3NMKA

Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
molecule tags Electron transport
source organism Escherichia coli
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmkA00
1CGOA 2XLDA 3NMIA 4N6HA 4D4NA 2XM4A 3ZTZA 3M15A 1E83A 5JSLA 1CGNA 3ZQYA 2XL8A 3U8PA 3C63A 3NMJA 3IQ6A 1QPUA 5JS5A 3HNKA 3HNIA 4JEBA 4JE9A 4D4XA 1LM3B 1YZAA 3TOMA 3DE9A 2BC5A 2XLVA 4JEAA 1GQAA 2XM0A 3FOOA 5JLIA 4EIYA 5JT4A 4JKVA 4CDVA 3L1MA 4WGYA 2YLDA 2XLEA 5AGFA 2YL3A 3QW1A 3HNLA 4IAQA 4L6RA 3ZTMA 3M79A 1YYJA 2J9BA 4U9DA 4CJGA 1BBHA 3NMKA 1JAFA 2XLWA 2YLIA 1MQVA 1CPRA 3ZWIA 3VRCA 1A7VA 3QVZA 2YL0A 2XLOA 3FOPA 2CCYA 1EKYA 1E85A 2J8WA 4CX9A 1RCPA 1APCA 2YL7A 1NBBA 1E84A 1S05A 3DE8A 4IB4A 3ZQVA 4IARA 4N4WA 5JP7A 4CJOA 3M4BA 5JRAA 5JVEA 1E86A 4CDAA 2YKZA 4U9EA 1QQ3A 3HNJA 2XLMA 4CIPA 3M4CA 2XL6A 2XLHA 3TOLA 1YYXA 2QLAA 1YZCA 5B3IA 3IQ5A 4CDYA 3QVYA 4ER9A 3C62A 3QW0A 256BA 2YLGA 4NC3A 1M6TA 5JUAA 4ULVA 2YL1A 4WGZA 1CPQA
chains in the Genus database with same CATH superfamily
2YVKA 5CI9A 3SXYA 2XLDA 2ZXWC 5KYXB 3I5PA 3S84A 3ZTZA 1E83A 4G78A 3W2WA 3KMIA 2R7RA 4Z9HA 2QE9A 2R7SA 2F22A 4OD4A 1QKRA 3G4XA 2GFHA 3C63A 5FZTA 1QZXA 3IPMO 2M4EA 3DJNB 1OCOC 1YA9A 1LM3B 1M2VA 5T1DB 1J8MF 4MNDA 5D92A 1JPJA 2R25A 1JOGA 2BC5A 3EQLF 1MMGA 3NRHA 5FCLA 3JSEO 3AJMA 2HFIA 2QTVA 2NUPA 3AG4C 3SXMA 1GS9A 1BR1A 3GWLA 1NU7D 3K33A 5BQGA 2X0CA 5AC4A 2J45A 4Z9IA 2P1AA 3GM2A 4DBRA 4BJ1A 3GEHA 1H7IA 2Y3HA 4JKVA 1FNTc 4YL1A 4JVSA 4K7BA 3LAYA 4PJNA 4CDVA 4U5GA 4WGYA 4E18A 2XLEA 4MVMA 4CBEA 3QMKA 4I3MA 2G3KA 2OQMA 2ZXRA 4JW1A 4MVUA 2TMVP 4ULWA 3I5QA 3RQGA 4L6RA 3U9JA 1PCXA 4AL0A 5L0IA 3EGXA 3GODA 3FVYA 2CW0F 2XS1A 1U89A 3DM9B 3B0UX 5GPGB 5L0DA 1Q0DA 4CJGA 1MNDA 1BBHA 1LKXA 2CDQA 4U5FE 3VF0A 3FDQA 2EIKC 4JTAB 4JCZA 2R7XA 2A68F 3E70C 1FAPB 2HUJA 4AX2A 1TWGA 2I8BA 3DKAA 4PK4A 1HY5A 1CPRA 3UMIA 3DAGA 1WATA 3ZWIA 3DD7A 2GAQA 4Z9JA 4BG0A 2FFHA 3NKDA 4K1OA 1RKCA 1V54C 2LP4A 2Q3TA 2XLOA 2JX0A 4J7YA 3PHF2 1T9KA 3TD7A 3TJ6A 3N24A 1LE2A 3K66A 3MX3A 1LIHA 3U0CA 1S7ZA 2WVOA 5KYXA 2RSEB 4CX9A 3UGOA 1RCPA 2UUHA 3US6A 3V7OA 1KU2A 2D5RB 4DJ9A 4EUKB 2R7QA 1E84A 4LDQA 3DE8A 1FFTC 1SF8A 3X2QC 3T6GB 4XPXA 2GA0A 2OEVA 3AQCA 1E2XA 2HV7A 1ZVZA 4XPYA 5KYYA 3S0XA 3K1HA 3LESA 2Y3GA 3M4BA 1LVKA 5HV9A 1D0YA 3ZG1A 3T6BA 3POVA 3RF3A 4C3BA 4KNWA 3IQCA 4YL3A 1FMWA 3M1CB 2Y69C 3F47A 3X1OA 4A4AA 4CS8A 2KK1A 4I1MA 4BJ5A 1H9GA 2L6HA 1L3PA 4CIPA 4Q4ZF 1A7EA 3RKOF 4DVZA 3M4CA 4P9TA 4BEMJ 1YYXA 3AG1C 3ZC4A 2L81A 2OCCC 4XPWA 1Q0KA 1K04A 4IJJA 4DRIB 1YZCA 4E7ZA 1U0BB 1RJ9A 4JCHA 3IQ5A 2ASRA 3QVYA 1QSPA 4O79A 4F4BA 1GGQA 1HW1A 3B0PA 3R7CA 4AE4A 2Y39A 5KYWA 5BQHA 4PACA 1ZHYA 4BEJA 5A6JA 3ATPA 4I1OB 2D4UA 1M6TA 3DAFA 3ECSA 3ZVRA 5IY5C 5JUAA 2RD9A 4PJJA 1O87A 2YZSA 1I4YA 1YA7O 4ZLCA 4WGZA 1NZEA 1Z7Qc 4C7OA 3EGXB 3WAQA 4GYTA 1V4AA 5A6AA 3KYJA 1M2OA 1OCCC 4U5DE 2OOCA 1ORYA 2XM4A 4MVOA 3M15A 2IM8A 2NG1A 4XEKA 3LS0A 1R5ID 1ZHWA 3KKBA 1PD1A 3RVZA 5E3CA 4AE4B 2XL8A 3PCVA 3LEOA 2CGEA 3LS1A 4MVSA 5E2QA 4BJTA 4GEHA 4W8PA 5A69A 3GANA 5L0HA 2R05A 2W9YA 1QPUA 2VCAA 4DVYP 5BUOA 4AK9A 5JS5A 1RJ9B 1QLEC 3EHMA 4YN0B 1AVOB 3T4RA 2EINC 3U3BA 3V5YA 1WTYA 2B0JA 4D4XA 4DRJB 3JZ0A 1Z63A 4PFPA 4XWJA 3TOMA 1DOVA 4G0HA 4NTBA 1WOLA 2XLVA 3DMDA 5E3AA 4M63A 1NSGB 4J7TA 2GWWA 3ZSUA 3C8GA 4G7OF 3FOOA 2A0BA 4E0HA 1VTMP 1T5OA 2OKUA 4EIYA 1FFHA 3ASOC 1G4WR 3ZIBA 3MYIA 5L3QA 3EGDB 3JSZA 3L1MA 3JYYA 4EWCA 3UR3C 2OU6A 3O6XA 1KNYA 1G5ZA 1UFBA 1WASA 5AGFA 4OIQF 3SXKA 4OIOF 3HNLA 4I44A 4IAQA 4NTAA 1D1CA 5B3SC 2CNWD 3ASNC 3C8GB 1LS1A 2J7PD 3KPHA 4DRHB 3FAPB 3ZTMA 3DWWA 2GDCA 3M79A 4IGGA 2OJQA 2PP4A 2IBFA 1C02A 2A1DD 1SR2A 2LQGA 3EG9A 2V3CC 1NU9C 4JRZA 3Q7LA 2VB6A 1I5NA 3PMRA 3DI5A 3V5XA 2E87A 2XXAB 3MBGA 2WZFA 1DOWA 3G4ZA 4PJMA 3VRCA 1A7VA 3BEHA 3S29A 2CCYA 3W8IA 5A6BA 2J0WA 3IHUA 1LI7A 1A0BA 3VM6A 1C17M 3K6BA 1F1MA 1TKNA 5DQZA 2VASA 2HMQA 1TFKB 3EZIA 2KC3A 1APCA 2YL7A 2R03A 1D1BA 3ABLC 5B1BC 1Y6DA 3WHNA 1S05A 3E9VA 3LJBA 4MVRA 3HJCA 1UG7A 1T6QA 4QDLA 1OW6A 2YRFA 2WL8A 1I4ZA 2VCCA 1K05A 1YJGA 3OA1A 4O6NA 1ZZPA 4O6MA 2ZD9A 1T6UA 4NCQA 4OIPF 4PJLA 3EHNA 1ZHTA 5COMA 4U9EA 1U6HA 2MYSA 2OG2A 2EPMX 1AUEA 4IWBA 2A6EF 2PF4E 2KSFA 4N06A 1GM5A 4LERA 3U2LA 4W8KA 2ZPAA 1MMDA 5EK0A 3TQOA 4XLNF 3FXHA 4P6IC 2PNOA 2UUIA 2XLHA 3R2PA 3TOLA 3JRMO 4BPMA 1ZW3A 2QLAA 4EBJA 3L0IA 5D91A 3O10A 5B3IA 3A11A 4LACB 3ABKC 5KYUA 5DQTA 2DI3A 3KYIA 3AOUA 1NFNA 2A0UA 3T6JA 4CDYA 1ZU5A 4ONSA 3B0VC 2Y3BA 3EJNA 4ER9A 3L8IA 2EPNA 3NKEA 3C62A 2B0HA 2FGYA 3GWNA 1D0ZA 2J7PA 2DYRC 4NQFA 2I15A 5E33A 4QI2A 2YLGA 4HE8D 3O55A 3AQBA 4NY3A 3NG1A 4U5BE 3WG7C 3L34A 1A7DA 3JYHA 1N1CA 4IAOA 2EILC 2W45A 3G50A 1CPQA 1VOMA 3JTLO 1CGOA 2H7BA 2NUTB 4J32B 3NMIA 4N6HA 1RXQA 3DZAA 1ORSC 4D4NA 1T01A 3I4UA 1Q0MA 3H65A 3EFOA 4MVQA 3JT1A 4X0RA 2J9VA 2CYDA 4AL1A 5K0IA 1CGNA 2MHRA 4MTFA 3VYWA 5DS6A 5KYYB 2HKVA 2Z15A 3IQ6A 2AU5A 1TWHA 2MWQA 3HNKA 3Q7GA 3LLKA 3C18A 4O7GA 2H7VC 3V5ZA 2AWYA 4JEBA 1WN0A 2NSFA 4JE9A 4B6IA 3B71A 1HMOA 3GEEA 1RKEB 3OWTA 3S9OA 1EA8A 3DE9A 1Z3IX 2Q00A 3U2MA 2H7OA 4WJ0A 5A6KA 3RQEA 5CIVA 1WGWA 2P61A 2G62A 4JEAA 3W2VA 1GQAA 2C04A 1V74B 1TQGA 5JT4A 2XL4A 1MNEA 2R02A 3VAYA 3B9QA 5KYNA 1ZYRF 3RW0A 2YLDA 1NG1A 3F46A 1D1AA 2LCHA 2R7OA 4JTCB 3TK0A 2HS5A 1VK5A 2JD3A 2OJED 1OW7A 2R7TA 4BJ5C 1BR2A 2DYSC 3H2VA 4CS8C 4OINF 1TWCA 2ICWG 4LDRA 2J0XA 2PX3A 1EI7A 2Q9BA 2W4MA 3MLGA 3UNGC 4JJFA 1VB5A 2EIMC 3RYLA 5L3VA 1W2WA 2J9BA 4U9DA 3TULA 1ZW2A 1M57C 2KW3C 3NMKA 2XSEA 1RKEA 3FHDA 3N2ZB 2YLIA 3CEXA 3S27A 2QY9A 3K1IA 4XTKA 4OIRF 1YARO 2A69F 2WZGA 2XRHA 2Q4FA 5T3TA 1MQVA 2O9XA 5AC5A 2H8AA 4A2NB 1AEPA 2LFDA 4IRUA 1LI5A 3QVZA 2YL0A 2WB7A 3FOPA 3T9OA 5COFA 3W4YA 1OCRC 2VH3A 1EKYA 5DLJA 3EG9B 1E85A 2J8WA 3UMHA 5EHHA 4KBLA 5DS5A 2LD6A 2LK4A 4RBNA 2HZ8A 3ABMC 1M2VB 1NBBA 2YHSA 1LE4A 1FTSA 4IB4A 1T6IA 3ZQVA 4YWQA 5L0JA 2DGJA 4MTGA 4N4WA 1LS4A 4H4KC 5JP7A 3S90A 2AVKA 3AG2C 4U5CE 4CJOA 1EQ1A 1R4TA 4HFFB 4JJGA 5F5FA 2CNWA 5JRAA 3SZRA 1E86A 4N6CA 2M64A 3FAJA 3BRJA 2LSEA 3EFOB 4CDAA 1QQ3A 1VLTA 1TR2A 4YT8A 3DXJF 3TJ5A 3HNJA 4JIOA 4Q5SF 1FR0A 2EPOA 1ST6A 4E17A 4UDVA 1L7CA 2ZXOA 1VYIA 5CI8A 1TWAA 3RVYA 4CSAC 5B1AC 3L8JA 2L7AA 3WODF 4MW3A 4Q7CA 2HJ3A 4EHPA 4XEFA 2YWAA 1NFOA 5TJ5E 2IXOA 1VLSA 3U5SA 3EH2A 3B29A 4RD9A 4JURI 2YQYA 4DBQA 5KYUB 3QW0A 2J9WA 4YT5A 1O3UA 2W4BA 4J30B 2P7VA 1SZIA 1Z6AA 1K40A 3U9MA 4NC3A 1RMVA 4U5HA 5A6BD 4YL0A 4ULVA 3H2UA 2YL1A 4R32A 3S28A 3AG3C 3ITFA 2LIGA 3NYMA 4YT4A 3PDMP 3NYJA 2R7WA 1OW8A 2AWCA 2JPUA 4PFOA 4JTDB 1JMWA 2EPKX 2J9UA 3KH2A 5L0CA 5JSLA 2IXNA 4P9FA 5KYWB 3AGUA 3IEEA 5L0GA 3OEOA 3ZQYA 4BJ6C 1XZPA 2IOQA 3U8PA 2HJMA 3NMJA 1OR2A 2XS8A 3SYNA 1HW2A 3NDBB 3DJUB 2FAPB 3HNIA 3RQFA 4XLPF 1ZU4A 2L9JA 4JC7A 1YZAA 3SXZA 1A41A 2EIJC 4BJ6A 4CS9C 1WWPA 3LUTB 2PBEA 2Y3DA 1JPNA 3ZDLA 4MQ9F 4KNVA 4ANJA 2DB4A 3LNMB 4FWVA 1KTMA 2KQ9A 3RFYA 2XM0A 2KYHA 5JLIA 4G7HF 4KI2A 3QZCA 4YK5A 2BE5F 1Y4CA 2X51A 3SP1A 2LFFA 5COGA 1PV3A 2NSGA 4QI0A 2XXAA 1XZQA 3LNRA 1G4US 1OQCA 3N0TA 3JCUQ 4CS7A 3EGDA 3EPVA 4K0DA 2YL3A 1C03A 3U3FA 1VMAA 3QW1A 4H54A 1Q0FA 3UMKA 4JZAA 1LPEA 2IXMA 1QVXA 2WVNA 2NUTA 2EPLX 3J06A 2A6HF 3GORA 2L6FA 1PD0A 1YVIA 3MYFA 3W8HA 2R7UA 4O6YA 1YYJA 2J46A 3CZ6A 3K1IC 4KC9A 3Q6MA 2WZLA 3AGTA 2YEVA 1JAFA 1H6GA 2IXPA 2XLWA 1Z23A 2KNHA 1XWJA 3KL4A 4C3DA 4CSAA 4WABA 1JR8A 2G3VA 3UGPA 2ZXPA 1ZHXA 1IW7F 2KGOA 3GM1A 4C3EA 3CSKA 4FAPB 4XEVA 4U5EE 1OR3A 3QTHA 3CQZA 1CGME 3O39A 3U8VA 5L0FA 2VCBA 2WVQA 1OXBA 4FX5A 3A9CA 1JRAA 1ZHZA 2PX0A 2HSBA 4OD5A 3HLZA 4C7OB 3HTKC 1YAUO 4MVZA 4RDAA 2HMZA 1MMNA 3MFNA 2V26A 3NYLA 3RIPA 3C7JA 5EGYA 4IARA 4LLEA 3HKKA 4HEAJ 2PFDA 4E0IA 4EKWA 3C8ZA 4XQ1A 2KJGA 4MW8A 3FMSA 3SNHA 4ZLDA 1V55C 5JVEA 1TFOB 1VYKA 4CIHA 1ORJA 1OXKA 3RH3A 1MMAA 5BQIA 1NLXA 5DS4A 2BL2A 2YKZA 3EH1A 4HFKB 2OEXA 1FMVA 4E7SA 3DM5A 1H9TA 2R9RB 2Q9AA 1Q0GA 1Z5ZA 4FESA 1OCZC 3SEOA 3GEIA 5F5HA 1SYQA 2XLMA 4G7ZF 1BZ4A 2IYLD 2C03A 2NUPB 4GQHA 2XL6A 2HSQA 3Q6NA 1IZMA 1D0XA 4YT2A 3LLIA 1M56C 3C8GD 4DXWA 4LLCA 1HMDA 2HV6A 2VC9A 3K7DA 2QUPA 4DOZA 1YDIA 1J8YF 4EBKA 1B68A 1HE1A 2L6GA 4NTFA 1BDJB 2P6VA 3IQTA 2Q9CA 4MS2A 1G8XA 1OKKA 4PR9A 3EZHA 1HE9A 256BA 3JRTA 4MTOA 1SMYF 2AP3A 5DVWA 2ETSA 4CS9A 2R7VA 3CAXA 5T3WA 2Q7RA 1YLMA 1OKKD 4LDKA 3GM3A 1O5HA 4YJWA 2QNLA 5F28E 1BR4A 2NPUA 3LEVA 2P0NA 4EBBA 5HSWA
chains in the Genus database with same CATH topology
1CGOA 2XLDA 3NMIA 4N6HA 4D4NA 2XM4A 3ZTZA 3M15A 1E83A 5JSLA 1CGNA 3ZQYA 2XL8A 3U8PA 3C63A 3NMJA 3IQ6A 1QPUA 5JS5A 3HNKA 3HNIA 4JEBA 4JE9A 4D4XA 1LM3B 1YZAA 3TOMA 3DE9A 2BC5A 2XLVA 4JEAA 1GQAA 2XM0A 3FOOA 5JLIA 4EIYA 5JT4A 4JKVA 4CDVA 3L1MA 4WGYA 2YLDA 2XLEA 5AGFA 2YL3A 3QW1A 3HNLA 4IAQA 4L6RA 3ZTMA 3M79A 1YYJA 2J9BA 4U9DA 4CJGA 1BBHA 3NMKA 1JAFA 2XLWA 2YLIA 1MQVA 1CPRA 3ZWIA 3VRCA 1A7VA 3QVZA 2YL0A 2XLOA 3FOPA 2CCYA 1EKYA 1E85A 2J8WA 4CX9A 1RCPA 1APCA 2YL7A 1NBBA 1E84A 1S05A 3DE8A 4IB4A 3ZQVA 4IARA 4N4WA 5JP7A 4CJOA 3M4BA 5JRAA 5JVEA 1E86A 4CDAA 2YKZA 4U9EA 1QQ3A 3HNJA 2XLMA 4CIPA 3M4CA 2XL6A 2XLHA 3TOLA 1YYXA 2QLAA 1YZCA 5B3IA 3IQ5A 4CDYA 3QVYA 4ER9A 3C62A 3QW0A 256BA 2YLGA 4NC3A 1M6TA 5JUAA 4ULVA 2YL1A 4WGZA 1CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGO A;  2XLD A;  3NMI A;  4N6H A;  4D4N A;  2XM4 A;  3ZTZ A;  3M15 A;  1E83 A;  5JSL A;  1CGN A;  3ZQY A;  2XL8 A;  3U8P A;  3C63 A;  3NMJ A;  3IQ6 A;  1QPU A;  5JS5 A;  3HNK A;  3HNI A;  4JEB A;  4JE9 A;  4D4X A;  1LM3 B;  1YZA A;  3TOM A;  3DE9 A;  2BC5 A;  2XLV A;  4JEA A;  1GQA A;  2XM0 A;  3FOO A;  5JLI A;  4EIY A;  5JT4 A;  4JKV A;  4CDV A;  3L1M A;  4WGY A;  2YLD A;  2XLE A;  5AGF A;  2YL3 A;  3QW1 A;  3HNL A;  4IAQ A;  4L6R A;  3ZTM A;  3M79 A;  1YYJ A;  2J9B A;  4U9D A;  4CJG A;  1BBH A;  3NMK A;  1JAF A;  2XLW A;  2YLI A;  1MQV A;  1CPR A;  3ZWI A;  3VRC A;  1A7V A;  3QVZ A;  2YL0 A;  2XLO A;  3FOP A;  2CCY A;  1EKY A;  1E85 A;  2J8W A;  4CX9 A;  1RCP A;  1APC A;  2YL7 A;  1NBB A;  1E84 A;  1S05 A;  3DE8 A;  4IB4 A;  3ZQV A;  4IAR A;  4N4W A;  5JP7 A;  4CJO A;  3M4B A;  5JRA A;  5JVE A;  1E86 A;  4CDA A;  2YKZ A;  4U9E A;  1QQ3 A;  3HNJ A;  2XLM A;  4CIP A;  3M4C A;  2XL6 A;  2XLH A;  3TOL A;  1YYX A;  2QLA A;  1YZC A;  5B3I A;  3IQ5 A;  4CDY A;  3QVY A;  4ER9 A;  3C62 A;  3QW0 A;  256B A;  2YLG A;  4NC3 A;  1M6T A;  5JUA A;  4ULV A;  2YL1 A;  4WGZ A;  1CPQ A; 
#chains in the Genus database with same CATH topology
 2YVK A;  5CI9 A;  3SXY A;  2XLD A;  2ZXW C;  5KYX B;  3I5P A;  3S84 A;  3ZTZ A;  1E83 A;  4G78 A;  3W2W A;  3KMI A;  2R7R A;  4Z9H A;  2QE9 A;  2R7S A;  2F22 A;  4OD4 A;  1QKR A;  3G4X A;  2GFH A;  3C63 A;  5FZT A;  1QZX A;  3IPM O;  2M4E A;  3DJN B;  1OCO C;  1YA9 A;  1LM3 B;  1M2V A;  5T1D B;  1J8M F;  4MND A;  5D92 A;  1JPJ A;  2R25 A;  1JOG A;  2BC5 A;  3EQL F;  1MMG A;  3NRH A;  5FCL A;  3JSE O;  3AJM A;  2HFI A;  2QTV A;  2NUP A;  3AG4 C;  3SXM A;  1GS9 A;  1BR1 A;  3GWL A;  1NU7 D;  3K33 A;  5BQG A;  2X0C A;  5AC4 A;  2J45 A;  4Z9I A;  2P1A A;  3GM2 A;  4DBR A;  4BJ1 A;  3GEH A;  1H7I A;  2Y3H A;  4JKV A;  1FNT c;  4YL1 A;  4JVS A;  4K7B A;  3LAY A;  4PJN A;  4CDV A;  4U5G A;  4WGY A;  4E18 A;  2XLE A;  4MVM A;  4CBE A;  3QMK A;  4I3M A;  2G3K A;  2OQM A;  2ZXR A;  4JW1 A;  4MVU A;  2TMV P;  4ULW A;  3I5Q A;  3RQG A;  4L6R A;  3U9J A;  1PCX A;  4AL0 A;  5L0I A;  3EGX A;  3GOD A;  3FVY A;  2CW0 F;  2XS1 A;  1U89 A;  3DM9 B;  3B0U X;  5GPG B;  5L0D A;  1Q0D A;  4CJG A;  1MND A;  1BBH A;  1LKX A;  2CDQ A;  4U5F E;  3VF0 A;  3FDQ A;  2EIK C;  4JTA B;  4JCZ A;  2R7X A;  2A68 F;  3E70 C;  1FAP B;  2HUJ A;  4AX2 A;  1TWG A;  2I8B A;  3DKA A;  4PK4 A;  1HY5 A;  1CPR A;  3UMI A;  3DAG A;  1WAT A;  3ZWI A;  3DD7 A;  2GAQ A;  4Z9J A;  4BG0 A;  2FFH A;  3NKD A;  4K1O A;  1RKC A;  1V54 C;  2LP4 A;  2Q3T A;  2XLO A;  2JX0 A;  4J7Y A;  3PHF 2;  1T9K A;  3TD7 A;  3TJ6 A;  3N24 A;  1LE2 A;  3K66 A;  3MX3 A;  1LIH A;  3U0C A;  1S7Z A;  2WVO A;  5KYX A;  2RSE B;  4CX9 A;  3UGO A;  1RCP A;  2UUH A;  3US6 A;  3V7O A;  1KU2 A;  2D5R B;  4DJ9 A;  4EUK B;  2R7Q A;  1E84 A;  4LDQ A;  3DE8 A;  1FFT C;  1SF8 A;  3X2Q C;  3T6G B;  4XPX A;  2GA0 A;  2OEV A;  3AQC A;  1E2X A;  2HV7 A;  1ZVZ A;  4XPY A;  5KYY A;  3S0X A;  3K1H A;  3LES A;  2Y3G A;  3M4B A;  1LVK A;  5HV9 A;  1D0Y A;  3ZG1 A;  3T6B A;  3POV A;  3RF3 A;  4C3B A;  4KNW A;  3IQC A;  4YL3 A;  1FMW A;  3M1C B;  2Y69 C;  3F47 A;  3X1O A;  4A4A A;  4CS8 A;  2KK1 A;  4I1M A;  4BJ5 A;  1H9G A;  2L6H A;  1L3P A;  4CIP A;  4Q4Z F;  1A7E A;  3RKO F;  4DVZ A;  3M4C A;  4P9T A;  4BEM J;  1YYX A;  3AG1 C;  3ZC4 A;  2L81 A;  2OCC C;  4XPW A;  1Q0K A;  1K04 A;  4IJJ A;  4DRI B;  1YZC A;  4E7Z A;  1U0B B;  1RJ9 A;  4JCH A;  3IQ5 A;  2ASR A;  3QVY A;  1QSP A;  4O79 A;  4F4B A;  1GGQ A;  1HW1 A;  3B0P A;  3R7C A;  4AE4 A;  2Y39 A;  5KYW A;  5BQH A;  4PAC A;  1ZHY A;  4BEJ A;  5A6J A;  3ATP A;  4I1O B;  2D4U A;  1M6T A;  3DAF A;  3ECS A;  3ZVR A;  5IY5 C;  5JUA A;  2RD9 A;  4PJJ A;  1O87 A;  2YZS A;  1I4Y A;  1YA7 O;  4ZLC A;  4WGZ A;  1NZE A;  1Z7Q c;  4C7O A;  3EGX B;  3WAQ A;  4GYT A;  1V4A A;  5A6A A;  3KYJ A;  1M2O A;  1OCC C;  4U5D E;  2OOC A;  1ORY A;  2XM4 A;  4MVO A;  3M15 A;  2IM8 A;  2NG1 A;  4XEK A;  3LS0 A;  1R5I D;  1ZHW A;  3KKB A;  1PD1 A;  3RVZ A;  5E3C A;  4AE4 B;  2XL8 A;  3PCV A;  3LEO A;  2CGE A;  3LS1 A;  4MVS A;  5E2Q A;  4BJT A;  4GEH A;  4W8P A;  5A69 A;  3GAN A;  5L0H A;  2R05 A;  2W9Y A;  1QPU A;  2VCA A;  4DVY P;  5BUO A;  4AK9 A;  5JS5 A;  1RJ9 B;  1QLE C;  3EHM A;  4YN0 B;  1AVO B;  3T4R A;  2EIN C;  3U3B A;  3V5Y A;  1WTY A;  2B0J A;  4D4X A;  4DRJ B;  3JZ0 A;  1Z63 A;  4PFP A;  4XWJ A;  3TOM A;  1DOV A;  4G0H A;  4NTB A;  1WOL A;  2XLV A;  3DMD A;  5E3A A;  4M63 A;  1NSG B;  4J7T A;  2GWW A;  3ZSU A;  3C8G A;  4G7O F;  3FOO A;  2A0B A;  4E0H A;  1VTM P;  1T5O A;  2OKU A;  4EIY A;  1FFH A;  3ASO C;  1G4W R;  3ZIB A;  3MYI A;  5L3Q A;  3EGD B;  3JSZ A;  3L1M A;  3JYY A;  4EWC A;  3UR3 C;  2OU6 A;  3O6X A;  1KNY A;  1G5Z A;  1UFB A;  1WAS A;  5AGF A;  4OIQ F;  3SXK A;  4OIO F;  3HNL A;  4I44 A;  4IAQ A;  4NTA A;  1D1C A;  5B3S C;  2CNW D;  3ASN C;  3C8G B;  1LS1 A;  2J7P D;  3KPH A;  4DRH B;  3FAP B;  3ZTM A;  3DWW A;  2GDC A;  3M79 A;  4IGG A;  2OJQ A;  2PP4 A;  2IBF A;  1C02 A;  2A1D D;  1SR2 A;  2LQG A;  3EG9 A;  2V3C C;  1NU9 C;  4JRZ A;  3Q7L A;  2VB6 A;  1I5N A;  3PMR A;  3DI5 A;  3V5X A;  2E87 A;  2XXA B;  3MBG A;  2WZF A;  1DOW A;  3G4Z A;  4PJM A;  3VRC A;  1A7V A;  3BEH A;  3S29 A;  2CCY A;  3W8I A;  5A6B A;  2J0W A;  3IHU A;  1LI7 A;  1A0B A;  3VM6 A;  1C17 M;  3K6B A;  1F1M A;  1TKN A;  5DQZ A;  2VAS A;  2HMQ A;  1TFK B;  3EZI A;  2KC3 A;  1APC A;  2YL7 A;  2R03 A;  1D1B A;  3ABL C;  5B1B C;  1Y6D A;  3WHN A;  1S05 A;  3E9V A;  3LJB A;  4MVR A;  3HJC A;  1UG7 A;  1T6Q A;  4QDL A;  1OW6 A;  2YRF A;  2WL8 A;  1I4Z A;  2VCC A;  1K05 A;  1YJG A;  3OA1 A;  4O6N A;  1ZZP A;  4O6M A;  2ZD9 A;  1T6U A;  4NCQ A;  4OIP F;  4PJL A;  3EHN A;  1ZHT A;  5COM A;  4U9E A;  1U6H A;  2MYS A;  2OG2 A;  2EPM X;  1AUE A;  4IWB A;  2A6E F;  2PF4 E;  2KSF A;  4N06 A;  1GM5 A;  4LER A;  3U2L A;  4W8K A;  2ZPA A;  1MMD A;  5EK0 A;  3TQO A;  4XLN F;  3FXH A;  4P6I C;  2PNO A;  2UUI A;  2XLH A;  3R2P A;  3TOL A;  3JRM O;  4BPM A;  1ZW3 A;  2QLA A;  4EBJ A;  3L0I A;  5D91 A;  3O10 A;  5B3I A;  3A11 A;  4LAC B;  3ABK C;  5KYU A;  5DQT A;  2DI3 A;  3KYI A;  3AOU A;  1NFN A;  2A0U A;  3T6J A;  4CDY A;  1ZU5 A;  4ONS A;  3B0V C;  2Y3B A;  3EJN A;  4ER9 A;  3L8I A;  2EPN A;  3NKE A;  3C62 A;  2B0H A;  2FGY A;  3GWN A;  1D0Z A;  2J7P A;  2DYR C;  4NQF A;  2I15 A;  5E33 A;  4QI2 A;  2YLG A;  4HE8 D;  3O55 A;  3AQB A;  4NY3 A;  3NG1 A;  4U5B E;  3WG7 C;  3L34 A;  1A7D A;  3JYH A;  1N1C A;  4IAO A;  2EIL C;  2W45 A;  3G50 A;  1CPQ A;  1VOM A;  3JTL O;  1CGO A;  2H7B A;  2NUT B;  4J32 B;  3NMI A;  4N6H A;  1RXQ A;  3DZA A;  1ORS C;  4D4N A;  1T01 A;  3I4U A;  1Q0M A;  3H65 A;  3EFO A;  4MVQ A;  3JT1 A;  4X0R A;  2J9V A;  2CYD A;  4AL1 A;  5K0I A;  1CGN A;  2MHR A;  4MTF A;  3VYW A;  5DS6 A;  5KYY B;  2HKV A;  2Z15 A;  3IQ6 A;  2AU5 A;  1TWH A;  2MWQ A;  3HNK A;  3Q7G A;  3LLK A;  3C18 A;  4O7G A;  2H7V C;  3V5Z A;  2AWY A;  4JEB A;  1WN0 A;  2NSF A;  4JE9 A;  4B6I A;  3B71 A;  1HMO A;  3GEE A;  1RKE B;  3OWT A;  3S9O A;  1EA8 A;  3DE9 A;  1Z3I X;  2Q00 A;  3U2M A;  2H7O A;  4WJ0 A;  5A6K A;  3RQE A;  5CIV A;  1WGW A;  2P61 A;  2G62 A;  4JEA A;  3W2V A;  1GQA A;  2C04 A;  1V74 B;  1TQG A;  5JT4 A;  2XL4 A;  1MNE A;  2R02 A;  3VAY A;  3B9Q A;  5KYN A;  1ZYR F;  3RW0 A;  2YLD A;  1NG1 A;  3F46 A;  1D1A A;  2LCH A;  2R7O A;  4JTC B;  3TK0 A;  2HS5 A;  1VK5 A;  2JD3 A;  2OJE D;  1OW7 A;  2R7T A;  4BJ5 C;  1BR2 A;  2DYS C;  3H2V A;  4CS8 C;  4OIN F;  1TWC A;  2ICW G;  4LDR A;  2J0X A;  2PX3 A;  1EI7 A;  2Q9B A;  2W4M A;  3MLG A;  3UNG C;  4JJF A;  1VB5 A;  2EIM C;  3RYL A;  5L3V A;  1W2W A;  2J9B A;  4U9D A;  3TUL A;  1ZW2 A;  1M57 C;  2KW3 C;  3NMK A;  2XSE A;  1RKE A;  3FHD A;  3N2Z B;  2YLI A;  3CEX A;  3S27 A;  2QY9 A;  3K1I A;  4XTK A;  4OIR F;  1YAR O;  2A69 F;  2WZG A;  2XRH A;  2Q4F A;  5T3T A;  1MQV A;  2O9X A;  5AC5 A;  2H8A A;  4A2N B;  1AEP A;  2LFD A;  4IRU A;  1LI5 A;  3QVZ A;  2YL0 A;  2WB7 A;  3FOP A;  3T9O A;  5COF A;  3W4Y A;  1OCR C;  2VH3 A;  1EKY A;  5DLJ A;  3EG9 B;  1E85 A;  2J8W A;  3UMH A;  5EHH A;  4KBL A;  5DS5 A;  2LD6 A;  2LK4 A;  4RBN A;  2HZ8 A;  3ABM C;  1M2V B;  1NBB A;  2YHS A;  1LE4 A;  1FTS A;  4IB4 A;  1T6I A;  3ZQV A;  4YWQ A;  5L0J A;  2DGJ A;  4MTG A;  4N4W A;  1LS4 A;  4H4K C;  5JP7 A;  3S90 A;  2AVK A;  3AG2 C;  4U5C E;  4CJO A;  1EQ1 A;  1R4T A;  4HFF B;  4JJG A;  5F5F A;  2CNW A;  5JRA A;  3SZR A;  1E86 A;  4N6C A;  2M64 A;  3FAJ A;  3BRJ A;  2LSE A;  3EFO B;  4CDA A;  1QQ3 A;  1VLT A;  1TR2 A;  4YT8 A;  3DXJ F;  3TJ5 A;  3HNJ A;  4JIO A;  4Q5S F;  1FR0 A;  2EPO A;  1ST6 A;  4E17 A;  4UDV A;  1L7C A;  2ZXO A;  1VYI A;  5CI8 A;  1TWA A;  3RVY A;  4CSA C;  5B1A C;  3L8J A;  2L7A A;  3WOD F;  4MW3 A;  4Q7C A;  2HJ3 A;  4EHP A;  4XEF A;  2YWA A;  1NFO A;  5TJ5 E;  2IXO A;  1VLS A;  3U5S A;  3EH2 A;  3B29 A;  4RD9 A;  4JUR I;  2YQY A;  4DBQ A;  5KYU B;  3QW0 A;  2J9W A;  4YT5 A;  1O3U A;  2W4B A;  4J30 B;  2P7V A;  1SZI A;  1Z6A A;  1K40 A;  3U9M A;  4NC3 A;  1RMV A;  4U5H A;  5A6B D;  4YL0 A;  4ULV A;  3H2U A;  2YL1 A;  4R32 A;  3S28 A;  3AG3 C;  3ITF A;  2LIG A;  3NYM A;  4YT4 A;  3PDM P;  3NYJ A;  2R7W A;  1OW8 A;  2AWC A;  2JPU A;  4PFO A;  4JTD B;  1JMW A;  2EPK X;  2J9U A;  3KH2 A;  5L0C A;  5JSL A;  2IXN A;  4P9F A;  5KYW B;  3AGU A;  3IEE A;  5L0G A;  3OEO A;  3ZQY A;  4BJ6 C;  1XZP A;  2IOQ A;  3U8P A;  2HJM A;  3NMJ A;  1OR2 A;  2XS8 A;  3SYN A;  1HW2 A;  3NDB B;  3DJU B;  2FAP B;  3HNI A;  3RQF A;  4XLP F;  1ZU4 A;  2L9J A;  4JC7 A;  1YZA A;  3SXZ A;  1A41 A;  2EIJ C;  4BJ6 A;  4CS9 C;  1WWP A;  3LUT B;  2PBE A;  2Y3D A;  1JPN A;  3ZDL A;  4MQ9 F;  4KNV A;  4ANJ A;  2DB4 A;  3LNM B;  4FWV A;  1KTM A;  2KQ9 A;  3RFY A;  2XM0 A;  2KYH A;  5JLI A;  4G7H F;  4KI2 A;  3QZC A;  4YK5 A;  2BE5 F;  1Y4C A;  2X51 A;  3SP1 A;  2LFF A;  5COG A;  1PV3 A;  2NSG A;  4QI0 A;  2XXA A;  1XZQ A;  3LNR A;  1G4U S;  1OQC A;  3N0T A;  3JCU Q;  4CS7 A;  3EGD A;  3EPV A;  4K0D A;  2YL3 A;  1C03 A;  3U3F A;  1VMA A;  3QW1 A;  4H54 A;  1Q0F A;  3UMK A;  4JZA A;  1LPE A;  2IXM A;  1QVX A;  2WVN A;  2NUT A;  2EPL X;  3J06 A;  2A6H F;  3GOR A;  2L6F A;  1PD0 A;  1YVI A;  3MYF A;  3W8H A;  2R7U A;  4O6Y A;  1YYJ A;  2J46 A;  3CZ6 A;  3K1I C;  4KC9 A;  3Q6M A;  2WZL A;  3AGT A;  2YEV A;  1JAF A;  1H6G A;  2IXP A;  2XLW A;  1Z23 A;  2KNH A;  1XWJ A;  3KL4 A;  4C3D A;  4CSA A;  4WAB A;  1JR8 A;  2G3V A;  3UGP A;  2ZXP A;  1ZHX A;  1IW7 F;  2KGO A;  3GM1 A;  4C3E A;  3CSK A;  4FAP B;  4XEV A;  4U5E E;  1OR3 A;  3QTH A;  3CQZ A;  1CGM E;  3O39 A;  3U8V A;  5L0F A;  2VCB A;  2WVQ A;  1OXB A;  4FX5 A;  3A9C A;  1JRA A;  1ZHZ A;  2PX0 A;  2HSB A;  4OD5 A;  3HLZ A;  4C7O B;  3HTK C;  1YAU O;  4MVZ A;  4RDA A;  2HMZ A;  1MMN A;  3MFN A;  2V26 A;  3NYL A;  3RIP A;  3C7J A;  5EGY A;  4IAR A;  4LLE A;  3HKK A;  4HEA J;  2PFD A;  4E0I A;  4EKW A;  3C8Z A;  4XQ1 A;  2KJG A;  4MW8 A;  3FMS A;  3SNH A;  4ZLD A;  1V55 C;  5JVE A;  1TFO B;  1VYK A;  4CIH A;  1ORJ A;  1OXK A;  3RH3 A;  1MMA A;  5BQI A;  1NLX A;  5DS4 A;  2BL2 A;  2YKZ A;  3EH1 A;  4HFK B;  2OEX A;  1FMV A;  4E7S A;  3DM5 A;  1H9T A;  2R9R B;  2Q9A A;  1Q0G A;  1Z5Z A;  4FES A;  1OCZ C;  3SEO A;  3GEI A;  5F5H A;  1SYQ A;  2XLM A;  4G7Z F;  1BZ4 A;  2IYL D;  2C03 A;  2NUP B;  4GQH A;  2XL6 A;  2HSQ A;  3Q6N A;  1IZM A;  1D0X A;  4YT2 A;  3LLI A;  1M56 C;  3C8G D;  4DXW A;  4LLC A;  1HMD A;  2HV6 A;  2VC9 A;  3K7D A;  2QUP A;  4DOZ A;  1YDI A;  1J8Y F;  4EBK A;  1B68 A;  1HE1 A;  2L6G A;  4NTF A;  1BDJ B;  2P6V A;  3IQT A;  2Q9C A;  4MS2 A;  1G8X A;  1OKK A;  4PR9 A;  3EZH A;  1HE9 A;  256B A;  3JRT A;  4MTO A;  1SMY F;  2AP3 A;  5DVW A;  2ETS A;  4CS9 A;  2R7V A;  3CAX A;  5T3W A;  2Q7R A;  1YLM A;  1OKK D;  4LDK A;  3GM3 A;  1O5H A;  4YJW A;  2QNL A;  5F28 E;  1BR4 A;  2NPU A;  3LEV A;  2P0N A;  4EBB A;  5HSW A; 
#chains in the Genus database with same CATH homology
 1CGO A;  2XLD A;  3NMI A;  4N6H A;  4D4N A;  2XM4 A;  3ZTZ A;  3M15 A;  1E83 A;  5JSL A;  1CGN A;  3ZQY A;  2XL8 A;  3U8P A;  3C63 A;  3NMJ A;  3IQ6 A;  1QPU A;  5JS5 A;  3HNK A;  3HNI A;  4JEB A;  4JE9 A;  4D4X A;  1LM3 B;  1YZA A;  3TOM A;  3DE9 A;  2BC5 A;  2XLV A;  4JEA A;  1GQA A;  2XM0 A;  3FOO A;  5JLI A;  4EIY A;  5JT4 A;  4JKV A;  4CDV A;  3L1M A;  4WGY A;  2YLD A;  2XLE A;  5AGF A;  2YL3 A;  3QW1 A;  3HNL A;  4IAQ A;  4L6R A;  3ZTM A;  3M79 A;  1YYJ A;  2J9B A;  4U9D A;  4CJG A;  1BBH A;  3NMK A;  1JAF A;  2XLW A;  2YLI A;  1MQV A;  1CPR A;  3ZWI A;  3VRC A;  1A7V A;  3QVZ A;  2YL0 A;  2XLO A;  3FOP A;  2CCY A;  1EKY A;  1E85 A;  2J8W A;  4CX9 A;  1RCP A;  1APC A;  2YL7 A;  1NBB A;  1E84 A;  1S05 A;  3DE8 A;  4IB4 A;  3ZQV A;  4IAR A;  4N4W A;  5JP7 A;  4CJO A;  3M4B A;  5JRA A;  5JVE A;  1E86 A;  4CDA A;  2YKZ A;  4U9E A;  1QQ3 A;  3HNJ A;  2XLM A;  4CIP A;  3M4C A;  2XL6 A;  2XLH A;  3TOL A;  1YYX A;  2QLA A;  1YZC A;  5B3I A;  3IQ5 A;  4CDY A;  3QVY A;  4ER9 A;  3C62 A;  3QW0 A;  256B A;  2YLG A;  4NC3 A;  1M6T A;  5JUA A;  4ULV A;  2YL1 A;  4WGZ A;  1CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...