3NMDA

Crystal structure of the leucine zipper domain of cgmp dependent protein kinase i beta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
GSLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQMLQNELDKYRSVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP Dependent PRotein Kinase
publication title A crystal structure of the cyclic GMP-dependent protein kinase I{beta} dimerization/docking domain reveals molecular details of isoform-specific anchoring.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nmdA00
2Q7CA 2XV5A 5APQA 4KHXA 5AVWB 4AUWA 5AVVB 1T2KD 2Z5IA 1FOSE 4RESB 3HE4A 3LIEA 5AW6B 2Q3IA 2WPSA 5APTA 5AW3B 3O8ZA 2YNYA 5AVSB 1A02F 3MGNA 2VRSA 4B86A 3SWFA 5AW7B 1CI6B 3T97A 5APYA 2YO3A 3UIAA 2ZFCA 3MD0A 1FAVA 3M0AA 1S9KE 1FOSF 1KQLA 2P67A 4AQRD 3VYIA 1MUUA 5APSA 5AW8B 3VMXA 1GK6A 2W27A 3L37A 2JJLA 5APWA 1JNMA 1YYCA 4M3LA 2XZRA 3TK1A 3M91A 4JYCA 1S9KD 1SP4A 3TNUB 3IR9A 4C7NB 5AW0B 2N9BA 1GU5A 3NTNA 2ZXEB 3VMZA 1MV8A 2KP8A 2QM7A 3V4WA 5APUA 3A7OA 2IPPA 3VMYA 1CZQA 3M06A 3I5CA 3M0DA 2YO2A 5AVYB 1HUCA 5APVA 3KQGA 2C9LY 1X8YA 3M9HA 4AYCA 2C9NY 3TNUA 4GKGA 4C7NA 3M9BA 2WT7B 1GD2E 1MFZA 5AW2B 3V4QA 5APXA 3VN0A 1CI6A 2W6AA 4JYBA 1GTWA 1JUNA 2E43A 3L35A 3TYYA 1SLQA 4EOTA 4LC1A 3NXSA 2H7HA 4XE5B 4C46A 3HE5B 1GU4A 5AW1B 1H88A 2P7JA 2BASA 2XU6A 1GK4A 2WT7A 1HBWA 1OWAA 1A02J 3A2AA 5AW4B 2Q5UA 3HTKA 3L36A 5AW5B 1IO4A 2P2UA 5AVXB 1NWQA 2R5BA 4I2LC 5AVUB 2WTYA 1GZLA 3P32A 2R32A 1DH3A 3A3YB 3KDPB 3HE5A 1OXZA 1HJBA 4DZOA 5AVQB 1NAFA 3NFQA 1J2JB 3OAKA 2WPRA 3HE4B 5AVRB 4GT1A 3A5TA 1H89A 1H8AA 5CMZA 5AW9B 3VTPC 2E42A 2WWWA 1HWTC 4I6MC 2QM8A 4HYTB 1CSBA 2Z5HA 3P7KA 3V5BA 5AVTB 1T2KC 3LIDA 1G2CB 2WPQA 2R3CA 3NMDA 3P8MC 5AVZB 2R5DA 3B8EB
chains in the Genus database with same CATH superfamily
3H1KG 3SSUA 2QJKB 3LIEA 5KAFH 2SPZA 3CCQP 4MN4C 1EXJA 4PD4D 5L8RJ 1S2EA 2FYUG 2B87B 2W6BA 3M0AA 3FXDA 1FJKA 3CL3D 2QA4P 3GG2A 3FWLA 1MUUA 4HJGH 3VMXA 5APWA 2CPSA 1SQBK 3FXEA 1YBKA 3VMZA 1N2DC 1E5WA 4Y28J 1S3JA 2M5AA 1PP9E 5KLVD 2WT7B 2HFED 2FXOA 1KFNA 2A06E 2XDJA 1GK4A 3L72D 3VOPA 3L74J 3BCCD 3H1JE 1IO4A 1HJ0A 2Q1KA 1NYHA 2CPBA 1HGZA 3HE5A 1KZUB 2K1AA 3CCUP 2IBZE 1L4AD 1M1JB 1FZEA 1PP9G 4GODA 2OTKE 1JY3P 1S4XA 1H8AA 1L4AB 2WITA 1PP9J 4IFFA 1MFTA 3CXHE 4WBAA 3AEAC 3CLQA 4H44C 3GHGB 2A06G 4I7ZC 5AVVB 4GDOA 4K3AA 1FOSE 1QX8A 1KYOD 2FFDA 3CCLP 3H1JG 1UIIA 2O1JA 1EDKA 2NRGA 2N1TD 2IBZG 5AW8B 1GK6A 4U3FE 2N1TB 3F89A 4L73A 1WMKA 2JDIH 5KJ7D 1SP4A 1J1DC 3TNUB 2E75C 4C7NB 3CC4P 1NTMD 4BWNA 2HLOA 2IZ1A 2RKLA 2Y9YA 2KSJA 3VMYA 1CZQA 1SQBE 3RK2C 1X8YA 4AYCA 2E74C 3HTKB 1EQ7A 1S5LX 3LW5H 1GL2A 3P8CE 2P7JA 4U3FG 3JCUH 2WT7A 1PPJD 3FWNA 5AW5B 1NTKK 2FFDC 4HKZH 1Y8AA 1NGMB 3G4SP 5CCHA 1EDIA 4TT3H 3I56P 1KILD 2WSCJ 2QJKC 5H2FH 4JBZA 1LJ2A 1ZOYC 1SQBG 3K5BA 1USEA 2ITAA 1SQXD 1KILB 2WWWA 2PRRA 3Q5SA 1RH5B 5KAIE 4W80A 3G9RA 2YKPA 2XV5A 2BCCE 3AEBC 1M1JA 2A45G 1FZFA 1VPCA 5APTA 1LT9B 3H1HE 1SQPJ 2OYHA 1L4AA 1HF9A 1OVRA 1LTJB 1FDOA 1RF0A 3GHGA 4DT0A 2P67A 4AQRD 1P84E 3AEDC 3OJAB 4JPZB 1MZ9A 3Q2YA 5GTHH 4PJ0H 1S9KD 2B88A 1X9VA 3L71E 5GTIE 1L0LD 1KB9E 3E7KA 2BCCG 3A7OA 3MIWA 2N1TA 1OX3A 1UIXA 3TNUA 3H1HG 4C7NA 1QL1A 1YIJP 1BE3D 1NTMK 4H0LD 1AVYA 4HB1A 3GF7A 4RO0A 2WZ7A 3CD6P 4OWFA 1IFJA 4H0LB 1SQVD 1M1JC 3FX0A 4N78D 3HTKA 3L73E 1YHQP 3OW2O 2OYHC 5AVXB 1L4AC 3L71G 1X79B 4ASVA 2JKVA 1IJDB 3H1IE 1SFCD 3GHGC 4EI2A 1G1JA 2WPRA 2MKVA 1SFCB 1R8EA 2ZYAA 2I8DA 2WSFH 4L74A 1SQQJ 1W2EA 3CXHH 4Y99B 3U59A 1R5SA 3BASA 2N1TC 1PZQA 3CX5E 1OW7A 1AVOA 3L73J 1VL2A 3H1IG 2W90A 3H25A 2G3AA 4XFJA 5KAFE 4M3LA 1FZCB 1LTJA 3L74D 1FU1A 1OW8A 1JCCA 1ZP0C 1VQOP 2AEJA 2KOGA 1IK9A 1YJNP 2W8ZA 1NU1E 2XNDH 3EWKA 5CCGA 4GKGA 3U1CA 3H1LE 2PFXA 4IL6H 1OW6A 2I1KA 2P58A 1PV3A 1GU4A 2M3EA 3N7NA 1OVVA 1GDTA 2Q5UA 1RY3A 2O1KA 3AEGC 2ZVNB 3PLNA 3EFFK 1NU1G 5AVQB 3CX5I 4N3YB 1RF1A 1SQVK 1EZVE 3PJSK 2FYNB 2JEEA 3H1LG 5CMZA 1N86A 5AW9B 1VQKP 1JO5A 1LTJC 3LIDA 3CMEP 3H1LJ 1SS1A 4KHXA 1OFCX 1SFCA 2RN0A 5AW3B 2GUVA 2YNYA 2VRSA 2C0WA 2OTJP 5B5EH 2YO3A 1VQ6P 1IFIA 1L0NJ 3PRJA 3IF4A 1KQLA 3VYIA 4YXWH 2QRXA 4R4LA 3RK3D 1DEBA 1JMBA 3AEEC 1BDCA 3RK3B 2V7QH 2R3SA 2N9BA 3PHLA 5APUA 2E5TA 2IPPA 2Z4EA 1FZCA 3SWKA 4H0LC 3L70D 3H32B 1KMIZ 4PD4H 1URQD 1JUNA 1Q2NA 1EZVI 1URQB 1RHZB 3IN6A 1SQPD 1SFCC 2GA1A 3P32A 1ZV8A 1OXZA 1YTZI 1NTZE 3GLMA 3JCUE 3ABVC 5BU8B 1H89A 4HYTB 3Q3DA 5M1BA 1KQGB 1M57D 3VP9A 3CI9A 3E1RA 5AW6B 3CWBJ 5H2FE 3TGUE 1ZR2A 2IFMA 3O8ZA 2GUSA 3MGNA 2LKMA 1FZCC 1CI6B 3IFMA 3T97A 5APYA 1BGYE 2ZFCA 3W68A 1OVUA 1H0TB 1QLED 2E76D 1BSHA 1NTZG 2JJLA 4ZKUA 1IFPA 2PGDA 3M91A 3QH9A 2E76B 3MTUE 1NTZJ 3H1KJ 1GU5A 1M56D 3Q5RA 1GW3A 3KXDA 1VF5D 3I5CA 3TGUG 5GTHE 2FYUJ 1KYOH 4PJ0E 1VF5B 1N73B 1BCCE 5APXA 1FC2C 1BGYG 1GTWA 1SQQD 1PGJA 1ZRTE 1LTAC 1JY2P 3H32A 3CPWO 4OGQC 4RJTA 3L36A 1JTHB 4GOEA 4I2LC 1YTZT 1GMJA 1URQA 3V6IA 1S5LH 4DZOA 3L73D 3V2NA 4GT1A 4KT0J 1LP1A 3II6A 1BCCG 2QM8A 1HGVA 2R5DA 5APQA 4DOJA 4HH2A 2IFNA 1FE6A 3RK3C 4GIFA 1YJWP 3KYQA 1IC2A 1FOSF 3AE1C 1YQ3C 3WUUA 1NOHA 2QJYB 2WQYC 4O9BA 1H0TA 1FS0E 3BVHA 1YQ4C 1URQC 3H1JJ 1NKNA 2L91A 2POHA 3A0HH 3S4RA 3TYYA 2FBWC 4PV1D 3RL0D 5E79H 2YKOA 2B87A 4K35A 2KI7B 1KTMA 4PV1B 3RL0B 1U7JA 1FZAA 4IL6E 2WTYA 2Q3EA 3E1IA 3QWOC 1L0ND 2IDBA 1VQ4P 1Q7YQ 1SQQK 2IBZI 3NFQA 3HE4B 5AVRB 1XTCC 3A5TA 2YKQA 3VTPC 2ZT9D 2Z5HA 1JOCA 2WPQA 5KLVK 5CHXA 5AVZB 3CXHI 2ZT9B 1EZVD 1LTSC 4U3FJ 2Z5IA 3H6PA 3WMM0 1QL2A 1Z56A 2IX7C 1R5LA 3MD0A 3MP7B 2KK7A 1SQBJ 2ZXXA 1YYCA 2KLUA 2AEMA 4D6TE 2D2CD 5CBNA 4UB6H 3IR9A 5B5EE 1N73C 1VF5C 4NPEA 2D2CB 1YJ9P 4IFMA 4DJGA 3MHVA 5BVZA 3V4QA 2E43A 1RE4A 4Z1MH 1VQ8P 3C1LA 4EOTA 2H7HA 2LXCB 2RMZA 2A45I 1LNQA 2P1JA 1DX7A 1HBWA 3A2AA 4OH8B 3CWBD 5AW4B 4D6TG 1ZW0A 3D70A 4PD4E 2KNCB 1K8AQ 1NWQA 2BCCJ 3BRVB 1GZLA 2R32A 2W83C 3A3YB 4UB8H 2W6JH 2AXCA 5KJ7A 3H1HJ 3PTZA 1W2BO 2J58A 4I6MC 2KYVA 3AE9C 3KZIH 2HYNA 3H1KD 2Q7CA 1JM0A 1PIXA 3CC7P 1T2KD 4JF7A 4TLFA 3HE4A 3CCRP 1NJIQ 3L71J 3G71P 1BSNA 5KLVE 1Y47A 2HODB 4L76A 2FYUD 4GOFA 2K9JB 1NTKE 1FAVA 2OARA 1T3JA 1X22A 4A7PA 5C39A 1N7LA 1P84I 1VQ5P 1RE4C 3Q1MA 4WB4A 2PP6A 3L72E 3CCVP 2KUBA 2K9YA 1PGOA 3BCCE 5KKZB 1KILA 1MV8A 3D6ZA 1SQXK 1KB9I 1QGKB 2YO2A 4PD4I 1ZXGA 5KJ7C 4PV1C 1ZN5A 3RL0C 1LT9A 1MFZA 5KLVG 4WWIA 3MUDA 3H1IJ 4EDFA 1NTKG 1LWUB 3VMAA 3G3ZA 2FXMA 2K88A 2LR2A 2HPCB 3HUSB 1NTKJ 1OMIA 3TF5A 3L72G 1KYOE 1PGQA 1NO4A 3BCCG 1N7SD 5AVUB 1VQ7P 3AE3C 2KZIA 2KXPB 2ZT9C 1N7SB 1PP9D 1L0LK 4W7YA 2OYOA 3F5HA 2KNCA 2WSEJ 4EIJA 2QEXP 3S1KA 1AFOA 1DD3A 2A06D 1NTME 1KQFB 1KILC 1KC8Q 1S5LE 2WPSA 4LGDE 3H1JD 3WU2H 3S9OA 1NU1J 1LT9C 2KZJA 2OTLP 3D6YA 3MUDC 2WPVB 2IBZD 2D2CC 1YITP 3SFDC 2B9BA 3TK1A 2HODA 1PPJE 2K9JA 1HH0A 3CXHD 3V2PA 2KP8A 2ZJSE 1E79H 3V4WA 1NTMG 2PAJA 1K05A 1NTMJ 1SQXE 2B89A 3OA7A 1SLQA 2ZYDA 4WY4D 4XE5B 1T8ZA 5AW1B 1H88A 4U3FD 3L4FA 2XU6A 4WY4B 1PPJG 1PGPA 2IYOA 3A0HE 3KDPB 5E79E 2YXRB 3CCSP 2OYIB 1SQBD 1Y9BA 3O6QB 1TU3F 4RKUJ 1T2KC 1AJYA 1SQXG 2OQQA 2WSSH 1G2CB 1L0LE 3P8CD 4L75A 1RQUA 3RL0g 2Y0CA 1KQSO 5TISH 1BE3E 1HVVA 4Y99C 2E75D 2G8YA 5KKZC 3TDKA 4QMAA 2HG5D 2E75B 2J59M 3CCEP 1DEEG 1AQ5A 1SQVE 2WMMA 1AQTA 1QVFO 4N78E 2L5GB 5AW0B 2MJZA 2BCCD 2FYZA 1L0LG 1LWUC 1USDA 1S72P 3M06A 5AVYB 3L75E 3H1HD 2C9NY 1JCDA 4I1LA 5AW2B 2ZYGA 4H13D 4UB6E 1BE3G 1JB0J 1LTBC 3LW5J 4NPDA 4H13B 4LC1A 3NXSA 1P84D 3AE8C 1BE3J 2KLVA 1T3UA 2YXQB 1D7MA 1N7SC 2FFDB 4ZKPA 3V2RA 1SQVG 1JMMA 1PL5A 3L71D 2P2UA 3RGUA 1SQVJ 1J1EB 1KB9D 4JQ0D 1OZHA 3TGUJ 3SFEC 4N6JA 4WY4A 1EDLA 2YMYA 3L75G 1BGYJ 5KLIB 3L74E 3B5ND 3L75J 2FYNC 4UB8E 4AUWA 2OYIA 3B5NB 3SWYA 2YIUB 3IAOA 3D71A 3PH0A 3O6QA 5AVSB 5AW7B 1G2CA 4C7RA 1GL2D 2QG4A 2JO1A 1KFMA 3KZIE 3RBXA 1SQPK 2KIKA 3H1ID 3PP5A 1GL2B 5BU5A 2H8PD 2QJPB 3FGAD 3L37A 1JEKA 3CMAP 1BCCJ 1NTKD 2FKWB 1S1CX 5CCHD 1G1IA 4OVNF 3L74G 1LGHB 2AXTH 2O01H 4EYYQ 2QM7A 4U7JA 1GW4A 1BDDA 1FZGA 3KQGA 5B66H 3M9HA 1IFNA 3TSIA 3CX5D 3M9BA 4WY4C 1CI6A 1NVOA 2W6AA 1M8OB 1EXIA 2DW3A 2IYPA 2OGUA 1HTLC 1NHLA 2OYHB 2OYIC 3CC2P 1Q81Q 3V2QA 1VQ9P 1RQVA 1NU1D 1HJBA 2V4HA 1LT1A 1NKZB 3RK3E 3H1LD 2QSIA 2WSFJ 1N73A 2O3JA 1NH4A 5AVWB 3GF3A 2H89C 2E5YA 4NPFX 3USSA 3GMAA 3M9QA 2JWDA 1VQPP 3L70E 1U7MA 4WVZA 2NPSD 1JTHA 2KSEA 5EFWB 3B5NA 2Y9ZA 3VP8A 2NPSB 2C0XA 3A0BH 1JNMA 1L2PA 3HD7D 1N8RQ 1JY2N 4JYCA 1SQPE 3AECC 3HD7B 3WU2E 3B71A 1JY2O 2E76C 2IZ0A 4H13C 1HUCA 1QVGO 4IFDK 1KN7A 4IOIH 1IZNB 5DJTB 3L70G 2JP3A 3AE6C 1X0TA 4DCKA 3L70J 1J1EC 1U57A 2P10A 1VQMP 1MKMA 2UWJE 1DD4A 2XNXA 4ZNCA 1SQPG 5KLIC 1WRGA 1JY3N 4LLHA 1ZR4A 5CJ0A 5K5GB 1JY3O 3B5NC 2N9YB 2JWAA 4ZMDA 2YIUC 1XTGB 1KD1Q 1CSBA 1EDJA 3AE7C 3AE4C 5CCGD 2QVAA 3B8EB 3NTNA 1NU1K 2CK3H 1LTIC 2Y0EA 1GL2C 4D6TJ 2Q3IA 2QJPC 2QE7H 3SWFA 3BRTB 2GM4A 1EC5A 3UIAA 1IFMA 1Q86Q 2M0BA 2WVRA 5CCHC 1SQQE 1NTZD 1M1KQ 1L0NK 2V7QJ 4BXLA 1YI2P 5TISE 2NZ2A 3W67A 2NPSA 2QJYC 1RF1B 1CW5A 1FBMA 3TGUD 3M0DA 2C9LY 4R4MA 4W7ZA 5CJ4A 3MZWB 1RF0C 1FJPA 3HD7A 2O01N 1BGYD 3AEFC 1T6AA 2KS1B 2QIWA 4JYBA 3L35A 3L75D 3WUVA 3JC22 4CPGA 3AE5C 4XA4A 1AA0A 1SQQG 2XKMA 2H88C 1FDIA 1DH3A 2Q6QA 1NAFA 5KLVJ 3L73G 4YTPC 3EQ2A 1BCCD 3I55P 1HWTC 5AVTB 2R3CA 1K04A 4YXDC 2HR3A 3L72J 2LXBA 1ZRTD 1KV4A 2NPSC 1RE3A 3BCCJ 2H43A 1A02F 3M0DC 2ZAEB 2K37A 3AE2C 2WSCH 3HD7C 1K73Q 2RH0A 3R4YA 2W27A 3Q5PA 2ZXEB 2FXPA 1WT6A 1IK7A 1L0NE 2A45H 1NTZK 3RBZA 4OGQD 2ZVOB 1Q90D 3VN0A 2AXTE 4OGQB 2FYUK 4BRYB 2J5UA 3HRNA 3C9IA 1LTGC 2BASA 3GW6A 3T97B 5B66E 1OWAA 1A02J 3JSVC 1FZBA 1KYOI 2KS1A 1KILE 1NAYA 1RE3C 1W5CE 5KAIH 3EFGA 1ZMEC 3ITKA 1L0NG 2AEFA 3OAKA 3R2PA 3CCJP 1IFDA 5CCGC 1PFIA 2M3BA 3U1AA 1LWUA 1EZVG 1P84H 3C8VA 4RESB 2Q9IA 2HPCA 2O01J 3HUSA 3B4SA 2JR8A 4H44D 4B86A 3KPEA 5GTIH 4H44B 1M90Q 4I7ZB 1KB9H 1S9KE 3BATA 5APSA 2M5AB 1RF1C 1N7SA 1FDMA 1SQXJ 2XZRA 2K3RA 1SVFA 4KJMA 3CWBE 4IL6X 1K9MQ 1M7LA 4ASWA 5KTBA 2R44A 3N4XA 3A0BE 5APVA 1LP1B 1J1DB 1DIPA 1GD2E 2FY8A 4YPCA 3G6EP 2Y0DA 1VQLP 1LTTC 3RK2D 2E74D 3CCMP 5DJUB 3H1KE 5CBOA 4C46A 3KHUA 3HE5B 3RK2B 2YMKA 2E74B 2BEQD 4D6TD 1KORA 3CWBG 3HUSC 3WUTA 3ZDMA 1L0LJ 2FYUE 2R5BA 2I1JA 4BRYA 1OIPA 1VQNP 2M8RA 1J2JB 1ZLLA 2BEZF 1QEXA 2KB7P 3CX5H 2E42A 3V5BA 3P7KA 5TJHA 2WSEH 1Q82Q 1VDFA 3NMDA 3P8MC 1AV1A
chains in the Genus database with same CATH topology
2Q7CA 4KHXA 5AVWB 1T2KD 4JF7A 3HE4A 3LIEA 1SFCA 5AW3B 3M9QA 2GUVA 2YNYA 2VRSA 2C0WA 2HODB 2YO3A 2NPSD 1JTHA 1FAVA 1IFIA 2OARA 2W6BA 3M0AA 3B5NA 1T3JA 1KQLA 3VP8A 1FJKA 3CL3D 1N7LA 3VYIA 2NPSB 1RE4C 1MUUA 2C0XA 3RK3D 1DEBA 4WB4A 3VMXA 1JNMA 5APWA 3HD7D 2PP6A 2CPSA 1JY2N 4JYCA 1SQBK 3RK3B 2N9BA 3HD7B 1KILA 3VMZA 1JY2O 1N2DC 1MV8A 1SQXK 1E5WA 5APUA 2IPPA 2Z4EA 1FZCA 2YO2A 1HUCA 4IFDK 5KJ7C 1ZN5A 3RL0C 2WT7B 3H32B 1LT9A 1MFZA 2HFED 1KFNA 3MUDA 1URQD 1JUNA 1LWUB 3G3ZA 2FXMA 1J1EC 2HPCB 1URQB 3HUSB 2XDJA 1GK4A 3VOPA 2XNXA 1SFCC 1IO4A 1NO4A 1N7SD 1WRGA 5AVUB 3P32A 1ZV8A 1JY3N 4LLHA 2CPBA 1HGZA 1ZR4A 3HE5A 1OXZA 1YTZI 5CJ0A 1KZUB 1N7SB 1L0LK 1L4AD 3B5NC 1JY3O 1FZEA 1M1JB 4W7YA 5BU8B 1JY3P 1H89A 1H8AA 1L4AB 2WITA 1XTGB 4EIJA 4HYTB 1CSBA 4IFFA 1AFOA 5CCGD 3VP9A 3NTNA 3CI9A 3B8EB 4WBAA 3CLQA 1NU1K 3GHGB 1KILC 5AVVB 1LTIC 1GL2C 1FOSE 5AW6B 2Q3IA 2WPSA 1ZR2A 2IFMA 4LGDE 3O8ZA 2GUSA 3MGNA 2FFDA 2LKMA 3SWFA 1FZCC 1CI6B 3IFMA 3BRTB 3T97A 2GM4A 5APYA 3UIAA 1IFMA 2O1JA 2ZFCA 1LT9C 2N1TD 5CCHC 5AW8B 1GK6A 2JJLA 2N1TB 1L0NK 4ZKUA 3TK1A 2HODA 3M91A 5KJ7D 1SP4A 1J1DC 3TNUB 3MTUE 4C7NB 1HH0A 1GU5A 3V2PA 2KP8A 2HLOA 2NPSA 3V4WA 1GW3A 2KSJA 1RF1B 3VMYA 1CW5A 1CZQA 1FBMA 3I5CA 3M0DA 2PAJA 2C9LY 3RK2C 1X8YA 4AYCA 4W7ZA 5CJ4A 1N73B 1RF0C 1FJPA 3HD7A 3HTKB 5APXA 4JYBA 1EQ7A 1GTWA 3OA7A 3L35A 1SLQA 4WY4D 4XE5B 4XA4A 1T8ZA 3LW5H 1GL2A 3P8CE 5AW1B 1H88A 3L4FA 2P7JA 2XKMA 2XU6A 2WT7A 1LTAC 1JY2P 3H32A 4WY4B 3L36A 1JTHB 5AW5B 1NTKK 4I2LC 1YTZT 2FFDC 1DH3A 3KDPB 1URQA 4DZOA 5CCHA 2OYIB 1NAFA 1KILD 3V2NA 4GT1A 3EQ2A 3II6A 1KILB 2WWWA 1HWTC 2QM8A 1HGVA 1T2KC 5AVTB 1G2CB 4W80A 2R3CA 2R5DA 2YKPA 2XV5A 5APQA 4DOJA 4HH2A 1M1JA 3P8CD 2A45G 1FZFA 2IFNA 2NPSC 1VPCA 5APTA 1LT9B 1RE3A 2H43A 2OYHA 1L4AA 1A02F 1LTJB 3M0DC 1RF0A 1HVVA 4Y99C 3RK3C 2WSCH 4GIFA 3KYQA 3GHGA 3HD7C 1IC2A 1FOSF 2P67A 4AQRD 2HG5D 3OJAB 2J59M 2W27A 1AQ5A 1MZ9A 1NOHA 4N78E 2L5GB 1S9KD 4O9BA 1X9VA 5AW0B 2MJZA 2ZXEB 3BVHA 1WT6A 2FYZA 1LWUC 3A7OA 3MIWA 2A45H 1NTZK 3M06A 2N1TA 1URQC 5AVYB 1NKNA 2C9NY 3TNUA 1JCDA 4C7NA 1QL1A 4I1LA 2POHA 5AW2B 3VN0A 1LTBC 3TYYA 1NTMK 3RL0D 2FYUK 2YKOA 4LC1A 3HRNA 3C9IA 3NXSA 2WZ7A 2KLVA 1IFJA 1LTGC 1T3UA 3RL0B 1N7SC 2BASA 2FFDB 4ZKPA 1M1JC 3V2RA 1OWAA 1JMMA 4N78D 1A02J 1FZBA 1FZAA 3HTKA 1RE3C 2P2UA 2OYHC 5AVXB 1L4AC 1X79B 3EFGA 2WTYA 1J1EB 3E1IA 1IJDB 1SFCD 1SQQK 4N6JA 3NFQA 3GHGC 1G1JA 3OAKA 2WPRA 3R2PA 4WY4A 1IFDA 2YMYA 3HE4B 5AVRB 5CCGC 1XTCC 3A5TA 1SFCB 2YKQA 3VTPC 1PFIA 2M3BA 2Z5HA 3B5ND 1JOCA 2WPQA 2WSFH 5KLVK 5CHXA 5AVZB 3U1AA 1LWUA 4AUWA 2OYIA 1LTSC 3B5NB 1W2EA 2Z5IA 3H6PA 4RESB 3SWYA 2Q9IA 2HPCA 4Y99B 3WMM0 3HUSA 3U59A 3BASA 5AVSB 4B86A 2N1TC 5AW7B 3KPEA 1G2CA 1QL2A 1Z56A 4C7RA 1GL2D 2IX7C 3MD0A 1KFMA 1SQPK 1S9KE 3BATA 3PP5A 1GL2B 5BU5A 2H8PD 5APSA 3L37A 1RF1C 1N7SA 1YYCA 1FDMA 4M3LA 1FZCB 1LTJA 2XZRA 1SVFA 2FKWB 1FU1A 3IR9A 1G1IA 5CCHD 1N73C 1LGHB 1JCCA 1M7LA 2O01H 2QM7A 2KOGA 5KTBA 1IK9A 1GW4A 4IFMA 1FZGA 3N4XA 5APVA 3KQGA 5CCGA 3M9HA 1J1DB 1IFNA 4GKGA 3TSIA 3U1CA 3M9BA 1GD2E 4WY4C 5BVZA 3V4QA 1CI6A 2W6AA 2E43A 1LTTC 3RK2D 1RE4A 4EOTA 2H7HA 4C46A 2I1KA 1HTLC 3HE5B 2A45I 3RK2B 1GU4A 1NHLA 2OYHB 2P1JA 3N7NA 1DX7A 2OYIC 1HBWA 3A2AA 4OH8B 5AW4B 1GDTA 2Q5UA 1RY3A 2O1KA 3HUSC 3V2QA 1NWQA 2R5BA 3BRVB 1GZLA 2I1JA 2R32A 3A3YB 1HJBA 5KJ7A 5AVQB 2M8RA 1J2JB 4N3YB 1NKZB 1SQVK 1ZLLA 1RF1A 2JEEA 2KB7P 5CMZA 1N86A 5AW9B 2E42A 2J58A 4I6MC 1JO5A 3V5BA 3P7KA 1LTJC 1N73A 3LIDA 2WSEH 2KYVA 1VDFA 3NMDA 3P8MC 2HYNA 1NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7C A;  2XV5 A;  5APQ A;  4KHX A;  5AVW B;  4AUW A;  5AVV B;  1T2K D;  2Z5I A;  1FOS E;  4RES B;  3HE4 A;  3LIE A;  5AW6 B;  2Q3I A;  2WPS A;  5APT A;  5AW3 B;  3O8Z A;  2YNY A;  5AVS B;  1A02 F;  3MGN A;  2VRS A;  4B86 A;  3SWF A;  5AW7 B;  1CI6 B;  3T97 A;  5APY A;  2YO3 A;  3UIA A;  2ZFC A;  3MD0 A;  1FAV A;  3M0A A;  1S9K E;  1FOS F;  1KQL A;  2P67 A;  4AQR D;  3VYI A;  1MUU A;  5APS A;  5AW8 B;  3VMX A;  1GK6 A;  2W27 A;  3L37 A;  2JJL A;  5APW A;  1JNM A;  1YYC A;  4M3L A;  2XZR A;  3TK1 A;  3M91 A;  4JYC A;  1S9K D;  1SP4 A;  3TNU B;  3IR9 A;  4C7N B;  5AW0 B;  2N9B A;  1GU5 A;  3NTN A;  2ZXE B;  3VMZ A;  1MV8 A;  2KP8 A;  2QM7 A;  3V4W A;  5APU A;  3A7O A;  2IPP A;  3VMY A;  1CZQ A;  3M06 A;  3I5C A;  3M0D A;  2YO2 A;  5AVY B;  1HUC A;  5APV A;  3KQG A;  2C9L Y;  1X8Y A;  3M9H A;  4AYC A;  2C9N Y;  3TNU A;  4GKG A;  4C7N A;  3M9B A;  2WT7 B;  1GD2 E;  1MFZ A;  5AW2 B;  3V4Q A;  5APX A;  3VN0 A;  1CI6 A;  2W6A A;  4JYB A;  1GTW A;  1JUN A;  2E43 A;  3L35 A;  3TYY A;  1SLQ A;  4EOT A;  4LC1 A;  3NXS A;  2H7H A;  4XE5 B;  4C46 A;  3HE5 B;  1GU4 A;  5AW1 B;  1H88 A;  2P7J A;  2BAS A;  2XU6 A;  1GK4 A;  2WT7 A;  1HBW A;  1OWA A;  1A02 J;  3A2A A;  5AW4 B;  2Q5U A;  3HTK A;  3L36 A;  5AW5 B;  1IO4 A;  2P2U A;  5AVX B;  1NWQ A;  2R5B A;  4I2L C;  5AVU B;  2WTY A;  1GZL A;  3P32 A;  2R32 A;  1DH3 A;  3A3Y B;  3KDP B;  3HE5 A;  1OXZ A;  1HJB A;  4DZO A;  5AVQ B;  1NAF A;  3NFQ A;  1J2J B;  3OAK A;  2WPR A;  3HE4 B;  5AVR B;  4GT1 A;  3A5T A;  1H89 A;  1H8A A;  5CMZ A;  5AW9 B;  3VTP C;  2E42 A;  2WWW A;  1HWT C;  4I6M C;  2QM8 A;  4HYT B;  1CSB A;  2Z5H A;  3P7K A;  3V5B A;  5AVT B;  1T2K C;  3LID A;  1G2C B;  2WPQ A;  2R3C A;  3NMD A;  3P8M C;  5AVZ B;  2R5D A;  3B8E B; 
#chains in the Genus database with same CATH topology
 3H1K G;  3SSU A;  2QJK B;  3LIE A;  5KAF H;  2SPZ A;  3CCQ P;  4MN4 C;  1EXJ A;  4PD4 D;  5L8R J;  1S2E A;  2FYU G;  2B87 B;  2W6B A;  3M0A A;  3FXD A;  1FJK A;  3CL3 D;  2QA4 P;  3GG2 A;  3FWL A;  1MUU A;  4HJG H;  3VMX A;  5APW A;  2CPS A;  1SQB K;  3FXE A;  1YBK A;  3VMZ A;  1N2D C;  1E5W A;  4Y28 J;  1S3J A;  2M5A A;  1PP9 E;  5KLV D;  2WT7 B;  2HFE D;  2FXO A;  1KFN A;  2A06 E;  2XDJ A;  1GK4 A;  3L72 D;  3VOP A;  3L74 J;  3BCC D;  3H1J E;  1IO4 A;  1HJ0 A;  2Q1K A;  1NYH A;  2CPB A;  1HGZ A;  3HE5 A;  1KZU B;  2K1A A;  3CCU P;  2IBZ E;  1L4A D;  1M1J B;  1FZE A;  1PP9 G;  4GOD A;  2OTK E;  1JY3 P;  1S4X A;  1H8A A;  1L4A B;  2WIT A;  1PP9 J;  4IFF A;  1MFT A;  3CXH E;  4WBA A;  3AEA C;  3CLQ A;  4H44 C;  3GHG B;  2A06 G;  4I7Z C;  5AVV B;  4GDO A;  4K3A A;  1FOS E;  1QX8 A;  1KYO D;  2FFD A;  3CCL P;  3H1J G;  1UII A;  2O1J A;  1EDK A;  2NRG A;  2N1T D;  2IBZ G;  5AW8 B;  1GK6 A;  4U3F E;  2N1T B;  3F89 A;  4L73 A;  1WMK A;  2JDI H;  5KJ7 D;  1SP4 A;  1J1D C;  3TNU B;  2E75 C;  4C7N B;  3CC4 P;  1NTM D;  4BWN A;  2HLO A;  2IZ1 A;  2RKL A;  2Y9Y A;  2KSJ A;  3VMY A;  1CZQ A;  1SQB E;  3RK2 C;  1X8Y A;  4AYC A;  2E74 C;  3HTK B;  1EQ7 A;  1S5L X;  3LW5 H;  1GL2 A;  3P8C E;  2P7J A;  4U3F G;  3JCU H;  2WT7 A;  1PPJ D;  3FWN A;  5AW5 B;  1NTK K;  2FFD C;  4HKZ H;  1Y8A A;  1NGM B;  3G4S P;  5CCH A;  1EDI A;  4TT3 H;  3I56 P;  1KIL D;  2WSC J;  2QJK C;  5H2F H;  4JBZ A;  1LJ2 A;  1ZOY C;  1SQB G;  3K5B A;  1USE A;  2ITA A;  1SQX D;  1KIL B;  2WWW A;  2PRR A;  3Q5S A;  1RH5 B;  5KAI E;  4W80 A;  3G9R A;  2YKP A;  2XV5 A;  2BCC E;  3AEB C;  1M1J A;  2A45 G;  1FZF A;  1VPC A;  5APT A;  1LT9 B;  3H1H E;  1SQP J;  2OYH A;  1L4A A;  1HF9 A;  1OVR A;  1LTJ B;  1FDO A;  1RF0 A;  3GHG A;  4DT0 A;  2P67 A;  4AQR D;  1P84 E;  3AED C;  3OJA B;  4JPZ B;  1MZ9 A;  3Q2Y A;  5GTH H;  4PJ0 H;  1S9K D;  2B88 A;  1X9V A;  3L71 E;  5GTI E;  1L0L D;  1KB9 E;  3E7K A;  2BCC G;  3A7O A;  3MIW A;  2N1T A;  1OX3 A;  1UIX A;  3TNU A;  3H1H G;  4C7N A;  1QL1 A;  1YIJ P;  1BE3 D;  1NTM K;  4H0L D;  1AVY A;  4HB1 A;  3GF7 A;  4RO0 A;  2WZ7 A;  3CD6 P;  4OWF A;  1IFJ A;  4H0L B;  1SQV D;  1M1J C;  3FX0 A;  4N78 D;  3HTK A;  3L73 E;  1YHQ P;  3OW2 O;  2OYH C;  5AVX B;  1L4A C;  3L71 G;  1X79 B;  4ASV A;  2JKV A;  1IJD B;  3H1I E;  1SFC D;  3GHG C;  4EI2 A;  1G1J A;  2WPR A;  2MKV A;  1SFC B;  1R8E A;  2ZYA A;  2I8D A;  2WSF H;  4L74 A;  1SQQ J;  1W2E A;  3CXH H;  4Y99 B;  3U59 A;  1R5S A;  3BAS A;  2N1T C;  1PZQ A;  3CX5 E;  1OW7 A;  1AVO A;  3L73 J;  1VL2 A;  3H1I G;  2W90 A;  3H25 A;  2G3A A;  4XFJ A;  5KAF E;  4M3L A;  1FZC B;  1LTJ A;  3L74 D;  1FU1 A;  1OW8 A;  1JCC A;  1ZP0 C;  1VQO P;  2AEJ A;  2KOG A;  1IK9 A;  1YJN P;  2W8Z A;  1NU1 E;  2XND H;  3EWK A;  5CCG A;  4GKG A;  3U1C A;  3H1L E;  2PFX A;  4IL6 H;  1OW6 A;  2I1K A;  2P58 A;  1PV3 A;  1GU4 A;  2M3E A;  3N7N A;  1OVV A;  1GDT A;  2Q5U A;  1RY3 A;  2O1K A;  3AEG C;  2ZVN B;  3PLN A;  3EFF K;  1NU1 G;  5AVQ B;  3CX5 I;  4N3Y B;  1RF1 A;  1SQV K;  1EZV E;  3PJS K;  2FYN B;  2JEE A;  3H1L G;  5CMZ A;  1N86 A;  5AW9 B;  1VQK P;  1JO5 A;  1LTJ C;  3LID A;  3CME P;  3H1L J;  1SS1 A;  4KHX A;  1OFC X;  1SFC A;  2RN0 A;  5AW3 B;  2GUV A;  2YNY A;  2VRS A;  2C0W A;  2OTJ P;  5B5E H;  2YO3 A;  1VQ6 P;  1IFI A;  1L0N J;  3PRJ A;  3IF4 A;  1KQL A;  3VYI A;  4YXW H;  2QRX A;  4R4L A;  3RK3 D;  1DEB A;  1JMB A;  3AEE C;  1BDC A;  3RK3 B;  2V7Q H;  2R3S A;  2N9B A;  3PHL A;  5APU A;  2E5T A;  2IPP A;  2Z4E A;  1FZC A;  3SWK A;  4H0L C;  3L70 D;  3H32 B;  1KMI Z;  4PD4 H;  1URQ D;  1JUN A;  1Q2N A;  1EZV I;  1URQ B;  1RHZ B;  3IN6 A;  1SQP D;  1SFC C;  2GA1 A;  3P32 A;  1ZV8 A;  1OXZ A;  1YTZ I;  1NTZ E;  3GLM A;  3JCU E;  3ABV C;  5BU8 B;  1H89 A;  4HYT B;  3Q3D A;  5M1B A;  1KQG B;  1M57 D;  3VP9 A;  3CI9 A;  3E1R A;  5AW6 B;  3CWB J;  5H2F E;  3TGU E;  1ZR2 A;  2IFM A;  3O8Z A;  2GUS A;  3MGN A;  2LKM A;  1FZC C;  1CI6 B;  3IFM A;  3T97 A;  5APY A;  1BGY E;  2ZFC A;  3W68 A;  1OVU A;  1H0T B;  1QLE D;  2E76 D;  1BSH A;  1NTZ G;  2JJL A;  4ZKU A;  1IFP A;  2PGD A;  3M91 A;  3QH9 A;  2E76 B;  3MTU E;  1NTZ J;  3H1K J;  1GU5 A;  1M56 D;  3Q5R A;  1GW3 A;  3KXD A;  1VF5 D;  3I5C A;  3TGU G;  5GTH E;  2FYU J;  1KYO H;  4PJ0 E;  1VF5 B;  1N73 B;  1BCC E;  5APX A;  1FC2 C;  1BGY G;  1GTW A;  1SQQ D;  1PGJ A;  1ZRT E;  1LTA C;  1JY2 P;  3H32 A;  3CPW O;  4OGQ C;  4RJT A;  3L36 A;  1JTH B;  4GOE A;  4I2L C;  1YTZ T;  1GMJ A;  1URQ A;  3V6I A;  1S5L H;  4DZO A;  3L73 D;  3V2N A;  4GT1 A;  4KT0 J;  1LP1 A;  3II6 A;  1BCC G;  2QM8 A;  1HGV A;  2R5D A;  5APQ A;  4DOJ A;  4HH2 A;  2IFN A;  1FE6 A;  3RK3 C;  4GIF A;  1YJW P;  3KYQ A;  1IC2 A;  1FOS F;  3AE1 C;  1YQ3 C;  3WUU A;  1NOH A;  2QJY B;  2WQY C;  4O9B A;  1H0T A;  1FS0 E;  3BVH A;  1YQ4 C;  1URQ C;  3H1J J;  1NKN A;  2L91 A;  2POH A;  3A0H H;  3S4R A;  3TYY A;  2FBW C;  4PV1 D;  3RL0 D;  5E79 H;  2YKO A;  2B87 A;  4K35 A;  2KI7 B;  1KTM A;  4PV1 B;  3RL0 B;  1U7J A;  1FZA A;  4IL6 E;  2WTY A;  2Q3E A;  3E1I A;  3QWO C;  1L0N D;  2IDB A;  1VQ4 P;  1Q7Y Q;  1SQQ K;  2IBZ I;  3NFQ A;  3HE4 B;  5AVR B;  1XTC C;  3A5T A;  2YKQ A;  3VTP C;  2ZT9 D;  2Z5H A;  1JOC A;  2WPQ A;  5KLV K;  5CHX A;  5AVZ B;  3CXH I;  2ZT9 B;  1EZV D;  1LTS C;  4U3F J;  2Z5I A;  3H6P A;  3WMM 0;  1QL2 A;  1Z56 A;  2IX7 C;  1R5L A;  3MD0 A;  3MP7 B;  2KK7 A;  1SQB J;  2ZXX A;  1YYC A;  2KLU A;  2AEM A;  4D6T E;  2D2C D;  5CBN A;  4UB6 H;  3IR9 A;  5B5E E;  1N73 C;  1VF5 C;  4NPE A;  2D2C B;  1YJ9 P;  4IFM A;  4DJG A;  3MHV A;  5BVZ A;  3V4Q A;  2E43 A;  1RE4 A;  4Z1M H;  1VQ8 P;  3C1L A;  4EOT A;  2H7H A;  2LXC B;  2RMZ A;  2A45 I;  1LNQ A;  2P1J A;  1DX7 A;  1HBW A;  3A2A A;  4OH8 B;  3CWB D;  5AW4 B;  4D6T G;  1ZW0 A;  3D70 A;  4PD4 E;  2KNC B;  1K8A Q;  1NWQ A;  2BCC J;  3BRV B;  1GZL A;  2R32 A;  2W83 C;  3A3Y B;  4UB8 H;  2W6J H;  2AXC A;  5KJ7 A;  3H1H J;  3PTZ A;  1W2B O;  2J58 A;  4I6M C;  2KYV A;  3AE9 C;  3KZI H;  2HYN A;  3H1K D;  2Q7C A;  1JM0 A;  1PIX A;  3CC7 P;  1T2K D;  4JF7 A;  4TLF A;  3HE4 A;  3CCR P;  1NJI Q;  3L71 J;  3G71 P;  1BSN A;  5KLV E;  1Y47 A;  2HOD B;  4L76 A;  2FYU D;  4GOF A;  2K9J B;  1NTK E;  1FAV A;  2OAR A;  1T3J A;  1X22 A;  4A7P A;  5C39 A;  1N7L A;  1P84 I;  1VQ5 P;  1RE4 C;  3Q1M A;  4WB4 A;  2PP6 A;  3L72 E;  3CCV P;  2KUB A;  2K9Y A;  1PGO A;  3BCC E;  5KKZ B;  1KIL A;  1MV8 A;  3D6Z A;  1SQX K;  1KB9 I;  1QGK B;  2YO2 A;  4PD4 I;  1ZXG A;  5KJ7 C;  4PV1 C;  1ZN5 A;  3RL0 C;  1LT9 A;  1MFZ A;  5KLV G;  4WWI A;  3MUD A;  3H1I J;  4EDF A;  1NTK G;  1LWU B;  3VMA A;  3G3Z A;  2FXM A;  2K88 A;  2LR2 A;  2HPC B;  3HUS B;  1NTK J;  1OMI A;  3TF5 A;  3L72 G;  1KYO E;  1PGQ A;  1NO4 A;  3BCC G;  1N7S D;  5AVU B;  1VQ7 P;  3AE3 C;  2KZI A;  2KXP B;  2ZT9 C;  1N7S B;  1PP9 D;  1L0L K;  4W7Y A;  2OYO A;  3F5H A;  2KNC A;  2WSE J;  4EIJ A;  2QEX P;  3S1K A;  1AFO A;  1DD3 A;  2A06 D;  1NTM E;  1KQF B;  1KIL C;  1KC8 Q;  1S5L E;  2WPS A;  4LGD E;  3H1J D;  3WU2 H;  3S9O A;  1NU1 J;  1LT9 C;  2KZJ A;  2OTL P;  3D6Y A;  3MUD C;  2WPV B;  2IBZ D;  2D2C C;  1YIT P;  3SFD C;  2B9B A;  3TK1 A;  2HOD A;  1PPJ E;  2K9J A;  1HH0 A;  3CXH D;  3V2P A;  2KP8 A;  2ZJS E;  1E79 H;  3V4W A;  1NTM G;  2PAJ A;  1K05 A;  1NTM J;  1SQX E;  2B89 A;  3OA7 A;  1SLQ A;  2ZYD A;  4WY4 D;  4XE5 B;  1T8Z A;  5AW1 B;  1H88 A;  4U3F D;  3L4F A;  2XU6 A;  4WY4 B;  1PPJ G;  1PGP A;  2IYO A;  3A0H E;  3KDP B;  5E79 E;  2YXR B;  3CCS P;  2OYI B;  1SQB D;  1Y9B A;  3O6Q B;  1TU3 F;  4RKU J;  1T2K C;  1AJY A;  1SQX G;  2OQQ A;  2WSS H;  1G2C B;  1L0L E;  3P8C D;  4L75 A;  1RQU A;  3RL0 g;  2Y0C A;  1KQS O;  5TIS H;  1BE3 E;  1HVV A;  4Y99 C;  2E75 D;  2G8Y A;  5KKZ C;  3TDK A;  4QMA A;  2HG5 D;  2E75 B;  2J59 M;  3CCE P;  1DEE G;  1AQ5 A;  1SQV E;  2WMM A;  1AQT A;  1QVF O;  4N78 E;  2L5G B;  5AW0 B;  2MJZ A;  2BCC D;  2FYZ A;  1L0L G;  1LWU C;  1USD A;  1S72 P;  3M06 A;  5AVY B;  3L75 E;  3H1H D;  2C9N Y;  1JCD A;  4I1L A;  5AW2 B;  2ZYG A;  4H13 D;  4UB6 E;  1BE3 G;  1JB0 J;  1LTB C;  3LW5 J;  4NPD A;  4H13 B;  4LC1 A;  3NXS A;  1P84 D;  3AE8 C;  1BE3 J;  2KLV A;  1T3U A;  2YXQ B;  1D7M A;  1N7S C;  2FFD B;  4ZKP A;  3V2R A;  1SQV G;  1JMM A;  1PL5 A;  3L71 D;  2P2U A;  3RGU A;  1SQV J;  1J1E B;  1KB9 D;  4JQ0 D;  1OZH A;  3TGU J;  3SFE C;  4N6J A;  4WY4 A;  1EDL A;  2YMY A;  3L75 G;  1BGY J;  5KLI B;  3L74 E;  3B5N D;  3L75 J;  2FYN C;  4UB8 E;  4AUW A;  2OYI A;  3B5N B;  3SWY A;  2YIU B;  3IAO A;  3D71 A;  3PH0 A;  3O6Q A;  5AVS B;  5AW7 B;  1G2C A;  4C7R A;  1GL2 D;  2QG4 A;  2JO1 A;  1KFM A;  3KZI E;  3RBX A;  1SQP K;  2KIK A;  3H1I D;  3PP5 A;  1GL2 B;  5BU5 A;  2H8P D;  2QJP B;  3FGA D;  3L37 A;  1JEK A;  3CMA P;  1BCC J;  1NTK D;  2FKW B;  1S1C X;  5CCH D;  1G1I A;  4OVN F;  3L74 G;  1LGH B;  2AXT H;  2O01 H;  4EYY Q;  2QM7 A;  4U7J A;  1GW4 A;  1BDD A;  1FZG A;  3KQG A;  5B66 H;  3M9H A;  1IFN A;  3TSI A;  3CX5 D;  3M9B A;  4WY4 C;  1CI6 A;  1NVO A;  2W6A A;  1M8O B;  1EXI A;  2DW3 A;  2IYP A;  2OGU A;  1HTL C;  1NHL A;  2OYH B;  2OYI C;  3CC2 P;  1Q81 Q;  3V2Q A;  1VQ9 P;  1RQV A;  1NU1 D;  1HJB A;  2V4H A;  1LT1 A;  1NKZ B;  3RK3 E;  3H1L D;  2QSI A;  2WSF J;  1N73 A;  2O3J A;  1NH4 A;  5AVW B;  3GF3 A;  2H89 C;  2E5Y A;  4NPF X;  3USS A;  3GMA A;  3M9Q A;  2JWD A;  1VQP P;  3L70 E;  1U7M A;  4WVZ A;  2NPS D;  1JTH A;  2KSE A;  5EFW B;  3B5N A;  2Y9Z A;  3VP8 A;  2NPS B;  2C0X A;  3A0B H;  1JNM A;  1L2P A;  3HD7 D;  1N8R Q;  1JY2 N;  4JYC A;  1SQP E;  3AEC C;  3HD7 B;  3WU2 E;  3B71 A;  1JY2 O;  2E76 C;  2IZ0 A;  4H13 C;  1HUC A;  1QVG O;  4IFD K;  1KN7 A;  4IOI H;  1IZN B;  5DJT B;  3L70 G;  2JP3 A;  3AE6 C;  1X0T A;  4DCK A;  3L70 J;  1J1E C;  1U57 A;  2P10 A;  1VQM P;  1MKM A;  2UWJ E;  1DD4 A;  2XNX A;  4ZNC A;  1SQP G;  5KLI C;  1WRG A;  1JY3 N;  4LLH A;  1ZR4 A;  5CJ0 A;  5K5G B;  1JY3 O;  3B5N C;  2N9Y B;  2JWA A;  4ZMD A;  2YIU C;  1XTG B;  1KD1 Q;  1CSB A;  1EDJ A;  3AE7 C;  3AE4 C;  5CCG D;  2QVA A;  3B8E B;  3NTN A;  1NU1 K;  2CK3 H;  1LTI C;  2Y0E A;  1GL2 C;  4D6T J;  2Q3I A;  2QJP C;  2QE7 H;  3SWF A;  3BRT B;  2GM4 A;  1EC5 A;  3UIA A;  1IFM A;  1Q86 Q;  2M0B A;  2WVR A;  5CCH C;  1SQQ E;  1NTZ D;  1M1K Q;  1L0N K;  2V7Q J;  4BXL A;  1YI2 P;  5TIS E;  2NZ2 A;  3W67 A;  2NPS A;  2QJY C;  1RF1 B;  1CW5 A;  1FBM A;  3TGU D;  3M0D A;  2C9L Y;  4R4M A;  4W7Z A;  5CJ4 A;  3MZW B;  1RF0 C;  1FJP A;  3HD7 A;  2O01 N;  1BGY D;  3AEF C;  1T6A A;  2KS1 B;  2QIW A;  4JYB A;  3L35 A;  3L75 D;  3WUV A;  3JC2 2;  4CPG A;  3AE5 C;  4XA4 A;  1AA0 A;  1SQQ G;  2XKM A;  2H88 C;  1FDI A;  1DH3 A;  2Q6Q A;  1NAF A;  5KLV J;  3L73 G;  4YTP C;  3EQ2 A;  1BCC D;  3I55 P;  1HWT C;  5AVT B;  2R3C A;  1K04 A;  4YXD C;  2HR3 A;  3L72 J;  2LXB A;  1ZRT D;  1KV4 A;  2NPS C;  1RE3 A;  3BCC J;  2H43 A;  1A02 F;  3M0D C;  2ZAE B;  2K37 A;  3AE2 C;  2WSC H;  3HD7 C;  1K73 Q;  2RH0 A;  3R4Y A;  2W27 A;  3Q5P A;  2ZXE B;  2FXP A;  1WT6 A;  1IK7 A;  1L0N E;  2A45 H;  1NTZ K;  3RBZ A;  4OGQ D;  2ZVO B;  1Q90 D;  3VN0 A;  2AXT E;  4OGQ B;  2FYU K;  4BRY B;  2J5U A;  3HRN A;  3C9I A;  1LTG C;  2BAS A;  3GW6 A;  3T97 B;  5B66 E;  1OWA A;  1A02 J;  3JSV C;  1FZB A;  1KYO I;  2KS1 A;  1KIL E;  1NAY A;  1RE3 C;  1W5C E;  5KAI H;  3EFG A;  1ZME C;  3ITK A;  1L0N G;  2AEF A;  3OAK A;  3R2P A;  3CCJ P;  1IFD A;  5CCG C;  1PFI A;  2M3B A;  3U1A A;  1LWU A;  1EZV G;  1P84 H;  3C8V A;  4RES B;  2Q9I A;  2HPC A;  2O01 J;  3HUS A;  3B4S A;  2JR8 A;  4H44 D;  4B86 A;  3KPE A;  5GTI H;  4H44 B;  1M90 Q;  4I7Z B;  1KB9 H;  1S9K E;  3BAT A;  5APS A;  2M5A B;  1RF1 C;  1N7S A;  1FDM A;  1SQX J;  2XZR A;  2K3R A;  1SVF A;  4KJM A;  3CWB E;  4IL6 X;  1K9M Q;  1M7L A;  4ASW A;  5KTB A;  2R44 A;  3N4X A;  3A0B E;  5APV A;  1LP1 B;  1J1D B;  1DIP A;  1GD2 E;  2FY8 A;  4YPC A;  3G6E P;  2Y0D A;  1VQL P;  1LTT C;  3RK2 D;  2E74 D;  3CCM P;  5DJU B;  3H1K E;  5CBO A;  4C46 A;  3KHU A;  3HE5 B;  3RK2 B;  2YMK A;  2E74 B;  2BEQ D;  4D6T D;  1KOR A;  3CWB G;  3HUS C;  3WUT A;  3ZDM A;  1L0L J;  2FYU E;  2R5B A;  2I1J A;  4BRY A;  1OIP A;  1VQN P;  2M8R A;  1J2J B;  1ZLL A;  2BEZ F;  1QEX A;  2KB7 P;  3CX5 H;  2E42 A;  3V5B A;  3P7K A;  5TJH A;  2WSE H;  1Q82 Q;  1VDF A;  3NMD A;  3P8M C;  1AV1 A; 
#chains in the Genus database with same CATH homology
 2Q7C A;  4KHX A;  5AVW B;  1T2K D;  4JF7 A;  3HE4 A;  3LIE A;  1SFC A;  5AW3 B;  3M9Q A;  2GUV A;  2YNY A;  2VRS A;  2C0W A;  2HOD B;  2YO3 A;  2NPS D;  1JTH A;  1FAV A;  1IFI A;  2OAR A;  2W6B A;  3M0A A;  3B5N A;  1T3J A;  1KQL A;  3VP8 A;  1FJK A;  3CL3 D;  1N7L A;  3VYI A;  2NPS B;  1RE4 C;  1MUU A;  2C0X A;  3RK3 D;  1DEB A;  4WB4 A;  3VMX A;  1JNM A;  5APW A;  3HD7 D;  2PP6 A;  2CPS A;  1JY2 N;  4JYC A;  1SQB K;  3RK3 B;  2N9B A;  3HD7 B;  1KIL A;  3VMZ A;  1JY2 O;  1N2D C;  1MV8 A;  1SQX K;  1E5W A;  5APU A;  2IPP A;  2Z4E A;  1FZC A;  2YO2 A;  1HUC A;  4IFD K;  5KJ7 C;  1ZN5 A;  3RL0 C;  2WT7 B;  3H32 B;  1LT9 A;  1MFZ A;  2HFE D;  1KFN A;  3MUD A;  1URQ D;  1JUN A;  1LWU B;  3G3Z A;  2FXM A;  1J1E C;  2HPC B;  1URQ B;  3HUS B;  2XDJ A;  1GK4 A;  3VOP A;  2XNX A;  1SFC C;  1IO4 A;  1NO4 A;  1N7S D;  1WRG A;  5AVU B;  3P32 A;  1ZV8 A;  1JY3 N;  4LLH A;  2CPB A;  1HGZ A;  1ZR4 A;  3HE5 A;  1OXZ A;  1YTZ I;  5CJ0 A;  1KZU B;  1N7S B;  1L0L K;  1L4A D;  3B5N C;  1JY3 O;  1FZE A;  1M1J B;  4W7Y A;  5BU8 B;  1JY3 P;  1H89 A;  1H8A A;  1L4A B;  2WIT A;  1XTG B;  4EIJ A;  4HYT B;  1CSB A;  4IFF A;  1AFO A;  5CCG D;  3VP9 A;  3NTN A;  3CI9 A;  3B8E B;  4WBA A;  3CLQ A;  1NU1 K;  3GHG B;  1KIL C;  5AVV B;  1LTI C;  1GL2 C;  1FOS E;  5AW6 B;  2Q3I A;  2WPS A;  1ZR2 A;  2IFM A;  4LGD E;  3O8Z A;  2GUS A;  3MGN A;  2FFD A;  2LKM A;  3SWF A;  1FZC C;  1CI6 B;  3IFM A;  3BRT B;  3T97 A;  2GM4 A;  5APY A;  3UIA A;  1IFM A;  2O1J A;  2ZFC A;  1LT9 C;  2N1T D;  5CCH C;  5AW8 B;  1GK6 A;  2JJL A;  2N1T B;  1L0N K;  4ZKU A;  3TK1 A;  2HOD A;  3M91 A;  5KJ7 D;  1SP4 A;  1J1D C;  3TNU B;  3MTU E;  4C7N B;  1HH0 A;  1GU5 A;  3V2P A;  2KP8 A;  2HLO A;  2NPS A;  3V4W A;  1GW3 A;  2KSJ A;  1RF1 B;  3VMY A;  1CW5 A;  1CZQ A;  1FBM A;  3I5C A;  3M0D A;  2PAJ A;  2C9L Y;  3RK2 C;  1X8Y A;  4AYC A;  4W7Z A;  5CJ4 A;  1N73 B;  1RF0 C;  1FJP A;  3HD7 A;  3HTK B;  5APX A;  4JYB A;  1EQ7 A;  1GTW A;  3OA7 A;  3L35 A;  1SLQ A;  4WY4 D;  4XE5 B;  4XA4 A;  1T8Z A;  3LW5 H;  1GL2 A;  3P8C E;  5AW1 B;  1H88 A;  3L4F A;  2P7J A;  2XKM A;  2XU6 A;  2WT7 A;  1LTA C;  1JY2 P;  3H32 A;  4WY4 B;  3L36 A;  1JTH B;  5AW5 B;  1NTK K;  4I2L C;  1YTZ T;  2FFD C;  1DH3 A;  3KDP B;  1URQ A;  4DZO A;  5CCH A;  2OYI B;  1NAF A;  1KIL D;  3V2N A;  4GT1 A;  3EQ2 A;  3II6 A;  1KIL B;  2WWW A;  1HWT C;  2QM8 A;  1HGV A;  1T2K C;  5AVT B;  1G2C B;  4W80 A;  2R3C A;  2R5D A;  2YKP A;  2XV5 A;  5APQ A;  4DOJ A;  4HH2 A;  1M1J A;  3P8C D;  2A45 G;  1FZF A;  2IFN A;  2NPS C;  1VPC A;  5APT A;  1LT9 B;  1RE3 A;  2H43 A;  2OYH A;  1L4A A;  1A02 F;  1LTJ B;  3M0D C;  1RF0 A;  1HVV A;  4Y99 C;  3RK3 C;  2WSC H;  4GIF A;  3KYQ A;  3GHG A;  3HD7 C;  1IC2 A;  1FOS F;  2P67 A;  4AQR D;  2HG5 D;  3OJA B;  2J59 M;  2W27 A;  1AQ5 A;  1MZ9 A;  1NOH A;  4N78 E;  2L5G B;  1S9K D;  4O9B A;  1X9V A;  5AW0 B;  2MJZ A;  2ZXE B;  3BVH A;  1WT6 A;  2FYZ A;  1LWU C;  3A7O A;  3MIW A;  2A45 H;  1NTZ K;  3M06 A;  2N1T A;  1URQ C;  5AVY B;  1NKN A;  2C9N Y;  3TNU A;  1JCD A;  4C7N A;  1QL1 A;  4I1L A;  2POH A;  5AW2 B;  3VN0 A;  1LTB C;  3TYY A;  1NTM K;  3RL0 D;  2FYU K;  2YKO A;  4LC1 A;  3HRN A;  3C9I A;  3NXS A;  2WZ7 A;  2KLV A;  1IFJ A;  1LTG C;  1T3U A;  3RL0 B;  1N7S C;  2BAS A;  2FFD B;  4ZKP A;  1M1J C;  3V2R A;  1OWA A;  1JMM A;  4N78 D;  1A02 J;  1FZB A;  1FZA A;  3HTK A;  1RE3 C;  2P2U A;  2OYH C;  5AVX B;  1L4A C;  1X79 B;  3EFG A;  2WTY A;  1J1E B;  3E1I A;  1IJD B;  1SFC D;  1SQQ K;  4N6J A;  3NFQ A;  3GHG C;  1G1J A;  3OAK A;  2WPR A;  3R2P A;  4WY4 A;  1IFD A;  2YMY A;  3HE4 B;  5AVR B;  5CCG C;  1XTC C;  3A5T A;  1SFC B;  2YKQ A;  3VTP C;  1PFI A;  2M3B A;  2Z5H A;  3B5N D;  1JOC A;  2WPQ A;  2WSF H;  5KLV K;  5CHX A;  5AVZ B;  3U1A A;  1LWU A;  4AUW A;  2OYI A;  1LTS C;  3B5N B;  1W2E A;  2Z5I A;  3H6P A;  4RES B;  3SWY A;  2Q9I A;  2HPC A;  4Y99 B;  3WMM 0;  3HUS A;  3U59 A;  3BAS A;  5AVS B;  4B86 A;  2N1T C;  5AW7 B;  3KPE A;  1G2C A;  1QL2 A;  1Z56 A;  4C7R A;  1GL2 D;  2IX7 C;  3MD0 A;  1KFM A;  1SQP K;  1S9K E;  3BAT A;  3PP5 A;  1GL2 B;  5BU5 A;  2H8P D;  5APS A;  3L37 A;  1RF1 C;  1N7S A;  1YYC A;  1FDM A;  4M3L A;  1FZC B;  1LTJ A;  2XZR A;  1SVF A;  2FKW B;  1FU1 A;  3IR9 A;  1G1I A;  5CCH D;  1N73 C;  1LGH B;  1JCC A;  1M7L A;  2O01 H;  2QM7 A;  2KOG A;  5KTB A;  1IK9 A;  1GW4 A;  4IFM A;  1FZG A;  3N4X A;  5APV A;  3KQG A;  5CCG A;  3M9H A;  1J1D B;  1IFN A;  4GKG A;  3TSI A;  3U1C A;  3M9B A;  1GD2 E;  4WY4 C;  5BVZ A;  3V4Q A;  1CI6 A;  2W6A A;  2E43 A;  1LTT C;  3RK2 D;  1RE4 A;  4EOT A;  2H7H A;  4C46 A;  2I1K A;  1HTL C;  3HE5 B;  2A45 I;  3RK2 B;  1GU4 A;  1NHL A;  2OYH B;  2P1J A;  3N7N A;  1DX7 A;  2OYI C;  1HBW A;  3A2A A;  4OH8 B;  5AW4 B;  1GDT A;  2Q5U A;  1RY3 A;  2O1K A;  3HUS C;  3V2Q A;  1NWQ A;  2R5B A;  3BRV B;  1GZL A;  2I1J A;  2R32 A;  3A3Y B;  1HJB A;  5KJ7 A;  5AVQ B;  2M8R A;  1J2J B;  4N3Y B;  1NKZ B;  1SQV K;  1ZLL A;  1RF1 A;  2JEE A;  2KB7 P;  5CMZ A;  1N86 A;  5AW9 B;  2E42 A;  2J58 A;  4I6M C;  1JO5 A;  3V5B A;  3P7K A;  1LTJ C;  1N73 A;  3LID A;  2WSE H;  2KYV A;  1VDF A;  3NMD A;  3P8M C;  2HYN A;  1NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...