3NMDA

Crystal structure of the leucine zipper domain of cgmp dependent protein kinase i beta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
GSLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQMLQNELDKYRSVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystal structure of the cyclic GMP-dependent protein kinase I{beta} dimerization/docking domain reveals molecular details of isoform-specific anchoring.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cGMP Dependent PRotein Kinase
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nmdA00
3VMYA 5AVZB 3P7KA 5AW1B 1X8YA 4AYCA 1GK4A 3M06A 4RESB 2WPSA 4KHXA 5AVVB 4JYBA 1GTWA 4LC1A 3V4QA 1S9KE 5APUA 3A3YB 5AVRB 3VTPC 4M3LA 3HE4A 1GK6A 1A02F 5APVA 1IO4A 3VMZA 2YO3A 1H89A 1HBWA 1H88A 4EOTA 1CZQA 2XV5A 4JYCA 5APWA 3NTNA 2N9BA 1DH3A 2WWWA 2W27A 3MD0A 5CMZA 1HUCA 4B86A 2YNYA 5APTA 3KDPB 4AUWA 5AW0B 3O8ZA 3OAKA 3HE4B 3HE5B 2E43A 3B8EB 2ZFCA 3M0DA 2WT7A 1FOSF 5AW8B 1HJBA 4AQRD 2IPPA 4XE5B 3VN0A 1MFZA 2R32A 4HYTB 3A7OA 3V5BA 1CSBA 3M9HA 3M9BA 2YO2A 5AW5B 2P67A 2Q3IA 1G2CB 4C7NB 3L37A 1CI6B 5AVXB 2QM7A 3HE5A 2WTYA 3L36A 2XU6A 1MV8A 3L35A 3I5CA 1KQLA 3M0AA 1CI6A 5APYA 1GD2E 3A5TA 5AVTB 3VMXA 3A2AA 3LIDA 2BASA 2R3CA 2P7JA 3V4WA 2JJLA 2Z5IA 2W6AA 3P32A 2C9LY 3UIAA 3M91A 5AW6B 3VYIA 1OWAA 1HWTC 5AW7B 5AVWB 2P2UA 5APSA 3SWFA 3TNUB 5AW3B 1NWQA 2WPQA 5APQA 5AVUB 1GU4A 3NMDA 4GT1A 2XZRA 2R5DA 2WT7B 1FOSE 1J2JB 2E42A 2VRSA 2Z5HA 3IR9A 5AVYB 3KQGA 3NXSA 4I6MC 2ZXEB 2Q5UA 4I2LC 2C9NY 3TYYA 1S9KD 1YYCA 5AVSB 3T97A 2KP8A 2R5BA 1JNMA 1FAVA 5AW4B 3TNUA 4C7NA 2H7HA 1GZLA 1T2KD 5AW9B 1A02J 1OXZA 1SP4A 2WPRA 1MUUA 1SLQA 3MGNA 1H8AA 3TK1A 3LIEA 4GKGA 3P8MC 4C46A 2QM8A 1NAFA 1JUNA 1T2KC 3HTKA 4DZOA 5AVQB 3NFQA 5APXA 2Q7CA 5AW2B 1GU5A
chains in the Genus database with same CATH superfamily
3KPEA 5AVZB 3LW5J 4CPGA 5AW1B 3RGUA 1QVFO 1L4AC 3RL0g 3E1IA 4L76A 2V7QJ 3RBXA 2O3JA 2PP6A 3CX5D 3H6PA 3TGUG 3S9OA 1OVVA 4JYBA 4W7ZA 1H0TB 2D2CB 4LC1A 3H1HG 1DEEG 3L74E 3RL0B 1YJ9P 3D71A 2E75C 5APUA 1AVYA 3JCUH 3VTPC 1HVVA 2GA1A 1JM0A 1NTZG 3RK2D 2OTJP 2B88A 3HE4A 4WY4A 3FXEA 3R4YA 3TGUE 1S72P 1QGKB 2YO3A 2O1KA 3IF4A 1H89A 4U3FJ 3CWBD 1BGYD 1YBKA 2M3BA 3USSA 1H88A 2IBZG 4JYCA 2QG4A 1VQ9P 2AXTE 4U3FD 1EZVE 1L4AA 1KMIZ 3AE2C 2N9BA 4PJ0H 2H88C 2M3EA 2P1JA 3B5NB 1EDKA 1PP9G 1T6AA 2G3AA 2YKOA 3O8ZA 3OAKA 5KJ7C 1LP1B 1U57A 1SQBE 2WSSH 1BGYE 2W6BA 4EDFA 1Q86Q 1NTKJ 1NKZB 2ZFCA 3M0DA 2WT7A 1FOSF 3BCCD 1HJBA 2IPPA 4GIFA 1T3UA 3CX5I 4H0LD 1HGZA 2KIKA 3AE3C 3IN6A 4GOEA 3WMM0 2IYPA 3A0BH 2B87A 3A7OA 1CSBA 5C39A 1Q7YQ 1SQBK 1KB9D 1MFTA 1E5WA 1RH5B 3MTUE 1K04A 2OYHA 5TISH 2Q3IA 1FZAA 3Q5RA 2HPCB 4AYCA 2RH0A 3AE9C 1QL1A 3L37A 1EXJA 3CCEP 2IZ0A 2QM7A 3HE5A 4WY4B 1VQKP 1BCCE 1LWUC 1BE3E 4UB8E 4IFDK 2BCCG 3L73D 1NKNA 1IZNB 1T8ZA 3L70G 4D6TG 1OFCX 1SQQD 3L74G 1RQVA 1ZLLA 2HODB 2R44A 3CWBJ 3MP7B 1VQLP 1FBMA 3H32B 1LTGC 1JY3O 1ZN5A 2JWAA 3BASA 1GD2E 4H44D 2YIUC 2ZJSE 3B5ND 4LLHA 3CCUP 1NGMB 3H1LG 4WBAA 5CCHA 1IC2A 3MHVA 5CCGA 1RF1B 1URQB 1EDIA 3H1JJ 3PLNA 1OIPA 1NU1E 2JJLA 4N78D 1KB9I 2BEQD 1ZOYC 2W6AA 3EFGA 1LTJB 2JDIH 3FWNA 1BDDA 3H1JD 4H13C 1OW8A 1GW3A 3GHGB 3E7KA 3M91A 1PP9E 2JO1A 5AW6B 1NHLA 2E74C 2FFDB 1FE6A 1IFMA 3N7NA 4BWNA 1NYHA 3KXDA 3GW6A 3L72J 5APSA 4XA4A 3KHUA 1GDTA 3M9QA 1YJNP 3U59A 1NWQA 1KN7A 1FU1A 2E75D 2IFNA 2FYUK 1GU4A 1FZGA 3CWBE 1JCDA 3H1IJ 1PIXA 2B9BA 4Y99B 2E42A 1FZCC 1PPJG 2ZT9B 3AEBC 2FYNB 3FWLA 3H1ID 3L73J 5BVZA 4I6MC 4ASWA 3L70J 1L4AD 4OGQB 4I2LC 2LR2A 4K3AA 2FBWC 1YYCA 2KS1B 3TYYA 3BVHA 2K9YA 2G8YA 1BE3G 2KP8A 1SQXK 2YMKA 3HUSC 1EZVG 1NTKK 1USEA 3CX5E 4C7NA 1GW4A 2QJKC 3EFFK 4LGDE 4PV1C 1X22A 4GOFA 1YJWP 1JMMA 1HJ0A 1GL2C 2ZYAA 3MGNA 3MUDA 4IL6E 4YXDC 3LIEA 5BU8B 3P8MC 2XNDH 3E1RA 1G2CA 2QM8A 3SSUA 4RJTA 1VF5D 4KJMA 2KXPB 1T2KC 2Y0CA 3RK3B 2ITAA 3HTKA 1N73C 2W6JH 5DJUB 2D2CD 5L8RJ 4C7RA 3JC22 4GODA 2CK3H 3A0HE 1VF5B 3L71E 5AW2B 3ZDMA 1YIJP 3TDKA 3FXDA 1GK4A 1NTME 2AEJA 1SQQE 2WPSA 2GM4A 5AVVB 1RE4A 1KC8Q 1VF5C 2CPBA 3AEGC 3H1LD 1UIXA 1SQXG 4Y28J 1VPCA 1M1JA 1S5LX 3H1LJ 1ZW0A 2N1TB 2O01J 3W67A 1N73B 3JCUE 1BCCG 1GK6A 1ZV8A 4PV1D 1A02F 5APVA 3H1KE 3VMZA 1SQQK 2PRRA 3KYQA 1SQXD 1HBWA 1NTZJ 3H25A 1LTTC 2QJKB 1SQXJ 4IFMA 4PV1B 5CCHD 1PPJE 1JTHA 5CCGC 1RF0A 2GUSA 1YITP 1JY3P 5CCHC 5CBOA 1DH3A 1PFIA 1FDMA 4B86A 3H1KG 1FZFA 4H0LB 5APTA 1PGPA 3AEDC 3G6EP 2NZ2A 4OGQC 1VQ7P 4AUWA 1SQBD 1WRGA 2L91A 3CLQA 3U1AA 1AFOA 1J1DC 2ZT9C 1JCCA 2OGUA 2JEEA 5CBNA 1FZCB 5TISE 4Y99C 2E43A 3B8EB 1M56D 1TU3F 2PGDA 2CPSA 1LWUA 1ZRTE 3Q1MA 2HPCA 2WSFH 4XE5B 2IDBA 3MZWB 3VN0A 3OA7A 1QVGO 3HD7A 2OYIA 2MKVA 4HYTB 2LKMA 2W90A 2B89A 2GUVA 1P84H 3H1LE 3P8CD 3SFDC 2QEXP 1BE3D 3V2RA 1BCCD 3M9BA 3RK2B 1L0LE 1NTMD 1S1CX 1PP9J 2P67A 1K9MQ 1BE3J 1QL2A 4W80A 2HODA 4DT0A 1NTZE 2K37A 2QE7H 2A45G 2NPSA 3AE7C 3H32A 3QWOC 1OZHA 1LTJC 4H13B 1YQ3C 1USDA 2M0BA 3L36A 2WSCH 3L35A 1EDLA 2K88A 1KQLA 1CI6A 3M0AA 5APYA 1BSNA 5KJ7A 1RF1C 1AVOA 1NOHA 1S2EA 3BCCE 2KNCA 1E79H 2YIUB 2ZAEB 3HRNA 1YQ4C 1JOCA 5AVTB 3TF5A 3P8CE 4ZNCA 2OARA 1FS0E 3F89A 2M8RA 3KZIE 2A45H 1KV4A 2E76D 1DD4A 1NJIQ 2YXQB 2LXCB 2HLOA 3L75J 2H8PD 3IAOA 1N7LA 5GTHE 1JY2P 1L0NJ 4R4LA 3BRVB 4EIJA 2Q1KA 2KZIA 3H1KJ 2A06G 3P32A 2P58A 4JF7A 3O6QB 4WY4C 4U3FE 3RL0D 3U1CA 1CW5A 1VDFA 1IO4A 3RBZA 3H1HE 3VYIA 1M57D 1S4XA 4NPDA 5KLVD 3CC4P 3CCRP 1JMBA 1JY3N 2UWJE 3VMAA 2P2UA 5B66H 2H89C 1BCCJ 2ZYDA 5AW3B 1GU5A 5APQA 1PL5A 1N7SA 1Q2NA 2V4HA 3L74D 5AVUB 1NTKD 1P84D 2XZRA 4GT1A 5KJ7D 2R5DA 1L0LK 2W8ZA 4H13D 1NTKE 1P84E 3BCCJ 1NU1G 3AE5C 3L70E 3IR9A 3SWYA 1U7MA 5AVYB 3CCSP 2XDJA 4L73A 1G1IA 3S1KA 1IJDB 1MZ9A 1X0TA 5E79H 2POHA 3OJAB 3V2PA 2IX7C 1S9KD 2C9NY 1G1JA 3CI9A 4N78E 2ZVNB 3TGUJ 4DCKA 3B5NC 3T97A 3II6A 3L75E 2R5BA 2Y9YA 5KLVE 1VQPP 1JNMA 1FAVA 2OTLP 3TNUA 3GLMA 1LT9A 2SPZA 2OTKE 3HTKB 1EC5A 2KSJA 3H1JG 4RKUJ 3RK2C 1OXZA 5KAFE 1SLQA 5GTIH 2IZ1A 4PD4I 2KYVA 3BCCG 4N3YB 1LNQA 1HH0A 4ZKUA 3CXHD 4I1LA 1L0ND 2AXTH 2Y0EA 3A0BE 4BXLA 5KLVK 1N8RQ 1ZP0C 1OVUA 1HF9A 4W7YA 1XTGB 1KYOD 5APXA 1KD1Q 1S5LH 1Q81Q 2D2CC 1S3JA 3VMYA 4BRYB 4IOIH 1AV1A 1J1DB 4YPCA 3CC7P 2QVAA 1BSHA 3SWKA 1L4AB 4RESB 3MIWA 5B66E 2BCCJ 4H0LC 1KB9E 4TLFA 2IBZD 1FJKA 1SQVD 1GTWA 3AEAC 4H44B 4MN4C 2RKLA 3V4QA 4NPEA 3V2QA 3PP5A 5B5EH 3I56P 1RF1A 3A3YB 1SQVJ 2A06D 2L5GB 1LT1A 3CXHH 3G3ZA 3HD7D 4PJ0E 2KZJA 5CHXA 3C8VA 2WSEH 3H1HD 1BDCA 1CZQA 2KSEA 2XV5A 1URQD 5KLIB 2N1TC 3L71G 3R2PA 1L0NK 2WWWA 1LTSC 1RE3A 2KOGA 1SFCD 2YXRB 1HUCA 1FC2C 1LTIC 2ZXXA 2YNYA 4I7ZB 2ZVOB 4UB8H 2JR8A 5E79E 2FKWB 3KDPB 2OYHB 2PFXA 5AW0B 1EZVD 3HD7B 2OYIB 3HE4B 3PJSK 1LJ2A 1PGOA 1NO4A 3CCVP 2P10A 3HE5B 3W68A 1JY2O 3H1JE 2NPSD 2IBZI 2K1AA 1L2PA 4BRYA 1BGYJ 4DOJA 3OW2O 1IFDA 3H1IG 5KAIE 2QA4P 3RK3C 1HTLC 1IFNA 1PPJD 2R32A 2WMMA 3CWBG 2NPSB 1Z56A 1DIPA 1SQVE 3M9HA 1NAYA 1OW6A 1GL2B 1M7LA 4D6TD 2QSIA 2YO2A 1NTZK 1SQPG 2J59M 1ZR2A 1Q82Q 4N6JA 3D6ZA 1W2BO 4C7NB 4D6TJ 4OWFA 1CI6B 1Y8AA 2KUBA 1URQA 3HUSB 1L0LD 1X79B 4WVZA 4L74A 4EYYQ 1FZEA 2KNCB 4PD4D 5BU5A 5KKZC 2WZ7A 2HR3A 2KB7P 2WVRA 4PD4E 3Q5PA 2KI7B 1IFPA 2WITA 3L71J 3AE8C 2I1JA 4U3FG 3TSIA 2FYNC 1FDOA 1M1JC 2W83C 3GF7A 5EFWB 1ZRTD 1FDIA 3RK3D 5GTIE 4HB1A 3A5TA 2RN0A 5CJ0A 4HKZH 1H0TA 2BCCE 3CCMP 2YMYA 3BATA 3O6QA 3PHLA 4HH2A 1NU1K 2FYUE 2BEZF 1SVFA 1VQMP 2KLUA 1KQGB 2MJZA 2P7JA 2WSCJ 1NTKG 2JP3A 2Z5IA 4Z1MH 3CCJP 1KB9H 1NH4A 3I55P 2E74B 2ZYGA 2FFDC 5GTHH 4UB6E 1UIIA 1PZQA 2C9LY 4U7JA 1N73A 3GHGC 3CCQP 1AJYA 3L70D 1N7SB 3L72E 1SQXE 1OWAA 1SFCC 1ZXGA 4PD4H 5AW7B 5KLVG 1HWTC 1GL2A 3MUDC 5AVWB 1AA0A 2PAJA 3SWFA 1J1EB 1YI2P 1KZUB 1KQSO 1URQC 1EZVI 3H1IE 1T3JA 3HUSA 4ZKPA 2OQQA 3L72G 3V2NA 3Q5SA 4O9BA 2WT7B 1K05A 1LTAC 1J2JB 1R8EA 1LGHB 2VRSA 1YTZI 2WQYC 4YXWH 2A06E 1FZCA 2M5AB 2Q5UA 2QIWA 3N4XA 3L71D 2FYZA 1LWUB 2C0XA 2K9JA 4IFFA 1KTMA 3L72D 1PP9D 4RO0A 2AEMA 1OW7A 2YKPA 1NU1J 1GZLA 2H7HA 3D70A 1AQTA 1Y9BA 3PTZA 5AW9B 3WU2E 1GMJA 1VQ6P 1IK7A 1SP4A 3ITKA 2E5TA 3TK1A 2QJYC 1M90Q 2E76C 3LW5H 3S4RA 1NAFA 2AXCA 1VQOP 1NTMG 2JWDA 4QMAA 5B5EE 5KTBA 1JUNA 1BGYG 1DEBA 4UB6H 4WWIA 2FYUG 1VL2A 5AVQB 2KS1A 2Q7CA 1N7SD 1N2DC 1KYOI 1X9VA 4XFJA 1NTZD 1SQQJ 3P7KA 2RMZA 1X8YA 3CXHI 1DX7A 3CMAP 1KORA 3M06A 2FXPA 4KHXA 2FXOA 2HFED 1K73Q 1VQ8P 3L75D 3G71P 1KILD 1Y47A 3L73E 3VP9A 1SFCA 1ZR4A 1S9KE 1SQBG 1QX8A 1JY2N 1R5LA 3AE4C 5AVRB 2JKVA 4M3LA 3Q3DA 3GHGA 3SFEC 2E76B 2M5AA 2I8DA 2Z4EA 1KYOH 5M1BA 2QJYB 1XTCC 4L75A 2FFDA 3EWKA 1RE4C 4D6TE 1EXIA 2Y0DA 3GG2A 1HGVA 1W5CE 4EOTA 2HG5D 1W2EA 1SQPK 4WB4A 3B71A 3NTNA 5APWA 1JB0J 3ABVC 2J58A 2E75B 4YTPC 3WUTA 2FY8A 2W27A 3MD0A 3PRJA 5CMZA 3A0HH 4OGQD 3RL0C 1NU1D 1P84I 1VQ5P 1NTMK 4K35A 4DJGA 4OH8B 3G9RA 4WY4D 3CX5H 2V7QH 2R3SA 5KAIH 3CMEP 2LXBA 2IYOA 1YHQP 3B5NA 3M0DC 4IL6H 4ASVA 5AW8B 2QJPC 4AQRD 2J5UA 4GDOA 1SQVK 4JBZA 1MFZA 3QH9A 1JO5A 1JTHB 2WPVB 1J1EC 3C1LA 3V5BA 1KILE 3L4FA 2YKQA 1M1KQ 5DJTB 3F5HA 1SFCB 5AW5B 1KILB 1N7SC 2FXMA 2I1KA 2XKMA 1VQNP 1G2CB 1LT9B 4IL6X 4JQ0D 5AVXB 2B87B 2AEFA 3WUUA 3L75G 1LTBC 1WMKA 3B4SA 3IFMA 2QRXA 1PV3A 2WTYA 2XU6A 1MV8A 2Q3EA 3VOPA 3AEEC 4HJGH 2O1JA 1RQUA 3I5CA 5H2FH 1K8AQ 1SQPJ 1YTZT 3Q2YA 5CJ4A 3CCLP 1KQFB 1OMIA 2DW3A 2FYUJ 3VMXA 3A2AA 3LIDA 2XNXA 1KYOE 1RE3C 1NTMJ 1RY3A 1SQVG 1M8OB 1RHZB 2BASA 1M1JB 2C0WA 2WSEJ 2A45I 2HYNA 2R3CA 1L0NE 3FX0A 2N1TA 3CXHE 1EDJA 1FJPA 3L74J 3V4WA 4A7PA 1S5LE 1QLED 1D7MA 2ZT9D 5KKZB 1OX3A 3H1HJ 1KFMA 3CD6P 3BRTB 2E5YA 3GMAA 3KZIH 3UIAA 2N9YB 1L0NG 3VP8A 1JEKA 1KFNA 3EQ2A 1PGJA 5KAFH 5K5GB 2O01H 1VQ4P 3TGUD 3AEFC 5CCGD 1LTJA 2OYOA 1KILA 1IFJA 1MKMA 2NPSC 3WUVA 5TJHA 3C9IA 3AE6C 3AECC 3V6IA 3TNUB 3G4SP 4TT3H 3CPWO 2KK7A 2WPQA 1IFIA 3NMDA 2IBZE 2K3RA 2KLVA 4JPZB 1FOSE 2K9JB 2NRGA 3WU2H 3H1KD 2Z5HA 4R4MA 1SQBJ 2O01N 2E74D 2H43A 3CC2P 3KQGA 1L0LG 3NXSA 1N86A 3HD7C 2OYIC 3JSVC 2ZXEB 3AE1C 1FZBA 1SS1A 5H2FE 5KLVJ 3K5BA 2Q9IA 2OYHC 2N1TD 1SQPD 2IFMA 4I7ZC 4ZMDA 3CL3D 3FGAD 5AVSB 2Y9ZA 4OVNF 3D6YA 3GF3A 3PH0A 1SQQG 5AW4B 2FYUD 4KT0J 1LT9C 1T2KD 1OVRA 1PGQA 5KLIC 1KILC 2BCCD 1QEXA 3L73G 1L0LJ 1A02J 1ZMEC 2WPRA 1MUUA 1H8AA 1AQ5A 4GKGA 3RK3E 1GL2D 4NPFX 2Q6QA 4C46A 1RF0C 2WSFJ 1IK9A 1DD3A 1R5SA 1LP1A 1WT6A 1EQ7A 4DZOA 2QJPB 3NFQA 1SQPE 4H44C 4EI2A 1NVOA 1Q90D 3T97B 1U7JA
chains in the Genus database with same CATH topology
3KPEA 5AVZB 5AW1B 1L4AC 3E1IA 4AYCA 2PP6A 3H6PA 4JYBA 4W7ZA 4LC1A 3RL0B 5APUA 3VTPC 1HVVA 3RK2D 3HE4A 4WY4A 2YO3A 2O1KA 1H89A 1H88A 2M3BA 4JYCA 1L4AA 2N9BA 2P1JA 3B5NB 2YKOA 3O8ZA 5KJ7C 3OAKA 2W6BA 1NKZB 2ZFCA 3M0DA 2WT7A 1FOSF 1HJBA 2IPPA 4GIFA 1T3UA 1HGZA 3WMM0 3A7OA 1CSBA 1SQBK 1E5WA 3MTUE 2OYHA 2Q3IA 1FZAA 2HPCB 3L37A 1QL1A 2QM7A 3HE5A 4WY4B 1LWUC 4IFDK 1NKNA 1T8ZA 1ZLLA 2HODB 1FBMA 3H32B 1LTGC 1JY3O 1ZN5A 3BASA 1GD2E 4LLHA 3B5ND 4WBAA 5CCHA 1IC2A 5CCGA 1RF1B 1URQB 4N78D 2JJLA 2W6AA 3EFGA 1LTJB 1GW3A 3GHGB 3M91A 5AW6B 1NHLA 2FFDB 1IFMA 3N7NA 5APSA 4XA4A 1GDTA 3M9QA 3U59A 1NWQA 1FU1A 1GU4A 2IFNA 2FYUK 1FZGA 1JCDA 4Y99B 2E42A 1FZCC 5BVZA 4I6MC 1L4AD 4I2LC 3TYYA 3BVHA 1YYCA 2KP8A 1SQXK 3HUSC 1NTKK 4C7NA 1GW4A 4LGDE 1JMMA 3MUDA 1GL2C 3MGNA 3LIEA 5BU8B 3P8MC 1G2CA 2QM8A 1N73C 1T2KC 3RK3B 3HTKA 4C7RA 5AW2B 1GK4A 2WPSA 2GM4A 5AVVB 1RE4A 2CPBA 1VPCA 1M1JA 1N73B 2N1TB 1GK6A 1ZV8A 1A02F 5APVA 3VMZA 1SQQK 3KYQA 1HBWA 1LTTC 4IFMA 5CCHD 5CCGC 1JTHA 1DH3A 1RF0A 2GUSA 1PFIA 1JY3P 5CCHC 1FDMA 4B86A 1FZFA 5APTA 4AUWA 3U1AA 1WRGA 1AFOA 3CLQA 1J1DC 1JCCA 2JEEA 1FZCB 4Y99C 2E43A 3B8EB 2CPSA 1LWUA 2HPCA 2WSFH 4XE5B 3VN0A 3OA7A 3HD7A 2OYIA 4HYTB 2LKMA 2GUVA 3P8CD 3V2RA 3M9BA 3RK2B 2P67A 4W80A 1QL2A 2HODA 4HH2A 3H32A 2A45G 2NPSA 1JO5A 1LTJC 3L36A 2WSCH 3L35A 1KQLA 1CI6A 3M0AA 5APYA 5KJ7A 1RF1C 1NOHA 5AVTB 3HRNA 1JOCA 3P8CE 2OARA 2M8RA 2A45H 2HLOA 2H8PD 1N7LA 1JY2P 4EIJA 3BRVB 3RL0D 4WY4C 3P32A 4JF7A 1CW5A 3U1CA 1VDFA 3VYIA 1JY3N 2P2UA 5AW3B 5APQA 1N7SA 5AVUB 4GT1A 2XZRA 5KJ7D 2R5DA 1L0LK 3IR9A 3SWYA 5AVYB 2XDJA 1G1IA 1IJDB 1MZ9A 2POHA 3OJAB 3V2PA 2IX7C 1S9KD 2C9NY 1G1JA 3CI9A 4N78E 3B5NC 3T97A 3II6A 2R5BA 1JNMA 1FAVA 3TNUA 1LT9A 3HTKB 2KSJA 3RK2C 1OXZA 1SLQA 2KYVA 4N3YB 1HH0A 4ZKUA 4I1LA 5KLVK 4W7YA 1XTGB 5APXA 3VMYA 1J1DB 1L4AB 4RESB 3MIWA 1FJKA 1GTWA 3V4QA 3V2QA 3PP5A 1RF1A 3A3YB 2L5GB 3G3ZA 5CHXA 2WSEH 1CZQA 2XV5A 1URQD 2N1TC 3R2PA 1L0NK 2WWWA 3HD7D 1LTSC 1RE3A 2KOGA 1SFCD 1HUCA 1LTIC 2Z4EA 2YNYA 2FKWB 3KDPB 2OYHB 5AW0B 3HD7B 2OYIB 3HE4B 1NO4A 3HE5B 1JY2O 2NPSD 4DOJA 1IFDA 3RK3C 1HTLC 1IFNA 2R32A 2NPSB 1Z56A 3M9HA 1GL2B 1M7LA 2YO2A 1NTZK 2J59M 1ZR2A 4N6JA 4C7NB 1CI6B 3HUSB 1URQA 1X79B 1FZEA 5BU5A 2WZ7A 2KB7P 3TSIA 2WITA 2I1JA 1M1JC 3RK3D 3A5TA 5CJ0A 2YMYA 3BATA 1NU1K 1SVFA 2MJZA 2P7JA 2Z5IA 1NH4A 2FFDC 2C9LY 1N73A 3GHGC 1N7SB 1OWAA 1SFCC 1HWTC 5AW7B 1GL2A 5AVWB 2PAJA 3SWFA 1J1EB 1KZUB 1URQC 3HUSA 1T3JA 4ZKPA 3V2NA 4O9BA 2WT7B 1LTAC 1J2JB 1LGHB 2VRSA 1YTZI 1FZCA 2Q5UA 3N4XA 2FYZA 1LWUB 2C0XA 4IFFA 2YKPA 2H7HA 1GZLA 5AW9B 1SP4A 3TK1A 3LW5H 1NAFA 1JUNA 5KTBA 1DEBA 5AVQB 2Q7CA 1N7SD 1N2DC 1X9VA 3P7KA 1X8YA 1DX7A 3M06A 4KHXA 2HFED 1KILD 1ZR4A 3VP9A 1SFCA 1S9KE 1JY2N 5AVRB 4M3LA 3GHGA 1IO4A 1XTCC 2FFDA 1RE4C 1HGVA 4EOTA 2HG5D 1W2EA 1SQPK 4WB4A 5APWA 3NTNA 2J58A 2W27A 3MD0A 5CMZA 3RL0C 1NTMK 4OH8B 4WY4D 3B5NA 3M0DC 5AW8B 4AQRD 1SQVK 1MFZA 1JTHB 1J1EC 3V5BA 3L4FA 2YKQA 1SFCB 5AW5B 1KILB 1N7SC 2FXMA 2I1KA 2XKMA 1G2CB 1LT9B 5AVXB 1LTBC 2WTYA 3IFMA 2XU6A 1MV8A 3VOPA 2O1JA 3I5CA 1YTZT 5CJ4A 3VMXA 3A2AA 3LIDA 2XNXA 1RE3C 2C0WA 1RY3A 2BASA 1M1JB 2A45I 2HYNA 2R3CA 1FJPA 2N1TA 3V4WA 1KFMA 3BRTB 3UIAA 3VP8A 1KFNA 3EQ2A 2O01H 5CCGD 1LTJA 1KILA 1IFJA 2NPSC 3C9IA 3TNUB 2WPQA 1IFIA 3NMDA 2KLVA 1FOSE 2Z5HA 2H43A 3KQGA 3NXSA 1N86A 3HD7C 2OYIC 2ZXEB 2Q9IA 1FZBA 2OYHC 2N1TD 2IFMA 3CL3D 5AVSB 5AW4B 1LT9C 1T2KD 1KILC 1A02J 2WPRA 1MUUA 1H8AA 1AQ5A 4GKGA 1GL2D 4C46A 1RF0C 1IK9A 1WT6A 1EQ7A 3NFQA 4DZOA 1GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMY A;  5AVZ B;  3P7K A;  5AW1 B;  1X8Y A;  4AYC A;  1GK4 A;  3M06 A;  4RES B;  2WPS A;  4KHX A;  5AVV B;  4JYB A;  1GTW A;  4LC1 A;  3V4Q A;  1S9K E;  5APU A;  3A3Y B;  5AVR B;  3VTP C;  4M3L A;  3HE4 A;  1GK6 A;  1A02 F;  5APV A;  1IO4 A;  3VMZ A;  2YO3 A;  1H89 A;  1HBW A;  1H88 A;  4EOT A;  1CZQ A;  2XV5 A;  4JYC A;  5APW A;  3NTN A;  2N9B A;  1DH3 A;  2WWW A;  2W27 A;  3MD0 A;  5CMZ A;  1HUC A;  4B86 A;  2YNY A;  5APT A;  3KDP B;  4AUW A;  5AW0 B;  3O8Z A;  3OAK A;  3HE4 B;  3HE5 B;  2E43 A;  3B8E B;  2ZFC A;  3M0D A;  2WT7 A;  1FOS F;  5AW8 B;  1HJB A;  4AQR D;  2IPP A;  4XE5 B;  3VN0 A;  1MFZ A;  2R32 A;  4HYT B;  3A7O A;  3V5B A;  1CSB A;  3M9H A;  3M9B A;  2YO2 A;  5AW5 B;  2P67 A;  2Q3I A;  1G2C B;  4C7N B;  3L37 A;  1CI6 B;  5AVX B;  2QM7 A;  3HE5 A;  2WTY A;  3L36 A;  2XU6 A;  1MV8 A;  3L35 A;  3I5C A;  1KQL A;  3M0A A;  1CI6 A;  5APY A;  1GD2 E;  3A5T A;  5AVT B;  3VMX A;  3A2A A;  3LID A;  2BAS A;  2R3C A;  2P7J A;  3V4W A;  2JJL A;  2Z5I A;  2W6A A;  3P32 A;  2C9L Y;  3UIA A;  3M91 A;  5AW6 B;  3VYI A;  1OWA A;  1HWT C;  5AW7 B;  5AVW B;  2P2U A;  5APS A;  3SWF A;  3TNU B;  5AW3 B;  1NWQ A;  2WPQ A;  5APQ A;  5AVU B;  1GU4 A;  3NMD A;  4GT1 A;  2XZR A;  2R5D A;  2WT7 B;  1FOS E;  1J2J B;  2E42 A;  2VRS A;  2Z5H A;  3IR9 A;  5AVY B;  3KQG A;  3NXS A;  4I6M C;  2ZXE B;  2Q5U A;  4I2L C;  2C9N Y;  3TYY A;  1S9K D;  1YYC A;  5AVS B;  3T97 A;  2KP8 A;  2R5B A;  1JNM A;  1FAV A;  5AW4 B;  3TNU A;  4C7N A;  2H7H A;  1GZL A;  1T2K D;  5AW9 B;  1A02 J;  1OXZ A;  1SP4 A;  2WPR A;  1MUU A;  1SLQ A;  3MGN A;  1H8A A;  3TK1 A;  3LIE A;  4GKG A;  3P8M C;  4C46 A;  2QM8 A;  1NAF A;  1JUN A;  1T2K C;  3HTK A;  4DZO A;  5AVQ B;  3NFQ A;  5APX A;  2Q7C A;  5AW2 B;  1GU5 A; 
#chains in the Genus database with same CATH topology
 3KPE A;  5AVZ B;  3LW5 J;  4CPG A;  5AW1 B;  3RGU A;  1QVF O;  1L4A C;  3RL0 g;  3E1I A;  4L76 A;  2V7Q J;  3RBX A;  2O3J A;  2PP6 A;  3CX5 D;  3H6P A;  3TGU G;  3S9O A;  1OVV A;  4JYB A;  4W7Z A;  1H0T B;  2D2C B;  4LC1 A;  3H1H G;  1DEE G;  3L74 E;  3RL0 B;  1YJ9 P;  3D71 A;  2E75 C;  5APU A;  1AVY A;  3JCU H;  3VTP C;  1HVV A;  2GA1 A;  1JM0 A;  1NTZ G;  3RK2 D;  2OTJ P;  2B88 A;  3HE4 A;  4WY4 A;  3FXE A;  3R4Y A;  3TGU E;  1S72 P;  1QGK B;  2YO3 A;  2O1K A;  3IF4 A;  1H89 A;  4U3F J;  3CWB D;  1BGY D;  1YBK A;  2M3B A;  3USS A;  1H88 A;  2IBZ G;  4JYC A;  2QG4 A;  1VQ9 P;  2AXT E;  4U3F D;  1EZV E;  1L4A A;  1KMI Z;  3AE2 C;  2N9B A;  4PJ0 H;  2H88 C;  2M3E A;  2P1J A;  3B5N B;  1EDK A;  1PP9 G;  1T6A A;  2G3A A;  2YKO A;  3O8Z A;  3OAK A;  5KJ7 C;  1LP1 B;  1U57 A;  1SQB E;  2WSS H;  1BGY E;  2W6B A;  4EDF A;  1Q86 Q;  1NTK J;  1NKZ B;  2ZFC A;  3M0D A;  2WT7 A;  1FOS F;  3BCC D;  1HJB A;  2IPP A;  4GIF A;  1T3U A;  3CX5 I;  4H0L D;  1HGZ A;  2KIK A;  3AE3 C;  3IN6 A;  4GOE A;  3WMM 0;  2IYP A;  3A0B H;  2B87 A;  3A7O A;  1CSB A;  5C39 A;  1Q7Y Q;  1SQB K;  1KB9 D;  1MFT A;  1E5W A;  1RH5 B;  3MTU E;  1K04 A;  2OYH A;  5TIS H;  2Q3I A;  1FZA A;  3Q5R A;  2HPC B;  4AYC A;  2RH0 A;  3AE9 C;  1QL1 A;  3L37 A;  1EXJ A;  3CCE P;  2IZ0 A;  2QM7 A;  3HE5 A;  4WY4 B;  1VQK P;  1BCC E;  1LWU C;  1BE3 E;  4UB8 E;  4IFD K;  2BCC G;  3L73 D;  1NKN A;  1IZN B;  1T8Z A;  3L70 G;  4D6T G;  1OFC X;  1SQQ D;  3L74 G;  1RQV A;  1ZLL A;  2HOD B;  2R44 A;  3CWB J;  3MP7 B;  1VQL P;  1FBM A;  3H32 B;  1LTG C;  1JY3 O;  1ZN5 A;  2JWA A;  3BAS A;  1GD2 E;  4H44 D;  2YIU C;  2ZJS E;  3B5N D;  4LLH A;  3CCU P;  1NGM B;  3H1L G;  4WBA A;  5CCH A;  1IC2 A;  3MHV A;  5CCG A;  1RF1 B;  1URQ B;  1EDI A;  3H1J J;  3PLN A;  1OIP A;  1NU1 E;  2JJL A;  4N78 D;  1KB9 I;  2BEQ D;  1ZOY C;  2W6A A;  3EFG A;  1LTJ B;  2JDI H;  3FWN A;  1BDD A;  3H1J D;  4H13 C;  1OW8 A;  1GW3 A;  3GHG B;  3E7K A;  3M91 A;  1PP9 E;  2JO1 A;  5AW6 B;  1NHL A;  2E74 C;  2FFD B;  1FE6 A;  1IFM A;  3N7N A;  4BWN A;  1NYH A;  3KXD A;  3GW6 A;  3L72 J;  5APS A;  4XA4 A;  3KHU A;  1GDT A;  3M9Q A;  1YJN P;  3U59 A;  1NWQ A;  1KN7 A;  1FU1 A;  2E75 D;  2IFN A;  2FYU K;  1GU4 A;  1FZG A;  3CWB E;  1JCD A;  3H1I J;  1PIX A;  2B9B A;  4Y99 B;  2E42 A;  1FZC C;  1PPJ G;  2ZT9 B;  3AEB C;  2FYN B;  3FWL A;  3H1I D;  3L73 J;  5BVZ A;  4I6M C;  4ASW A;  3L70 J;  1L4A D;  4OGQ B;  4I2L C;  2LR2 A;  4K3A A;  2FBW C;  1YYC A;  2KS1 B;  3TYY A;  3BVH A;  2K9Y A;  2G8Y A;  1BE3 G;  2KP8 A;  1SQX K;  2YMK A;  3HUS C;  1EZV G;  1NTK K;  1USE A;  3CX5 E;  4C7N A;  1GW4 A;  2QJK C;  3EFF K;  4LGD E;  4PV1 C;  1X22 A;  4GOF A;  1YJW P;  1JMM A;  1HJ0 A;  1GL2 C;  2ZYA A;  3MGN A;  3MUD A;  4IL6 E;  4YXD C;  3LIE A;  5BU8 B;  3P8M C;  2XND H;  3E1R A;  1G2C A;  2QM8 A;  3SSU A;  4RJT A;  1VF5 D;  4KJM A;  2KXP B;  1T2K C;  2Y0C A;  3RK3 B;  2ITA A;  3HTK A;  1N73 C;  2W6J H;  5DJU B;  2D2C D;  5L8R J;  4C7R A;  3JC2 2;  4GOD A;  2CK3 H;  3A0H E;  1VF5 B;  3L71 E;  5AW2 B;  3ZDM A;  1YIJ P;  3TDK A;  3FXD A;  1GK4 A;  1NTM E;  2AEJ A;  1SQQ E;  2WPS A;  2GM4 A;  5AVV B;  1RE4 A;  1KC8 Q;  1VF5 C;  2CPB A;  3AEG C;  3H1L D;  1UIX A;  1SQX G;  4Y28 J;  1VPC A;  1M1J A;  1S5L X;  3H1L J;  1ZW0 A;  2N1T B;  2O01 J;  3W67 A;  1N73 B;  3JCU E;  1BCC G;  1GK6 A;  1ZV8 A;  4PV1 D;  1A02 F;  5APV A;  3H1K E;  3VMZ A;  1SQQ K;  2PRR A;  3KYQ A;  1SQX D;  1HBW A;  1NTZ J;  3H25 A;  1LTT C;  2QJK B;  1SQX J;  4IFM A;  4PV1 B;  5CCH D;  1PPJ E;  1JTH A;  5CCG C;  1RF0 A;  2GUS A;  1YIT P;  1JY3 P;  5CCH C;  5CBO A;  1DH3 A;  1PFI A;  1FDM A;  4B86 A;  3H1K G;  1FZF A;  4H0L B;  5APT A;  1PGP A;  3AED C;  3G6E P;  2NZ2 A;  4OGQ C;  1VQ7 P;  4AUW A;  1SQB D;  1WRG A;  2L91 A;  3CLQ A;  3U1A A;  1AFO A;  1J1D C;  2ZT9 C;  1JCC A;  2OGU A;  2JEE A;  5CBN A;  1FZC B;  5TIS E;  4Y99 C;  2E43 A;  3B8E B;  1M56 D;  1TU3 F;  2PGD A;  2CPS A;  1LWU A;  1ZRT E;  3Q1M A;  2HPC A;  2WSF H;  4XE5 B;  2IDB A;  3MZW B;  3VN0 A;  3OA7 A;  1QVG O;  3HD7 A;  2OYI A;  2MKV A;  4HYT B;  2LKM A;  2W90 A;  2B89 A;  2GUV A;  1P84 H;  3H1L E;  3P8C D;  3SFD C;  2QEX P;  1BE3 D;  3V2R A;  1BCC D;  3M9B A;  3RK2 B;  1L0L E;  1NTM D;  1S1C X;  1PP9 J;  2P67 A;  1K9M Q;  1BE3 J;  1QL2 A;  4W80 A;  2HOD A;  4DT0 A;  1NTZ E;  2K37 A;  2QE7 H;  2A45 G;  2NPS A;  3AE7 C;  3H32 A;  3QWO C;  1OZH A;  1LTJ C;  4H13 B;  1YQ3 C;  1USD A;  2M0B A;  3L36 A;  2WSC H;  3L35 A;  1EDL A;  2K88 A;  1KQL A;  1CI6 A;  3M0A A;  5APY A;  1BSN A;  5KJ7 A;  1RF1 C;  1AVO A;  1NOH A;  1S2E A;  3BCC E;  2KNC A;  1E79 H;  2YIU B;  2ZAE B;  3HRN A;  1YQ4 C;  1JOC A;  5AVT B;  3TF5 A;  3P8C E;  4ZNC A;  2OAR A;  1FS0 E;  3F89 A;  2M8R A;  3KZI E;  2A45 H;  1KV4 A;  2E76 D;  1DD4 A;  1NJI Q;  2YXQ B;  2LXC B;  2HLO A;  3L75 J;  2H8P D;  3IAO A;  1N7L A;  5GTH E;  1JY2 P;  1L0N J;  4R4L A;  3BRV B;  4EIJ A;  2Q1K A;  2KZI A;  3H1K J;  2A06 G;  3P32 A;  2P58 A;  4JF7 A;  3O6Q B;  4WY4 C;  4U3F E;  3RL0 D;  3U1C A;  1CW5 A;  1VDF A;  1IO4 A;  3RBZ A;  3H1H E;  3VYI A;  1M57 D;  1S4X A;  4NPD A;  5KLV D;  3CC4 P;  3CCR P;  1JMB A;  1JY3 N;  2UWJ E;  3VMA A;  2P2U A;  5B66 H;  2H89 C;  1BCC J;  2ZYD A;  5AW3 B;  1GU5 A;  5APQ A;  1PL5 A;  1N7S A;  1Q2N A;  2V4H A;  3L74 D;  5AVU B;  1NTK D;  1P84 D;  2XZR A;  4GT1 A;  5KJ7 D;  2R5D A;  1L0L K;  2W8Z A;  4H13 D;  1NTK E;  1P84 E;  3BCC J;  1NU1 G;  3AE5 C;  3L70 E;  3IR9 A;  3SWY A;  1U7M A;  5AVY B;  3CCS P;  2XDJ A;  4L73 A;  1G1I A;  3S1K A;  1IJD B;  1MZ9 A;  1X0T A;  5E79 H;  2POH A;  3OJA B;  3V2P A;  2IX7 C;  1S9K D;  2C9N Y;  1G1J A;  3CI9 A;  4N78 E;  2ZVN B;  3TGU J;  4DCK A;  3B5N C;  3T97 A;  3II6 A;  3L75 E;  2R5B A;  2Y9Y A;  5KLV E;  1VQP P;  1JNM A;  1FAV A;  2OTL P;  3TNU A;  3GLM A;  1LT9 A;  2SPZ A;  2OTK E;  3HTK B;  1EC5 A;  2KSJ A;  3H1J G;  4RKU J;  3RK2 C;  1OXZ A;  5KAF E;  1SLQ A;  5GTI H;  2IZ1 A;  4PD4 I;  2KYV A;  3BCC G;  4N3Y B;  1LNQ A;  1HH0 A;  4ZKU A;  3CXH D;  4I1L A;  1L0N D;  2AXT H;  2Y0E A;  3A0B E;  4BXL A;  5KLV K;  1N8R Q;  1ZP0 C;  1OVU A;  1HF9 A;  4W7Y A;  1XTG B;  1KYO D;  5APX A;  1KD1 Q;  1S5L H;  1Q81 Q;  2D2C C;  1S3J A;  3VMY A;  4BRY B;  4IOI H;  1AV1 A;  1J1D B;  4YPC A;  3CC7 P;  2QVA A;  1BSH A;  3SWK A;  1L4A B;  4RES B;  3MIW A;  5B66 E;  2BCC J;  4H0L C;  1KB9 E;  4TLF A;  2IBZ D;  1FJK A;  1SQV D;  1GTW A;  3AEA C;  4H44 B;  4MN4 C;  2RKL A;  3V4Q A;  4NPE A;  3V2Q A;  3PP5 A;  5B5E H;  3I56 P;  1RF1 A;  3A3Y B;  1SQV J;  2A06 D;  2L5G B;  1LT1 A;  3CXH H;  3G3Z A;  3HD7 D;  4PJ0 E;  2KZJ A;  5CHX A;  3C8V A;  2WSE H;  3H1H D;  1BDC A;  1CZQ A;  2KSE A;  2XV5 A;  1URQ D;  5KLI B;  2N1T C;  3L71 G;  3R2P A;  1L0N K;  2WWW A;  1LTS C;  1RE3 A;  2KOG A;  1SFC D;  2YXR B;  1HUC A;  1FC2 C;  1LTI C;  2ZXX A;  2YNY A;  4I7Z B;  2ZVO B;  4UB8 H;  2JR8 A;  5E79 E;  2FKW B;  3KDP B;  2OYH B;  2PFX A;  5AW0 B;  1EZV D;  3HD7 B;  2OYI B;  3HE4 B;  3PJS K;  1LJ2 A;  1PGO A;  1NO4 A;  3CCV P;  2P10 A;  3HE5 B;  3W68 A;  1JY2 O;  3H1J E;  2NPS D;  2IBZ I;  2K1A A;  1L2P A;  4BRY A;  1BGY J;  4DOJ A;  3OW2 O;  1IFD A;  3H1I G;  5KAI E;  2QA4 P;  3RK3 C;  1HTL C;  1IFN A;  1PPJ D;  2R32 A;  2WMM A;  3CWB G;  2NPS B;  1Z56 A;  1DIP A;  1SQV E;  3M9H A;  1NAY A;  1OW6 A;  1GL2 B;  1M7L A;  4D6T D;  2QSI A;  2YO2 A;  1NTZ K;  1SQP G;  2J59 M;  1ZR2 A;  1Q82 Q;  4N6J A;  3D6Z A;  1W2B O;  4C7N B;  4D6T J;  4OWF A;  1CI6 B;  1Y8A A;  2KUB A;  1URQ A;  3HUS B;  1L0L D;  1X79 B;  4WVZ A;  4L74 A;  4EYY Q;  1FZE A;  2KNC B;  4PD4 D;  5BU5 A;  5KKZ C;  2WZ7 A;  2HR3 A;  2KB7 P;  2WVR A;  4PD4 E;  3Q5P A;  2KI7 B;  1IFP A;  2WIT A;  3L71 J;  3AE8 C;  2I1J A;  4U3F G;  3TSI A;  2FYN C;  1FDO A;  1M1J C;  2W83 C;  3GF7 A;  5EFW B;  1ZRT D;  1FDI A;  3RK3 D;  5GTI E;  4HB1 A;  3A5T A;  2RN0 A;  5CJ0 A;  4HKZ H;  1H0T A;  2BCC E;  3CCM P;  2YMY A;  3BAT A;  3O6Q A;  3PHL A;  4HH2 A;  1NU1 K;  2FYU E;  2BEZ F;  1SVF A;  1VQM P;  2KLU A;  1KQG B;  2MJZ A;  2P7J A;  2WSC J;  1NTK G;  2JP3 A;  2Z5I A;  4Z1M H;  3CCJ P;  1KB9 H;  1NH4 A;  3I55 P;  2E74 B;  2ZYG A;  2FFD C;  5GTH H;  4UB6 E;  1UII A;  1PZQ A;  2C9L Y;  4U7J A;  1N73 A;  3GHG C;  3CCQ P;  1AJY A;  3L70 D;  1N7S B;  3L72 E;  1SQX E;  1OWA A;  1SFC C;  1ZXG A;  4PD4 H;  5AW7 B;  5KLV G;  1HWT C;  1GL2 A;  3MUD C;  5AVW B;  1AA0 A;  2PAJ A;  3SWF A;  1J1E B;  1YI2 P;  1KZU B;  1KQS O;  1URQ C;  1EZV I;  3H1I E;  1T3J A;  3HUS A;  4ZKP A;  2OQQ A;  3L72 G;  3V2N A;  3Q5S A;  4O9B A;  2WT7 B;  1K05 A;  1LTA C;  1J2J B;  1R8E A;  1LGH B;  2VRS A;  1YTZ I;  2WQY C;  4YXW H;  2A06 E;  1FZC A;  2M5A B;  2Q5U A;  2QIW A;  3N4X A;  3L71 D;  2FYZ A;  1LWU B;  2C0X A;  2K9J A;  4IFF A;  1KTM A;  3L72 D;  1PP9 D;  4RO0 A;  2AEM A;  1OW7 A;  2YKP A;  1NU1 J;  1GZL A;  2H7H A;  3D70 A;  1AQT A;  1Y9B A;  3PTZ A;  5AW9 B;  3WU2 E;  1GMJ A;  1VQ6 P;  1IK7 A;  1SP4 A;  3ITK A;  2E5T A;  3TK1 A;  2QJY C;  1M90 Q;  2E76 C;  3LW5 H;  3S4R A;  1NAF A;  2AXC A;  1VQO P;  1NTM G;  2JWD A;  4QMA A;  5B5E E;  5KTB A;  1JUN A;  1BGY G;  1DEB A;  4UB6 H;  4WWI A;  2FYU G;  1VL2 A;  5AVQ B;  2KS1 A;  2Q7C A;  1N7S D;  1N2D C;  1KYO I;  1X9V A;  4XFJ A;  1NTZ D;  1SQQ J;  3P7K A;  2RMZ A;  1X8Y A;  3CXH I;  1DX7 A;  3CMA P;  1KOR A;  3M06 A;  2FXP A;  4KHX A;  2FXO A;  2HFE D;  1K73 Q;  1VQ8 P;  3L75 D;  3G71 P;  1KIL D;  1Y47 A;  3L73 E;  3VP9 A;  1SFC A;  1ZR4 A;  1S9K E;  1SQB G;  1QX8 A;  1JY2 N;  1R5L A;  3AE4 C;  5AVR B;  2JKV A;  4M3L A;  3Q3D A;  3GHG A;  3SFE C;  2E76 B;  2M5A A;  2I8D A;  2Z4E A;  1KYO H;  5M1B A;  2QJY B;  1XTC C;  4L75 A;  2FFD A;  3EWK A;  1RE4 C;  4D6T E;  1EXI A;  2Y0D A;  3GG2 A;  1HGV A;  1W5C E;  4EOT A;  2HG5 D;  1W2E A;  1SQP K;  4WB4 A;  3B71 A;  3NTN A;  5APW A;  1JB0 J;  3ABV C;  2J58 A;  2E75 B;  4YTP C;  3WUT A;  2FY8 A;  2W27 A;  3MD0 A;  3PRJ A;  5CMZ A;  3A0H H;  4OGQ D;  3RL0 C;  1NU1 D;  1P84 I;  1VQ5 P;  1NTM K;  4K35 A;  4DJG A;  4OH8 B;  3G9R A;  4WY4 D;  3CX5 H;  2V7Q H;  2R3S A;  5KAI H;  3CME P;  2LXB A;  2IYO A;  1YHQ P;  3B5N A;  3M0D C;  4IL6 H;  4ASV A;  5AW8 B;  2QJP C;  4AQR D;  2J5U A;  4GDO A;  1SQV K;  4JBZ A;  1MFZ A;  3QH9 A;  1JO5 A;  1JTH B;  2WPV B;  1J1E C;  3C1L A;  3V5B A;  1KIL E;  3L4F A;  2YKQ A;  1M1K Q;  5DJT B;  3F5H A;  1SFC B;  5AW5 B;  1KIL B;  1N7S C;  2FXM A;  2I1K A;  2XKM A;  1VQN P;  1G2C B;  1LT9 B;  4IL6 X;  4JQ0 D;  5AVX B;  2B87 B;  2AEF A;  3WUU A;  3L75 G;  1LTB C;  1WMK A;  3B4S A;  3IFM A;  2QRX A;  1PV3 A;  2WTY A;  2XU6 A;  1MV8 A;  2Q3E A;  3VOP A;  3AEE C;  4HJG H;  2O1J A;  1RQU A;  3I5C A;  5H2F H;  1K8A Q;  1SQP J;  1YTZ T;  3Q2Y A;  5CJ4 A;  3CCL P;  1KQF B;  1OMI A;  2DW3 A;  2FYU J;  3VMX A;  3A2A A;  3LID A;  2XNX A;  1KYO E;  1RE3 C;  1NTM J;  1RY3 A;  1SQV G;  1M8O B;  1RHZ B;  2BAS A;  1M1J B;  2C0W A;  2WSE J;  2A45 I;  2HYN A;  2R3C A;  1L0N E;  3FX0 A;  2N1T A;  3CXH E;  1EDJ A;  1FJP A;  3L74 J;  3V4W A;  4A7P A;  1S5L E;  1QLE D;  1D7M A;  2ZT9 D;  5KKZ B;  1OX3 A;  3H1H J;  1KFM A;  3CD6 P;  3BRT B;  2E5Y A;  3GMA A;  3KZI H;  3UIA A;  2N9Y B;  1L0N G;  3VP8 A;  1JEK A;  1KFN A;  3EQ2 A;  1PGJ A;  5KAF H;  5K5G B;  2O01 H;  1VQ4 P;  3TGU D;  3AEF C;  5CCG D;  1LTJ A;  2OYO A;  1KIL A;  1IFJ A;  1MKM A;  2NPS C;  3WUV A;  5TJH A;  3C9I A;  3AE6 C;  3AEC C;  3V6I A;  3TNU B;  3G4S P;  4TT3 H;  3CPW O;  2KK7 A;  2WPQ A;  1IFI A;  3NMD A;  2IBZ E;  2K3R A;  2KLV A;  4JPZ B;  1FOS E;  2K9J B;  2NRG A;  3WU2 H;  3H1K D;  2Z5H A;  4R4M A;  1SQB J;  2O01 N;  2E74 D;  2H43 A;  3CC2 P;  3KQG A;  1L0L G;  3NXS A;  1N86 A;  3HD7 C;  2OYI C;  3JSV C;  2ZXE B;  3AE1 C;  1FZB A;  1SS1 A;  5H2F E;  5KLV J;  3K5B A;  2Q9I A;  2OYH C;  2N1T D;  1SQP D;  2IFM A;  4I7Z C;  4ZMD A;  3CL3 D;  3FGA D;  5AVS B;  2Y9Z A;  4OVN F;  3D6Y A;  3GF3 A;  3PH0 A;  1SQQ G;  5AW4 B;  2FYU D;  4KT0 J;  1LT9 C;  1T2K D;  1OVR A;  1PGQ A;  5KLI C;  1KIL C;  2BCC D;  1QEX A;  3L73 G;  1L0L J;  1A02 J;  1ZME C;  2WPR A;  1MUU A;  1H8A A;  1AQ5 A;  4GKG A;  3RK3 E;  1GL2 D;  4NPF X;  2Q6Q A;  4C46 A;  1RF0 C;  2WSF J;  1IK9 A;  1DD3 A;  1R5S A;  1LP1 A;  1WT6 A;  1EQ7 A;  4DZO A;  2QJP B;  3NFQ A;  1SQP E;  4H44 C;  4EI2 A;  1NVO A;  1Q90 D;  3T97 B;  1U7J A; 
#chains in the Genus database with same CATH homology
 3KPE A;  5AVZ B;  5AW1 B;  1L4A C;  3E1I A;  4AYC A;  2PP6 A;  3H6P A;  4JYB A;  4W7Z A;  4LC1 A;  3RL0 B;  5APU A;  3VTP C;  1HVV A;  3RK2 D;  3HE4 A;  4WY4 A;  2YO3 A;  2O1K A;  1H89 A;  1H88 A;  2M3B A;  4JYC A;  1L4A A;  2N9B A;  2P1J A;  3B5N B;  2YKO A;  3O8Z A;  5KJ7 C;  3OAK A;  2W6B A;  1NKZ B;  2ZFC A;  3M0D A;  2WT7 A;  1FOS F;  1HJB A;  2IPP A;  4GIF A;  1T3U A;  1HGZ A;  3WMM 0;  3A7O A;  1CSB A;  1SQB K;  1E5W A;  3MTU E;  2OYH A;  2Q3I A;  1FZA A;  2HPC B;  3L37 A;  1QL1 A;  2QM7 A;  3HE5 A;  4WY4 B;  1LWU C;  4IFD K;  1NKN A;  1T8Z A;  1ZLL A;  2HOD B;  1FBM A;  3H32 B;  1LTG C;  1JY3 O;  1ZN5 A;  3BAS A;  1GD2 E;  4LLH A;  3B5N D;  4WBA A;  5CCH A;  1IC2 A;  5CCG A;  1RF1 B;  1URQ B;  4N78 D;  2JJL A;  2W6A A;  3EFG A;  1LTJ B;  1GW3 A;  3GHG B;  3M91 A;  5AW6 B;  1NHL A;  2FFD B;  1IFM A;  3N7N A;  5APS A;  4XA4 A;  1GDT A;  3M9Q A;  3U59 A;  1NWQ A;  1FU1 A;  1GU4 A;  2IFN A;  2FYU K;  1FZG A;  1JCD A;  4Y99 B;  2E42 A;  1FZC C;  5BVZ A;  4I6M C;  1L4A D;  4I2L C;  3TYY A;  3BVH A;  1YYC A;  2KP8 A;  1SQX K;  3HUS C;  1NTK K;  4C7N A;  1GW4 A;  4LGD E;  1JMM A;  3MUD A;  1GL2 C;  3MGN A;  3LIE A;  5BU8 B;  3P8M C;  1G2C A;  2QM8 A;  1N73 C;  1T2K C;  3RK3 B;  3HTK A;  4C7R A;  5AW2 B;  1GK4 A;  2WPS A;  2GM4 A;  5AVV B;  1RE4 A;  2CPB A;  1VPC A;  1M1J A;  1N73 B;  2N1T B;  1GK6 A;  1ZV8 A;  1A02 F;  5APV A;  3VMZ A;  1SQQ K;  3KYQ A;  1HBW A;  1LTT C;  4IFM A;  5CCH D;  5CCG C;  1JTH A;  1DH3 A;  1RF0 A;  2GUS A;  1PFI A;  1JY3 P;  5CCH C;  1FDM A;  4B86 A;  1FZF A;  5APT A;  4AUW A;  3U1A A;  1WRG A;  1AFO A;  3CLQ A;  1J1D C;  1JCC A;  2JEE A;  1FZC B;  4Y99 C;  2E43 A;  3B8E B;  2CPS A;  1LWU A;  2HPC A;  2WSF H;  4XE5 B;  3VN0 A;  3OA7 A;  3HD7 A;  2OYI A;  4HYT B;  2LKM A;  2GUV A;  3P8C D;  3V2R A;  3M9B A;  3RK2 B;  2P67 A;  4W80 A;  1QL2 A;  2HOD A;  4HH2 A;  3H32 A;  2A45 G;  2NPS A;  1JO5 A;  1LTJ C;  3L36 A;  2WSC H;  3L35 A;  1KQL A;  1CI6 A;  3M0A A;  5APY A;  5KJ7 A;  1RF1 C;  1NOH A;  5AVT B;  3HRN A;  1JOC A;  3P8C E;  2OAR A;  2M8R A;  2A45 H;  2HLO A;  2H8P D;  1N7L A;  1JY2 P;  4EIJ A;  3BRV B;  3RL0 D;  4WY4 C;  3P32 A;  4JF7 A;  1CW5 A;  3U1C A;  1VDF A;  3VYI A;  1JY3 N;  2P2U A;  5AW3 B;  5APQ A;  1N7S A;  5AVU B;  4GT1 A;  2XZR A;  5KJ7 D;  2R5D A;  1L0L K;  3IR9 A;  3SWY A;  5AVY B;  2XDJ A;  1G1I A;  1IJD B;  1MZ9 A;  2POH A;  3OJA B;  3V2P A;  2IX7 C;  1S9K D;  2C9N Y;  1G1J A;  3CI9 A;  4N78 E;  3B5N C;  3T97 A;  3II6 A;  2R5B A;  1JNM A;  1FAV A;  3TNU A;  1LT9 A;  3HTK B;  2KSJ A;  3RK2 C;  1OXZ A;  1SLQ A;  2KYV A;  4N3Y B;  1HH0 A;  4ZKU A;  4I1L A;  5KLV K;  4W7Y A;  1XTG B;  5APX A;  3VMY A;  1J1D B;  1L4A B;  4RES B;  3MIW A;  1FJK A;  1GTW A;  3V4Q A;  3V2Q A;  3PP5 A;  1RF1 A;  3A3Y B;  2L5G B;  3G3Z A;  5CHX A;  2WSE H;  1CZQ A;  2XV5 A;  1URQ D;  2N1T C;  3R2P A;  1L0N K;  2WWW A;  3HD7 D;  1LTS C;  1RE3 A;  2KOG A;  1SFC D;  1HUC A;  1LTI C;  2Z4E A;  2YNY A;  2FKW B;  3KDP B;  2OYH B;  5AW0 B;  3HD7 B;  2OYI B;  3HE4 B;  1NO4 A;  3HE5 B;  1JY2 O;  2NPS D;  4DOJ A;  1IFD A;  3RK3 C;  1HTL C;  1IFN A;  2R32 A;  2NPS B;  1Z56 A;  3M9H A;  1GL2 B;  1M7L A;  2YO2 A;  1NTZ K;  2J59 M;  1ZR2 A;  4N6J A;  4C7N B;  1CI6 B;  3HUS B;  1URQ A;  1X79 B;  1FZE A;  5BU5 A;  2WZ7 A;  2KB7 P;  3TSI A;  2WIT A;  2I1J A;  1M1J C;  3RK3 D;  3A5T A;  5CJ0 A;  2YMY A;  3BAT A;  1NU1 K;  1SVF A;  2MJZ A;  2P7J A;  2Z5I A;  1NH4 A;  2FFD C;  2C9L Y;  1N73 A;  3GHG C;  1N7S B;  1OWA A;  1SFC C;  1HWT C;  5AW7 B;  1GL2 A;  5AVW B;  2PAJ A;  3SWF A;  1J1E B;  1KZU B;  1URQ C;  3HUS A;  1T3J A;  4ZKP A;  3V2N A;  4O9B A;  2WT7 B;  1LTA C;  1J2J B;  1LGH B;  2VRS A;  1YTZ I;  1FZC A;  2Q5U A;  3N4X A;  2FYZ A;  1LWU B;  2C0X A;  4IFF A;  2YKP A;  2H7H A;  1GZL A;  5AW9 B;  1SP4 A;  3TK1 A;  3LW5 H;  1NAF A;  1JUN A;  5KTB A;  1DEB A;  5AVQ B;  2Q7C A;  1N7S D;  1N2D C;  1X9V A;  3P7K A;  1X8Y A;  1DX7 A;  3M06 A;  4KHX A;  2HFE D;  1KIL D;  1ZR4 A;  3VP9 A;  1SFC A;  1S9K E;  1JY2 N;  5AVR B;  4M3L A;  3GHG A;  1IO4 A;  1XTC C;  2FFD A;  1RE4 C;  1HGV A;  4EOT A;  2HG5 D;  1W2E A;  1SQP K;  4WB4 A;  5APW A;  3NTN A;  2J58 A;  2W27 A;  3MD0 A;  5CMZ A;  3RL0 C;  1NTM K;  4OH8 B;  4WY4 D;  3B5N A;  3M0D C;  5AW8 B;  4AQR D;  1SQV K;  1MFZ A;  1JTH B;  1J1E C;  3V5B A;  3L4F A;  2YKQ A;  1SFC B;  5AW5 B;  1KIL B;  1N7S C;  2FXM A;  2I1K A;  2XKM A;  1G2C B;  1LT9 B;  5AVX B;  1LTB C;  2WTY A;  3IFM A;  2XU6 A;  1MV8 A;  3VOP A;  2O1J A;  3I5C A;  1YTZ T;  5CJ4 A;  3VMX A;  3A2A A;  3LID A;  2XNX A;  1RE3 C;  2C0W A;  1RY3 A;  2BAS A;  1M1J B;  2A45 I;  2HYN A;  2R3C A;  1FJP A;  2N1T A;  3V4W A;  1KFM A;  3BRT B;  3UIA A;  3VP8 A;  1KFN A;  3EQ2 A;  2O01 H;  5CCG D;  1LTJ A;  1KIL A;  1IFJ A;  2NPS C;  3C9I A;  3TNU B;  2WPQ A;  1IFI A;  3NMD A;  2KLV A;  1FOS E;  2Z5H A;  2H43 A;  3KQG A;  3NXS A;  1N86 A;  3HD7 C;  2OYI C;  2ZXE B;  2Q9I A;  1FZB A;  2OYH C;  2N1T D;  2IFM A;  3CL3 D;  5AVS B;  5AW4 B;  1LT9 C;  1T2K D;  1KIL C;  1A02 J;  2WPR A;  1MUU A;  1H8A A;  1AQ5 A;  4GKG A;  1GL2 D;  4C46 A;  1RF0 C;  1IK9 A;  1WT6 A;  1EQ7 A;  3NFQ A;  4DZO A;  1GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...