3NMDA

Crystal structure of the leucine zipper domain of cgmp dependent protein kinase i beta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
GSLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQMLQNELDKYRSVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystal structure of the cyclic GMP-dependent protein kinase I{beta} dimerization/docking domain reveals molecular details of isoform-specific anchoring.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cGMP Dependent PRotein Kinase
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nmdA00
4C46A 4RESB 3LIEA 1JUNA 2Q5UA 5AVUB 5APSA 3L37A 4AUWA 3TNUB 2WT7A 1MUUA 1S9KD 3M0DA 3SWFA 2XU6A 2P67A 5APXA 4AQRD 1A02J 2QM8A 2WPRA 2ZFCA 1OWAA 3VMZA 3IR9A 4I6MC 3HE4B 3OAKA 3L35A 1YYCA 3TYYA 5AW8B 4DZOA 1IO4A 3VMXA 2WWWA 1J2JB 1KQLA 1HWTC 3L36A 1X8YA 2ZXEB 3P32A 5APTA 1FOSF 2BASA 3HTKA 3KQGA 2P7JA 3HE4A 5APQA 3LIDA 2WPQA 3A2AA 1FOSE 3V4WA 3A5TA 3B8EB 4LC1A 4EOTA 3UIAA 2P2UA 1MV8A 3P8MC 3TNUA 5AVXB 5APYA 1SLQA 2YNYA 5APUA 5AW7B 1NWQA 3NMDA 2YO3A 5AW4B 5AVYB 5AW0B 5AVZB 3HE5A 1H8AA 2R32A 3NFQA 4C7NB 1GK4A 1CI6B 4GT1A 2QM7A 2W6AA 3MD0A 3A3YB 1HBWA 5AVRB 1SP4A 1G2CB 4C7NA 1S9KE 1GU4A 3NXSA 1DH3A 2YO2A 2WPSA 3HE5B 3M06A 2JJLA 3V4QA 1GU5A 3NTNA 5AW5B 2XZRA 1CZQA 3T97A 2WTYA 2N9BA 2E43A 2Z5IA 2R3CA 1GD2E 3O8ZA 3VN0A 1GTWA 1T2KC 3KDPB 2R5DA 2R5BA 5AW6B 1JNMA 5APWA 3VTPC 4AYCA 2W27A 5AW1B 3M91A 1T2KD 2Z5HA 5CMZA 5APVA 2E42A 3A7OA 1HUCA 5AVVB 2KP8A 1H88A 5AVQB 3P7KA 2Q7CA 2C9NY 4GKGA 5AW3B 4JYCA 1FAVA 2IPPA 5AW9B 3VYIA 3M0AA 1GZLA 1CSBA 4B86A 3M9HA 3TK1A 5AVSB 1A02F 2WT7B 2H7HA 2XV5A 1OXZA 1HJBA 1H89A 4HYTB 4JYBA 2C9LY 4I2LC 4KHXA 1NAFA 3VMYA 5AVTB 2VRSA 5AVWB 5AW2B 4XE5B 1MFZA 2Q3IA 1GK6A 3MGNA 1CI6A 3I5CA 3V5BA 4M3LA 3M9BA
chains in the Genus database with same CATH superfamily
1SQVK 1N7SC 1KFMA 1M90Q 1DD3A 1NTKE 2FYNC 2KOGA 1RF0C 4YTPC 1HTLC 3BCCE 3MHVA 1SQBG 1EZVG 2GUVA 1P84E 4PV1C 1DD4A 2NZ2A 1J1DB 2QJYB 4AUWA 3TNUB 1JOCA 1LTJB 4UB8E 3OJAB 1NTZD 3M0DA 3SWFA 3D71A 3H1KE 1S9KD 3L74D 2OYHA 3FX0A 5APXA 2WPVB 3L4FA 1EZVD 1VQ7P 4H44C 1URQC 1WT6A 3V6IA 2WPRA 1NU1K 2ZFCA 3RL0g 4NPDA 4WY4B 4I7ZB 2O01J 3WUVA 2E74B 3H32B 1ZW0A 1KB9D 1PP9G 2E76D 2QE7H 1N7SB 1S3JA 2NPSA 3GW6A 3VMXA 2E74D 1EQ7A 2WWWA 2AXTH 2JP3A 3E7KA 3H1LG 4H0LC 3V2PA 4BRYA 1M8OB 1HWTC 1LTBC 4BRYB 3KZIH 1EZVE 2IBZE 2WITA 1FOSF 2BASA 1LWUC 1KB9E 3ITKA 2KNCA 3KXDA 1RQVA 3PH0A 3R4YA 5APQA 5H2FE 3VP8A 2ZXXA 1KQGB 2SPZA 1K73Q 2BCCJ 3A2AA 5KLVE 1URQB 3V4WA 3CCUP 1FZEA 4WVZA 1IK7A 2E5TA 3GHGC 2FXPA 4N78E 2P2UA 3UIAA 1GL2B 3HUSC 4TT3H 3TNUA 5CCGC 4L73A 1NU1G 1SLQA 2W6BA 2YXRB 5APUA 1IFNA 1XTCC 4YPCA 2XNXA 5AW7B 3NMDA 3CCMP 3Q5SA 2H43A 3Q2YA 2M3BA 2HODB 1LTGC 1W2EA 1L0LD 1L4AC 2KS1B 1D7MA 1N7LA 5DJUB 1S5LE 1KYOI 2FYUK 1LGHB 2QJPC 2OTKE 1IFPA 3CLQA 1K04A 2D2CD 4IFDK 1GK4A 2IFMA 3IAOA 3A3YB 4L74A 4D6TG 4N78D 1Z56A 5AVRB 1IFJA 1IC2A 4IFMA 4XA4A 4C7NA 2ITAA 4UB6E 1ZN5A 2QA4P 1S9KE 1GU4A 1LTTC 1L0LG 2PAJA 2B9BA 1BSNA 2QJPB 1BCCG 4KJMA 3P8CE 3V4QA 1KQSO 1M1JA 4R4LA 3AECC 3G6EP 4IFFA 5M1BA 2ZAEB 5KLIC 1KMIZ 1LTIC 2V7QJ 2Z5IA 1PPJG 3OA7A 4W80A 3CXHH 1JEKA 1LNQA 1S72P 1DIPA 1HF9A 2R5DA 2R5BA 4EI2A 3CWBG 3L73J 3WUTA 1LP1A 2QJKC 1R8EA 3USSA 1JO5A 1GL2D 2YIUB 2D2CC 3CMAP 3L72E 1JY3P 1OW7A 2C0WA 2KNCB 3P8CD 3PTZA 4U3FE 5KJ7A 1MFTA 1Q90D 3M91A 4PD4E 1VQ5P 1YIJP 1T2KD 3H6PA 2E75D 2WSSH 5APVA 3CCJP 1VF5C 3CC2P 1SQXE 4N6JA 3JC22 5AVVB 1EXJA 1AQ5A 4ZNCA 1VF5D 1KILA 2B87A 2Q7CA 1EDKA 1KYOE 4JYCA 1SQBD 4PD4D 2IPPA 1DEBA 1JY3O 3H1HD 1GW4A 1FZBA 2N1TB 3HD7B 3L72D 3BRVB 4U3FD 2GA1A 3VYIA 3CC7P 2IDBA 1RF1A 2V7QH 3L74G 1GL2C 1SQBK 4B86A 4H44B 4MN4C 2OYHB 4K3AA 2IYOA 1LTJA 1NVOA 3BCCG 3ABVC 1FZGA 1DX7A 3T97B 5CCHD 1VQMP 1W2BO 1HJBA 2JEEA 1H89A 2HFED 3L75D 2KLVA 1IFDA 3H1KG 4H13D 1BSHA 1L4AA 3B5NC 5AVTB 2VRSA 5AVWB 2ZT9D 3JCUE 4XE5B 2DW3A 2Q3IA 2K9JA 2ZT9B 3FXEA 1KN7A 1USEA 1NTMJ 1T6AA 1VDFA 3CX5E 1M57D 1Q82Q 4KT0J 1IJDB 2WSCH 4WB4A 2E75C 2J58A 2YMKA 2JDIH 3AEFC 3MUDA 1KQFB 4C46A 2WZ7A 1L0ND 2WMMA 4OGQB 1M1JC 1OZHA 3JCUH 3PLNA 5GTHH 5KAIE 3G71P 1YJ9P 3EWKA 4NPEA 2KB7P 3A0HH 1SFCB 4UB8H 2XU6A 2P67A 3RK2B 3TF5A 2B89A 1G1IA 4A7PA 2N1TD 3HD7D 3B4SA 3M9QA 1A02J 1S4XA 1IFIA 2QM8A 1OWAA 3VMZA 2HG5D 1JY2O 2K3RA 3L75J 2O01N 3OAKA 2IBZI 1VQ6P 3AE9C 1RHZB 2FYUD 3MP7B 3RGUA 4DOJA 1FZCB 5AW8B 1NTZE 3KPEA 4IL6X 3EFFK 1VQ8P 2WSFH 1LT9B 2M5AA 3CX5H 1KD1Q 1U57A 3CCQP 2JR8A 4JQ0D 1NTMD 2L91A 3L36A 2OYIB 3FXDA 2V4HA 1QX8A 3SWYA 2HPCA 1FZCA 3EFGA 4GOFA 2E74C 4D6TE 4Y99B 2BEQD 1L0NJ 1UIXA 2LR2A 1IFMA 2HR3A 3LIDA 4PJ0H 3L75E 4DJGA 3L71G 3EQ2A 2P10A 1AQTA 1BCCJ 4BWNA 3A5TA 1N86A 1NTZJ 4EOTA 1VQNP 1MV8A 5CCGD 4GIFA 5APYA 3JSVC 3S9OA 3V2NA 1NJIQ 3AE3C 3WU2H 1K9MQ 1EDLA 2A06G 3U59A 2YO3A 3H1LE 2FYNB 1EXIA 3RK3D 3W68A 3PP5A 2OARA 3BCCD 3CCSP 1VQKP 3L70G 1P84D 1FC2C 2B88A 3RL0C 3FWLA 2R32A 4YXDC 2W90A 1SS1A 2WSFJ 2IBZG 1RE4C 3AEDC 3MIWA 3L72G 4GT1A 4U3FG 4LGDE 4XFJA 4EDFA 1HBWA 3H1KJ 3H1JG 1G2CB 1N73A 3K5BA 1NTZK 1OMIA 4C7RA 2WPSA 1Q2NA 3CXHD 3HE5B 1L4AB 2FFDA 2Y0CA 4I7ZC 3AE8C 3H1LD 3NTNA 5B5EE 3QWOC 1CZQA 1JCDA 1S1CX 2FYUG 2BCCD 2IYPA 3FGAD 3RK2C 3W67A 2R3CA 1URQD 2YXQB 1GD2E 1OW6A 1VL2A 1GTWA 3CXHE 3BASA 2RH0A 4DCKA 3I55P 4UB6H 4NPFX 3E1IA 1HVVA 1ZLLA 2KZJA 2N1TA 2Q6QA 3HD7A 4PV1D 1YITP 3AE7C 2IBZD 2A45I 4YXWH 3CC4P 1NO4A 1Y9BA 2QIWA 2W27A 3V5BA 1KILB 5K5GB 2HPCB 4U7JA 1Y47A 4PJ0E 3U1AA 1FZFA 1NTKK 2BCCE 5CMZA 5BU5A 2E42A 1TU3F 1R5SA 5B66H 1PL5A 3A0BH 2E76B 3H1KD 1YI2P 3P7KA 2Y0DA 2PFXA 2MKVA 4DZOA 3KYQA 1EDJA 3H25A 1QL1A 2KIKA 1FZAA 1LWUA 1KILD 4PD4I 4QMAA 1NTMG 4WY4C 5AW9B 2Q9IA 2YKQA 3M0AA 1GZLA 5CCHA 1KC8Q 3TDKA 1CSBA 2A45H 2JWDA 2O1JA 2RN0A 3CWBE 3G3ZA 3GF3A 2W6JH 1X79B 2Q3EA 1SFCC 5CJ0A 5EFWB 3MZWB 3SSUA 3GHGA 1N2DC 1SQXD 1SQBE 3GF7A 3LW5J 3L73D 5CCGA 1LTSC 3TGUJ 1QGKB 2FXOA 2YKOA 2M8RA 1RE3A 2ZVOB 3PRJA 4I2LC 1HJ0A 1T3UA 1DEEG 1SQXK 5CBOA 2W83C 1YJWP 2OTLP 1QL2A 5CBNA 3H1HG 4R4MA 2QSIA 4OH8B 1U7JA 3IN6A 3V2QA 1ZR4A 2OYIC 1HH0A 3AE5C 1H88A 2WVRA 3AEAC 3B5NB 1ZR2A 3L73E 1K8AQ 1GDTA 3FWNA 1SQBJ 2Y9YA 3Q5PA 1P84I 1JUNA 3TGUE 2WSEH 3L72J 4U3FJ 1FJKA 1P84H 4WBAA 1UIIA 5APSA 3RK3B 1BE3D 3VP9A 3L37A 2RKLA 2IFNA 3S4RA 1GL2A 1SQPG 1MUUA 1BDCA 3HUSA 5KJ7D 5GTIH 5CJ4A 3LW5H 1SQXJ 4W7ZA 4AQRD 1SQPJ 3ZDMA 4HH2A 1RF1B 1LT1A 3CX5D 3CCLP 3V2RA 2POHA 3TGUD 1RH5B 3IR9A 3H1HE 1SQQK 2PP6A 3G9RA 4OGQC 2KSJA 1PGOA 1RQUA 3L35A 4ZKUA 3TYYA 5KKZB 2OGUA 5KJ7C 3E1RA 3Q5RA 1IO4A 1YTZI 2IX7C 3WU2E 3AEEC 1J2JB 1PGJA 1PP9J 2KK7A 1KQLA 5B66E 1X22A 1VQOP 1FDMA 1SQPK 1AJYA 5DJTB 3RL0B 3SWKA 3P32A 3HRNA 5APTA 5KKZC 3H32A 3H1IJ 1AVOA 1SQPE 3KQGA 2P7JA 3U1CA 4JPZB 4WY4A 2XKMA 1BGYG 2KZIA 4PD4H 2WSEJ 4WWIA 1M56D 2WPQA 1FDIA 2IZ1A 1RF1C 1FOSE 3RBZA 3HUSB 1LJ2A 2YKPA 3L71J 3P8MC 3R2PA 5AVXB 2QG4A 2Z4EA 1LTJC 3B5ND 3II6A 1PP9E 4JF7A 2QVAA 2I1KA 4Y99C 5AW4B 1M1JB 1NU1J 5AVYB 4I1LA 5AW0B 3S1KA 1PZQA 4RKUJ 1W5CE 2CPSA 3B5NA 1VQLP 1NHLA 1USDA 3NFQA 4C7NB 1PGPA 1H0TA 2HYNA 3H1IG 2R44A 2CK3H 1GMJA 2MJZA 3AE2C 1SP4A 1JB0J 1BGYE 1KILC 1SQVG 3B71A 2K37A 3NXSA 3Q3DA 1DH3A 4L76A 3L71E 3M06A 3H1ID 1OVRA 1FZCC 2KS1A 1SQXG 1FBMA 1LTAC 1RF0A 2JJLA 2HODA 5E79E 2XZRA 1NTMK 1E5WA 1HGZA 1NYHA 1NU1E 2Q1KA 2RMZA 4H13B 3RBXA 2WTYA 2E43A 2NRGA 5BU8B 1BCCD 2Y9ZA 3GG2A 3GHGB 5KAFE 2O1KA 3VN0A 3L71D 2FXMA 3CPWO 1J1EC 1T2KC 1URQA 1FS0E 3KDPB 3L70E 5AW6B 4Y28J 2E5YA 3WUUA 1YBKA 2C0XA 1NH4A 1NTKJ 2AXCA 3PJSK 5E79H 1BGYJ 3VTPC 4RO0A 3BCCJ 4AYCA 4D6TJ 1YQ4C 3D6YA 5L8RJ 5AW1B 1L0NE 2IZ0A 5KLVD 3O6QB 3D70A 4OVNF 1AVYA 2W8ZA 1G1JA 1VF5B 2M3EA 1JMBA 2ZT9C 1AA0A 1BCCE 1HUCA 2FYZA 1NGMB 1L0NK 2KP8A 3F89A 2P58A 5KTBA 5AVQB 1N7SA 2NPSB 3CD6P 4GKGA 5AW3B 3PHLA 5GTHE 3L70J 3H1LJ 2J59M 3TSIA 2WSCJ 2KXPB 2K9YA 1NOHA 1WMKA 1X9VA 1JY2N 1T3JA 2R3SA 2UWJE 3M9HA 4EIJA 3CCRP 2OYHC 2JWAA 1A02F 3TGUG 3L74J 1OIPA 5KLIB 1FU1A 5TISH 3BVHA 2XV5A 2H7HA 3RK3C 2JO1A 1S5LX 1GU5A 3CX5I 3VMAA 5TJHA 2KYVA 4HYTB 3AEGC 3WMM0 5KLVK 1YTZT 3SFEC 2C9LY 4KHXA 1NAFA 3AEBC 3BATA 2NPSC 3BRTB 2FFDB 5KLVJ 1KORA 1S2EA 2CPBA 1N73B 4OWFA 1OX3A 1MFZA 3N4XA 1GK6A 1CI6A 2LXCB 1AFOA 1KFNA 1JMMA 2ZYDA 1M7LA 3M9BA 3L74E 1EC5A 2D2CB 1JM0A 3F5HA 1S5LH 3L70D 4RESB 3LIEA 4IL6E 3RK3E 1KYOH 2Q5UA 5AVUB 3OW2O 1ZMEC 5KAIH 3CCEP 2WT7A 2KUBA 1K05A 2ZJSE 2G3AA 1EDIA 1MZ9A 3A0HE 4L75A 1QVGO 3L75G 1M1KQ 1NAYA 2K1AA 4RJTA 2A45G 2H89C 2O3JA 1NKZB 1VPCA 4I6MC 3HE4B 2N1TC 3HD7C 1L0LJ 1LWUB 1RE3C 2A06D 1Y8AA 2NPSD 1YYCA 3HTKB 4K35A 4LLHA 2N9YB 1RE4A 2FKWB 2ZVNB 3CWBJ 3L73G 2KI7B 1JTHB 1PGQA 1LT9C 1NTKG 1PIXA 2PRRA 1JTHA 2M5AB 1Q86Q 1X8YA 2ZXEB 3I56P 3C9IA 5TISE 2K88A 1E79H 2I1JA 1HGVA 1SFCD 3HTKA 1N7SD 5H2FH 1OFCX 3VOPA 2ZYGA 3Q1MA 3MUDC 3HE4A 4O9BA 2LXBA 1ZRTE 1BE3J 4WY4D 1L0LE 1OVUA 4HJGH 4OGQD 4BXLA 1PFIA 2HLOA 3B8EB 4LC1A 3AE4C 1J1EB 1SFCA 3QH9A 1EZVI 2GM4A 2AEFA 2KSEA 4PV1B 1SQPD 4H13C 1L0LK 1ZP0C 2YNYA 1NWQA 1CW5A 1ZXGA 1JY2P 1FDOA 2OYOA 1VQ4P 1KZUB 1KILE 5AVZB 3HE5A 4ASWA 1H8AA 4EYYQ 4HB1A 3SFDC 1G2CA 1SQQD 2G8YA 3CWBD 1YQ3C 1CI6B 1PP9D 1X0TA 4H0LD 2QEXP 2QM7A 2W6AA 1BE3E 3MD0A 2OTJP 1L4AD 4JBZA 1JY3N 3CXHI 1XTGB 4TLFA 1KV4A 2YO2A 1Q7YQ 2BCCG 5KLVG 1FE6A 4Z1MH 1SQVJ 1ZV8A 3H1HJ 2QJKB 2Y0EA 1T8ZA 4H44D 5AW5B 3GLMA 2YIUC 5CCHC 2I8DA 1KB9H 3CCVP 1Q81Q 3T97A 4N3YB 2N9BA 4DT0A 2A06E 2QRXA 3M0DC 4GDOA 3AE1C 3AE6C 3C1LA 1NTME 2FY8A 3H1JD 1ZOYC 3O8ZA 4GOEA 4IOIH 2FBWC 3G4SP 4HKZH 1JNMA 5APWA 1NU1D 2XDJA 3H1IE 3MTUE 1L2PA 1SQQG 2E75B 2H8PD 1IK9A 1BE3G 3IFMA 1BDDA 3RL0D 1KYOD 1WRGA 2B87B 1SQVE 2ZYAA 3H1JE 4ZMDA 4CPGA 1SQQJ 2Z5HA 2OYIA 1ZRTD 2AEJA 3A7OA 2E76C 1RY3A 2BEZF 1MKMA 2M0BA 3A0BE 5GTIE 1LT9A 1OVVA 1VQPP 3IF4A 3KHUA 2KLUA 2J5UA 3O6QA 1N73C 1IZNB 2FYUE 3KZIE 4IL6H 1YHQP 1FAVA 4GODA 1GW3A 1SQVD 2XNDH 1PPJE 1N8RQ 3CMEP 1VQ9P 1PV3A 2OQQA 4W7YA 4ZKPA 1YJNP 1LP1B 2AXTE 5C39A 3GMAA 2O01H 5B5EH 5CHXA 1FJPA 3H1JJ 2YMYA 5AVSB 3TK1A 2JKVA 2WT7B 1SQQE 2GUSA 3N7NA 2C9NY 1PPJD 3C8VA 5BVZA 1J1DC 1L0NG 1OXZA 2QJYC 1QVFO 2WQYC 1NTKD 2H88C 1BGYD 2LKMA 3CI9A 3CL3D 4JYBA 3RK2D 3D6ZA 4D6TD 2AEMA 2FYUJ 1KB9I 4ASVA 3VMYA 1QEXA 1OW8A 1QLED 1R5LA 5AW2B 1AV1A 2L5GB 2P1JA 2PGDA 2K9JB 3MGNA 1JCCA 1U7MA 3I5CA 5KAFH 1NTZG 1NKNA 1SVFA 1KTMA 1H0TB 4M3LA 4H0LB 2FFDC
chains in the Genus database with same CATH topology
1SQVK 1N7SC 1KFMA 2KOGA 1RF0C 1HTLC 2GUVA 4AUWA 1J1DB 3TNUB 1JOCA 1LTJB 1S9KD 3OJAB 3M0DA 3SWFA 2OYHA 5APXA 3L4FA 1URQC 1WT6A 2WPRA 1NU1K 2ZFCA 4WY4B 3H32B 3R2PA 4DZOA 1N7SB 2NPSA 3VMXA 2WWWA 1EQ7A 3V2PA 1HWTC 1LTBC 2WITA 1FOSF 2BASA 1LWUC 5APQA 3VP8A 3A2AA 1URQB 3V4WA 1FZEA 3GHGC 4N78E 3UIAA 2P2UA 1GL2B 3HUSC 3TNUA 5CCGC 5CCHD 1SLQA 2W6BA 5APUA 1IFNA 1XTCC 5AW7B 2XNXA 2H43A 3NMDA 2M3BA 2HODB 1LTGC 1W2EA 1L4AC 1N7LA 2FYUK 1LGHB 3CLQA 4IFDK 1GK4A 2IFMA 3A3YB 4N78D 1Z56A 5AVRB 1IFJA 1IC2A 4IFMA 4XA4A 4C7NA 1S9KE 1ZN5A 1GU4A 1LTTC 2PAJA 3P8CE 3V4QA 1M1JA 4IFFA 1LTIC 2Z5IA 3OA7A 4W80A 2R5DA 2R5BA 1JO5A 1GL2D 1JY3P 2C0WA 3P8CD 5KJ7A 3M91A 1T2KD 3H6PA 5APVA 4N6JA 5AVVB 2Q7CA 1KILA 4JYCA 2IPPA 1DEBA 1JY3O 1GW4A 1FZBA 2N1TB 3HD7B 3VYIA 3BRVB 1RF1A 1GL2C 1SQBK 4B86A 2OYHB 1LTJA 1DX7A 1FZGA 1HJBA 2JEEA 1H89A 2HFED 2KLVA 1IFDA 1L4AA 3B5NC 5AVTB 2VRSA 5AVWB 4XE5B 2Q3IA 1VDFA 4WB4A 2WSCH 1IJDB 2J58A 3MUDA 4C46A 2WZ7A 1M1JC 2KB7P 1SFCB 2XU6A 2P67A 3RK2B 1G1IA 2N1TD 3HD7D 3M9QA 1A02J 2QM8A 1IFIA 3VMZA 1OWAA 2HG5D 1JY2O 3OAKA 4DOJA 1FZCB 5AW8B 3KPEA 2WSFH 1LT9B 3L36A 2OYIB 3SWYA 2HPCA 1FZCA 3EFGA 4Y99B 1IFMA 3LIDA 3EQ2A 3A5TA 4EOTA 1N86A 1MV8A 5CCGD 4GIFA 5APYA 3V2NA 3U59A 2YO3A 3RK3D 3PP5A 2OARA 3RL0C 2R32A 1RE4C 3MIWA 4GT1A 4LGDE 1HBWA 1G2CB 1N73A 1NTZK 4C7RA 2WPSA 3HE5B 2FFDA 1L4AB 3NTNA 1CZQA 1JCDA 3RK2C 2R3CA 1URQD 1GD2E 1GTWA 3BASA 3E1IA 1HVVA 1ZLLA 2N1TA 3HD7A 2A45I 1NO4A 2W27A 3V5BA 1KILB 2HPCB 1FZFA 3U1AA 1NTKK 5CMZA 5BU5A 2E42A 3P7KA 3KYQA 1QL1A 1FZAA 1LWUA 1KILD 4WY4C 5AW9B 2Q9IA 3M0AA 2YKQA 1GZLA 5CCHA 1CSBA 2A45H 2O1JA 3G3ZA 1X79B 5CJ0A 1SFCC 3GHGA 1N2DC 5CCGA 1LTSC 2YKOA 2M8RA 1RE3A 4I2LC 1T3UA 1SQXK 1QL2A 1ZR4A 4OH8B 3V2QA 2OYIC 1HH0A 1H88A 3B5NB 1ZR2A 1GDTA 1JUNA 2WSEH 1FJKA 4WBAA 5APSA 3RK3B 3VP9A 3L37A 2IFNA 1GL2A 1MUUA 3HUSA 5KJ7D 5CJ4A 3LW5H 4W7ZA 4AQRD 4HH2A 1RF1B 3V2RA 2POHA 3IR9A 1SQQK 2PP6A 2KSJA 3L35A 4ZKUA 3TYYA 5KJ7C 1IO4A 1YTZI 2IX7C 1J2JB 1FDMA 1KQLA 1SQPK 3RL0B 3P32A 3HRNA 5APTA 3H32A 3KQGA 2P7JA 3U1CA 4WY4A 2XKMA 2WPQA 1RF1C 1FOSE 3HUSB 2YKPA 3P8MC 5AVXB 2Z4EA 1LTJC 3B5ND 3II6A 4JF7A 2I1KA 4Y99C 5AW4B 1M1JB 5AVYB 4I1LA 5AW0B 2CPSA 3B5NA 1NHLA 3NFQA 4C7NB 2HYNA 2MJZA 1SP4A 1KILC 3NXSA 1DH3A 3M06A 1FZCC 2JJLA 1FBMA 1LTAC 1RF0A 2HODA 2XZRA 1NTMK 1E5WA 1HGZA 2WTYA 2E43A 5BU8B 3GHGB 2O1KA 3VN0A 1T2KC 2FXMA 1J1EC 1URQA 3KDPB 5AW6B 2C0XA 1NH4A 3VTPC 4AYCA 5AW1B 1G1JA 1HUCA 2FYZA 1L0NK 2KP8A 5KTBA 5AVQB 1N7SA 2NPSB 4GKGA 5AW3B 3TSIA 2J59M 1NOHA 1X9VA 1JY2N 1T3JA 3M9HA 4EIJA 2OYHC 1A02F 1FU1A 3BVHA 2H7HA 2XV5A 3RK3C 2KYVA 4HYTB 3WMM0 5KLVK 1YTZT 2C9LY 4KHXA 1NAFA 3BATA 3BRTB 2NPSC 2FFDB 2CPBA 1N73B 1MFZA 3N4XA 1GK6A 1CI6A 1AFOA 1KFNA 1JMMA 1M7LA 3M9BA 4RESB 3LIEA 2Q5UA 5AVUB 2WT7A 1MZ9A 2A45G 1NKZB 1VPCA 4I6MC 3HE4B 2N1TC 3HD7C 1LWUB 1RE3C 2NPSD 3HTKB 1YYCA 4LLHA 1RE4A 2FKWB 1JTHB 1LT9C 1JTHA 1X8YA 2ZXEB 3C9IA 2I1JA 1HGVA 1SFCD 3HTKA 1N7SD 3VOPA 3HE4A 4O9BA 4WY4D 1PFIA 2HLOA 3B8EB 4LC1A 2GM4A 1J1EB 1SFCA 1L0LK 2YNYA 1NWQA 1JY2P 1KZUB 5AVZB 3HE5A 1H8AA 1G2CA 1CI6B 2QM7A 2W6AA 3MD0A 1L4AD 1JY3N 1XTGB 2YO2A 1ZV8A 5CCHC 1GU5A 1T8ZA 5AW5B 3T97A 4N3YB 2N9BA 3M0DC 3O8ZA 1JNMA 5APWA 2XDJA 3MTUE 1CW5A 2H8PD 1IK9A 3IFMA 3RL0D 1WRGA 2Z5HA 2OYIA 3A7OA 1RY3A 1LT9A 1AQ5A 2C9NY 1N73C 1FAVA 1GW3A 4W7YA 4ZKPA 2O01H 5CHXA 1FJPA 2YMYA 5AVSB 3TK1A 2WT7B 2GUSA 3N7NA 5BVZA 1J1DC 1OXZA 2LKMA 4JYBA 3CI9A 3CL3D 3RK2D 3VMYA 5AW2B 2L5GB 2P1JA 3MGNA 1JCCA 3I5CA 1NKNA 1SVFA 4M3LA 2FFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  4RES B;  3LIE A;  1JUN A;  2Q5U A;  5AVU B;  5APS A;  3L37 A;  4AUW A;  3TNU B;  2WT7 A;  1MUU A;  1S9K D;  3M0D A;  3SWF A;  2XU6 A;  2P67 A;  5APX A;  4AQR D;  1A02 J;  2QM8 A;  2WPR A;  2ZFC A;  1OWA A;  3VMZ A;  3IR9 A;  4I6M C;  3HE4 B;  3OAK A;  3L35 A;  1YYC A;  3TYY A;  5AW8 B;  4DZO A;  1IO4 A;  3VMX A;  2WWW A;  1J2J B;  1KQL A;  1HWT C;  3L36 A;  1X8Y A;  2ZXE B;  3P32 A;  5APT A;  1FOS F;  2BAS A;  3HTK A;  3KQG A;  2P7J A;  3HE4 A;  5APQ A;  3LID A;  2WPQ A;  3A2A A;  1FOS E;  3V4W A;  3A5T A;  3B8E B;  4LC1 A;  4EOT A;  3UIA A;  2P2U A;  1MV8 A;  3P8M C;  3TNU A;  5AVX B;  5APY A;  1SLQ A;  2YNY A;  5APU A;  5AW7 B;  1NWQ A;  3NMD A;  2YO3 A;  5AW4 B;  5AVY B;  5AW0 B;  5AVZ B;  3HE5 A;  1H8A A;  2R32 A;  3NFQ A;  4C7N B;  1GK4 A;  1CI6 B;  4GT1 A;  2QM7 A;  2W6A A;  3MD0 A;  3A3Y B;  1HBW A;  5AVR B;  1SP4 A;  1G2C B;  4C7N A;  1S9K E;  1GU4 A;  3NXS A;  1DH3 A;  2YO2 A;  2WPS A;  3HE5 B;  3M06 A;  2JJL A;  3V4Q A;  1GU5 A;  3NTN A;  5AW5 B;  2XZR A;  1CZQ A;  3T97 A;  2WTY A;  2N9B A;  2E43 A;  2Z5I A;  2R3C A;  1GD2 E;  3O8Z A;  3VN0 A;  1GTW A;  1T2K C;  3KDP B;  2R5D A;  2R5B A;  5AW6 B;  1JNM A;  5APW A;  3VTP C;  4AYC A;  2W27 A;  5AW1 B;  3M91 A;  1T2K D;  2Z5H A;  5CMZ A;  5APV A;  2E42 A;  3A7O A;  1HUC A;  5AVV B;  2KP8 A;  1H88 A;  5AVQ B;  3P7K A;  2Q7C A;  2C9N Y;  4GKG A;  5AW3 B;  4JYC A;  1FAV A;  2IPP A;  5AW9 B;  3VYI A;  3M0A A;  1GZL A;  1CSB A;  4B86 A;  3M9H A;  3TK1 A;  5AVS B;  1A02 F;  2WT7 B;  2H7H A;  2XV5 A;  1OXZ A;  1HJB A;  1H89 A;  4HYT B;  4JYB A;  2C9L Y;  4I2L C;  4KHX A;  1NAF A;  3VMY A;  5AVT B;  2VRS A;  5AVW B;  5AW2 B;  4XE5 B;  1MFZ A;  2Q3I A;  1GK6 A;  3MGN A;  1CI6 A;  3I5C A;  3V5B A;  4M3L A;  3M9B A; 
#chains in the Genus database with same CATH topology
 1SQV K;  1N7S C;  1KFM A;  1M90 Q;  1DD3 A;  1NTK E;  2FYN C;  2KOG A;  1RF0 C;  4YTP C;  1HTL C;  3BCC E;  3MHV A;  1SQB G;  1EZV G;  2GUV A;  1P84 E;  4PV1 C;  1DD4 A;  2NZ2 A;  1J1D B;  2QJY B;  4AUW A;  3TNU B;  1JOC A;  1LTJ B;  4UB8 E;  3OJA B;  1NTZ D;  3M0D A;  3SWF A;  3D71 A;  3H1K E;  1S9K D;  3L74 D;  2OYH A;  3FX0 A;  5APX A;  2WPV B;  3L4F A;  1EZV D;  1VQ7 P;  4H44 C;  1URQ C;  1WT6 A;  3V6I A;  2WPR A;  1NU1 K;  2ZFC A;  3RL0 g;  4NPD A;  4WY4 B;  4I7Z B;  2O01 J;  3WUV A;  2E74 B;  3H32 B;  1ZW0 A;  1KB9 D;  1PP9 G;  2E76 D;  2QE7 H;  1N7S B;  1S3J A;  2NPS A;  3GW6 A;  3VMX A;  2E74 D;  1EQ7 A;  2WWW A;  2AXT H;  2JP3 A;  3E7K A;  3H1L G;  4H0L C;  3V2P A;  4BRY A;  1M8O B;  1HWT C;  1LTB C;  4BRY B;  3KZI H;  1EZV E;  2IBZ E;  2WIT A;  1FOS F;  2BAS A;  1LWU C;  1KB9 E;  3ITK A;  2KNC A;  3KXD A;  1RQV A;  3PH0 A;  3R4Y A;  5APQ A;  5H2F E;  3VP8 A;  2ZXX A;  1KQG B;  2SPZ A;  1K73 Q;  2BCC J;  3A2A A;  5KLV E;  1URQ B;  3V4W A;  3CCU P;  1FZE A;  4WVZ A;  1IK7 A;  2E5T A;  3GHG C;  2FXP A;  4N78 E;  2P2U A;  3UIA A;  1GL2 B;  3HUS C;  4TT3 H;  3TNU A;  5CCG C;  4L73 A;  1NU1 G;  1SLQ A;  2W6B A;  2YXR B;  5APU A;  1IFN A;  1XTC C;  4YPC A;  2XNX A;  5AW7 B;  3NMD A;  3CCM P;  3Q5S A;  2H43 A;  3Q2Y A;  2M3B A;  2HOD B;  1LTG C;  1W2E A;  1L0L D;  1L4A C;  2KS1 B;  1D7M A;  1N7L A;  5DJU B;  1S5L E;  1KYO I;  2FYU K;  1LGH B;  2QJP C;  2OTK E;  1IFP A;  3CLQ A;  1K04 A;  2D2C D;  4IFD K;  1GK4 A;  2IFM A;  3IAO A;  3A3Y B;  4L74 A;  4D6T G;  4N78 D;  1Z56 A;  5AVR B;  1IFJ A;  1IC2 A;  4IFM A;  4XA4 A;  4C7N A;  2ITA A;  4UB6 E;  1ZN5 A;  2QA4 P;  1S9K E;  1GU4 A;  1LTT C;  1L0L G;  2PAJ A;  2B9B A;  1BSN A;  2QJP B;  1BCC G;  4KJM A;  3P8C E;  3V4Q A;  1KQS O;  1M1J A;  4R4L A;  3AEC C;  3G6E P;  4IFF A;  5M1B A;  2ZAE B;  5KLI C;  1KMI Z;  1LTI C;  2V7Q J;  2Z5I A;  1PPJ G;  3OA7 A;  4W80 A;  3CXH H;  1JEK A;  1LNQ A;  1S72 P;  1DIP A;  1HF9 A;  2R5D A;  2R5B A;  4EI2 A;  3CWB G;  3L73 J;  3WUT A;  1LP1 A;  2QJK C;  1R8E A;  3USS A;  1JO5 A;  1GL2 D;  2YIU B;  2D2C C;  3CMA P;  3L72 E;  1JY3 P;  1OW7 A;  2C0W A;  2KNC B;  3P8C D;  3PTZ A;  4U3F E;  5KJ7 A;  1MFT A;  1Q90 D;  3M91 A;  4PD4 E;  1VQ5 P;  1YIJ P;  1T2K D;  3H6P A;  2E75 D;  2WSS H;  5APV A;  3CCJ P;  1VF5 C;  3CC2 P;  1SQX E;  4N6J A;  3JC2 2;  5AVV B;  1EXJ A;  1AQ5 A;  4ZNC A;  1VF5 D;  1KIL A;  2B87 A;  2Q7C A;  1EDK A;  1KYO E;  4JYC A;  1SQB D;  4PD4 D;  2IPP A;  1DEB A;  1JY3 O;  3H1H D;  1GW4 A;  1FZB A;  2N1T B;  3HD7 B;  3L72 D;  3BRV B;  4U3F D;  2GA1 A;  3VYI A;  3CC7 P;  2IDB A;  1RF1 A;  2V7Q H;  3L74 G;  1GL2 C;  1SQB K;  4B86 A;  4H44 B;  4MN4 C;  2OYH B;  4K3A A;  2IYO A;  1LTJ A;  1NVO A;  3BCC G;  3ABV C;  1FZG A;  1DX7 A;  3T97 B;  5CCH D;  1VQM P;  1W2B O;  1HJB A;  2JEE A;  1H89 A;  2HFE D;  3L75 D;  2KLV A;  1IFD A;  3H1K G;  4H13 D;  1BSH A;  1L4A A;  3B5N C;  5AVT B;  2VRS A;  5AVW B;  2ZT9 D;  3JCU E;  4XE5 B;  2DW3 A;  2Q3I A;  2K9J A;  2ZT9 B;  3FXE A;  1KN7 A;  1USE A;  1NTM J;  1T6A A;  1VDF A;  3CX5 E;  1M57 D;  1Q82 Q;  4KT0 J;  1IJD B;  2WSC H;  4WB4 A;  2E75 C;  2J58 A;  2YMK A;  2JDI H;  3AEF C;  3MUD A;  1KQF B;  4C46 A;  2WZ7 A;  1L0N D;  2WMM A;  4OGQ B;  1M1J C;  1OZH A;  3JCU H;  3PLN A;  5GTH H;  5KAI E;  3G71 P;  1YJ9 P;  3EWK A;  4NPE A;  2KB7 P;  3A0H H;  1SFC B;  4UB8 H;  2XU6 A;  2P67 A;  3RK2 B;  3TF5 A;  2B89 A;  1G1I A;  4A7P A;  2N1T D;  3HD7 D;  3B4S A;  3M9Q A;  1A02 J;  1S4X A;  1IFI A;  2QM8 A;  1OWA A;  3VMZ A;  2HG5 D;  1JY2 O;  2K3R A;  3L75 J;  2O01 N;  3OAK A;  2IBZ I;  1VQ6 P;  3AE9 C;  1RHZ B;  2FYU D;  3MP7 B;  3RGU A;  4DOJ A;  1FZC B;  5AW8 B;  1NTZ E;  3KPE A;  4IL6 X;  3EFF K;  1VQ8 P;  2WSF H;  1LT9 B;  2M5A A;  3CX5 H;  1KD1 Q;  1U57 A;  3CCQ P;  2JR8 A;  4JQ0 D;  1NTM D;  2L91 A;  3L36 A;  2OYI B;  3FXD A;  2V4H A;  1QX8 A;  3SWY A;  2HPC A;  1FZC A;  3EFG A;  4GOF A;  2E74 C;  4D6T E;  4Y99 B;  2BEQ D;  1L0N J;  1UIX A;  2LR2 A;  1IFM A;  2HR3 A;  3LID A;  4PJ0 H;  3L75 E;  4DJG A;  3L71 G;  3EQ2 A;  2P10 A;  1AQT A;  1BCC J;  4BWN A;  3A5T A;  1N86 A;  1NTZ J;  4EOT A;  1VQN P;  1MV8 A;  5CCG D;  4GIF A;  5APY A;  3JSV C;  3S9O A;  3V2N A;  1NJI Q;  3AE3 C;  3WU2 H;  1K9M Q;  1EDL A;  2A06 G;  3U59 A;  2YO3 A;  3H1L E;  2FYN B;  1EXI A;  3RK3 D;  3W68 A;  3PP5 A;  2OAR A;  3BCC D;  3CCS P;  1VQK P;  3L70 G;  1P84 D;  1FC2 C;  2B88 A;  3RL0 C;  3FWL A;  2R32 A;  4YXD C;  2W90 A;  1SS1 A;  2WSF J;  2IBZ G;  1RE4 C;  3AED C;  3MIW A;  3L72 G;  4GT1 A;  4U3F G;  4LGD E;  4XFJ A;  4EDF A;  1HBW A;  3H1K J;  3H1J G;  1G2C B;  1N73 A;  3K5B A;  1NTZ K;  1OMI A;  4C7R A;  2WPS A;  1Q2N A;  3CXH D;  3HE5 B;  1L4A B;  2FFD A;  2Y0C A;  4I7Z C;  3AE8 C;  3H1L D;  3NTN A;  5B5E E;  3QWO C;  1CZQ A;  1JCD A;  1S1C X;  2FYU G;  2BCC D;  2IYP A;  3FGA D;  3RK2 C;  3W67 A;  2R3C A;  1URQ D;  2YXQ B;  1GD2 E;  1OW6 A;  1VL2 A;  1GTW A;  3CXH E;  3BAS A;  2RH0 A;  4DCK A;  3I55 P;  4UB6 H;  4NPF X;  3E1I A;  1HVV A;  1ZLL A;  2KZJ A;  2N1T A;  2Q6Q A;  3HD7 A;  4PV1 D;  1YIT P;  3AE7 C;  2IBZ D;  2A45 I;  4YXW H;  3CC4 P;  1NO4 A;  1Y9B A;  2QIW A;  2W27 A;  3V5B A;  1KIL B;  5K5G B;  2HPC B;  4U7J A;  1Y47 A;  4PJ0 E;  3U1A A;  1FZF A;  1NTK K;  2BCC E;  5CMZ A;  5BU5 A;  2E42 A;  1TU3 F;  1R5S A;  5B66 H;  1PL5 A;  3A0B H;  2E76 B;  3H1K D;  1YI2 P;  3P7K A;  2Y0D A;  2PFX A;  2MKV A;  4DZO A;  3KYQ A;  1EDJ A;  3H25 A;  1QL1 A;  2KIK A;  1FZA A;  1LWU A;  1KIL D;  4PD4 I;  4QMA A;  1NTM G;  4WY4 C;  5AW9 B;  2Q9I A;  2YKQ A;  3M0A A;  1GZL A;  5CCH A;  1KC8 Q;  3TDK A;  1CSB A;  2A45 H;  2JWD A;  2O1J A;  2RN0 A;  3CWB E;  3G3Z A;  3GF3 A;  2W6J H;  1X79 B;  2Q3E A;  1SFC C;  5CJ0 A;  5EFW B;  3MZW B;  3SSU A;  3GHG A;  1N2D C;  1SQX D;  1SQB E;  3GF7 A;  3LW5 J;  3L73 D;  5CCG A;  1LTS C;  3TGU J;  1QGK B;  2FXO A;  2YKO A;  2M8R A;  1RE3 A;  2ZVO B;  3PRJ A;  4I2L C;  1HJ0 A;  1T3U A;  1DEE G;  1SQX K;  5CBO A;  2W83 C;  1YJW P;  2OTL P;  1QL2 A;  5CBN A;  3H1H G;  4R4M A;  2QSI A;  4OH8 B;  1U7J A;  3IN6 A;  3V2Q A;  1ZR4 A;  2OYI C;  1HH0 A;  3AE5 C;  1H88 A;  2WVR A;  3AEA C;  3B5N B;  1ZR2 A;  3L73 E;  1K8A Q;  1GDT A;  3FWN A;  1SQB J;  2Y9Y A;  3Q5P A;  1P84 I;  1JUN A;  3TGU E;  2WSE H;  3L72 J;  4U3F J;  1FJK A;  1P84 H;  4WBA A;  1UII A;  5APS A;  3RK3 B;  1BE3 D;  3VP9 A;  3L37 A;  2RKL A;  2IFN A;  3S4R A;  1GL2 A;  1SQP G;  1MUU A;  1BDC A;  3HUS A;  5KJ7 D;  5GTI H;  5CJ4 A;  3LW5 H;  1SQX J;  4W7Z A;  4AQR D;  1SQP J;  3ZDM A;  4HH2 A;  1RF1 B;  1LT1 A;  3CX5 D;  3CCL P;  3V2R A;  2POH A;  3TGU D;  1RH5 B;  3IR9 A;  3H1H E;  1SQQ K;  2PP6 A;  3G9R A;  4OGQ C;  2KSJ A;  1PGO A;  1RQU A;  3L35 A;  4ZKU A;  3TYY A;  5KKZ B;  2OGU A;  5KJ7 C;  3E1R A;  3Q5R A;  1IO4 A;  1YTZ I;  2IX7 C;  3WU2 E;  3AEE C;  1J2J B;  1PGJ A;  1PP9 J;  2KK7 A;  1KQL A;  5B66 E;  1X22 A;  1VQO P;  1FDM A;  1SQP K;  1AJY A;  5DJT B;  3RL0 B;  3SWK A;  3P32 A;  3HRN A;  5APT A;  5KKZ C;  3H32 A;  3H1I J;  1AVO A;  1SQP E;  3KQG A;  2P7J A;  3U1C A;  4JPZ B;  4WY4 A;  2XKM A;  1BGY G;  2KZI A;  4PD4 H;  2WSE J;  4WWI A;  1M56 D;  2WPQ A;  1FDI A;  2IZ1 A;  1RF1 C;  1FOS E;  3RBZ A;  3HUS B;  1LJ2 A;  2YKP A;  3L71 J;  3P8M C;  3R2P A;  5AVX B;  2QG4 A;  2Z4E A;  1LTJ C;  3B5N D;  3II6 A;  1PP9 E;  4JF7 A;  2QVA A;  2I1K A;  4Y99 C;  5AW4 B;  1M1J B;  1NU1 J;  5AVY B;  4I1L A;  5AW0 B;  3S1K A;  1PZQ A;  4RKU J;  1W5C E;  2CPS A;  3B5N A;  1VQL P;  1NHL A;  1USD A;  3NFQ A;  4C7N B;  1PGP A;  1H0T A;  2HYN A;  3H1I G;  2R44 A;  2CK3 H;  1GMJ A;  2MJZ A;  3AE2 C;  1SP4 A;  1JB0 J;  1BGY E;  1KIL C;  1SQV G;  3B71 A;  2K37 A;  3NXS A;  3Q3D A;  1DH3 A;  4L76 A;  3L71 E;  3M06 A;  3H1I D;  1OVR A;  1FZC C;  2KS1 A;  1SQX G;  1FBM A;  1LTA C;  1RF0 A;  2JJL A;  2HOD A;  5E79 E;  2XZR A;  1NTM K;  1E5W A;  1HGZ A;  1NYH A;  1NU1 E;  2Q1K A;  2RMZ A;  4H13 B;  3RBX A;  2WTY A;  2E43 A;  2NRG A;  5BU8 B;  1BCC D;  2Y9Z A;  3GG2 A;  3GHG B;  5KAF E;  2O1K A;  3VN0 A;  3L71 D;  2FXM A;  3CPW O;  1J1E C;  1T2K C;  1URQ A;  1FS0 E;  3KDP B;  3L70 E;  5AW6 B;  4Y28 J;  2E5Y A;  3WUU A;  1YBK A;  2C0X A;  1NH4 A;  1NTK J;  2AXC A;  3PJS K;  5E79 H;  1BGY J;  3VTP C;  4RO0 A;  3BCC J;  4AYC A;  4D6T J;  1YQ4 C;  3D6Y A;  5L8R J;  5AW1 B;  1L0N E;  2IZ0 A;  5KLV D;  3O6Q B;  3D70 A;  4OVN F;  1AVY A;  2W8Z A;  1G1J A;  1VF5 B;  2M3E A;  1JMB A;  2ZT9 C;  1AA0 A;  1BCC E;  1HUC A;  2FYZ A;  1NGM B;  1L0N K;  2KP8 A;  3F89 A;  2P58 A;  5KTB A;  5AVQ B;  1N7S A;  2NPS B;  3CD6 P;  4GKG A;  5AW3 B;  3PHL A;  5GTH E;  3L70 J;  3H1L J;  2J59 M;  3TSI A;  2WSC J;  2KXP B;  2K9Y A;  1NOH A;  1WMK A;  1X9V A;  1JY2 N;  1T3J A;  2R3S A;  2UWJ E;  3M9H A;  4EIJ A;  3CCR P;  2OYH C;  2JWA A;  1A02 F;  3TGU G;  3L74 J;  1OIP A;  5KLI B;  1FU1 A;  5TIS H;  3BVH A;  2XV5 A;  2H7H A;  3RK3 C;  2JO1 A;  1S5L X;  1GU5 A;  3CX5 I;  3VMA A;  5TJH A;  2KYV A;  4HYT B;  3AEG C;  3WMM 0;  5KLV K;  1YTZ T;  3SFE C;  2C9L Y;  4KHX A;  1NAF A;  3AEB C;  3BAT A;  2NPS C;  3BRT B;  2FFD B;  5KLV J;  1KOR A;  1S2E A;  2CPB A;  1N73 B;  4OWF A;  1OX3 A;  1MFZ A;  3N4X A;  1GK6 A;  1CI6 A;  2LXC B;  1AFO A;  1KFN A;  1JMM A;  2ZYD A;  1M7L A;  3M9B A;  3L74 E;  1EC5 A;  2D2C B;  1JM0 A;  3F5H A;  1S5L H;  3L70 D;  4RES B;  3LIE A;  4IL6 E;  3RK3 E;  1KYO H;  2Q5U A;  5AVU B;  3OW2 O;  1ZME C;  5KAI H;  3CCE P;  2WT7 A;  2KUB A;  1K05 A;  2ZJS E;  2G3A A;  1EDI A;  1MZ9 A;  3A0H E;  4L75 A;  1QVG O;  3L75 G;  1M1K Q;  1NAY A;  2K1A A;  4RJT A;  2A45 G;  2H89 C;  2O3J A;  1NKZ B;  1VPC A;  4I6M C;  3HE4 B;  2N1T C;  3HD7 C;  1L0L J;  1LWU B;  1RE3 C;  2A06 D;  1Y8A A;  2NPS D;  1YYC A;  3HTK B;  4K35 A;  4LLH A;  2N9Y B;  1RE4 A;  2FKW B;  2ZVN B;  3CWB J;  3L73 G;  2KI7 B;  1JTH B;  1PGQ A;  1LT9 C;  1NTK G;  1PIX A;  2PRR A;  1JTH A;  2M5A B;  1Q86 Q;  1X8Y A;  2ZXE B;  3I56 P;  3C9I A;  5TIS E;  2K88 A;  1E79 H;  2I1J A;  1HGV A;  1SFC D;  3HTK A;  1N7S D;  5H2F H;  1OFC X;  3VOP A;  2ZYG A;  3Q1M A;  3MUD C;  3HE4 A;  4O9B A;  2LXB A;  1ZRT E;  1BE3 J;  4WY4 D;  1L0L E;  1OVU A;  4HJG H;  4OGQ D;  4BXL A;  1PFI A;  2HLO A;  3B8E B;  4LC1 A;  3AE4 C;  1J1E B;  1SFC A;  3QH9 A;  1EZV I;  2GM4 A;  2AEF A;  2KSE A;  4PV1 B;  1SQP D;  4H13 C;  1L0L K;  1ZP0 C;  2YNY A;  1NWQ A;  1CW5 A;  1ZXG A;  1JY2 P;  1FDO A;  2OYO A;  1VQ4 P;  1KZU B;  1KIL E;  5AVZ B;  3HE5 A;  4ASW A;  1H8A A;  4EYY Q;  4HB1 A;  3SFD C;  1G2C A;  1SQQ D;  2G8Y A;  3CWB D;  1YQ3 C;  1CI6 B;  1PP9 D;  1X0T A;  4H0L D;  2QEX P;  2QM7 A;  2W6A A;  1BE3 E;  3MD0 A;  2OTJ P;  1L4A D;  4JBZ A;  1JY3 N;  3CXH I;  1XTG B;  4TLF A;  1KV4 A;  2YO2 A;  1Q7Y Q;  2BCC G;  5KLV G;  1FE6 A;  4Z1M H;  1SQV J;  1ZV8 A;  3H1H J;  2QJK B;  2Y0E A;  1T8Z A;  4H44 D;  5AW5 B;  3GLM A;  2YIU C;  5CCH C;  2I8D A;  1KB9 H;  3CCV P;  1Q81 Q;  3T97 A;  4N3Y B;  2N9B A;  4DT0 A;  2A06 E;  2QRX A;  3M0D C;  4GDO A;  3AE1 C;  3AE6 C;  3C1L A;  1NTM E;  2FY8 A;  3H1J D;  1ZOY C;  3O8Z A;  4GOE A;  4IOI H;  2FBW C;  3G4S P;  4HKZ H;  1JNM A;  5APW A;  1NU1 D;  2XDJ A;  3H1I E;  3MTU E;  1L2P A;  1SQQ G;  2E75 B;  2H8P D;  1IK9 A;  1BE3 G;  3IFM A;  1BDD A;  3RL0 D;  1KYO D;  1WRG A;  2B87 B;  1SQV E;  2ZYA A;  3H1J E;  4ZMD A;  4CPG A;  1SQQ J;  2Z5H A;  2OYI A;  1ZRT D;  2AEJ A;  3A7O A;  2E76 C;  1RY3 A;  2BEZ F;  1MKM A;  2M0B A;  3A0B E;  5GTI E;  1LT9 A;  1OVV A;  1VQP P;  3IF4 A;  3KHU A;  2KLU A;  2J5U A;  3O6Q A;  1N73 C;  1IZN B;  2FYU E;  3KZI E;  4IL6 H;  1YHQ P;  1FAV A;  4GOD A;  1GW3 A;  1SQV D;  2XND H;  1PPJ E;  1N8R Q;  3CME P;  1VQ9 P;  1PV3 A;  2OQQ A;  4W7Y A;  4ZKP A;  1YJN P;  1LP1 B;  2AXT E;  5C39 A;  3GMA A;  2O01 H;  5B5E H;  5CHX A;  1FJP A;  3H1J J;  2YMY A;  5AVS B;  3TK1 A;  2JKV A;  2WT7 B;  1SQQ E;  2GUS A;  3N7N A;  2C9N Y;  1PPJ D;  3C8V A;  5BVZ A;  1J1D C;  1L0N G;  1OXZ A;  2QJY C;  1QVF O;  2WQY C;  1NTK D;  2H88 C;  1BGY D;  2LKM A;  3CI9 A;  3CL3 D;  4JYB A;  3RK2 D;  3D6Z A;  4D6T D;  2AEM A;  2FYU J;  1KB9 I;  4ASV A;  3VMY A;  1QEX A;  1OW8 A;  1QLE D;  1R5L A;  5AW2 B;  1AV1 A;  2L5G B;  2P1J A;  2PGD A;  2K9J B;  3MGN A;  1JCC A;  1U7M A;  3I5C A;  5KAF H;  1NTZ G;  1NKN A;  1SVF A;  1KTM A;  1H0T B;  4M3L A;  4H0L B;  2FFD C; 
#chains in the Genus database with same CATH homology
 1SQV K;  1N7S C;  1KFM A;  2KOG A;  1RF0 C;  1HTL C;  2GUV A;  4AUW A;  1J1D B;  3TNU B;  1JOC A;  1LTJ B;  1S9K D;  3OJA B;  3M0D A;  3SWF A;  2OYH A;  5APX A;  3L4F A;  1URQ C;  1WT6 A;  2WPR A;  1NU1 K;  2ZFC A;  4WY4 B;  3H32 B;  3R2P A;  4DZO A;  1N7S B;  2NPS A;  3VMX A;  2WWW A;  1EQ7 A;  3V2P A;  1HWT C;  1LTB C;  2WIT A;  1FOS F;  2BAS A;  1LWU C;  5APQ A;  3VP8 A;  3A2A A;  1URQ B;  3V4W A;  1FZE A;  3GHG C;  4N78 E;  3UIA A;  2P2U A;  1GL2 B;  3HUS C;  3TNU A;  5CCG C;  5CCH D;  1SLQ A;  2W6B A;  5APU A;  1IFN A;  1XTC C;  5AW7 B;  2XNX A;  2H43 A;  3NMD A;  2M3B A;  2HOD B;  1LTG C;  1W2E A;  1L4A C;  1N7L A;  2FYU K;  1LGH B;  3CLQ A;  4IFD K;  1GK4 A;  2IFM A;  3A3Y B;  4N78 D;  1Z56 A;  5AVR B;  1IFJ A;  1IC2 A;  4IFM A;  4XA4 A;  4C7N A;  1S9K E;  1ZN5 A;  1GU4 A;  1LTT C;  2PAJ A;  3P8C E;  3V4Q A;  1M1J A;  4IFF A;  1LTI C;  2Z5I A;  3OA7 A;  4W80 A;  2R5D A;  2R5B A;  1JO5 A;  1GL2 D;  1JY3 P;  2C0W A;  3P8C D;  5KJ7 A;  3M91 A;  1T2K D;  3H6P A;  5APV A;  4N6J A;  5AVV B;  2Q7C A;  1KIL A;  4JYC A;  2IPP A;  1DEB A;  1JY3 O;  1GW4 A;  1FZB A;  2N1T B;  3HD7 B;  3VYI A;  3BRV B;  1RF1 A;  1GL2 C;  1SQB K;  4B86 A;  2OYH B;  1LTJ A;  1DX7 A;  1FZG A;  1HJB A;  2JEE A;  1H89 A;  2HFE D;  2KLV A;  1IFD A;  1L4A A;  3B5N C;  5AVT B;  2VRS A;  5AVW B;  4XE5 B;  2Q3I A;  1VDF A;  4WB4 A;  2WSC H;  1IJD B;  2J58 A;  3MUD A;  4C46 A;  2WZ7 A;  1M1J C;  2KB7 P;  1SFC B;  2XU6 A;  2P67 A;  3RK2 B;  1G1I A;  2N1T D;  3HD7 D;  3M9Q A;  1A02 J;  2QM8 A;  1IFI A;  3VMZ A;  1OWA A;  2HG5 D;  1JY2 O;  3OAK A;  4DOJ A;  1FZC B;  5AW8 B;  3KPE A;  2WSF H;  1LT9 B;  3L36 A;  2OYI B;  3SWY A;  2HPC A;  1FZC A;  3EFG A;  4Y99 B;  1IFM A;  3LID A;  3EQ2 A;  3A5T A;  4EOT A;  1N86 A;  1MV8 A;  5CCG D;  4GIF A;  5APY A;  3V2N A;  3U59 A;  2YO3 A;  3RK3 D;  3PP5 A;  2OAR A;  3RL0 C;  2R32 A;  1RE4 C;  3MIW A;  4GT1 A;  4LGD E;  1HBW A;  1G2C B;  1N73 A;  1NTZ K;  4C7R A;  2WPS A;  3HE5 B;  2FFD A;  1L4A B;  3NTN A;  1CZQ A;  1JCD A;  3RK2 C;  2R3C A;  1URQ D;  1GD2 E;  1GTW A;  3BAS A;  3E1I A;  1HVV A;  1ZLL A;  2N1T A;  3HD7 A;  2A45 I;  1NO4 A;  2W27 A;  3V5B A;  1KIL B;  2HPC B;  1FZF A;  3U1A A;  1NTK K;  5CMZ A;  5BU5 A;  2E42 A;  3P7K A;  3KYQ A;  1QL1 A;  1FZA A;  1LWU A;  1KIL D;  4WY4 C;  5AW9 B;  2Q9I A;  3M0A A;  2YKQ A;  1GZL A;  5CCH A;  1CSB A;  2A45 H;  2O1J A;  3G3Z A;  1X79 B;  5CJ0 A;  1SFC C;  3GHG A;  1N2D C;  5CCG A;  1LTS C;  2YKO A;  2M8R A;  1RE3 A;  4I2L C;  1T3U A;  1SQX K;  1QL2 A;  1ZR4 A;  4OH8 B;  3V2Q A;  2OYI C;  1HH0 A;  1H88 A;  3B5N B;  1ZR2 A;  1GDT A;  1JUN A;  2WSE H;  1FJK A;  4WBA A;  5APS A;  3RK3 B;  3VP9 A;  3L37 A;  2IFN A;  1GL2 A;  1MUU A;  3HUS A;  5KJ7 D;  5CJ4 A;  3LW5 H;  4W7Z A;  4AQR D;  4HH2 A;  1RF1 B;  3V2R A;  2POH A;  3IR9 A;  1SQQ K;  2PP6 A;  2KSJ A;  3L35 A;  4ZKU A;  3TYY A;  5KJ7 C;  1IO4 A;  1YTZ I;  2IX7 C;  1J2J B;  1FDM A;  1KQL A;  1SQP K;  3RL0 B;  3P32 A;  3HRN A;  5APT A;  3H32 A;  3KQG A;  2P7J A;  3U1C A;  4WY4 A;  2XKM A;  2WPQ A;  1RF1 C;  1FOS E;  3HUS B;  2YKP A;  3P8M C;  5AVX B;  2Z4E A;  1LTJ C;  3B5N D;  3II6 A;  4JF7 A;  2I1K A;  4Y99 C;  5AW4 B;  1M1J B;  5AVY B;  4I1L A;  5AW0 B;  2CPS A;  3B5N A;  1NHL A;  3NFQ A;  4C7N B;  2HYN A;  2MJZ A;  1SP4 A;  1KIL C;  3NXS A;  1DH3 A;  3M06 A;  1FZC C;  2JJL A;  1FBM A;  1LTA C;  1RF0 A;  2HOD A;  2XZR A;  1NTM K;  1E5W A;  1HGZ A;  2WTY A;  2E43 A;  5BU8 B;  3GHG B;  2O1K A;  3VN0 A;  1T2K C;  2FXM A;  1J1E C;  1URQ A;  3KDP B;  5AW6 B;  2C0X A;  1NH4 A;  3VTP C;  4AYC A;  5AW1 B;  1G1J A;  1HUC A;  2FYZ A;  1L0N K;  2KP8 A;  5KTB A;  5AVQ B;  1N7S A;  2NPS B;  4GKG A;  5AW3 B;  3TSI A;  2J59 M;  1NOH A;  1X9V A;  1JY2 N;  1T3J A;  3M9H A;  4EIJ A;  2OYH C;  1A02 F;  1FU1 A;  3BVH A;  2H7H A;  2XV5 A;  3RK3 C;  2KYV A;  4HYT B;  3WMM 0;  5KLV K;  1YTZ T;  2C9L Y;  4KHX A;  1NAF A;  3BAT A;  3BRT B;  2NPS C;  2FFD B;  2CPB A;  1N73 B;  1MFZ A;  3N4X A;  1GK6 A;  1CI6 A;  1AFO A;  1KFN A;  1JMM A;  1M7L A;  3M9B A;  4RES B;  3LIE A;  2Q5U A;  5AVU B;  2WT7 A;  1MZ9 A;  2A45 G;  1NKZ B;  1VPC A;  4I6M C;  3HE4 B;  2N1T C;  3HD7 C;  1LWU B;  1RE3 C;  2NPS D;  3HTK B;  1YYC A;  4LLH A;  1RE4 A;  2FKW B;  1JTH B;  1LT9 C;  1JTH A;  1X8Y A;  2ZXE B;  3C9I A;  2I1J A;  1HGV A;  1SFC D;  3HTK A;  1N7S D;  3VOP A;  3HE4 A;  4O9B A;  4WY4 D;  1PFI A;  2HLO A;  3B8E B;  4LC1 A;  2GM4 A;  1J1E B;  1SFC A;  1L0L K;  2YNY A;  1NWQ A;  1JY2 P;  1KZU B;  5AVZ B;  3HE5 A;  1H8A A;  1G2C A;  1CI6 B;  2QM7 A;  2W6A A;  3MD0 A;  1L4A D;  1JY3 N;  1XTG B;  2YO2 A;  1ZV8 A;  5CCH C;  1GU5 A;  1T8Z A;  5AW5 B;  3T97 A;  4N3Y B;  2N9B A;  3M0D C;  3O8Z A;  1JNM A;  5APW A;  2XDJ A;  3MTU E;  1CW5 A;  2H8P D;  1IK9 A;  3IFM A;  3RL0 D;  1WRG A;  2Z5H A;  2OYI A;  3A7O A;  1RY3 A;  1LT9 A;  1AQ5 A;  2C9N Y;  1N73 C;  1FAV A;  1GW3 A;  4W7Y A;  4ZKP A;  2O01 H;  5CHX A;  1FJP A;  2YMY A;  5AVS B;  3TK1 A;  2WT7 B;  2GUS A;  3N7N A;  5BVZ A;  1J1D C;  1OXZ A;  2LKM A;  4JYB A;  3CI9 A;  3CL3 D;  3RK2 D;  3VMY A;  5AW2 B;  2L5G B;  2P1J A;  3MGN A;  1JCC A;  3I5C A;  1NKN A;  1SVF A;  4M3L A;  2FFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...