0A 5JMTA 3TNDA 3GFQA 2X1HA 4BCDA 3WIBA 1L8QA 1EBBA 1PR2A 2WIGA 3TEFA 3RS8A 3V9PA 4D0GA 4EI9A 5KSYA 5LU8A 4BU0A 1S5PA 3E7PA 3OJCA 2O4UX 2VHVA 1ZCZA 3FRJA 1VB5A 5JV5A 2A78A 1MJNA 1KI3A 2ZB2A 1IJBA 5AJHA 2O6LA 2L18A 3D8NA 3O9ZA 2V7QA 3OZDA 3QG5A 2WYIA 2EAUA 2OUKA 1KJZA 1KY4A 4FMBB 1CZLA 2FFHA 3CGWA 3OY7A 3CFYA 3DBLA 3I2HA 4LCEA 4NYJQ 4DNQA 1Q7EA 1VJCA 3BKWA 4G4SO 1EA7A 1KH1A 1DUVG 4OI1A 1DV2A 1FBTA 4QQFA 4PLFA 3U61B 5CNIA 4PICA 1HUQA 2R86A 2YH2A 2HCBA 4N0MA 1LDMA 5B3AA 2WJ3A 3BD9A 3FWNA 4GPIB 4KVFA 4Q34A 4Y6SA 1HT3A 2ZQYA 4B5KA 4HVCA 1GZSA 3L9WA 4LC1A 4PWZA 2PNJA 4F5EA 1K92A 4ZU3A 2NV6A 4ND1A 3E1GA 2P9YA 1KZ4A 4MCJA 5EPOA 4MVWA 5JECA 2VSFA 4FNMA 4FFDA 3IIJA 4GYWA 4OB8A 3E3AA 4RX1A 2ZREA 2YY7A 4L74A 2GAIA 2GWRA 1Y7LA 3A1CA 4MV5A 3TDNA 2YQ4A 3NM4A 1EE2A 2VPPA 2YIMA 2YWJA 3MM4A 2RCYA 4AKHA 4EJ0A 2Z04A 1QFZA 1YHNA 3DNFA 4H4EA 1E6EA 2WIKA 4D74A 3FYUC 5MHTA 1V35A 2UVQA 4N8EA 2VF4X 5DHRA 3EC1A 1JEEA 4US2R 5JANA 1OA1A 4LECA 1IBMB 1PZHA 2ORWA 1BO6A 2D2EA 2F1JA 3Q7RA 2OR3A 1C9YA 3DS8A 1UOQA 4OYYA 4Y18A 2PGXA 4LVNA 1RYNA 1ZHOA 2HF9A 5HIKA 4QNRA 5IN5A 1H69A 3QV1A 4PHFA 5CFRA 3FI0A 1G2IA 4XOUA 1IL0A 4ENPA 4FOPA 1JDBB 4WVFA 2H2WA 4QEKA 5CW1A 2NZYA 4N6OA 2EZ4A 1FXWA 1AQUA 1IAVA 4H6VA 1OBVA 4OHCA 5IAOA 4RD3A 1RJ9B 5KQPA 2HPAA 4CIAA 1DCTA 5I9NA 4GDFA 1N6LA 1XHFA 3Q7QA 5EIOA 1PGOA 4U63A 3USZA 3JQAB 1HE3A 2FLWA 2L17A 2ZI3A 2RH5A 1W1UA 1OXVA 1C4KA 2O2XA 2HA2A 3E0XA 3G1WA 3GJ5A 4BNYA 3QKUA 4JUIA 4G63A 5CW2A 4GZ5A 5MDHA 3IQGX 3PC7A 4KGVA 2AN9A 5IAKA 1ST3A 3AM1A 2ZUVA 4Z9BA 1JS1X 2XYRA 3U3KA 3ACDA 2VJBA 4NBVA 1KI1A 1HLDA 3E9RA 1PJAA 4MQBA 2HCTA 4GZ3A 1XDBA 4BEJA 2LV8A 3WLTA 2VBIA 4NNPA 4EB8A 4HRVA 2WLTA 3F6EX 5JQGA 3HWRA 1LC3A 3KYCB 3HJGA 1UADA 1W36C 2MYPA 4LXGA 4MVJM 2SBTA 1BZYA 2DYKA 1JDNA 2ORED 5A1JA 1NN1A 1R0BA 4DMLA 3ZWWA 4JLPA 5F33A 2ZYVX 3S5JA 4TX1A 4F3CA 1FP4A 1O97D 2CBZA 3NALA 3X1YA 3I2YX 3RJTA 2JFWA 1CEYA 3FUCA 2FQWA 2QMYA 2UVPB 1ZMOA 3SIRA 4F4JA 2CXOA 4YYEA 1QGUA 3EIOA 2ETXA 1E7MA 3QIAA 4YBRA 4ZOLB 4YRJA 2VDPB 1GNRA 1KZ1A 2QMOA 1M1ZA 3F97A 4P4UA 5A9TA 3ZY2A 4ZV4A 4B5LA 3FGZA 4ZZ2A 3IAEA 2ZIZA 2PBFA 4JAVC 3SIXA 2AE1A 1O89A 3TSYA 3H99A 4HMPA 3OE1A 2QB5A 3IODA 2Y77A 4NZ9A 1NNSA 5EFOA 3UB2A 4D4LA 1X7DA 4IQ0A 2Q9AA 1DBSA 2HXSA 3OEYA 5KYYA 3D7MA 2XCUA 3H8SA 1AG9A 2AOVA 2IIVA 2QRHA 2LPMA 4ZVVA 2XRZA 3GFVA 3EVGA 4BZPA 2O8BA 4MW9A 2IZ1A 2HO5A 2Y2UA 4PX3A 1EBUA 1EJ0A 4XSGA 3R7WB 1AIPA 1NF9A 2N3ZA 1OLSA 1Z38A 2RAVA 4D9GA 3WGIA 2XNDA 1SEVA 2VDKB 4QG3A 1E2KA 1MIOA 2COEA 3AVYA 3II6X 4M0LA 1C1HA 3G6WA 3IOEA 4Q4AB 4UAJA 3E4CA 4BS9A 3OLVA 1E4OA 2HPVA 1A5BB 3EVDA 4CKYA 1BE6A 2ZYDA 3ZYCA 1ZMXA 2IPMA 4UMEA 1OVMA 3W5DA 4JKOA 3G9QA 1N5MA 1YBAA 1RRKA 3UT6A 4ZT2A 1IK6A 5BPHA 1M8GA 2MYTA 3DW1X 3ZXYA 1MO5A 1R8JA 4J3JA 4X64B 2IPOA 2W2QA 5LA6A 3GJXC 4BP1A 5MN4A 3ELUA 3SC6A 5JO0A 2XE8A 5CK5A 5FQOA 3GJTA 1BROA 2O0KA 1RXYA 4ZODA 1TW2A 1LW6E 3D6UA 1JX6A 3EPPA 4CIXA 4EY8A 5FUWA 3G0CA 4H7HA 5JD3A 2Z6AA 2W93A 2X22A 3P0IA 3RADC 1M1NB 1SOAA 1VL6A 4K6FA 2IHNA 3PE4A 4FZJA 4E6EA 1SHJA 1DJMA 2BDEA 4WLUA 1EJBA 4MGKR 2BFEB 4IX9A 3ESQA 1RIIA 3TFOA 1V45E 1IHXA 4CR6A 2HLDA 1T13A 1TM2A 2YJ6A 1BS2A 1HFEL 1DMRA 1KK2A 1RSZA 3BH6A 4G1FA 4PSDA 1OFUA 1K06A 3M4JA 2F62A 1HZJA 1QU2A 1IEQA 3D3JA 4W6QA 2O20A 1T10A 2WAOA 2VYND 4DEVA 1C7JA 1ORTA 1QGYA 5EZQA 4YJFA 4BNWA 5KSOA 2RGCA 3NAMA 1JNYA 4LJ7A 3TBKA 4B33A 4LBZA 4PVCA 1COWD 2DGDA 2HCRA 2Z2KA 4HAXA 1FVHA 1KVQA 2ZJOA 2VHWA 3A1VA 1G9SA 3KZXA 5CHYA 1QZ3A 2WZCA 3ED1A 4LSMA 1KMQA 5AHRA 4KC0A 2WF5A 4Q9LA 1DC5A 1TGVA 1TU3A 1I3OA 2AHOA 4HWKA 1L5LA 1XZDA 1B1CA 1SMKA 1RBZA 1Z83A 4RS3A 1AUOA 1CQJA 1N6IA 1H1LB 2D2VA 2OFWA 3MRSA 1CJMA 1RJFA 5EJ6A 3UYLA 3ZKWA 1JB1A 2MSKA 1CUEA 4CMIB 4I81A 5DNDA 5K51A 5LVAA 2XVYA 1FMTA 4UJ3A 1W8DA 3N2IA 3V4FA 3A4YA 2DM6A 4E21A 2HC9A 4F91B 4UZFA 1US8A 1UKZA 5BNFA 5GV7A 3WX0A 1QAOA 4ARAA 2PKYX 1GARA 4MWEA 4C20A 4FBGA 2XE6A 5F3WB 1NBMD 1W93A 2AFRA 3SGLA 2EKBA 1MX5A 1BFKA 1N9GA 2ZETA 4P93A 4F04A 1H2ZA 4LY3A 4X7RA 3KTOA 1VKJA 2ZIUB 1ZD1A 3AFNA 2R4QA 3K4HA 4Z0HO 5LR6A 3UFXB 2YHIB 3Q3VA 3R5TA 1WHSA 3FWKA 3OCZA 1A95A 4H1UA 4D9CA 1KI2A 1GAEO 3JSAA 2AG0A 2QD1A 4OGWA 1OZGA 3KZKA 1M67A 4BO9A 3AW8A 1BU8A 4MWTA 1DBWA 1U3VA 3O3NB 2HRBA 4Q12A 4PVDA 4JB8A 5A7FA 3FWHA 1DS6A 2Q9UA 1IDOA 3B7WA 1ZXLA 4BX8A 4P4SB 4ALLA 2DSTA 3IHKA 3TDMA 5IASA 3MSXA 1C9NA 1TFUA 2WJGA 2B7BA 4RFSB 1H2BA 4U2EA 3UWPA 4F4DA 2FZGA 3P9PA 4QFDA 3DDCA 3P4UA 3CEJA 1ZN8A 1WULS 1XZAA 3Q5EA 5A0VA 2W37A 1JXQA 4FQ8A 5DBIA 3IILA 5JCXA 4UTNA 2QRKA 1O6FA 1XAJA 4EJ2A 3AWIA 5AUOB 1XN1A 5H8WA 3MGAA 4UTVA 1LBHA 4MA4A 4Y9RA 1YOVB 5DPMA 4ZAYA 3W5VA 2WBLC 2IYVA 3KVRA 5A9RA 3UBMA 1QBKC 2XUHA 1TPZA 2Q28A 2AW5A 2XUDA 3O9VA 4Q18A 2NTVA 2C2OA 2IHUA 2PEYA 2V6IA 3CLUD 4IGAA 2FGKA 1K2VN 1PK9A 1Q15A 2CL7X 3TRHA 4ESVA 1SKMA 3OE7D 2BFCB 5SZKB 2QZPA 2NOAA 3IGFA 3EPLA 2SKCA 3AK4A 4Z1MA 2PUCA 4QASA 3PS9A 1M6NA 2R1ZA 1W8IA 4R2HA 4K9DA 3BG5A 4IDEA 4PR0A 2FW9A 4TRRA 2Q62A 4LX0A 2BM0A 2ZSKA 1OFVA 2PEZA 3GJYA 3IPRA 1XQWA 4G1EB 4EH1A 2AXNA 3TZHA 5I9LA 4WECA 2YIVX 2A5DA 5TNXA 3GPCA 1F0KA 5JDCA 2QL9A 1UFQA 3E2MA 4Q3NA 1IN7A 4QYMA 1RI1A 3CF6R 5KYXB 2BZSA 3OJFA 1T15A 2AZMA 2XOXA 3PZBA 1E1DA 2X2FA 1L4KA 3AU8A 4V2IA 2IWHA 2UYGA 5AFSA 3ROKA 2PL9A 2DT5A 4HUQB 5JJ5A 3A6LA 1WHTA 4R9VA 2B6HA 5C3UA 1HURA 1T3HA 3ZS9A 3IEPA 2IEDA 1EHCA 1NXPA 3GXBA 2NX2A 2PZAA 3NJRA 4Q93A 3DVLA 2PSFA 1RKUA 3VO2A 4KBGA 1A9OA 4IM7A 5KNCH 1ZJWA 1EESA 1HOTA 1U0FA 4V0RA 1YMQA 3OLQA 1OTHA 2X0JA 4X1YA 3EQ2A 5AW9A 5LNK6 4UEKA 1D7OA 3CUSA 3M8KA 3E22B 2E55A 4Q4JB 2F3RA 2WHRA 1P31A 5CUQA 4Y2RA 2VUSA 3I5AA 1JWLA 4E0BA 1MAAA 1U11A 5I4BA 3CVYA 2PVPA 1JLSA 2AMVA 4BJ1A 1FTYA 1KO8A 3WLJA 4DLTA 3R5HA 5IYZB 2H9YA 3TLEA 1AZSC 4Q37A 1NIPA 1MPTA 4GMDA 2Y0DA 4A0HA 5A4JA 2CC2A 4CN8A 2HADA 4PF1A 4EVIA 5CBPA 1D2CA 1F4PA 4IHKA 1DNPA 2I3ZA 3HJAA 5J2TF 3R20A 2IZZA 1TJNA 1CUBA 2E9SA 2PL1A 1GZVA 2UUCB 2IS2A 1E3MA 5KO2A 4EARA 3PE3A 3DXYA 1Q12A 2BL4A 3CF4G 1GFSA 4FN4A 4M53A 1Q21A 1U0HC 1M2GA 3CW8X 3VYVA 3EWSA 1FFSA 4ZV9A 4YAIA 2B36A 1ZH6A 1XCMA 4FCCA 4MCAA 1Q7TA 4NAVA 3WLSA 4MUBA 1NAIA 4Z9YA 4ZT3A 3AOEA 2H08A 3R7SA 2PUAA 3HS3A 1VIVA 2FRXA 5J1SB 4LE2A 5AM5A 2OCPA 2YDYA 3TZCA 1RQ2A 1DPFA 2VUTA 1FTGA 2PX2A 4LJAA 5CB4A 1XRJA 2E89A 3BB4A 1SEPA 2EU8A 3H1PA 2ZI4A 4DSNA 5L45A 1E3EA 1MT3A 2ZYAA 2DQKA 4DT1B 3H5NA 5BW5A 3U19A 5IXSA 3NO4A 3F3MA 1XR3A 1QFSA 1OKKD 2HTFA 1HT2E 3DTVD 1W0JD 3TLGA 2O3RA 3ETGA 3ZTWA 1FFHA 2AG1A 4OXKA 2GGSA 1SK9A 2HY7A 1JP7A 1E20A 2A67A 2HK6A 3VO8A 5FI5A 1YJBA 2B5WA 2I4TA 1RFGE 1TT7A 4W1RA 1FMLA 2WG0A 3BE4A 3WJ1A 4CQLB 1QP4A 4A2PA 4EFKA 3ZX4A 1HE8B 2G63A 3KELA 4C14A 2AYYA 2P4SA 3SS7X 1T2NA 4L5AA 2HEIA 4OQYA 1EEHA 1GLNA 1DAMA 3H6HA 3L04A 4KPFC 2I8CA 1ZI6A 2PA3A 3W8DA 4YJGB 2V54A 1M0TA 3DEKA 2VCEA 3IP8A 4J2TA 4X97A 1ZL2A 4TTJA 4QDOA 2HL6A 3WRYA 1XALA 2XD4A 2VYCA 3RI3A 2ANBA 3ORHA 2VN8A 3ZHYA 3KOUA 2B98A 2JB9A 3K96A 5ALSA 5BSMA 8AT1A 4F2WA 5FBHA 1GTMA 2ZIFA 1KYXA 3DM9B 2O1XA 3AHJA 3WSTA 1XTRA 3L8DA 1MH9A 1AQNA 2RARA 2Q7DA 1GZ6A 4N7MA 3W9UA 5E7MA 1I3MA 4S2UA 3UMGA 3PPXA 4B9AA 1QNLA 1N0VC 4FZRA 5JFOA 3EDMA 1RWPA 5BWLA 4NOKA 3RTCA 3EZ2A 3N2KA 2GB4A 4OHKA 2ZUDA 3VHXA 3TE6A 3JRNA 3PYXA 3CO0S 5EXDA 3W5CA 1JIUA 1ACLA 3OFSA 5TQ0A 2BH2A 3GDWA 3NC1C 2D1TA 1CLUA 1R0WA 3FHLA 4CUZA 2Y1WA 3UHJA 4G5XA 2DJIA 1TK9A 1USVA 1T6XA 2J45A 2WA2A 3QFTA 4C3ZA 3VR4D 5JS8A 2H18A 1PBNA 2JFFA 3DZHA 3ABOB 4NOJA 2L2QA 1U3TA 1VA5A 2EW1A 2JGAA 2QN7A 1NBIA 3DOUA 4Q7JB 2W8BB 3NP7A 4CKBA 2Q0HA 4GVPA 4PW0A 2IH4A 2BGJA 5KDLA 1V41E 4GM0A 4CPDA 5IJ9B 1XNRB 1RP1A 1BIFA 5F78A 4D4GA 3VI4B 2Y0BA 2H17A 4US1R 4BFZA 1GEGA 3D3WA 4ZEWA 2AOUB 2FJPA 3GFTA 2BEUA 4PIMA 1GJRA 2DHRA 4KQIA 1PUIA 1OWNA 2P4QA 2YWFA 3QJGA 1FSGA 3U31A 5DF1A 2K7FA 1LQ2A 3ESYA 3WMFA 1H9AA 2GBGA 1L7NA 1LPPA 3IHWA 3LKZA 3TYXA 4B7ZA 5AK0A 3LD9A 3I83A 1NJSA 4G65A 1A7AA 2V0GA 1FYFA 1NXSA 1F1JA 7ADHA 3F8WA 3LC1O 1V11A 3OKFA 5H3HA 2GO1A 2OZPA 4JCCA 4ZAXA 4LXTA 1TLLA 3A05A 3G2LA 3BRSA 4BKRA 1TZCA 2JA1A 4U5QA 5DM2A 2XKAA 2OHFA 3DLBA 2QLJA 1U81A 2QD4A 4X60A 3QXGA 2W2KB 2FOIA 1WVMA 4WHMA 4ZOQI 3T4EA 1C4WA 4EFNA 4Z6KA 4Z8XA 3NP9A 3MXOA 3SJCA 1ZRNA 4P4NA 1SJ9A 2QZZA 3I8XA 3FNFA 4N0PA 4BUZA 4CFYA 2R7KA 3OP1A 4YDQA 4BNHA 4HAWA 5AVJA 5IJWA 1Z3CA 2JJMA 1U80A 2Q3JA 3IOCA 5KOHA 4Q9AA 3U1BA 2J7KA 2J09A 3W1EA 3EFEA 4D02A 1XCLA 5JHGB 3IMCA 421PA 1I7LA 4MKZA 2GF2A 1FTWA 3JR3A 4NYMQ 1ACMA 2X8BA 5NLLA 2OPHA 1VLJA 2P11A 2KWIA 3FZEA 4O3FA 4NP6A 4OYLA 5F3RA 1H5QA 4IXMA 4M1MA 5I7EA 2C04A 1AN0A 3AF6A 2R6HA 3CNLA 4MPDA 1QLWA 1FP1D 1NV9A 4GEKA 1JSXA 1JEQA 3I9JA 3HJFA 4ZCRA 3U39A 1JQ3A 2OYRA 2CFRA 3IDAA 2C3MA 2ZUSA 2PRSA 4HS4A 1KI7A 4LQ4A 1MRZA 4IIXA 4YMVA 1L4HA 3DP7A 5FULA 3E81A 3OPQA 3BMOB 1USGA 5CLJA 5K3FA 1U3GA 5TXGA 1T5OA 1DT5A 4RFVA 4KXUA 1T0UA 3L7DA 1Z2DA 4L95C 2WD9A 1DOZA 4B31A 5KTOA 2A94A 3JWEA 4H0CA 3QUAA 3GT7A 4WCDA 3NYQA 4JV5B 4MA5A 4X6XA 1G41A 5GZ3A 4KXLA 4YRKA 1ZW1A 5BR4A 2HT1A 1IOWA 3Q5GA 3LP6A 2CXQA 2OWDA 2HJGA 2EG5A 5D2CA 2G9RA 2QQEA 5KWVA 1WZEA 3B9QA 3L6UA 3OSZA 4LNUA 4KREA 2FG6C 2C29D 2VXOA 4NS1A 1LK0A 3EXAA 2WTMA 3EJWA 3SHTA 3P5SA 4YRBA 1T1SA 4I9HA 5AVVA 1PWEA 1Z5OA 3EUWA 3N7UA 2Y1KA 3FR7A 1XRNA 1C5KA 5F23A 3AJEA 1MMFB 2IXDA 3VAZA 2PT7A 1KVTA 2CNOA 2EKQA 3LWNA 3NT4A 1R2QA 4O0MA 2GNAA 5DN6A 3CWCA 3T7AA 3NHUA 5I6DA 4UTPA 5B58T 3AYXB 2VPZA 3Q4GA 1L7BA 3FAZA 1QO0D 4EY7A 3UJ7A 3WK9A 2J33A 1J07A 4OLAA 1HORA 1JU9A 3TZKA 1H8HD 2ZQZA 2P9GA 4A0RA 4EDHA 1W0JA 2QZ9A 1L4NA 1R0LA 4TWJA 4DCUA 3DOOA 3AT1A 4FGUA 1P5FA 3C1AA 1FU7A 4OY3A 2H2DA 5F76A 4E1AA 1UL1X 3I72A 2J46A 1NXTA 3PGLA 4J9VA 5L51A 2GCGA 1PDWA 2V0CA 4LDQA 1FS5A 1XT6A 3KDSE 1MO2A 1QYCA 3AQ4A 3RVKA 4C7JA 3QW4B 2WB4A 4JC8A 2PRJA 4Y0AA 3MWEB 1TMKA 5J59A 2R1VB 4M0UA 1GAQA 2QRLA 4RYDA 3VZDA 3BK7A 1ISSA 4IUYA 1RHRA 2Q6VA 3FTQA 5BSKA 1XDSA 1YIDA 3G6KA 1LDGA 3LRPA 3QUCA 1PGNA 2CMFA 1ENOA 2Z2JA 3KKKA 1P5RA 2PSEA 3B9BA 4GF5A 1KHTA 2XMGA 5BT9A 3WGMA 1TRHA 3DKKA 3DXXA 1PN3A 1Z7YA 3UT0A 4DR2B 1T9DA 4AMGA 1QOPB 1JKIA 5E9JA 2TMDA 5B12A 4R7TA 3ED5A 1H4QA 3EFBA 4CM8B 1OLUA 4LHSA 3ZCQA 5H81A 1OXBB 4DQKA 1YDHA 5ALNA 3RJ5A 5HR5A 1QE0A 4MRPA 5GQSA 3T3GA 1NJ8A 2ASVA 3CW2A 3GVCA 4QXPA 1MTOA 1IBSA 3LU1A 4Z4GA 2D6FA 2X4DA 2NSLA 4FDAA 3ADBA 5GINE 3P71T 2AN5A 4QARA 3RU2A 3CRMA 4LK2A 4FDTA 2NQ2C 4D81A 3ISVA 3TSCA 3JQ8A 5ISMA 4TTSA 4DR3B 2PVSA 1T0IA 3AH8A 3SYLA 4MPTA 1F5SA 4QPPA 4Y3UA 2DPXA 4V1CA 1FP6A 4NZOA 2HA5A 2XRFA 4ZAFA 5B1EA 1QAMA 2YZNA 3QLEA 4BMNA 4KLNA 2CUZA 2JCXA 1ZU4A 2PUVA 2YMQA 4MP3A 4XUCA 3ZKWB 4EI8A 1AU9A 3IJ5A 3AKEA 4B8ZA 3VAYA 1IQ0A 4HGPA 4ZTZB 1ISPA 2FW6A 2HA7A 4WASA 3PX3A 1LNSA 1EWKA 4FMDB 1MENA 2GYUA 1P61B 1RD4A 4R6WA 4UHDA 1TVKB 2C4TA 4WZAE 3X3HA 3WV5A 1OX4B 4N49A 1EDZA 1TCAA 2TS1A 2VTVA 4ZGGA 1A2QA 5JAQA 3VZPA 4DA4A 1ODJA 1S2NA 3CZRA 3GVXA 2XT9A 3RS2A 3AP2A 2H31A 4TWIA 1CIJA 4PYNA 4RTMA 1YKFA 1O94A 2NTEA 4NX2A 2GEBA 4YTEA 5KI6A 3FUUA 4CE6A 3SBOA 2B34A 3I64A 4KLAA 4PO9A 1G6OA 5FBRB 1VDZA 1JFRA 2VYVD 2WT4A 5C31A 4F5YA 2PCLA 1O3YA 3OQIB 4WE3A 5J2UA 1C30A 3FFAA 3ZDCA 3ZNOA 2RG1A 1M6YA 1YVRA 1Z68A 1E66A 5EWJB 3U6KA 4KV7A 5CITA 2YNMD 3KG2A 2O07A 2JFBA 4GMKA 4R1LA 2XBUA 2O5RA 2PZEA 2IXFA 3O1LA 3M82A 4L28A 3CH6A 5KWJA 5F2KA 5AMXA 4G36A 1JXAA 4GPZA 2BFEA 4JEMA 1N2GA 5FRDA 3SFZA 2XZLA 4HH0A 2QF7A 2X5KO 4MMZB 4FUTA 4FX5A 4LYFA 2PUJA 5AYVA 4PRYA 521PA 2J9XB 4X41A 4C29A 1NUUA 2G28A 1T9CA 1XZLA 3S2ZA 3O1HB 3VISA 2KX7A 2F3TA 1XU4A 1BS9A 4KXYA 5A5DA 4BO4A 4CHGA 2ATIA 5D5QA 3SFTA 1PD0A 3DO8A 3IPAA 2Y1EA 4WI1A 5DWQA 5DNVA 1TTTA 1ND5A 3N2EA 1J0XO 2Q1XA 3JD1A 5KJ1A 1H4TA 3I6MA 1A7UA 3E3LA 3WLPA 3KJZA 2GPJA 2QYTA 3GZNA 1ZK0A 4KPUB 6ADHA 1HEYA 4X85A 4YUYA 2C4VA 2PV0A 3PHGA 3SR0A 1QUFA 2PGNA 3B78A 5DXAA 2HDNB 5IM4F 2O1WA 2FSUA 1D4FA 1R7RA 3HCFA 4INAA 4L5IA 4PNHA 3IV9A 3EY9A 1XIVA 2H1IA 2CF6A 2OCGA 2H5EA 3RABA 3P94A 3IB3A 4K9QA 4AJIA 1QG4A 1QHXA 3WO1A 1ETUA 1FQWA 1WQ3A 1RKBA 5JI2E 3O47A 4M7OA 1FJXA 4RABA 4CBVA 3SM3A 2MIIA 2CXPA 3C4JA 4NC9A 2ZM6B 3TZQA 3GQVA 1KDTA 5KYYB 5DHPA 2O0MA 4UPDA 4AZ0B 5FTMA 5K8VA 1NUHA 4DA7A 3QVXA 4MQEB 2YN4A 3KWFA 3GO4A 4WXMA 5G1PA 1BHO1 1DIBA 1T0BA 1IFXA 1PI3A 2Q5EA 4KE6A 3UTDA 3KCQA 1JHXA 3KHUA 1YDFA 4TWBA 2FPUA 1ESCA 2ODWA 2I4RA 4W1QA 1GQRA 2VDLB 3H2YA 3SZLA 1O95C 3W5JA 5AVZA 3SXUA 3DC7A 1IVYA 1I2ZA 4MPRA 3NWOA 2O14A 4M9QA 5AQEA 4A0GA 4BLWA 4YUAA 3CG0A 3BD7A 4LC9A 4WOPA 4EYOA 4LHXA 3U0VA 3K0SA 1Y8ZA 5BT8A 1JYSA 1YCHA 1K9VF 1NI5A 2AVDA 3PQ6A 4DZTA 1YJQA 2E82A 4CI9A 2XYPA 4HJXA 2BEKA 4DYHA 4NRDA 3WQRA 3HBJA 5HNKA 2GFHA 3VU8A 3ZCPA 4EZBA 4HSGA 3IOMA 5EP1A 4RA9A 3VU0A 5JEDA 1M0WA 3IL2A 3PQFA 3ZE1B 4BFYA 1GSAA 1MXFA 1N2EA 3AVTA 3LL4A 3IDZA 3QBEA 1CS0B 3JARB 4ZO4A 5SYNA 3MPOA 4PYKA 1QNFA 4FR0A 4PYJA 4NCAA 3JQ8B 1P29A 4UAVA 4Q0MA 4W5OA 2CLSA 1IOLA 2HN9A 3I45A 1JJAA 2B69A 3VJMA 4RIHA 2PGDA 4IZOA 5BN1A 5EL0A 4OXNA 3M1IA 2JGNA 3FOEC 3ZLVA 1DQSA 3QKRB 2JIPA 5GWXA 2WF9A 1P45A 3B3FA 1FU8A 4DCJA 2YZ2A 2GS9A 3RRMA 5SZJA 2SHKA 1E9RA 3TSOA 1G4HA 3I61A 3LT4A 2ZVDA 4EG6A 1C9DB 1EJ6A 2FPOA 3RJMA 1WLSA 3FPLA 4D5EA 3F6BX 1KSHA 2B61A 2PGJA 3A6JA 4MWOA 4QXMA 1FRVA 5DCUA 3W1VA 3ZE6A 5FF9A 2Q7OE 1MOQA 5JFGA 3KYDA 1RE0A 2ZG6A 4FFLA 4KXVA 3VC7A 1NVMB 1RCTE 2SKEA 3SHFA 4ALMA 3R3XA 1EP3B 5ECWA 4GI7A 4DGQA 2VBCA 3JQGA 1IPFA 1IM8A 2BN4A 3NBQA 4IVPA 2Q27A 1X7HA 2R79A 1ZD8A 2YQ5A 5BN5B 2EX4A 3L2OB 4J0DA 1EWYA 2Q6IA 4HVTA 3BDIA 4WBSA 3VA7A 3RFTA 5CX1B 5FD8A 1F2TB 3C3MA 4YY3B 4F38A 2ENUA 2RH4A 1S8AA 1KPHA 3KEOA 4ALIA 1HYGA 2C9YA 1CJBA 2JFPA 2Q8PA 3OKAA 4ZAZA 2JLWA 1LS6A 4ZYTA 3UT5A 2JKYA 1L5YA 4YAFA 4F4IA 1DXHA 3BMCB 2AJLI 4MW5A 2X0EA 4EQZA 3SYNA 1CERA 4FDMA 3OZXA 4W8GA 3WKBA 2F8TA 1KYYA 4DMFA 3AJAA 1SC9A 2EKLA 3BIWA 2E4XA 1G6KA 3FFBA 2QE6A 4WNAB 5A6SA 4ZQGA 3R0JA 1KXJA 5KAMA 4Q4HA 5J2UB 4HQOA 2FK8A 3UMFA 2BMAA 3DZKA 4Q7EA 1GNPA 4LRYA 3X1WA 5B36A 3EVNA 3EEOA 1PQUA 3IB6A 1HTTA 2HHCA 4D9FA 2FAXA 3OG9A 3ORYA 4YMTA 2M2IA 1PEKE 3EN0A 4LJYA 4OU5A 3ZJYA 4EGAA 3K0HA 3KJNA 5ICEA 5LU9A 3BCRA 2JNWA 3DE5X 2PPVA 3RPEA 2P68A 3OMXA 1KDVA 2DX7A 1CF2O 4YAGA 1OLXA 1ZC3A 2JJ2A 1GRVA 5LIRA 3TM4A 3OAAA 4OLJA 5C80A 1D2AA 1Z7BA 1Y48E 2GJSA 3RQSA 4DIFA 2BZ0A 4F3TA 3B20A 1E7WA 5JMWA 2X5XA 4XW2A 2GD1O 3EDCA 3Q8WA 3FCCA 2EG9A 5LZ7A 3FNQA 4N03A 4H3VA 1BRTA 1GTL1 4ZN6A 2DBQA 4PIVA 4LOHA 4FW9A 3DCIA 3NEYA 4Q24A 3ZPXA 1M73E 2BFBB 4NMHA 4RCVA 4UM8B 4Q1AA 2XUKA 2HIMA 1K8RA 1E6KA 1E79A 4R3UC 5DTIA 3TF5A 4RIGA 4RWZA 4AZTA 1U90A 2BMFA 5JJBA 2Y6VA 4PSKA 5J5CA 1JG3A 1S1CA 4M8KA 5FFFA 1XRSB 2Q21A 3DT8A 3EZXA 3EG9B 3KJHA 3U4IA 2QTAA 4G89A 1W85A 2PMFA 2WWFA 3LPAA 4LRXA 3OX4A 3P1JA 1YACA 1EA5A 3V8MA 1JIXA 5ENZA 5KX5F 4P84A 1EG7A 3WDKA 1VHTA 3G8AA 1BEZA 4P2BA 2BDUA 4BNJA 2BHNA 1W36D 1TD9A 3MW8A 3AV3A 2P2ZA 4IDFA 5ED0A 4B2LA 2C4WA 4B6EA 5KTSA 1RYEA 4GZMA 1NVVR 1A9XB 2HOQA 4QYTA 4RF4A 4K9NA 4PQRA 1HG1A 3S2FA 4H08A 4H4CA 3N76A 5KDDA 4TXLA 4MQFA 2FFAA 4RADA 3ZC3A 2YHUA 1DQPA 2VOJA 4LE1A 4DLVA 5FA8A 4EK9A 3LYLA 1EFHA 1L1QA 2O9JA 2Y9PB 1ONOA 1Z88A 2MSCB 3FCUB 1K63A 3I9LA 2JPDA 2PYIA 2V7BA 1V11B 5K8JB 3DT9A 3QNMA 4TN5A 5FOTA 3OLWA 4RYLA 5GONA 1OXSC 2OENG 1BE8A 2DZDA 3FVTA 4NU0A 1U0OC 5DZSA 1PJSA 2V55B 2A6PA 4D46A 4EDFA 5B3LA 3FW1A 2QQ0A 3LQFA 4R8RA 1VKHA 3FLAA 4I46A 3HA5A 3OX3A 3G0OA 5IWCA 4LOAA 1CE8A 3IMFA 1CG6A 2F1KA 2YBEA 3KFXA 4OCZA 5ALXA 1ISRA 1W4CA 2NPFA 3M9LA 4IY1A 1XVTA 5G0VA 3SZOA 3LKVA 4TSFD 1HDZA 3HCAA 5DYYA 1H5NA 3HU3A 1P2SA 4PSAA 2GTIA 1PR6A 4L9AA 1H0HA 1J20A 1J9EA 3WWCA 5JSYA 1V7ZA 1Q95A 4OMFG 4BGDA 1CUIA 4Z0NA 1LBQA 3QLTA 1EZ1A 5EMHA 3LA6A 1P72A 3MINA 4F8JA 3MGBA 4KACA 3IV7A 3QEJA 4LYJA 5JLAA 4F6RA 5DEIA 1TEZA 3NXSA 3IAS6 4D98A 4E4YA 4LNUB 3N53A 2Y0EA 1ZO8A 4QOJA 4XLLA 5IBQA 2UZIR 3WFJA 1MC1A 1X7XA 4M1ZA 1E2JA 4JENA 4LJLA 5FOSA 4E3WA 4B3FX 4QUGA 9GPBA 5JTUA 1ODKA 5FEUA 1OH7A 1WCIA 4BN0A 3TLXA 1B15A 1DAHA 1L5HB 1RIFA 1L1FA 2WMDA 1N0UA 3MTQA 4NEQA 4Y6RA 3A2MA 1I7SB 1RLOA 2XVAA 4N5NA 2OXIA 3L1JA 2ZT7A 4IDAA 3WO0A 4HKTA 2V3WA 2B4RO 3A6GA 4IYJA 4UDNA 3KQPA 3C3DA 4PE5B 3H8VA 2RHHA 3TL3A 4D3DA 1PZNA 1J4AA 1MUUA 2DPGA 2C0CA 4FJ1A 4V3CA 4WADA 5JC8A 1E69A 2ARKA 3AKCA 3GW8A 3ICCA 3NCTA 3HKEA 4HN4B 3BERA 4HPWA 3D6TB 4L4UA 5E6RB 2CYCA 2VVTA 1PR4A 5JMOA 2G1AA 5IT9A 1LBEA 1RADA 1KNXA 4DBZA 3GLFE 1RWXA 4MOWA 2P65A 4MIKA 3JVDA 3I23A 3QVOA 2K2WA 3RRXA 1WHSB 3C5HA 4TMYA 1VSVA 3OCUA 3LUCA 4EY4A 3HR8A 4EB6B 2FDXA 4YP5A 2ABWA 3DWFA 4RTSA 1FOEB 3LE8A 5HBGA 1KAHA 5I4KA 4JIMA 4TLDA 2VH1A 1SZCA 4K0KB 2P4UA 3GT3A 1J8FA 3PRYA 3GEGA 4G5RA 4PYIA 4YRSA 2Z6QA 4TXMA 4CG1A 4TRMA 3S99A 4QRDA 2LCQA 5CB4B 2IUYA 1VHQA 1U7DA 1U99A 1JQBA 1XD9A 4GXNA 5TJ9A 4AS2A 1SC4A 3KPJA 2VHUA 2XXAB 4JJ7A 4YUWA 5AHOA 1WBBA 3TPCA 2A0KA 4Y6QA 3R9XA 3PNLA 4O4IF 3TGLA 2CL5A 3IXLA 4BQSA 4EF4A 2CK3D 5KYWA 3BBLA 5EWLB 2FOLA 5KWEA 1F17A 2I66A 2BTOA 2GI4A 4IEEA 1U0NA 4DYDA 4UULA 1ZESA 4OKNA 4WKOA 3WHIA 3UY4A 4EUFA 3HXLA 3EPRA 3PNYA 5L3ZA 5LL6P 1E1CA 2F4NA 1TDJA 4NXMB 5JBNA 1GTG1 1X70A 4C6HA 4Z9AA 3DF9A 3DOIA 4IZHA 3SS9X 3JCZA 3ZBTA 4AFNA 4P0QB 1B41A 3A10A 2JFQA 4B46A 5IUJC 4DV0B 1JJ7A 2C2GA 3EQZA 1L5KA 1ODCA 3KUKA 1VFNA 4K3VA 3ZWPA 1U7UA 4N3GA 1XVLA 2FEWB 2VP0A 3QHPA 1EFCA 1X9IA 4HGYA 4DIUA 5E3JA 2Z5FA 5H1YA 1SK8A 4LYYA 4RD2A 2PL5A 5ADHA 2B4KA 2R8ZA 2V59A 2WAAA 4XX1A 2GM5A 5IUKC 1R9NA 4IL5A 5BVGB 4BRSA 1RWVA 3L7NA 3W06A 2WWIA 4ERNA 4GI3A 1ZAYA 3W3ZB 4Y2VA 1QP0A 1WUKS 3LUPA 1F51E 5HKAA 2OB2A 3ACBA 3FUXA 4DY6A 4JODA 4LPKA 1MGPA 4DUZB 4JVNA 1NZDA 1X7XB 5DXFA 4IOKA 2BC9A 3TIGA 1R6TA 2E6KA 1QQTA 3NYRA 2YYSA 4L3WA 3GLTA 4D45A 2V0NA 3ELBA 1G21A 3HC7A 3OPXA 3D5QA 5GM2A 4NL4H 5AI0A 3ZUGA 2FW0A 2ZWAA 1T5LA 3AM3A 3NRCA 4C7MA 5JDIC 4N41A 2I1VB 3F3KA 3NDJA 3WRYC 5LA6B 2C94A 4B48A 4MJ7A 4L51A 3HDJA 2B2XA 3D02A 1J6UA 1P18A 2P3SA 1JL3A 3UJAA 4ND6A 2OHIA 4PYQA 4BJ6A 5KJEA 1KJ9A 4QDXA 1SFRA 4EWLA 5LUAA 5A04A 1I14A 2CUNA 4XFKA 1V95A 2V7UA 3I2IA 1JQKA 4LYDA 4DTIA 1JVNA 2NU6B 3GR6A 2E1RA 3G02A 2QLMA 3B5EA 2BJVA 4X44A 3O93A 4UU0A 2WKWA 2PG3A 3OUZA 1KY2A 1FVFA 3H19A 1FYEA 2EGGA 1OOEA 1OYOA 5ALDA 4ZT5A 3DCYA 2XXBA 2EQAA 4GSYA 1CKEA 1PL6A 4XYEA 1DTSA 2H9AA 2NT3A 4U6NA 4PZLA 1UDXA 4A16A 2ZYUX 3PD7A 5C8YA 2GLTA 1UDRA 1VA4A 1WXDA 2EFYA 2PX0A 3B1KA 4X1OA 3SX4A 1WVGA 3F4LA 2Y68A 5GJVC 1Q3HA 3SEQA 3MT9A 3VO9A 2C2HA 2PH5A 1QF9A 2ZSFA 1G63A 4OA5A 2KMLA 5DM0A 4E5KA 1VLVA 3GMIA 4UNIA 1EQ2A 3KR2A 5KWIA 4P2GA 2F4VB 2ZPAA 3C48A 3VYRB 3DVRX 4JL5A 5EIHA 4JI5B 2V7EA 3N2ZB 3OEED 2DH5A 5ALYA 4TVOA 1M7BA 2QR2A 2J07A 1C1XB 1GPAA 2FPMA 2WOJA 3A7DA 3AI3A 3BWXA 3FTNA 4XM0A 2R62A 1TAHA 4DIEA 2ADFA 4FHEA 1TUBA 4WACA 1SN7A 5BQ5A 2VQDA 3IIIA 3OJWA 4MRNA 1W4LA 3VDQA 3ZR4B 9ABPA 4CIDA 4TXNA 5JCJD 4LY9A 2NZJA 3NTLA 3V7WA 1UT5A 3B7PA 4EEXA 3MJRA 3KXKA 2DKNA 2VJOA 1YZ3A 5EE5B 5IAEA 1Y3IA 3DWGA 2YWCA 3D2CA 3WXMA 2ESRA 4BFCA 2P79A 2G4VA 1ECPA 2QORA 3KHSA 5EQFA 4YP6A 2F1OA 2YN2A 3DGFC 1J5XA 4PZEA 5K0JA