3NMKA

Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmkA00
5JT4A 2YL3A 4N4WA 1E85A 4IB4A 3QVYA 4JKVA 3HNIA 3TOLA 3U8PA 2J8WA 4CIPA 3IQ6A 2YKZA 3ZQVA 4CDAA 3NMIA 2XLWA 3QW0A 2XLVA 2XM0A 1E84A 4JEAA 4NC3A 1CGNA 3DE8A 5JLIA 4IARA 1YZAA 1BBHA 4IAQA 2XLMA 3FOOA 1JAFA 1M6TA 2XLOA 1YYJA 4U9DA 1LM3B 5JUAA 4D4NA 3HNJA 256BA 4WGZA 3FOPA 3NMKA 3L1MA 4CDVA 3HNLA 1S05A 1CPRA 1QPUA 2CCYA 3IQ5A 1NBBA 3DE9A 1E86A 3M4CA 2XL6A 2YL1A 5JRAA 2YLIA 1EKYA 3M79A 3M4BA 3QVZA 3C63A 2XM4A 4JE9A 4JEBA 4WGYA 1E83A 1YZCA 2YLDA 2YL0A 4L6RA 3QW1A 1GQAA 4ER9A 4EIYA 3VRCA 5JSLA 1APCA 1CGOA 1A7VA 3ZQYA 5JS5A 3HNKA 1YYXA 4D4XA 3C62A 4CDYA 4U9EA 5JP7A 4CJOA 4CJGA 3NMJA 2YLGA 5AGFA 3TOMA 1MQVA 5JVEA 1CPQA 2BC5A 2XL8A 2XLDA 2YL7A 4CX9A 2XLHA 3ZTZA 2J9BA 2QLAA 1QQ3A 3M15A 1RCPA 3ZWIA 4ULVA 5B3IA 4N6HA 2XLEA 3ZTMA
chains in the Genus database with same CATH superfamily
1VMAA 2AWCA 3O10A 3Q7LA 5JT4A 1JR8A 5KYWA 2VCBA 3Q7GA 1EI7A 4IB4A 4X0RA 5EGYA 1H7IA 3LLIA 2AP3A 3HNIA 2HUJA 1VYKA 2J8WA 3W2WA 1WWPA 2ASRA 2QNLA 2CYDA 3LNRA 1V54C 2J7PD 4GQHA 4JIOA 4C3EA 3EFOA 1S7ZA 2GDCA 1D0YA 1RMVA 4CS9A 2XLVA 2XM0A 1NU9C 1OW8A 3G50A 2EIKC 3H2UA 4H4KC 4JEAA 1FNTc 3FMSA 1YDIA 4XEVA 4IARA 1T01A 2G62A 1LIHA 1YZAA 1YA7O 5DQZA 1FMVA 1ZYRF 4IAQA 1Z63A 3O6XA 3LEVA 3QZCA 1SR2A 2A69F 1H9TA 2WZLA 4EWCA 2BL2A 4U5FE 3S0XA 1Q0MA 1T6IA 3X1OA 2J7PA 2OJQA 3TJ5A 4MW8A 2EPLX 5F5FA 2CDQA 4WGZA 1Q0KA 1TR2A 3FOPA 3W8HA 4JTAB 3RH3A 3NMKA 3EG9B 1OCCC 2YQYA 2QUPA 1OXBA 3L1MA 2EPKX 1ZHTA 2OKUA 1DOWA 2HKVA 1U6HA 1EQ1A 2PF4E 5IY5C 3PHF2 1S05A 2ZXOA 4Q5SF 1QPUA 1R4TA 1BZ4A 1WASA 1NBBA 2O9XA 2ZD9A 3IQ5A 3TQOA 3M4CA 3LS0A 3ZC4A 4YT4A 4JURI 3POVA 3E9VA 1TWHA 1EKYA 2A68F 5KYUA 3RVZA 3K1IC 5BQHA 2EILC 2HS5A 3DD7A 3EHMA 3ZDLA 5A6KA 3EH2A 3QVZA 3UMHA 3HTKC 4I3MA 1N1CA 1MNEA 3TJ6A 3EJNA 5A69A 3L8JA 4OD4A 1T6QA 1YA9A 4BJTA 2YL0A 4JZAA 3IQCA 3ABMC 5CI9A 1I4YA 1LPEA 2AWYA 3RQFA 2XSEA 4CSAC 3RQGA 4ER9A 3WAQA 4EIYA 4NY3A 1ZW3A 2KYHA 1LVKA 2EPOA 1KTMA 4C3BA 4HEAJ 2IXMA 3V5YA 3AQCA 3UMKA 2W9YA 3GM2A 4YJWA 2Q4FA 3EGDB 3RIPA 4A2NB 2BE5F 5DLJA 4QDLA 2IOQA 4XLNF 2HV6A 3C8ZA 4MS2A 2NUTA 1GGQA 4M63A 4UDVA 3DM5A 4I1MA 2Q9BA 5JP7A 3UNGC 5KYWB 1HW1A 2GAQA 5BUOA 2PX0A 1WGWA 3GORA 4O6YA 4HFFB 3NKEA 4NTBA 2YLGA 3GEHA 3U2LA 4YT8A 3U0CA 3EG9A 2KNHA 2NSFA 5FZTA 3LESA 2C03A 1D1CA 3H65A 3K1HA 1HE9A 3KMIA 3L0IA 4FESA 4JW1A 1ORSC 4K0DA 3PMRA 4PFPA 3W2VA 4XLPF 1SMYF 1IZMA 2PFDA 3NYLA 4NTAA 3U9JA 2A6EF 3NYMA 4JTCB 4OD5A 3U9MA 3W4YA 2EPNA 4CX9A 4BG0A 4JJFA 1ZHZA 4MVMA 4ULVA 3S29A 4DVYP 4LACB 2X0CA 5B3IA 1T9KA 2Y3GA 4I1OB 4K1OA 1Y6DA 1BR1A 2DI3A 2KJGA 3QTHA 2NUPA 4U5DE 2D5RB 2VASA 1ZW2A 3C8GA 4N4WA 5L0CA 3EGDA 3NG1A 1FFTC 3LEOA 1NU7D 5B1AC 4E7ZA 3U8PA 5L0DA 2ZXRA 1J8YF 2B0HA 1TQGA 5HSWA 2HMQA 3RVYA 4BJ5A 5DS6A 2YKZA 3ASNC 3ZSUA 4IWBA 4DOZA 4E0IA 2PBEA 4CDAA 4OIRF 1QZXA 3QW0A 3OWTA 2AU5A 4U5EE 3B0UX 2J46A 2LSEA 1LKXA 3JRTA 1CGME 3S27A 2FFHA 2CW0F 2WZGA 5JLIA 2Y3BA 2XRHA 3AOUA 3C8GD 5L0FA 3HKKA 2R05A 4XQ1A 2L9JA 3G4ZA 3DI5A 4W8PA 3RKOF 5COGA 3VAYA 4ANJA 1UG7A 1JAFA 3JZ0A 1ZVZA 5L0IA 3EH1A 2XXAB 1NFNA 4U5GA 2IXNA 1LS4A 2A0BA 5DQTA 4EUKB 2P6VA 1TWCA 5JUAA 1OKKD 2VB6A 5B1BC 4D4NA 3HNJA 3F46A 2DB4A 2F22A 1O5HA 1G8XA 1A7EA 3ZG1A 5TJ5E 4EBBA 2QY9A 3NRHA 2HMZA 4RBNA 3JYYA 1D1AA 1BDJB 3JRMO 1ORJA 5AC5A 2OOCA 1H6GA 2P1AA 3AGTA 4MVQA 3X2QC 1A0BA 3JSEO 2J9VA 1L7CA 2XL4A 3ITFA 1E86A 2HJ3A 1YVIA 2ICWG 1NSGB 1UFBA 3DM9B 4XPWA 3DAFA 4DBQA 2HSQA 4MVZA 4G7HF 1OKKA 1VK5A 5EK0A 2NSGA 4B6IA 4JC7A 2Q9AA 4JE9A 3FXHA 2L7AA 2YLDA 2IXOA 3SXZA 1NLXA 3SXKA 1OCRC 4GYTA 4Q7CA 4YK5A 1FFHA 5E3CA 2LFFA 2R7VA 4MVUA 1AEPA 2LQGA 2A0UA 3QW1A 5D91A 3EZHA 4R32A 1GQAA 2R7TA 2I15A 3N24A 3VM6A 4N6CA 1JRAA 1M2OA 3CQZA 3VRCA 4AE4B 3WG7C 4H54A 2J0WA 5BQIA 3DXJF 2B0JA 4U5CE 1A7DA 1APCA 4LLEA 2WVNA 3M1CB 3N2ZB 4NTFA 1A7VA 4YT2A 5L0HA 2V3CC 1FTSA 1OW7A 2LP4A 4MW3A 2I8BA 4XEKA 1RJ9A 3GM1A 1PD1A 3W8IA 4MVSA 5JS5A 1XZPA 4D4XA 2KK1A 3C62A 3MX3A 4LLCA 1RKEB 1MNDA 2PX3A 4O6NA 4Z9JA 4J7YA 2HSBA 5DS5A 3FAPB 5COMA 4ZLCA 2R7SA 5AC4A 4FAPB 3ABKC 3ZVRA 3VF0A 3N0TA 3US6A 1XWJA 5T3TA 4BJ5C 4OIQF 1C03A 4KNWA 2CNWA 2J9UA 3DZAA 1U89A 3TOMA 4AK9A 2DYSC 2R7WA 2L6GA 2VCCA 4E0HA 3TULA 4CS9C 1CPQA 1KU2A 4G0HA 3JYHA 2ZPAA 4Z9IA 1OQCA 2BC5A 4BEMJ 2XL8A 4XTKA 2Q7RA 2D4UA 1K04A 2MWQA 4IAOA 1C17M 1KNYA 2XLHA 3RYLA 2P61A 1ZHYA 2YEVA 1M2VA 1RCPA 2YZSA 3AG3C 3M15A 3RF3A 3T6BA 4AL0A 4EBJA 3LUTB 2KC3A 4N6HA 2LK4A 1G5ZA 3IQTA 2YWAA 2IM8A 3CAXA 1OR3A 4ONSA 5F5HA 4YT5A 3GODA 4ULWA 4YL3A 3NKDA 5COFA 2YL3A 3RFYA 2ZXPA 3GEEA 1D0ZA 1E85A 4JJGA 4JKVA 3TOLA 2KQ9A 2HV7A 1Z6AA 3AQBA 3T9OA 4F4BA 1HY5A 4J32B 2H7BA 1J8MF 2LIGA 5L3VA 4DRJB 3ZQVA 3WODF 1K40A 1RXQA 2XLWA 5DS4A 2FGYA 2E87A 4QI0A 2KW3C 1E84A 4MTFA 3A9CA 1CGNA 2HZ8A 3MYIA 3S84A 5L3QA 1TKNA 4PJNA 3GANA 3T6GB 2LCHA 3G4XA 4G7ZF 1VB5A 1M56C 3FOOA 3AGUA 3B71A 1RJ9B 3IPMO 3AG2C 1VOMA 1Z5ZA 1D0XA 2Y3DA 1Y4CA 4XPYA 3ZIBA 5A6JA 3B0VC 3C7JA 1MMNA 1FR0A 2XLOA 4DVZA 3ATPA 3LNMB 1YYJA 4U9DA 1LM3B 3DWWA 1IW7F 1YJGA 3BRJA 4K7BA 2IYLD 5BQGA 256BA 2IBFA 2PNOA 2Y39A 3LS1A 2LFDA 1V55C 2WVQA 3K33A 2NUPB 4JCHA 3EFOB 1NG1A 3VYWA 3T6JA 1OCZC 3HNLA 1QVXA 1E2XA 2KGOA 1CPRA 2XS1A 3MYFA 4N06A 4DBRA 1R5ID 3DE9A 2WL8A 2HFIA 2OQMA 4IRUA 2XL6A 2G3VA 2GWWA 2YLIA 4LDKA 2W4BA 3SYNA 4PFOA 1ST6A 2Q3TA 1SF8A 2H7VC 2YVKA 3ABLC 3M4BA 3U3BA 1A41A 4DRIB 5HV9A 3C63A 5B3SC 2XM4A 1OR2A 2MHRA 4JEBA 1YZCA 4LERA 4Z9HA 4E7SA 5KYXB 3UMIA 1ZHWA 5E33A 2QTVA 1GS9A 4G78A 1L3PA 3K66A 3BEHA 1K05A 4O6MA 1VTMP 4OIOF 1NZEA 3QMKA 4L6RA 4PJMA 3SZRA 3R2PA 1HE1A 4OINF 1GM5A 1MMAA 1QLEC 1ZZPA 1YARO 5JSLA 2EINC 2NG1A 2X51A 3AG4C 3SEOA 1CGOA 1Q0FA 4JRZA 3AG1C 4BJ6A 1QKRA 4AX2A 4JCZA 4KBLA 4EKWA 2OU6A 4J7TA 3UGOA 1M2VB 1OW6A 1TFKB 4DJ9A 4YN0B 1FMWA 1U0BB 3HNKA 2WZFA 2QE9A 1H9GA 4CDYA 1ZU4A 1LE4A 2RD9A 4U9EA 4AL1A 4C7OA 2VC9A 3V7OA 4O7GA 4U5BE 1WOLA 1M57C 2R03A 1VYIA 2H7OA 3S90A 3PDMP 1TFOB 1JMWA 3NMJA 1QSPA 5CI8A 1YLMA 3U3FA 1I5NA 3EHNA 3FDQA 4YL0A 1Z23A 1HW2A 5JVEA 4WJ0A 1Z7Qc 1PCXA 2R25A 2YRFA 4XWJA 3TK0A 5FCLA 5EHHA 2LD6A 4MQ9F 2XLDA 2ZXWC 2CGEA 2YL7A 3IEEA 3WHNA 2J9BA 2EIJC 2A1DD 5KYYB 2EPMX 3FHDA 2Q9CA 3UGPA 2XXAA 3JCUQ 4P9TA 4YWQA 1LI7A 5E2QA 1DOVA 3Q6NA 4JVSA 3IHUA 5KYNA 2L6HA 5L0GA 2R7RA 1HMOA 3FAJA 1AUEA 1FAPB 1PD0A 2R7UA 3A11A 1ZHXA 4BJ1A 1I4ZA 3E70C 2EIMC 3QVYA 1V4AA 2OEXA 1C02A 1EA8A 1LI5A 3Q6MA 4W8KA 3C18A 4CIPA 4LDQA 4RDAA 4EBKA 2V26A 3IQ6A 4C7OB 3I5QA 1B68A 3DJUB 3TD7A 5T3WA 2WB7A 3DAGA 1TWAA 3U2MA 3U5SA 2OG2A 2PP4A 3EQLF 3NMIA 4P9FA 2W4MA 1JPNA 4BJ6C 1YAUO 4KI2A 2VCAA 4NC3A 2TMVP 2R7QA 3DE8A 4JTDB 4EHPA 1D1BA 4BEJA 3O55A 1BBHA 2XLMA 2H8AA 3MBGA 3U8VA 3SNHA 3ZTMA 5CIVA 3KKBA 1MMGA 4CS8A 1JPJA 3MLGA 1LS1A 4KC9A 3KYJA 4O79A 1M6TA 1HMDA 3I5PA 4BPMA 2NUTB 1JOGA 4IJJA 2OEVA 2OJED 4MVRA 2DYRC 1F1MA 2UUHA 4LDRA 5T1DB 1VLSA 3B9QA 1WATA 3L34A 2L81A 2JPUA 2P7VA 3DMDA 3F47A 3O39A 4KNVA 3V5XA 3I4UA 5A6BD 3NDBB 2HJMA 4CDVA 1VLTA 2Y3HA 3K6BA 3J06A 2XS8A 5F28E 2GA0A 3DKAA 1W2WA 3GM3A 1O3UA 2CCYA 1G4WR 1V74B 2GFHA 1O87A 3LJBA 3OA1A 2A6HF 2YL1A 2JD3A 2P0NA 3EZIA 5JRAA 2DGJA 3KH2A 3K7DA 3LAYA 3M79A 5KYYA 3L8IA 2M4EA 4CIHA 2R02A 3CEXA 1MMDA 2ETSA 2Z15A 1Q0GA 4WGYA 1E83A 4RD9A 2Y69C 3HJCA 3SXYA 1LE2A 4J30B 4FX5A 1ZU5A 5A6BA 2AVKA 3EGXA 3JTLO 1Q0DA 2WVOA 3SP1A 4XPXA 4HE8D 1BR2A 4PR9A 4FWVA 1WTYA 4PJJA 2M64A 4PJLA 2R7XA 3S9OA 3MFNA 4MVOA 4NQFA 2G3KA 3JSZA 1Z3IX 3H2VA 4OIPF 3LLKA 2J0XA 2C04A 4PACA 3B29A 3AJMA 3RW0A 4Q4ZF 1RKCA 5DVWA 4ZLDA 2MYSA 1AVOB 2UUIA 1SYQA 2RSEB 5GPGB 3DJNB 1T5OA 2OCCC 3ZQYA 4CS8C 3EPVA 3SXMA 4MTOA 5A6AA 3FVYA 4WABA 2KSFA 2W45A 3K1IA 3CZ6A 3R7CA 3GEIA 4A4AA 4NCQA 5E3AA 2Q00A 1YYXA 4CBEA 4HFKB 2J45A 1SZIA 1TWGA 2R7OA 3ECSA 3EGXB 4P6IC 4XEFA 3RQEA 4CS7A 3JT1A 3C8GB 4CJOA 3T4RA 3KL4A 4CSAA 5L0JA 3V5ZA 4CJGA 1WN0A 1OXKA 5K0IA 4DRHB 5AGFA 2IXPA 5KYXA 3KPHA 1MQVA 4AE4A 2NPUA 1ORYA 3CSKA 4IGGA 4E18A 1NFOA 1T6UA 3ASOC 4MTGA 1PV3A 2L6FA 5D92A 4PK4A 1OCOC 2VH3A 3ZTZA 1G4US 1XZQA 4DXWA 3HLZA 2QLAA 1QQ3A 4MNDA 3UR3C 3ZWIA 4YL1A 4G7OF 4QI2A 3GWLA 3GWNA 4U5HA 3S28A 2FAPB 3OEOA 5KYUB 2R9RB 2XLEA 2YHSA 3B0PA 3NYJA 4GEHA 4E17A 1RKEA 2J9WA 3KYIA 2CNWD 4I44A 3PCVA 1BR4A 4C3DA 2JX0A
chains in the Genus database with same CATH topology
5JT4A 2YL3A 4N4WA 1E85A 4IB4A 3QVYA 4JKVA 3HNIA 3TOLA 3U8PA 2J8WA 4CIPA 3IQ6A 2YKZA 3ZQVA 4CDAA 3NMIA 2XLWA 3QW0A 2XLVA 2XM0A 1E84A 4JEAA 4NC3A 1CGNA 3DE8A 5JLIA 4IARA 1YZAA 1BBHA 4IAQA 2XLMA 3FOOA 1JAFA 1M6TA 2XLOA 1YYJA 4U9DA 1LM3B 5JUAA 4D4NA 3HNJA 256BA 4WGZA 3FOPA 3NMKA 3L1MA 4CDVA 3HNLA 1S05A 1CPRA 1QPUA 2CCYA 3IQ5A 1NBBA 3DE9A 1E86A 3M4CA 2XL6A 2YL1A 5JRAA 2YLIA 1EKYA 3M79A 3M4BA 3QVZA 3C63A 2XM4A 4JE9A 4JEBA 4WGYA 1E83A 1YZCA 2YLDA 2YL0A 4L6RA 3QW1A 1GQAA 4ER9A 4EIYA 3VRCA 5JSLA 1APCA 1CGOA 1A7VA 3ZQYA 5JS5A 3HNKA 1YYXA 4D4XA 3C62A 4CDYA 4U9EA 5JP7A 4CJOA 4CJGA 3NMJA 2YLGA 5AGFA 3TOMA 1MQVA 5JVEA 1CPQA 2BC5A 2XL8A 2XLDA 2YL7A 4CX9A 2XLHA 3ZTZA 2J9BA 2QLAA 1QQ3A 3M15A 1RCPA 3ZWIA 4ULVA 5B3IA 4N6HA 2XLEA 3ZTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  2YL3 A;  4N4W A;  1E85 A;  4IB4 A;  3QVY A;  4JKV A;  3HNI A;  3TOL A;  3U8P A;  2J8W A;  4CIP A;  3IQ6 A;  2YKZ A;  3ZQV A;  4CDA A;  3NMI A;  2XLW A;  3QW0 A;  2XLV A;  2XM0 A;  1E84 A;  4JEA A;  4NC3 A;  1CGN A;  3DE8 A;  5JLI A;  4IAR A;  1YZA A;  1BBH A;  4IAQ A;  2XLM A;  3FOO A;  1JAF A;  1M6T A;  2XLO A;  1YYJ A;  4U9D A;  1LM3 B;  5JUA A;  4D4N A;  3HNJ A;  256B A;  4WGZ A;  3FOP A;  3NMK A;  3L1M A;  4CDV A;  3HNL A;  1S05 A;  1CPR A;  1QPU A;  2CCY A;  3IQ5 A;  1NBB A;  3DE9 A;  1E86 A;  3M4C A;  2XL6 A;  2YL1 A;  5JRA A;  2YLI A;  1EKY A;  3M79 A;  3M4B A;  3QVZ A;  3C63 A;  2XM4 A;  4JE9 A;  4JEB A;  4WGY A;  1E83 A;  1YZC A;  2YLD A;  2YL0 A;  4L6R A;  3QW1 A;  1GQA A;  4ER9 A;  4EIY A;  3VRC A;  5JSL A;  1APC A;  1CGO A;  1A7V A;  3ZQY A;  5JS5 A;  3HNK A;  1YYX A;  4D4X A;  3C62 A;  4CDY A;  4U9E A;  5JP7 A;  4CJO A;  4CJG A;  3NMJ A;  2YLG A;  5AGF A;  3TOM A;  1MQV A;  5JVE A;  1CPQ A;  2BC5 A;  2XL8 A;  2XLD A;  2YL7 A;  4CX9 A;  2XLH A;  3ZTZ A;  2J9B A;  2QLA A;  1QQ3 A;  3M15 A;  1RCP A;  3ZWI A;  4ULV A;  5B3I A;  4N6H A;  2XLE A;  3ZTM A; 
#chains in the Genus database with same CATH topology
 1VMA A;  2AWC A;  3O10 A;  3Q7L A;  5JT4 A;  1JR8 A;  5KYW A;  2VCB A;  3Q7G A;  1EI7 A;  4IB4 A;  4X0R A;  5EGY A;  1H7I A;  3LLI A;  2AP3 A;  3HNI A;  2HUJ A;  1VYK A;  2J8W A;  3W2W A;  1WWP A;  2ASR A;  2QNL A;  2CYD A;  3LNR A;  1V54 C;  2J7P D;  4GQH A;  4JIO A;  4C3E A;  3EFO A;  1S7Z A;  2GDC A;  1D0Y A;  1RMV A;  4CS9 A;  2XLV A;  2XM0 A;  1NU9 C;  1OW8 A;  3G50 A;  2EIK C;  3H2U A;  4H4K C;  4JEA A;  1FNT c;  3FMS A;  1YDI A;  4XEV A;  4IAR A;  1T01 A;  2G62 A;  1LIH A;  1YZA A;  1YA7 O;  5DQZ A;  1FMV A;  1ZYR F;  4IAQ A;  1Z63 A;  3O6X A;  3LEV A;  3QZC A;  1SR2 A;  2A69 F;  1H9T A;  2WZL A;  4EWC A;  2BL2 A;  4U5F E;  3S0X A;  1Q0M A;  1T6I A;  3X1O A;  2J7P A;  2OJQ A;  3TJ5 A;  4MW8 A;  2EPL X;  5F5F A;  2CDQ A;  4WGZ A;  1Q0K A;  1TR2 A;  3FOP A;  3W8H A;  4JTA B;  3RH3 A;  3NMK A;  3EG9 B;  1OCC C;  2YQY A;  2QUP A;  1OXB A;  3L1M A;  2EPK X;  1ZHT A;  2OKU A;  1DOW A;  2HKV A;  1U6H A;  1EQ1 A;  2PF4 E;  5IY5 C;  3PHF 2;  1S05 A;  2ZXO A;  4Q5S F;  1QPU A;  1R4T A;  1BZ4 A;  1WAS A;  1NBB A;  2O9X A;  2ZD9 A;  3IQ5 A;  3TQO A;  3M4C A;  3LS0 A;  3ZC4 A;  4YT4 A;  4JUR I;  3POV A;  3E9V A;  1TWH A;  1EKY A;  2A68 F;  5KYU A;  3RVZ A;  3K1I C;  5BQH A;  2EIL C;  2HS5 A;  3DD7 A;  3EHM A;  3ZDL A;  5A6K A;  3EH2 A;  3QVZ A;  3UMH A;  3HTK C;  4I3M A;  1N1C A;  1MNE A;  3TJ6 A;  3EJN A;  5A69 A;  3L8J A;  4OD4 A;  1T6Q A;  1YA9 A;  4BJT A;  2YL0 A;  4JZA A;  3IQC A;  3ABM C;  5CI9 A;  1I4Y A;  1LPE A;  2AWY A;  3RQF A;  2XSE A;  4CSA C;  3RQG A;  4ER9 A;  3WAQ A;  4EIY A;  4NY3 A;  1ZW3 A;  2KYH A;  1LVK A;  2EPO A;  1KTM A;  4C3B A;  4HEA J;  2IXM A;  3V5Y A;  3AQC A;  3UMK A;  2W9Y A;  3GM2 A;  4YJW A;  2Q4F A;  3EGD B;  3RIP A;  4A2N B;  2BE5 F;  5DLJ A;  4QDL A;  2IOQ A;  4XLN F;  2HV6 A;  3C8Z A;  4MS2 A;  2NUT A;  1GGQ A;  4M63 A;  4UDV A;  3DM5 A;  4I1M A;  2Q9B A;  5JP7 A;  3UNG C;  5KYW B;  1HW1 A;  2GAQ A;  5BUO A;  2PX0 A;  1WGW A;  3GOR A;  4O6Y A;  4HFF B;  3NKE A;  4NTB A;  2YLG A;  3GEH A;  3U2L A;  4YT8 A;  3U0C A;  3EG9 A;  2KNH A;  2NSF A;  5FZT A;  3LES A;  2C03 A;  1D1C A;  3H65 A;  3K1H A;  1HE9 A;  3KMI A;  3L0I A;  4FES A;  4JW1 A;  1ORS C;  4K0D A;  3PMR A;  4PFP A;  3W2V A;  4XLP F;  1SMY F;  1IZM A;  2PFD A;  3NYL A;  4NTA A;  3U9J A;  2A6E F;  3NYM A;  4JTC B;  4OD5 A;  3U9M A;  3W4Y A;  2EPN A;  4CX9 A;  4BG0 A;  4JJF A;  1ZHZ A;  4MVM A;  4ULV A;  3S29 A;  4DVY P;  4LAC B;  2X0C A;  5B3I A;  1T9K A;  2Y3G A;  4I1O B;  4K1O A;  1Y6D A;  1BR1 A;  2DI3 A;  2KJG A;  3QTH A;  2NUP A;  4U5D E;  2D5R B;  2VAS A;  1ZW2 A;  3C8G A;  4N4W A;  5L0C A;  3EGD A;  3NG1 A;  1FFT C;  3LEO A;  1NU7 D;  5B1A C;  4E7Z A;  3U8P A;  5L0D A;  2ZXR A;  1J8Y F;  2B0H A;  1TQG A;  5HSW A;  2HMQ A;  3RVY A;  4BJ5 A;  5DS6 A;  2YKZ A;  3ASN C;  3ZSU A;  4IWB A;  4DOZ A;  4E0I A;  2PBE A;  4CDA A;  4OIR F;  1QZX A;  3QW0 A;  3OWT A;  2AU5 A;  4U5E E;  3B0U X;  2J46 A;  2LSE A;  1LKX A;  3JRT A;  1CGM E;  3S27 A;  2FFH A;  2CW0 F;  2WZG A;  5JLI A;  2Y3B A;  2XRH A;  3AOU A;  3C8G D;  5L0F A;  3HKK A;  2R05 A;  4XQ1 A;  2L9J A;  3G4Z A;  3DI5 A;  4W8P A;  3RKO F;  5COG A;  3VAY A;  4ANJ A;  1UG7 A;  1JAF A;  3JZ0 A;  1ZVZ A;  5L0I A;  3EH1 A;  2XXA B;  1NFN A;  4U5G A;  2IXN A;  1LS4 A;  2A0B A;  5DQT A;  4EUK B;  2P6V A;  1TWC A;  5JUA A;  1OKK D;  2VB6 A;  5B1B C;  4D4N A;  3HNJ A;  3F46 A;  2DB4 A;  2F22 A;  1O5H A;  1G8X A;  1A7E A;  3ZG1 A;  5TJ5 E;  4EBB A;  2QY9 A;  3NRH A;  2HMZ A;  4RBN A;  3JYY A;  1D1A A;  1BDJ B;  3JRM O;  1ORJ A;  5AC5 A;  2OOC A;  1H6G A;  2P1A A;  3AGT A;  4MVQ A;  3X2Q C;  1A0B A;  3JSE O;  2J9V A;  1L7C A;  2XL4 A;  3ITF A;  1E86 A;  2HJ3 A;  1YVI A;  2ICW G;  1NSG B;  1UFB A;  3DM9 B;  4XPW A;  3DAF A;  4DBQ A;  2HSQ A;  4MVZ A;  4G7H F;  1OKK A;  1VK5 A;  5EK0 A;  2NSG A;  4B6I A;  4JC7 A;  2Q9A A;  4JE9 A;  3FXH A;  2L7A A;  2YLD A;  2IXO A;  3SXZ A;  1NLX A;  3SXK A;  1OCR C;  4GYT A;  4Q7C A;  4YK5 A;  1FFH A;  5E3C A;  2LFF A;  2R7V A;  4MVU A;  1AEP A;  2LQG A;  2A0U A;  3QW1 A;  5D91 A;  3EZH A;  4R32 A;  1GQA A;  2R7T A;  2I15 A;  3N24 A;  3VM6 A;  4N6C A;  1JRA A;  1M2O A;  3CQZ A;  3VRC A;  4AE4 B;  3WG7 C;  4H54 A;  2J0W A;  5BQI A;  3DXJ F;  2B0J A;  4U5C E;  1A7D A;  1APC A;  4LLE A;  2WVN A;  3M1C B;  3N2Z B;  4NTF A;  1A7V A;  4YT2 A;  5L0H A;  2V3C C;  1FTS A;  1OW7 A;  2LP4 A;  4MW3 A;  2I8B A;  4XEK A;  1RJ9 A;  3GM1 A;  1PD1 A;  3W8I A;  4MVS A;  5JS5 A;  1XZP A;  4D4X A;  2KK1 A;  3C62 A;  3MX3 A;  4LLC A;  1RKE B;  1MND A;  2PX3 A;  4O6N A;  4Z9J A;  4J7Y A;  2HSB A;  5DS5 A;  3FAP B;  5COM A;  4ZLC A;  2R7S A;  5AC4 A;  4FAP B;  3ABK C;  3ZVR A;  3VF0 A;  3N0T A;  3US6 A;  1XWJ A;  5T3T A;  4BJ5 C;  4OIQ F;  1C03 A;  4KNW A;  2CNW A;  2J9U A;  3DZA A;  1U89 A;  3TOM A;  4AK9 A;  2DYS C;  2R7W A;  2L6G A;  2VCC A;  4E0H A;  3TUL A;  4CS9 C;  1CPQ A;  1KU2 A;  4G0H A;  3JYH A;  2ZPA A;  4Z9I A;  1OQC A;  2BC5 A;  4BEM J;  2XL8 A;  4XTK A;  2Q7R A;  2D4U A;  1K04 A;  2MWQ A;  4IAO A;  1C17 M;  1KNY A;  2XLH A;  3RYL A;  2P61 A;  1ZHY A;  2YEV A;  1M2V A;  1RCP A;  2YZS A;  3AG3 C;  3M15 A;  3RF3 A;  3T6B A;  4AL0 A;  4EBJ A;  3LUT B;  2KC3 A;  4N6H A;  2LK4 A;  1G5Z A;  3IQT A;  2YWA A;  2IM8 A;  3CAX A;  1OR3 A;  4ONS A;  5F5H A;  4YT5 A;  3GOD A;  4ULW A;  4YL3 A;  3NKD A;  5COF A;  2YL3 A;  3RFY A;  2ZXP A;  3GEE A;  1D0Z A;  1E85 A;  4JJG A;  4JKV A;  3TOL A;  2KQ9 A;  2HV7 A;  1Z6A A;  3AQB A;  3T9O A;  4F4B A;  1HY5 A;  4J32 B;  2H7B A;  1J8M F;  2LIG A;  5L3V A;  4DRJ B;  3ZQV A;  3WOD F;  1K40 A;  1RXQ A;  2XLW A;  5DS4 A;  2FGY A;  2E87 A;  4QI0 A;  2KW3 C;  1E84 A;  4MTF A;  3A9C A;  1CGN A;  2HZ8 A;  3MYI A;  3S84 A;  5L3Q A;  1TKN A;  4PJN A;  3GAN A;  3T6G B;  2LCH A;  3G4X A;  4G7Z F;  1VB5 A;  1M56 C;  3FOO A;  3AGU A;  3B71 A;  1RJ9 B;  3IPM O;  3AG2 C;  1VOM A;  1Z5Z A;  1D0X A;  2Y3D A;  1Y4C A;  4XPY A;  3ZIB A;  5A6J A;  3B0V C;  3C7J A;  1MMN A;  1FR0 A;  2XLO A;  4DVZ A;  3ATP A;  3LNM B;  1YYJ A;  4U9D A;  1LM3 B;  3DWW A;  1IW7 F;  1YJG A;  3BRJ A;  4K7B A;  2IYL D;  5BQG A;  256B A;  2IBF A;  2PNO A;  2Y39 A;  3LS1 A;  2LFD A;  1V55 C;  2WVQ A;  3K33 A;  2NUP B;  4JCH A;  3EFO B;  1NG1 A;  3VYW A;  3T6J A;  1OCZ C;  3HNL A;  1QVX A;  1E2X A;  2KGO A;  1CPR A;  2XS1 A;  3MYF A;  4N06 A;  4DBR A;  1R5I D;  3DE9 A;  2WL8 A;  2HFI A;  2OQM A;  4IRU A;  2XL6 A;  2G3V A;  2GWW A;  2YLI A;  4LDK A;  2W4B A;  3SYN A;  4PFO A;  1ST6 A;  2Q3T A;  1SF8 A;  2H7V C;  2YVK A;  3ABL C;  3M4B A;  3U3B A;  1A41 A;  4DRI B;  5HV9 A;  3C63 A;  5B3S C;  2XM4 A;  1OR2 A;  2MHR A;  4JEB A;  1YZC A;  4LER A;  4Z9H A;  4E7S A;  5KYX B;  3UMI A;  1ZHW A;  5E33 A;  2QTV A;  1GS9 A;  4G78 A;  1L3P A;  3K66 A;  3BEH A;  1K05 A;  4O6M A;  1VTM P;  4OIO F;  1NZE A;  3QMK A;  4L6R A;  4PJM A;  3SZR A;  3R2P A;  1HE1 A;  4OIN F;  1GM5 A;  1MMA A;  1QLE C;  1ZZP A;  1YAR O;  5JSL A;  2EIN C;  2NG1 A;  2X51 A;  3AG4 C;  3SEO A;  1CGO A;  1Q0F A;  4JRZ A;  3AG1 C;  4BJ6 A;  1QKR A;  4AX2 A;  4JCZ A;  4KBL A;  4EKW A;  2OU6 A;  4J7T A;  3UGO A;  1M2V B;  1OW6 A;  1TFK B;  4DJ9 A;  4YN0 B;  1FMW A;  1U0B B;  3HNK A;  2WZF A;  2QE9 A;  1H9G A;  4CDY A;  1ZU4 A;  1LE4 A;  2RD9 A;  4U9E A;  4AL1 A;  4C7O A;  2VC9 A;  3V7O A;  4O7G A;  4U5B E;  1WOL A;  1M57 C;  2R03 A;  1VYI A;  2H7O A;  3S90 A;  3PDM P;  1TFO B;  1JMW A;  3NMJ A;  1QSP A;  5CI8 A;  1YLM A;  3U3F A;  1I5N A;  3EHN A;  3FDQ A;  4YL0 A;  1Z23 A;  1HW2 A;  5JVE A;  4WJ0 A;  1Z7Q c;  1PCX A;  2R25 A;  2YRF A;  4XWJ A;  3TK0 A;  5FCL A;  5EHH A;  2LD6 A;  4MQ9 F;  2XLD A;  2ZXW C;  2CGE A;  2YL7 A;  3IEE A;  3WHN A;  2J9B A;  2EIJ C;  2A1D D;  5KYY B;  2EPM X;  3FHD A;  2Q9C A;  3UGP A;  2XXA A;  3JCU Q;  4P9T A;  4YWQ A;  1LI7 A;  5E2Q A;  1DOV A;  3Q6N A;  4JVS A;  3IHU A;  5KYN A;  2L6H A;  5L0G A;  2R7R A;  1HMO A;  3FAJ A;  1AUE A;  1FAP B;  1PD0 A;  2R7U A;  3A11 A;  1ZHX A;  4BJ1 A;  1I4Z A;  3E70 C;  2EIM C;  3QVY A;  1V4A A;  2OEX A;  1C02 A;  1EA8 A;  1LI5 A;  3Q6M A;  4W8K A;  3C18 A;  4CIP A;  4LDQ A;  4RDA A;  4EBK A;  2V26 A;  3IQ6 A;  4C7O B;  3I5Q A;  1B68 A;  3DJU B;  3TD7 A;  5T3W A;  2WB7 A;  3DAG A;  1TWA A;  3U2M A;  3U5S A;  2OG2 A;  2PP4 A;  3EQL F;  3NMI A;  4P9F A;  2W4M A;  1JPN A;  4BJ6 C;  1YAU O;  4KI2 A;  2VCA A;  4NC3 A;  2TMV P;  2R7Q A;  3DE8 A;  4JTD B;  4EHP A;  1D1B A;  4BEJ A;  3O55 A;  1BBH A;  2XLM A;  2H8A A;  3MBG A;  3U8V A;  3SNH A;  3ZTM A;  5CIV A;  3KKB A;  1MMG A;  4CS8 A;  1JPJ A;  3MLG A;  1LS1 A;  4KC9 A;  3KYJ A;  4O79 A;  1M6T A;  1HMD A;  3I5P A;  4BPM A;  2NUT B;  1JOG A;  4IJJ A;  2OEV A;  2OJE D;  4MVR A;  2DYR C;  1F1M A;  2UUH A;  4LDR A;  5T1D B;  1VLS A;  3B9Q A;  1WAT A;  3L34 A;  2L81 A;  2JPU A;  2P7V A;  3DMD A;  3F47 A;  3O39 A;  4KNV A;  3V5X A;  3I4U A;  5A6B D;  3NDB B;  2HJM A;  4CDV A;  1VLT A;  2Y3H A;  3K6B A;  3J06 A;  2XS8 A;  5F28 E;  2GA0 A;  3DKA A;  1W2W A;  3GM3 A;  1O3U A;  2CCY A;  1G4W R;  1V74 B;  2GFH A;  1O87 A;  3LJB A;  3OA1 A;  2A6H F;  2YL1 A;  2JD3 A;  2P0N A;  3EZI A;  5JRA A;  2DGJ A;  3KH2 A;  3K7D A;  3LAY A;  3M79 A;  5KYY A;  3L8I A;  2M4E A;  4CIH A;  2R02 A;  3CEX A;  1MMD A;  2ETS A;  2Z15 A;  1Q0G A;  4WGY A;  1E83 A;  4RD9 A;  2Y69 C;  3HJC A;  3SXY A;  1LE2 A;  4J30 B;  4FX5 A;  1ZU5 A;  5A6B A;  2AVK A;  3EGX A;  3JTL O;  1Q0D A;  2WVO A;  3SP1 A;  4XPX A;  4HE8 D;  1BR2 A;  4PR9 A;  4FWV A;  1WTY A;  4PJJ A;  2M64 A;  4PJL A;  2R7X A;  3S9O A;  3MFN A;  4MVO A;  4NQF A;  2G3K A;  3JSZ A;  1Z3I X;  3H2V A;  4OIP F;  3LLK A;  2J0X A;  2C04 A;  4PAC A;  3B29 A;  3AJM A;  3RW0 A;  4Q4Z F;  1RKC A;  5DVW A;  4ZLD A;  2MYS A;  1AVO B;  2UUI A;  1SYQ A;  2RSE B;  5GPG B;  3DJN B;  1T5O A;  2OCC C;  3ZQY A;  4CS8 C;  3EPV A;  3SXM A;  4MTO A;  5A6A A;  3FVY A;  4WAB A;  2KSF A;  2W45 A;  3K1I A;  3CZ6 A;  3R7C A;  3GEI A;  4A4A A;  4NCQ A;  5E3A A;  2Q00 A;  1YYX A;  4CBE A;  4HFK B;  2J45 A;  1SZI A;  1TWG A;  2R7O A;  3ECS A;  3EGX B;  4P6I C;  4XEF A;  3RQE A;  4CS7 A;  3JT1 A;  3C8G B;  4CJO A;  3T4R A;  3KL4 A;  4CSA A;  5L0J A;  3V5Z A;  4CJG A;  1WN0 A;  1OXK A;  5K0I A;  4DRH B;  5AGF A;  2IXP A;  5KYX A;  3KPH A;  1MQV A;  4AE4 A;  2NPU A;  1ORY A;  3CSK A;  4IGG A;  4E18 A;  1NFO A;  1T6U A;  3ASO C;  4MTG A;  1PV3 A;  2L6F A;  5D92 A;  4PK4 A;  1OCO C;  2VH3 A;  3ZTZ A;  1G4U S;  1XZQ A;  4DXW A;  3HLZ A;  2QLA A;  1QQ3 A;  4MND A;  3UR3 C;  3ZWI A;  4YL1 A;  4G7O F;  4QI2 A;  3GWL A;  3GWN A;  4U5H A;  3S28 A;  2FAP B;  3OEO A;  5KYU B;  2R9R B;  2XLE A;  2YHS A;  3B0P A;  3NYJ A;  4GEH A;  4E17 A;  1RKE A;  2J9W A;  3KYI A;  2CNW D;  4I44 A;  3PCV A;  1BR4 A;  4C3D A;  2JX0 A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  2YL3 A;  4N4W A;  1E85 A;  4IB4 A;  3QVY A;  4JKV A;  3HNI A;  3TOL A;  3U8P A;  2J8W A;  4CIP A;  3IQ6 A;  2YKZ A;  3ZQV A;  4CDA A;  3NMI A;  2XLW A;  3QW0 A;  2XLV A;  2XM0 A;  1E84 A;  4JEA A;  4NC3 A;  1CGN A;  3DE8 A;  5JLI A;  4IAR A;  1YZA A;  1BBH A;  4IAQ A;  2XLM A;  3FOO A;  1JAF A;  1M6T A;  2XLO A;  1YYJ A;  4U9D A;  1LM3 B;  5JUA A;  4D4N A;  3HNJ A;  256B A;  4WGZ A;  3FOP A;  3NMK A;  3L1M A;  4CDV A;  3HNL A;  1S05 A;  1CPR A;  1QPU A;  2CCY A;  3IQ5 A;  1NBB A;  3DE9 A;  1E86 A;  3M4C A;  2XL6 A;  2YL1 A;  5JRA A;  2YLI A;  1EKY A;  3M79 A;  3M4B A;  3QVZ A;  3C63 A;  2XM4 A;  4JE9 A;  4JEB A;  4WGY A;  1E83 A;  1YZC A;  2YLD A;  2YL0 A;  4L6R A;  3QW1 A;  1GQA A;  4ER9 A;  4EIY A;  3VRC A;  5JSL A;  1APC A;  1CGO A;  1A7V A;  3ZQY A;  5JS5 A;  3HNK A;  1YYX A;  4D4X A;  3C62 A;  4CDY A;  4U9E A;  5JP7 A;  4CJO A;  4CJG A;  3NMJ A;  2YLG A;  5AGF A;  3TOM A;  1MQV A;  5JVE A;  1CPQ A;  2BC5 A;  2XL8 A;  2XLD A;  2YL7 A;  4CX9 A;  2XLH A;  3ZTZ A;  2J9B A;  2QLA A;  1QQ3 A;  3M15 A;  1RCP A;  3ZWI A;  4ULV A;  5B3I A;  4N6H A;  2XLE A;  3ZTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...