3NMKA

Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmkA00
2YLIA 1CGOA 3VRCA 3FOOA 1A7VA 2XM4A 3NMKA 4U9DA 3IQ5A 4IAQA 4JKVA 4CDVA 1BBHA 1E84A 3M4CA 5JP7A 2YKZA 1JAFA 1APCA 3M79A 4CDYA 3HNIA 2YL1A 4N6HA 4CJOA 4ULVA 2BC5A 4CIPA 5AGFA 3NMJA 2YL0A 3ZWIA 4D4NA 3M15A 1YZCA 4JE9A 1QPUA 1E83A 2YLDA 3HNKA 4ER9A 1MQVA 1QQ3A 3C63A 1CPQA 3M4BA 3TOLA 1GQAA 3ZTMA 2J9BA 3DE9A 2XLDA 4IB4A 5JSLA 1YZAA 1S05A 4N4WA 2XL8A 2YL3A 4CJGA 3U8PA 3HNJA 5JRAA 4D4XA 5JVEA 3L1MA 3ZQVA 256BA 4WGYA 5B3IA 2XLVA 2XLEA 3IQ6A 3QW1A 3ZQYA 1LM3B 4WGZA 1NBBA 5JS5A 1E86A 3FOPA 2XL6A 2XM0A 5JLIA 1RCPA 4CDAA 2XLHA 3QW0A 3TOMA 3NMIA 4JEBA 5JT4A 3HNLA 4JEAA 1M6TA 4NC3A 1CPRA 4L6RA 2XLOA 3C62A 2QLAA 1YYXA 2XLMA 1E85A 3ZTZA 4CX9A 3DE8A 2CCYA 3QVZA 4U9EA 1CGNA 2J8WA 3QVYA 2XLWA 2YLGA 1EKYA 5JUAA 1YYJA 4IARA 2YL7A 4EIYA
chains in the Genus database with same CATH superfamily
2R05A 1WWPA 3C8GB 4YN0B 2NSGA 2CYDA 1NFNA 1OW6A 3FXHA 1CGOA 1OKKA 4MVSA 1G4US 3ECSA 3RVZA 1U89A 3VRCA 2L6FA 4OD4A 1S7ZA 3EZIA 1TWHA 3W8HA 3IQ5A 3RVYA 3U9MA 1TKNA 5K0IA 3HLZA 3RIPA 2JX0A 2J0XA 4K7BA 3SXZA 5BQHA 4U5GA 1JAFA 1OCRC 1PV3A 3GWNA 5E2QA 1YA9A 2PBEA 1IW7F 2R7RA 1M56C 1APCA 1ST6A 4FESA 4G7OF 2PX3A 2D5RB 1GM5A 2YL1A 1A0BA 4O7GA 3LESA 4ULVA 4JVSA 3VYWA 5A6BA 3UGPA 1H9GA 3Q6MA 4CIPA 2MWQA 1LKXA 2OEXA 1TFOB 5KYXB 1NZEA 1YA7O 4O79A 4D4NA 2WZLA 1YZCA 3OWTA 4PACA 1UFBA 1RMVA 2IM8A 2OOCA 4OINF 1WOLA 1EA8A 1Z23A 1IZMA 1Q0DA 2TMVP 5B1AC 1ZU5A 1EKYA 2HMZA 3TULA 2I8BA 2XS8A 2VCBA 1QQ3A 5TJ5E 1ZHXA 2EILC 1CPQA 4ANJA 2BE5F 1OXKA 2IBFA 2Y3HA 3EJNA 2ICWG 2DYRC 5L3VA 2R9RB 3GM1A 1TWAA 2MHRA 2ZXWC 1I5NA 2Y3GA 3H65A 3HKKA 1RKCA 1HMOA 1MMDA 1CGME 1OCOC 5KYUA 3T9OA 4G7ZF 2A1DD 3DE9A 2XLDA 1C02A 3NKEA 4IB4A 4JZAA 1O3UA 3AOUA 1K05A 2E87A 2KJGA 4XEKA 4XPXA 4DVYP 3UGOA 4JTDB 1J8MF 2DB4A 4AL1A 1OW8A 1ORSC 5F5FA 5E3AA 1Z63A 1V74B 4B6IA 4JTCB 1NSGB 4WABA 1PD1A 2D4UA 2KW3C 5JRAA 5D92A 3L1MA 2HV7A 3CZ6A 1YARO 4QDLA 5BQIA 3VAYA 2J9UA 4YK5A 256BA 1JPNA 3EHMA 4OIPF 1O5HA 2XLEA 2HZ8A 3IQ6A 3OEOA 4NQFA 4PFOA 2OCCC 4MVRA 1NU7D 4YL1A 3W2VA 4BJTA 4KI2A 4FWVA 1T6QA 4KBLA 2HUJA 3ATPA 1VTMP 4NTAA 1HE1A 2GFHA 5T3WA 4BJ6A 4AE4B 5A6BD 2XLHA 3DI5A 3S28A 2HS5A 2P6VA 3IQCA 4J30B 2AVKA 1M2VA 3O6XA 4NTFA 3AG2C 4EBKA 2YQYA 4JEBA 4P9FA 1KNYA 2G3VA 5DLJA 2W9YA 4RDAA 2IXMA 5DS4A 5BUOA 2Y69C 5KYNA 3E9VA 2GA0A 4IGGA 4U5HA 4GYTA 5T3TA 2XLMA 4PR9A 5L3QA 1AVOB 4DVZA 4MTOA 2PP4A 3DE8A 4CS9C 3Q7GA 4P6IC 2IOQA 3U9JA 3NYLA 1RXQA 2Q4FA 2R7WA 3MYIA 1FFHA 2EPMX 2J45A 2NG1A 4IRUA 2HJ3A 3QVYA 1FAPB 4C7OB 1MMNA 4DJ9A 3AG4C 1FFTC 2L7AA 3SNHA 4GEHA 3RW0A 3ZSUA 4EHPA 4EKWA 4XLPF 4N06A 5JUAA 1YYJA 3B9QA 1G5ZA 3EH2A 4IARA 2LCHA 2X51A 4P9TA 4J7YA 3RH3A 4E0IA 1VLSA 1M2OA 3TQOA 1T6IA 2B0HA 2LFDA 3DKAA 5F28E 1A7VA 1VMAA 3NYMA 1NU9C 4JURI 3ZDLA 3B71A 2V3CC 2VC9A 3K1HA 2UUHA 4IAQA 4JKVA 4DOZA 4OD5A 4CDVA 3Q6NA 4C3DA 1RJ9B 4JCZA 3UNGC 4ZLDA 1T9KA 4IAOA 2YKZA 3N0TA 3QTHA 4I1MA 2R03A 4AL0A 3KKBA 3ZC4A 4E17A 3B0VC 1VK5A 3F46A 4MVMA 3ASOC 4CDYA 1F1MA 1BZ4A 3DMDA 5B1BC 2QY9A 5A6AA 4J32B 4NY3A 4HEAJ 2C04A 2GDCA 2YL0A 3BRJA 4AX2A 3NDBB 3M15A 4BEMJ 1I4YA 2H8AA 4JE9A 4F4BA 1MNDA 1V54C 3EGDB 4E7SA 2NUPB 1FTSA 1BR1A 2P0NA 3GEHA 4WJ0A 3V5ZA 4LERA 1OCCC 4JW1A 1E2XA 3M1CB 1ZW3A 2EIJC 2W4BA 5EHHA 3FDQA 3F47A 1YJGA 2P61A 3W8IA 1RJ9A 4ER9A 1FNTc 3AGUA 4OIRF 3LS1A 1WATA 3C63A 2W4MA 3T6JA 4O6NA 2A69F 2ZPAA 2XRHA 3B0PA 2R7TA 4PJMA 1WASA 1BR4A 1XWJA 3N2ZB 4MTFA 3TJ6A 3QZCA 3GORA 1ZW2A 2RSEB 1LS4A 3LNMB 3KL4A 3LNRA 5JSLA 3GEEA 3C7JA 2I15A 3AQBA 1BDJB 4QI0A 4U5CE 5E3CA 4AE4A 2M4EA 4YT2A 2LQGA 1RKEA 4CJGA 1HE9A 1Z3IX 2AP3A 2NPUA 2R7SA 3FAPB 2Y3DA 1GGQA 1VYKA 3SXYA 1L3PA 5JVEA 5DS5A 3J06A 3KPHA 3LJBA 5L0JA 2W45A 2Z15A 2KGOA 4WGYA 2DGJA 2EIKC 3U3BA 2XLVA 4JCHA 2ETSA 4CSAA 3QW1A 1TWCA 3K1IA 1LM3B 2YZSA 2XXAB 1D0ZA 1R4TA 1PCXA 3DJNB 1NBBA 4BJ5A 5EGYA 3K7DA 1E86A 2LSEA 3O55A 3JTLO 1QVXA 2F22A 2LIGA 4CDAA 3T6BA 3ABKC 3TOMA 1QKRA 2LK4A 4PFPA 2R25A 2KNHA 2A6EF 3FVYA 4G78A 1C17M 2FAPB 3DAFA 3V5XA 2R7UA 1C03A 3SXKA 3RFYA 4JRZA 4N6CA 1CPRA 3EFOA 4L6RA 5KYWA 2H7VC 1BR2A 3LLKA 2QLAA 4YT8A 3G4XA 2HSQA 4X0RA 4C3EA 2B0JA 2P1AA 2L6GA 4O6YA 3EGDA 3S84A 3RQFA 3ZG1A 3VF0A 2CCYA 2WVNA 3QVZA 1U0BB 2OG2A 2HJMA 2NUTB 5KYYB 2CDQA 1CGNA 1YDIA 2V26A 3DJUB 3G50A 2HV6A 3NG1A 2YWAA 2M64A 2YLGA 4Z9HA 3X2QC 4PJLA 3GODA 3KMIA 2OU6A 4Z9IA 1ORYA 2EPKX 3AJMA 2CGEA 1FMVA 3JCUQ 1SYQA 5L0GA 3C8GD 3S9OA 4LDQA 4EIYA 1U6HA 3TK0A 3K66A 2YLIA 3JRTA 4MQ9F 2YRFA 4EBBA 2J46A 2L6HA 3JRMO 3V7OA 3SYNA 1H9TA 2Y39A 3MLGA 3FOOA 2GAQA 2XM4A 4BG0A 2YHSA 4E7ZA 1SR2A 2OJQA 3BEHA 4U9DA 2L9JA 2R02A 5HV9A 1FMWA 4KC9A 2IXOA 3M4CA 4YT4A 4XLNF 2LP4A 1V4AA 3UR3C 3KYIA 5A6JA 4DRHB 1TQGA 3Q7LA 4EWCA 1LE4A 3GM2A 1KU2A 4LDRA 2PF4E 4XWJA 2IYLD 3K6BA 1A41A 3ASNC 4XEVA 1OR2A 4YL0A 3U2LA 2HKVA 4CIHA 3HNIA 4DBQA 1ZHYA 1YVIA 2DI3A 1L7CA 1M57C 2VB6A 3LEVA 4K0DA 3L8JA 1A7DA 1T6UA 4EBJA 1VB5A 3E70C 2XSEA 2A0UA 3SEOA 1V55C 1G4WR 4LLCA 2OQMA 3PDMP 1D1CA 2G62A 1JPJA 1OW7A 3AG3C 2PX0A 1NFOA 3EGXB 4XEFA 3V5YA 1ZU4A 1MMAA 3GM3A 1E83A 3TJ5A 2YLDA 3HNKA 2IXPA 3DAGA 1MQVA 3WHNA 2Q9BA 3R7CA 2J7PD 4CSAC 4XQ1A 2R7XA 3I5QA 3M4BA 5CI9A 4U5FE 3AQCA 2WZGA 3FHDA 3B29A 1GQAA 3ZTMA 5DQZA 3O39A 4CS8A 2EPOA 4XPYA 2AU5A 3CQZA 1YLMA 2J9WA 4BEJA 1G8XA 1S05A 1YZAA 1OR3A 3EH1A 1Q0MA 4W8KA 1VOMA 1SZIA 2XL4A 1WGWA 2YL3A 4J7TA 4KNVA 1D0XA 4AK9A 5A6KA 4I3MA 4MW3A 3U8PA 3HNJA 1WN0A 1LIHA 3PCVA 1YAUO 2Q3TA 5FCLA 4DRIB 3WODF 3ZQVA 1MMGA 1TWGA 2OKUA 2Q9CA 1Q0GA 5B3IA 1JR8A 4IWBA 2XS1A 4FAPB 3R2PA 3ZQYA 3PHF2 4MVOA 3RF3A 1D1AA 3EGXA 5COGA 4WGZA 5GPGB 3DM5A 3U2MA 3FOPA 2XL6A 5A69A 1DOVA 3UMKA 5L0CA 4BJ6C 1KTMA 3RQEA 4ZLCA 1J8YF 1RCPA 3GWLA 4MVQA 5JLIA 3MX3A 3S90A 3DWWA 3RYLA 3ZVRA 3W2WA 4DBRA 3EHNA 3QMKA 2NUTA 5KYUB 2P7VA 5JT4A 1FR0A 4PJNA 4H4KC 3HNLA 1HW1A 3JSZA 4I1OB 1M6TA 4NC3A 5L0FA 1Z6AA 2HMQA 2QE9A 3GANA 3T4RA 2EPNA 1XZPA 1Q0KA 1Y4CA 2ASRA 1A7EA 1QLEC 3JZ0A 1E85A 1AUEA 2J0WA 2J7PA 3I4UA 5D91A 1K40A 1N1CA 3NKDA 1LPEA 1VLTA 3EG9A 3CSKA 4XPWA 5EK0A 3S29A 2KQ9A 1R5ID 4BJ1A 2PNOA 1DOWA 4A2NB 3VM6A 2VCCA 3C8ZA 5F5HA 2Y3BA 1B68A 3POVA 1VYIA 2DYSC 2A68F 3GEIA 2FGYA 1Z5ZA 5KYXA 3TD7A 4BPMA 5DQTA 3HTKC 2OJED 4C7OA 3ZIBA 2YL7A 2JD3A 3LAYA 2YVKA 2R7QA 1OKKD 3X1OA 3L8IA 2QUPA 1D0YA 3IPMO 4EUKB 3HJCA 3IEEA 4OIQF 4I44A 5BQGA 3H2VA 1HW2A 4RD9A 3RQGA 3NMKA 4H54A 4DXWA 2H7OA 2XXAA 2YEVA 2CNWD 4G7HF 1BBHA 2KK1A 1OQCA 1E84A 3JSEO 2HFIA 1ZHWA 5CI8A 5JP7A 3B0UX 2J9VA 1NG1A 2UUIA 3DD7A 1I4ZA 3K33A 2BL2A 4MNDA 3AGTA 4YT5A 3W4YA 4JJGA 1WTYA 4HFKB 1HY5A 2CNWA 3DXJF 1XZQA 2EPLX 3M79A 3SP1A 3JYHA 4G0HA 4O6MA 4N6HA 3I5PA 1ZZPA 3A9CA 3SZRA 4CJOA 4YJWA 2BC5A 3JT1A 1M2VB 3IQTA 5AGFA 1T01A 4CS7A 2H7BA 2EINC 3NMJA 3ZWIA 1NLXA 4JC7A 2KC3A 5DS6A 3NRHA 4MVUA 3RKOF 4E0HA 2WVOA 5L0IA 2A6HF 4HFFB 4PK4A 2VH3A 1TR2A 3KH2A 4JIOA 4BJ5C 3U0CA 4Q5SF 3K1IC 3ITFA 1GS9A 4KNWA 4A4AA 5B3SC 2LD6A 3CAXA 4PJJA 1QPUA 3UMIA 3LLIA 1OCZC 2NUPA 2IXNA 1MNEA 1SF8A 2Q00A 1EI7A 3C18A 3PMRA 4MVZA 4JJFA 2O9XA 2PFDA 4NCQA 1EQ1A 3OA1A 3MFNA 1Z7Qc 3IHUA 4MTGA 1Q0FA 3TOLA 2QNLA 2VCAA 1LVKA 3NYJA 1RKEB 3EQLF 3T6GB 4ONSA 1SMYF 4C3BA 4FX5A 4U5EE 4Q4ZF 2J9BA 1H7IA 1LI5A 5COFA 5KYYA 4RBNA 1JMWA 4CS9A 4U5DE 5AC5A 4N4WA 2JPUA 3DM9B 2XL8A 3FAJA 2WZFA 1QSPA 2A0BA 2VASA 2WVQA 4K1OA 4LLEA 4NTBA 1AEPA 1JOGA 2MYSA 3SXMA 4CS8C 1LI7A 2WL8A 1LE2A 1ZHTA 2R7OA 3N24A 2X0CA 3EZHA 1QZXA 3EG9B 4D4XA 3O10A 2NSFA 3KYJA 3UMHA 5HSWA 2HSBA 3ABMC 3EFOB 4OIOF 2L81A 5T1DB 5E33A 4YL3A 3FMSA 4DRJB 2LFFA 2ZXPA 1K04A 4UDVA 2FFHA 3H2UA 3US6A 2AWYA 2C03A 2ZD9A 5L0HA 4LACB 5L0DA 5JS5A 1Y6DA 2KSFA 2CW0F 4LDKA 3JYYA 2QTVA 1OXBA 2XM0A 4E18A 4W8PA 1ZVZA 3QW0A 3MBGA 4HE8D 1T5OA 5DVWA 1ORJA 3DZAA 3NMIA 3S0XA 4QI2A 1HMDA 4GQHA 1ZHZA 3S27A 4MW8A 1LS1A 1JRAA 3A11A 4JEAA 3L0IA 1UG7A 3MYFA 2Q9AA 2R7VA 2OEVA 3LEOA 2XLOA 3C62A 2EIMC 1YYXA 2WB7A 3WG7C 4Q7CA 4ULWA 3ZTZA 4CX9A 1O87A 4M63A 4R32A 3EPVA 2ZXRA 3L34A 4YWQA 4JTAB 5CIVA 4IJJA 3AG1C 5FZTA 1ZYRF 2ZXOA 2Q7RA 1PD0A 5KYWB 2AWCA 2J8WA 4U9EA 2G3KA 5COMA 3ABLC 4Z9JA 3U8VA 3WAQA 2XLWA 3LUTB 2KYHA 4U5BE 4XTKA 2GWWA 3C8GA 3G4ZA 3LS0A 3CEXA 4MS2A 1TFKB 3U5SA 4CBEA 3U3FA 5IY5C 1H6GA 1W2WA 1D1BA 2RD9A 5AC4A
chains in the Genus database with same CATH topology
2YLIA 1CGOA 3VRCA 3FOOA 1A7VA 2XM4A 3NMKA 4U9DA 3IQ5A 4IAQA 4JKVA 4CDVA 1BBHA 1E84A 3M4CA 5JP7A 2YKZA 1JAFA 1APCA 3M79A 4CDYA 3HNIA 2YL1A 4N6HA 4CJOA 4ULVA 2BC5A 4CIPA 5AGFA 3NMJA 2YL0A 3ZWIA 4D4NA 3M15A 1YZCA 4JE9A 1QPUA 1E83A 2YLDA 3HNKA 4ER9A 1MQVA 1QQ3A 3C63A 1CPQA 3M4BA 3TOLA 1GQAA 3ZTMA 2J9BA 3DE9A 2XLDA 4IB4A 5JSLA 1YZAA 1S05A 4N4WA 2XL8A 2YL3A 4CJGA 3U8PA 3HNJA 5JRAA 4D4XA 5JVEA 3L1MA 3ZQVA 256BA 4WGYA 5B3IA 2XLVA 2XLEA 3IQ6A 3QW1A 3ZQYA 1LM3B 4WGZA 1NBBA 5JS5A 1E86A 3FOPA 2XL6A 2XM0A 5JLIA 1RCPA 4CDAA 2XLHA 3QW0A 3TOMA 3NMIA 4JEBA 5JT4A 3HNLA 4JEAA 1M6TA 4NC3A 1CPRA 4L6RA 2XLOA 3C62A 2QLAA 1YYXA 2XLMA 1E85A 3ZTZA 4CX9A 3DE8A 2CCYA 3QVZA 4U9EA 1CGNA 2J8WA 3QVYA 2XLWA 2YLGA 1EKYA 5JUAA 1YYJA 4IARA 2YL7A 4EIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLI A;  1CGO A;  3VRC A;  3FOO A;  1A7V A;  2XM4 A;  3NMK A;  4U9D A;  3IQ5 A;  4IAQ A;  4JKV A;  4CDV A;  1BBH A;  1E84 A;  3M4C A;  5JP7 A;  2YKZ A;  1JAF A;  1APC A;  3M79 A;  4CDY A;  3HNI A;  2YL1 A;  4N6H A;  4CJO A;  4ULV A;  2BC5 A;  4CIP A;  5AGF A;  3NMJ A;  2YL0 A;  3ZWI A;  4D4N A;  3M15 A;  1YZC A;  4JE9 A;  1QPU A;  1E83 A;  2YLD A;  3HNK A;  4ER9 A;  1MQV A;  1QQ3 A;  3C63 A;  1CPQ A;  3M4B A;  3TOL A;  1GQA A;  3ZTM A;  2J9B A;  3DE9 A;  2XLD A;  4IB4 A;  5JSL A;  1YZA A;  1S05 A;  4N4W A;  2XL8 A;  2YL3 A;  4CJG A;  3U8P A;  3HNJ A;  5JRA A;  4D4X A;  5JVE A;  3L1M A;  3ZQV A;  256B A;  4WGY A;  5B3I A;  2XLV A;  2XLE A;  3IQ6 A;  3QW1 A;  3ZQY A;  1LM3 B;  4WGZ A;  1NBB A;  5JS5 A;  1E86 A;  3FOP A;  2XL6 A;  2XM0 A;  5JLI A;  1RCP A;  4CDA A;  2XLH A;  3QW0 A;  3TOM A;  3NMI A;  4JEB A;  5JT4 A;  3HNL A;  4JEA A;  1M6T A;  4NC3 A;  1CPR A;  4L6R A;  2XLO A;  3C62 A;  2QLA A;  1YYX A;  2XLM A;  1E85 A;  3ZTZ A;  4CX9 A;  3DE8 A;  2CCY A;  3QVZ A;  4U9E A;  1CGN A;  2J8W A;  3QVY A;  2XLW A;  2YLG A;  1EKY A;  5JUA A;  1YYJ A;  4IAR A;  2YL7 A;  4EIY A; 
#chains in the Genus database with same CATH topology
 2R05 A;  1WWP A;  3C8G B;  4YN0 B;  2NSG A;  2CYD A;  1NFN A;  1OW6 A;  3FXH A;  1CGO A;  1OKK A;  4MVS A;  1G4U S;  3ECS A;  3RVZ A;  1U89 A;  3VRC A;  2L6F A;  4OD4 A;  1S7Z A;  3EZI A;  1TWH A;  3W8H A;  3IQ5 A;  3RVY A;  3U9M A;  1TKN A;  5K0I A;  3HLZ A;  3RIP A;  2JX0 A;  2J0X A;  4K7B A;  3SXZ A;  5BQH A;  4U5G A;  1JAF A;  1OCR C;  1PV3 A;  3GWN A;  5E2Q A;  1YA9 A;  2PBE A;  1IW7 F;  2R7R A;  1M56 C;  1APC A;  1ST6 A;  4FES A;  4G7O F;  2PX3 A;  2D5R B;  1GM5 A;  2YL1 A;  1A0B A;  4O7G A;  3LES A;  4ULV A;  4JVS A;  3VYW A;  5A6B A;  3UGP A;  1H9G A;  3Q6M A;  4CIP A;  2MWQ A;  1LKX A;  2OEX A;  1TFO B;  5KYX B;  1NZE A;  1YA7 O;  4O79 A;  4D4N A;  2WZL A;  1YZC A;  3OWT A;  4PAC A;  1UFB A;  1RMV A;  2IM8 A;  2OOC A;  4OIN F;  1WOL A;  1EA8 A;  1Z23 A;  1IZM A;  1Q0D A;  2TMV P;  5B1A C;  1ZU5 A;  1EKY A;  2HMZ A;  3TUL A;  2I8B A;  2XS8 A;  2VCB A;  1QQ3 A;  5TJ5 E;  1ZHX A;  2EIL C;  1CPQ A;  4ANJ A;  2BE5 F;  1OXK A;  2IBF A;  2Y3H A;  3EJN A;  2ICW G;  2DYR C;  5L3V A;  2R9R B;  3GM1 A;  1TWA A;  2MHR A;  2ZXW C;  1I5N A;  2Y3G A;  3H65 A;  3HKK A;  1RKC A;  1HMO A;  1MMD A;  1CGM E;  1OCO C;  5KYU A;  3T9O A;  4G7Z F;  2A1D D;  3DE9 A;  2XLD A;  1C02 A;  3NKE A;  4IB4 A;  4JZA A;  1O3U A;  3AOU A;  1K05 A;  2E87 A;  2KJG A;  4XEK A;  4XPX A;  4DVY P;  3UGO A;  4JTD B;  1J8M F;  2DB4 A;  4AL1 A;  1OW8 A;  1ORS C;  5F5F A;  5E3A A;  1Z63 A;  1V74 B;  4B6I A;  4JTC B;  1NSG B;  4WAB A;  1PD1 A;  2D4U A;  2KW3 C;  5JRA A;  5D92 A;  3L1M A;  2HV7 A;  3CZ6 A;  1YAR O;  4QDL A;  5BQI A;  3VAY A;  2J9U A;  4YK5 A;  256B A;  1JPN A;  3EHM A;  4OIP F;  1O5H A;  2XLE A;  2HZ8 A;  3IQ6 A;  3OEO A;  4NQF A;  4PFO A;  2OCC C;  4MVR A;  1NU7 D;  4YL1 A;  3W2V A;  4BJT A;  4KI2 A;  4FWV A;  1T6Q A;  4KBL A;  2HUJ A;  3ATP A;  1VTM P;  4NTA A;  1HE1 A;  2GFH A;  5T3W A;  4BJ6 A;  4AE4 B;  5A6B D;  2XLH A;  3DI5 A;  3S28 A;  2HS5 A;  2P6V A;  3IQC A;  4J30 B;  2AVK A;  1M2V A;  3O6X A;  4NTF A;  3AG2 C;  4EBK A;  2YQY A;  4JEB A;  4P9F A;  1KNY A;  2G3V A;  5DLJ A;  2W9Y A;  4RDA A;  2IXM A;  5DS4 A;  5BUO A;  2Y69 C;  5KYN A;  3E9V A;  2GA0 A;  4IGG A;  4U5H A;  4GYT A;  5T3T A;  2XLM A;  4PR9 A;  5L3Q A;  1AVO B;  4DVZ A;  4MTO A;  2PP4 A;  3DE8 A;  4CS9 C;  3Q7G A;  4P6I C;  2IOQ A;  3U9J A;  3NYL A;  1RXQ A;  2Q4F A;  2R7W A;  3MYI A;  1FFH A;  2EPM X;  2J45 A;  2NG1 A;  4IRU A;  2HJ3 A;  3QVY A;  1FAP B;  4C7O B;  1MMN A;  4DJ9 A;  3AG4 C;  1FFT C;  2L7A A;  3SNH A;  4GEH A;  3RW0 A;  3ZSU A;  4EHP A;  4EKW A;  4XLP F;  4N06 A;  5JUA A;  1YYJ A;  3B9Q A;  1G5Z A;  3EH2 A;  4IAR A;  2LCH A;  2X51 A;  4P9T A;  4J7Y A;  3RH3 A;  4E0I A;  1VLS A;  1M2O A;  3TQO A;  1T6I A;  2B0H A;  2LFD A;  3DKA A;  5F28 E;  1A7V A;  1VMA A;  3NYM A;  1NU9 C;  4JUR I;  3ZDL A;  3B71 A;  2V3C C;  2VC9 A;  3K1H A;  2UUH A;  4IAQ A;  4JKV A;  4DOZ A;  4OD5 A;  4CDV A;  3Q6N A;  4C3D A;  1RJ9 B;  4JCZ A;  3UNG C;  4ZLD A;  1T9K A;  4IAO A;  2YKZ A;  3N0T A;  3QTH A;  4I1M A;  2R03 A;  4AL0 A;  3KKB A;  3ZC4 A;  4E17 A;  3B0V C;  1VK5 A;  3F46 A;  4MVM A;  3ASO C;  4CDY A;  1F1M A;  1BZ4 A;  3DMD A;  5B1B C;  2QY9 A;  5A6A A;  4J32 B;  4NY3 A;  4HEA J;  2C04 A;  2GDC A;  2YL0 A;  3BRJ A;  4AX2 A;  3NDB B;  3M15 A;  4BEM J;  1I4Y A;  2H8A A;  4JE9 A;  4F4B A;  1MND A;  1V54 C;  3EGD B;  4E7S A;  2NUP B;  1FTS A;  1BR1 A;  2P0N A;  3GEH A;  4WJ0 A;  3V5Z A;  4LER A;  1OCC C;  4JW1 A;  1E2X A;  3M1C B;  1ZW3 A;  2EIJ C;  2W4B A;  5EHH A;  3FDQ A;  3F47 A;  1YJG A;  2P61 A;  3W8I A;  1RJ9 A;  4ER9 A;  1FNT c;  3AGU A;  4OIR F;  3LS1 A;  1WAT A;  3C63 A;  2W4M A;  3T6J A;  4O6N A;  2A69 F;  2ZPA A;  2XRH A;  3B0P A;  2R7T A;  4PJM A;  1WAS A;  1BR4 A;  1XWJ A;  3N2Z B;  4MTF A;  3TJ6 A;  3QZC A;  3GOR A;  1ZW2 A;  2RSE B;  1LS4 A;  3LNM B;  3KL4 A;  3LNR A;  5JSL A;  3GEE A;  3C7J A;  2I15 A;  3AQB A;  1BDJ B;  4QI0 A;  4U5C E;  5E3C A;  4AE4 A;  2M4E A;  4YT2 A;  2LQG A;  1RKE A;  4CJG A;  1HE9 A;  1Z3I X;  2AP3 A;  2NPU A;  2R7S A;  3FAP B;  2Y3D A;  1GGQ A;  1VYK A;  3SXY A;  1L3P A;  5JVE A;  5DS5 A;  3J06 A;  3KPH A;  3LJB A;  5L0J A;  2W45 A;  2Z15 A;  2KGO A;  4WGY A;  2DGJ A;  2EIK C;  3U3B A;  2XLV A;  4JCH A;  2ETS A;  4CSA A;  3QW1 A;  1TWC A;  3K1I A;  1LM3 B;  2YZS A;  2XXA B;  1D0Z A;  1R4T A;  1PCX A;  3DJN B;  1NBB A;  4BJ5 A;  5EGY A;  3K7D A;  1E86 A;  2LSE A;  3O55 A;  3JTL O;  1QVX A;  2F22 A;  2LIG A;  4CDA A;  3T6B A;  3ABK C;  3TOM A;  1QKR A;  2LK4 A;  4PFP A;  2R25 A;  2KNH A;  2A6E F;  3FVY A;  4G78 A;  1C17 M;  2FAP B;  3DAF A;  3V5X A;  2R7U A;  1C03 A;  3SXK A;  3RFY A;  4JRZ A;  4N6C A;  1CPR A;  3EFO A;  4L6R A;  5KYW A;  2H7V C;  1BR2 A;  3LLK A;  2QLA A;  4YT8 A;  3G4X A;  2HSQ A;  4X0R A;  4C3E A;  2B0J A;  2P1A A;  2L6G A;  4O6Y A;  3EGD A;  3S84 A;  3RQF A;  3ZG1 A;  3VF0 A;  2CCY A;  2WVN A;  3QVZ A;  1U0B B;  2OG2 A;  2HJM A;  2NUT B;  5KYY B;  2CDQ A;  1CGN A;  1YDI A;  2V26 A;  3DJU B;  3G50 A;  2HV6 A;  3NG1 A;  2YWA A;  2M64 A;  2YLG A;  4Z9H A;  3X2Q C;  4PJL A;  3GOD A;  3KMI A;  2OU6 A;  4Z9I A;  1ORY A;  2EPK X;  3AJM A;  2CGE A;  1FMV A;  3JCU Q;  1SYQ A;  5L0G A;  3C8G D;  3S9O A;  4LDQ A;  4EIY A;  1U6H A;  3TK0 A;  3K66 A;  2YLI A;  3JRT A;  4MQ9 F;  2YRF A;  4EBB A;  2J46 A;  2L6H A;  3JRM O;  3V7O A;  3SYN A;  1H9T A;  2Y39 A;  3MLG A;  3FOO A;  2GAQ A;  2XM4 A;  4BG0 A;  2YHS A;  4E7Z A;  1SR2 A;  2OJQ A;  3BEH A;  4U9D A;  2L9J A;  2R02 A;  5HV9 A;  1FMW A;  4KC9 A;  2IXO A;  3M4C A;  4YT4 A;  4XLN F;  2LP4 A;  1V4A A;  3UR3 C;  3KYI A;  5A6J A;  4DRH B;  1TQG A;  3Q7L A;  4EWC A;  1LE4 A;  3GM2 A;  1KU2 A;  4LDR A;  2PF4 E;  4XWJ A;  2IYL D;  3K6B A;  1A41 A;  3ASN C;  4XEV A;  1OR2 A;  4YL0 A;  3U2L A;  2HKV A;  4CIH A;  3HNI A;  4DBQ A;  1ZHY A;  1YVI A;  2DI3 A;  1L7C A;  1M57 C;  2VB6 A;  3LEV A;  4K0D A;  3L8J A;  1A7D A;  1T6U A;  4EBJ A;  1VB5 A;  3E70 C;  2XSE A;  2A0U A;  3SEO A;  1V55 C;  1G4W R;  4LLC A;  2OQM A;  3PDM P;  1D1C A;  2G62 A;  1JPJ A;  1OW7 A;  3AG3 C;  2PX0 A;  1NFO A;  3EGX B;  4XEF A;  3V5Y A;  1ZU4 A;  1MMA A;  3GM3 A;  1E83 A;  3TJ5 A;  2YLD A;  3HNK A;  2IXP A;  3DAG A;  1MQV A;  3WHN A;  2Q9B A;  3R7C A;  2J7P D;  4CSA C;  4XQ1 A;  2R7X A;  3I5Q A;  3M4B A;  5CI9 A;  4U5F E;  3AQC A;  2WZG A;  3FHD A;  3B29 A;  1GQA A;  3ZTM A;  5DQZ A;  3O39 A;  4CS8 A;  2EPO A;  4XPY A;  2AU5 A;  3CQZ A;  1YLM A;  2J9W A;  4BEJ A;  1G8X A;  1S05 A;  1YZA A;  1OR3 A;  3EH1 A;  1Q0M A;  4W8K A;  1VOM A;  1SZI A;  2XL4 A;  1WGW A;  2YL3 A;  4J7T A;  4KNV A;  1D0X A;  4AK9 A;  5A6K A;  4I3M A;  4MW3 A;  3U8P A;  3HNJ A;  1WN0 A;  1LIH A;  3PCV A;  1YAU O;  2Q3T A;  5FCL A;  4DRI B;  3WOD F;  3ZQV A;  1MMG A;  1TWG A;  2OKU A;  2Q9C A;  1Q0G A;  5B3I A;  1JR8 A;  4IWB A;  2XS1 A;  4FAP B;  3R2P A;  3ZQY A;  3PHF 2;  4MVO A;  3RF3 A;  1D1A A;  3EGX A;  5COG A;  4WGZ A;  5GPG B;  3DM5 A;  3U2M A;  3FOP A;  2XL6 A;  5A69 A;  1DOV A;  3UMK A;  5L0C A;  4BJ6 C;  1KTM A;  3RQE A;  4ZLC A;  1J8Y F;  1RCP A;  3GWL A;  4MVQ A;  5JLI A;  3MX3 A;  3S90 A;  3DWW A;  3RYL A;  3ZVR A;  3W2W A;  4DBR A;  3EHN A;  3QMK A;  2NUT A;  5KYU B;  2P7V A;  5JT4 A;  1FR0 A;  4PJN A;  4H4K C;  3HNL A;  1HW1 A;  3JSZ A;  4I1O B;  1M6T A;  4NC3 A;  5L0F A;  1Z6A A;  2HMQ A;  2QE9 A;  3GAN A;  3T4R A;  2EPN A;  1XZP A;  1Q0K A;  1Y4C A;  2ASR A;  1A7E A;  1QLE C;  3JZ0 A;  1E85 A;  1AUE A;  2J0W A;  2J7P A;  3I4U A;  5D91 A;  1K40 A;  1N1C A;  3NKD A;  1LPE A;  1VLT A;  3EG9 A;  3CSK A;  4XPW A;  5EK0 A;  3S29 A;  2KQ9 A;  1R5I D;  4BJ1 A;  2PNO A;  1DOW A;  4A2N B;  3VM6 A;  2VCC A;  3C8Z A;  5F5H A;  2Y3B A;  1B68 A;  3POV A;  1VYI A;  2DYS C;  2A68 F;  3GEI A;  2FGY A;  1Z5Z A;  5KYX A;  3TD7 A;  4BPM A;  5DQT A;  3HTK C;  2OJE D;  4C7O A;  3ZIB A;  2YL7 A;  2JD3 A;  3LAY A;  2YVK A;  2R7Q A;  1OKK D;  3X1O A;  3L8I A;  2QUP A;  1D0Y A;  3IPM O;  4EUK B;  3HJC A;  3IEE A;  4OIQ F;  4I44 A;  5BQG A;  3H2V A;  1HW2 A;  4RD9 A;  3RQG A;  3NMK A;  4H54 A;  4DXW A;  2H7O A;  2XXA A;  2YEV A;  2CNW D;  4G7H F;  1BBH A;  2KK1 A;  1OQC A;  1E84 A;  3JSE O;  2HFI A;  1ZHW A;  5CI8 A;  5JP7 A;  3B0U X;  2J9V A;  1NG1 A;  2UUI A;  3DD7 A;  1I4Z A;  3K33 A;  2BL2 A;  4MND A;  3AGT A;  4YT5 A;  3W4Y A;  4JJG A;  1WTY A;  4HFK B;  1HY5 A;  2CNW A;  3DXJ F;  1XZQ A;  2EPL X;  3M79 A;  3SP1 A;  3JYH A;  4G0H A;  4O6M A;  4N6H A;  3I5P A;  1ZZP A;  3A9C A;  3SZR A;  4CJO A;  4YJW A;  2BC5 A;  3JT1 A;  1M2V B;  3IQT A;  5AGF A;  1T01 A;  4CS7 A;  2H7B A;  2EIN C;  3NMJ A;  3ZWI A;  1NLX A;  4JC7 A;  2KC3 A;  5DS6 A;  3NRH A;  4MVU A;  3RKO F;  4E0H A;  2WVO A;  5L0I A;  2A6H F;  4HFF B;  4PK4 A;  2VH3 A;  1TR2 A;  3KH2 A;  4JIO A;  4BJ5 C;  3U0C A;  4Q5S F;  3K1I C;  3ITF A;  1GS9 A;  4KNW A;  4A4A A;  5B3S C;  2LD6 A;  3CAX A;  4PJJ A;  1QPU A;  3UMI A;  3LLI A;  1OCZ C;  2NUP A;  2IXN A;  1MNE A;  1SF8 A;  2Q00 A;  1EI7 A;  3C18 A;  3PMR A;  4MVZ A;  4JJF A;  2O9X A;  2PFD A;  4NCQ A;  1EQ1 A;  3OA1 A;  3MFN A;  1Z7Q c;  3IHU A;  4MTG A;  1Q0F A;  3TOL A;  2QNL A;  2VCA A;  1LVK A;  3NYJ A;  1RKE B;  3EQL F;  3T6G B;  4ONS A;  1SMY F;  4C3B A;  4FX5 A;  4U5E E;  4Q4Z F;  2J9B A;  1H7I A;  1LI5 A;  5COF A;  5KYY A;  4RBN A;  1JMW A;  4CS9 A;  4U5D E;  5AC5 A;  4N4W A;  2JPU A;  3DM9 B;  2XL8 A;  3FAJ A;  2WZF A;  1QSP A;  2A0B A;  2VAS A;  2WVQ A;  4K1O A;  4LLE A;  4NTB A;  1AEP A;  1JOG A;  2MYS A;  3SXM A;  4CS8 C;  1LI7 A;  2WL8 A;  1LE2 A;  1ZHT A;  2R7O A;  3N24 A;  2X0C A;  3EZH A;  1QZX A;  3EG9 B;  4D4X A;  3O10 A;  2NSF A;  3KYJ A;  3UMH A;  5HSW A;  2HSB A;  3ABM C;  3EFO B;  4OIO F;  2L81 A;  5T1D B;  5E33 A;  4YL3 A;  3FMS A;  4DRJ B;  2LFF A;  2ZXP A;  1K04 A;  4UDV A;  2FFH A;  3H2U A;  3US6 A;  2AWY A;  2C03 A;  2ZD9 A;  5L0H A;  4LAC B;  5L0D A;  5JS5 A;  1Y6D A;  2KSF A;  2CW0 F;  4LDK A;  3JYY A;  2QTV A;  1OXB A;  2XM0 A;  4E18 A;  4W8P A;  1ZVZ A;  3QW0 A;  3MBG A;  4HE8 D;  1T5O A;  5DVW A;  1ORJ A;  3DZA A;  3NMI A;  3S0X A;  4QI2 A;  1HMD A;  4GQH A;  1ZHZ A;  3S27 A;  4MW8 A;  1LS1 A;  1JRA A;  3A11 A;  4JEA A;  3L0I A;  1UG7 A;  3MYF A;  2Q9A A;  2R7V A;  2OEV A;  3LEO A;  2XLO A;  3C62 A;  2EIM C;  1YYX A;  2WB7 A;  3WG7 C;  4Q7C A;  4ULW A;  3ZTZ A;  4CX9 A;  1O87 A;  4M63 A;  4R32 A;  3EPV A;  2ZXR A;  3L34 A;  4YWQ A;  4JTA B;  5CIV A;  4IJJ A;  3AG1 C;  5FZT A;  1ZYR F;  2ZXO A;  2Q7R A;  1PD0 A;  5KYW B;  2AWC A;  2J8W A;  4U9E A;  2G3K A;  5COM A;  3ABL C;  4Z9J A;  3U8V A;  3WAQ A;  2XLW A;  3LUT B;  2KYH A;  4U5B E;  4XTK A;  2GWW A;  3C8G A;  3G4Z A;  3LS0 A;  3CEX A;  4MS2 A;  1TFK B;  3U5S A;  4CBE A;  3U3F A;  5IY5 C;  1H6G A;  1W2W A;  1D1B A;  2RD9 A;  5AC4 A; 
#chains in the Genus database with same CATH homology
 2YLI A;  1CGO A;  3VRC A;  3FOO A;  1A7V A;  2XM4 A;  3NMK A;  4U9D A;  3IQ5 A;  4IAQ A;  4JKV A;  4CDV A;  1BBH A;  1E84 A;  3M4C A;  5JP7 A;  2YKZ A;  1JAF A;  1APC A;  3M79 A;  4CDY A;  3HNI A;  2YL1 A;  4N6H A;  4CJO A;  4ULV A;  2BC5 A;  4CIP A;  5AGF A;  3NMJ A;  2YL0 A;  3ZWI A;  4D4N A;  3M15 A;  1YZC A;  4JE9 A;  1QPU A;  1E83 A;  2YLD A;  3HNK A;  4ER9 A;  1MQV A;  1QQ3 A;  3C63 A;  1CPQ A;  3M4B A;  3TOL A;  1GQA A;  3ZTM A;  2J9B A;  3DE9 A;  2XLD A;  4IB4 A;  5JSL A;  1YZA A;  1S05 A;  4N4W A;  2XL8 A;  2YL3 A;  4CJG A;  3U8P A;  3HNJ A;  5JRA A;  4D4X A;  5JVE A;  3L1M A;  3ZQV A;  256B A;  4WGY A;  5B3I A;  2XLV A;  2XLE A;  3IQ6 A;  3QW1 A;  3ZQY A;  1LM3 B;  4WGZ A;  1NBB A;  5JS5 A;  1E86 A;  3FOP A;  2XL6 A;  2XM0 A;  5JLI A;  1RCP A;  4CDA A;  2XLH A;  3QW0 A;  3TOM A;  3NMI A;  4JEB A;  5JT4 A;  3HNL A;  4JEA A;  1M6T A;  4NC3 A;  1CPR A;  4L6R A;  2XLO A;  3C62 A;  2QLA A;  1YYX A;  2XLM A;  1E85 A;  3ZTZ A;  4CX9 A;  3DE8 A;  2CCY A;  3QVZ A;  4U9E A;  1CGN A;  2J8W A;  3QVY A;  2XLW A;  2YLG A;  1EKY A;  5JUA A;  1YYJ A;  4IAR A;  2YL7 A;  4EIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...