3NMPA

Crystal structure of the abscisic receptor pyl2 mutant a93f in complex with pyrabactin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
176
structure length
176
Chain Sequence
SEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPFSTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Identification and mechanism of ABA receptor antagonism.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone binding protein
total genus 48
structure length 176
sequence length 176
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nmpA00
3P9VA 3KDIA 4XRWA 2EJXA 2E3OA 3PUTA 2M89A 2M47A 3UJLA 3CNWA 3Q63A 2LCGA 5I9JA 3W9KA 1BV1A 2LGHA 3JRQB 4FPWA 4PSBA 2L8OA 1LN2A 2LE1A 2KTEA 3KDJA 4R7KA 3RT2A 1TXCA 1FM4A 4A85A 1EM2A 3KL1A 3KLXA 2I9YA 2GKDA 2LEQA 4A88A 4JHGA 5E4MA 4Z3LA 3ELIA 2LPXA 4A81A 3JRSA 1XN5A 2NN5A 4Q0KA 5AMWA 3TVRA 4LG5A 3NJ1A 3NMPA 4DSCA 2BK0A 4A86A 1UW5A 3TL1A 4GY9A 1E09A 2LIOA 2LF2A 3UIDA 4N0GC 2FFSA 2LUZA 3H3RA 3H3QA 4IH2A 3P0LA 3KAYA 2QIMA 2E3QA 5JO1A 3KAZA 2Z9ZA 3NJ0A 4A8GA 2N4AA 1LLTA 1TW0A 3Q64A 4REHA 4A8VA 3NMVA 3KB3A 4BTZA 3K90A 4JDLA 4OICA 3K3KA 5E46A 3NJOA 1IFVA 3KB0A 2E3RA 2VQ5A 3QN1A 4DS8A 4MNSA 1XUVA 4JDAA 4XRTA 3R6PA 3ZVUA 5E4DA 5E4BA 4LGAA 3OH8A 4IHRA 2Z9YA 4A84A 4B9RA 4DSBA 4LGBA 2E3SA 3RT0C 3NMNA 3GGNA 4A87A 2E3NA 4IGVA 4QIPA 3OJIA 3PU2A 4WVOA 1ZXFA 5JNNA 1B6FA 1BTVA 2R55A 3H3SA 5C9YA 2PSOA 4IGXA 3NMTA 4Y31A 4C9CA 3FO5A 3RD6A 2PCSA 2REZA 3W9RA 3TFZA 4JHHA 1LN3A 3IE5A 1H2OA 1Z94A 1KCMA 1X53A 2NS9A 3E85A 3NEFA 3TVQA 4A8UA 5JO2A 3NR4A 4RYVA 5BRLA 4BKCA 4C94A 2LAKA 3NEGA 3UQHA 3NI8A 4M9WA 1VJHA 2KF2A 2KCZA 2K5GA 2KEWA 3WG8A 4A83A 2LDKA 2E3MA 4M9BA 2L9PA 1ICXA 2L65A 2N4BA 5I8FA 3QSZA 4BK6A 3NS2A 2MOUA 4MAPA 3NMHA 1T17A 2Q3QA 2WQLA 3OQUA 3OTLA 2D4RA 1XN6A 3C0VA 4IH0A 1JSSA 3H3TA 4IGYA 1QMRA 3P51A 4BK7A 1XFSA 2FLHA 4A80A 4BKDA 1T27A 3Q6AA 2RESA 1FSKA 4REJA 2QPVA 2A1LA 4C9IA 4JHIA 3IJTA 4IGWA 1XDFA 4LA7A 2VNEA 2E3PA 4N3EA 3KDHA 2IL5A 2RERA 4MA6A 4REIA 3F08A 1LN1A 2K7HA
chains in the Genus database with same CATH superfamily
3P9VA 3KDIA 3GB4A 4XRWA 2EJXA 2E3OA 3PUTA 2M89A 2M47A 3UJLA 3CNWA 3Q63A 2LCGA 5I9JA 3W9KA 4N76A 1BV1A 2LGHA 3JRQB 4FPWA 4PSBA 2L8OA 4N47A 1LN2A 2LE1A 2KTEA 3KDJA 4R7KA 3RT2A 3DLHA 1TXCA 1FM4A 4A85A 1EM2A 3KL1A 3KLXA 2I9YA 2GKDA 2LEQA 4A88A 4JHGA 3GTEA 5E4MA 4Z3LA 3ELIA 2LPXA 4JHYA 4A81A 3JRSA 1XN5A 2NN5A 4Q0KA 5AMWA 3TVRA 4LG5A 3NJ1A 3NMPA 4DSCA 2BK0A 4A86A 1UW5A 3TL1A 4GY9A 1E09A 2LIOA 2LF2A 3UIDA 4N0GC 2FFSA 2LUZA 3H3RA 3H3QA 4IH2A 3GOBA 4N41A 3P0LA 3KAYA 2QIMA 2E3QA 5JO1A 3KAZA 2Z9ZA 3NJ0A 4A8GA 3F73A 2N4AA 3HM9A 1LLTA 1TW0A 3Q64A 4REHA 4A8VA 3NMVA 4QDFA 3KB3A 4BTZA 3K90A 4JDLA 4OICA 3K3KA 5E46A 3NJOA 1IFVA 3KB0A 2E3RA 2VQ5A 2YH6A 3QN1A 4DS8A 4MNSA 4KPYA 4NCBA 1XUVA 4JDAA 4XRTA 3R6PA 3ZVUA 5E4DA 3GTSA 4QDFB 4QDCA 4LGAA 5E4BA 2LAFA 3OH8A 4IHRA 2Z9YA 4A84A 4B9RA 4DSBA 4LGBA 2E3SA 3RT0C 3NMNA 3HXMA 3GGNA 4A87A 2E3NA 4IGVA 4E6FA 4QIPA 3GKEA 3OJIA 3PU2A 4WVOA 1ZXFA 3DLBA 5JNNA 3HO1A 1B6FA 1BTVA 2R55A 3H3SA 5C9YA 2PSOA 4IGXA 3NMTA 4Y31A 4C9CA 3HK2A 4NCAA 3FO5A 3RD6A 2ZYLA 2PCSA 2REZA 4QCKA 3W9RA 3TFZA 4JHHA 3GL2A 1LN3A 3IE5A 1H2OA 1Z94A 1KCMA 1X53A 2NS9A 3E85A 3NEFA 3TVQA 4A8UA 5JO2A 3HVRA 3NR4A 4RYVA 3TGOC 5BRLA 4BKCA 4C94A 2LAKA 3GL0A 3NEGA 3NI8A 3UQHA 4M9WA 1VJHA 2KF2A 2KCZA 2K5GA 2KEWA 4QDDA 3WG8A 4A83A 2LDKA 2E3MA 4M9BA 2L9PA 1ICXA 2L65A 2N4BA 5I8FA 3QSZA 4BK6A 3NS2A 2MOUA 4MAPA 3NMHA 1T17A 2Q3QA 2WQLA 3OQUA 3OTLA 2D4RA 5EKQC 1XN6A 3C0VA 4IH0A 1JSSA 3H3TA 4IGYA 1QMRA 3P51A 4BK7A 1XFSA 2FLHA 4A80A 4BKDA 1T27A 3Q6AA 2RESA 1FSKA 4REJA 2QPVA 2A1LA 4C9IA 4JHIA 3IJTA 4IGWA 1XDFA 4LA7A 2VNEA 2E3PA 4N3EA 3KDHA 2IL5A 2RERA 3NQNA 4MA6A 3F08A 4REIA 3HJFA 1LN1A 2K7HA
chains in the Genus database with same CATH topology
3P9VA 3KDIA 3GB4A 4XRWA 2EJXA 2E3OA 3PUTA 2M89A 2M47A 3UJLA 3CNWA 3Q63A 2LCGA 5I9JA 3W9KA 4N76A 1BV1A 2LGHA 3JRQB 4FPWA 4PSBA 2L8OA 4N47A 1LN2A 2LE1A 2KTEA 3KDJA 4R7KA 3RT2A 3DLHA 1TXCA 1FM4A 4A85A 1EM2A 3KL1A 3KLXA 2I9YA 2GKDA 2LEQA 4A88A 4JHGA 3GTEA 5E4MA 4Z3LA 3ELIA 2LPXA 4JHYA 4A81A 3JRSA 1XN5A 2NN5A 4Q0KA 5AMWA 3TVRA 4LG5A 3NJ1A 3NMPA 4DSCA 2BK0A 4A86A 1UW5A 3TL1A 4GY9A 1E09A 2LIOA 2LF2A 3UIDA 4N0GC 2FFSA 2LUZA 3H3RA 3H3QA 4IH2A 3GOBA 4N41A 3P0LA 3KAYA 2QIMA 2E3QA 5JO1A 3KAZA 2Z9ZA 3NJ0A 4A8GA 3F73A 2N4AA 3HM9A 1LLTA 1TW0A 3Q64A 4REHA 4A8VA 3NMVA 4QDFA 3KB3A 4BTZA 3K90A 4JDLA 4OICA 3K3KA 5E46A 3NJOA 1IFVA 3KB0A 2E3RA 2VQ5A 2YH6A 3QN1A 4DS8A 4MNSA 4KPYA 4NCBA 1XUVA 4JDAA 4XRTA 3R6PA 3ZVUA 5E4DA 3GTSA 4QDFB 4QDCA 4LGAA 5E4BA 2LAFA 3OH8A 4IHRA 2Z9YA 4A84A 4B9RA 4DSBA 4LGBA 2E3SA 3RT0C 3NMNA 3HXMA 3GGNA 4A87A 2E3NA 4IGVA 4E6FA 4QIPA 3GKEA 3OJIA 3PU2A 4WVOA 1ZXFA 3DLBA 5JNNA 3HO1A 1B6FA 1BTVA 2R55A 3H3SA 5C9YA 2PSOA 4IGXA 3NMTA 4Y31A 4C9CA 3HK2A 4NCAA 3FO5A 3RD6A 2ZYLA 2PCSA 2REZA 4QCKA 3W9RA 3TFZA 4JHHA 3GL2A 1LN3A 3IE5A 1H2OA 1Z94A 1KCMA 1X53A 2NS9A 3E85A 3NEFA 3TVQA 4A8UA 5JO2A 3HVRA 3NR4A 4RYVA 3TGOC 5BRLA 4BKCA 4C94A 2LAKA 3GL0A 3NEGA 3NI8A 3UQHA 4M9WA 1VJHA 2KF2A 2KCZA 2K5GA 2KEWA 4QDDA 3WG8A 4A83A 2LDKA 2E3MA 4M9BA 2L9PA 1ICXA 2L65A 2N4BA 5I8FA 3QSZA 4BK6A 3NS2A 2MOUA 4MAPA 3NMHA 1T17A 2Q3QA 2WQLA 3OQUA 3OTLA 2D4RA 5EKQC 1XN6A 3C0VA 4IH0A 1JSSA 3H3TA 4IGYA 1QMRA 3P51A 4BK7A 1XFSA 2FLHA 4A80A 4BKDA 1T27A 3Q6AA 2RESA 1FSKA 4REJA 2QPVA 2A1LA 4C9IA 4JHIA 3IJTA 4IGWA 1XDFA 4LA7A 2VNEA 2E3PA 4N3EA 3KDHA 2IL5A 2RERA 3NQNA 4MA6A 3F08A 4REIA 3HJFA 1LN1A 2K7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9V A;  3KDI A;  4XRW A;  2EJX A;  2E3O A;  3PUT A;  2M89 A;  2M47 A;  3UJL A;  3CNW A;  3Q63 A;  2LCG A;  5I9J A;  3W9K A;  1BV1 A;  2LGH A;  3JRQ B;  4FPW A;  4PSB A;  2L8O A;  1LN2 A;  2LE1 A;  2KTE A;  3KDJ A;  4R7K A;  3RT2 A;  1TXC A;  1FM4 A;  4A85 A;  1EM2 A;  3KL1 A;  3KLX A;  2I9Y A;  2GKD A;  2LEQ A;  4A88 A;  4JHG A;  5E4M A;  4Z3L A;  3ELI A;  2LPX A;  4A81 A;  3JRS A;  1XN5 A;  2NN5 A;  4Q0K A;  5AMW A;  3TVR A;  4LG5 A;  3NJ1 A;  3NMP A;  4DSC A;  2BK0 A;  4A86 A;  1UW5 A;  3TL1 A;  4GY9 A;  1E09 A;  2LIO A;  2LF2 A;  3UID A;  4N0G C;  2FFS A;  2LUZ A;  3H3R A;  3H3Q A;  4IH2 A;  3P0L A;  3KAY A;  2QIM A;  2E3Q A;  5JO1 A;  3KAZ A;  2Z9Z A;  3NJ0 A;  4A8G A;  2N4A A;  1LLT A;  1TW0 A;  3Q64 A;  4REH A;  4A8V A;  3NMV A;  3KB3 A;  4BTZ A;  3K90 A;  4JDL A;  4OIC A;  3K3K A;  5E46 A;  3NJO A;  1IFV A;  3KB0 A;  2E3R A;  2VQ5 A;  3QN1 A;  4DS8 A;  4MNS A;  1XUV A;  4JDA A;  4XRT A;  3R6P A;  3ZVU A;  5E4D A;  5E4B A;  4LGA A;  3OH8 A;  4IHR A;  2Z9Y A;  4A84 A;  4B9R A;  4DSB A;  4LGB A;  2E3S A;  3RT0 C;  3NMN A;  3GGN A;  4A87 A;  2E3N A;  4IGV A;  4QIP A;  3OJI A;  3PU2 A;  4WVO A;  1ZXF A;  5JNN A;  1B6F A;  1BTV A;  2R55 A;  3H3S A;  5C9Y A;  2PSO A;  4IGX A;  3NMT A;  4Y31 A;  4C9C A;  3FO5 A;  3RD6 A;  2PCS A;  2REZ A;  3W9R A;  3TFZ A;  4JHH A;  1LN3 A;  3IE5 A;  1H2O A;  1Z94 A;  1KCM A;  1X53 A;  2NS9 A;  3E85 A;  3NEF A;  3TVQ A;  4A8U A;  5JO2 A;  3NR4 A;  4RYV A;  5BRL A;  4BKC A;  4C94 A;  2LAK A;  3NEG A;  3UQH A;  3NI8 A;  4M9W A;  1VJH A;  2KF2 A;  2KCZ A;  2K5G A;  2KEW A;  3WG8 A;  4A83 A;  2LDK A;  2E3M A;  4M9B A;  2L9P A;  1ICX A;  2L65 A;  2N4B A;  5I8F A;  3QSZ A;  4BK6 A;  3NS2 A;  2MOU A;  4MAP A;  3NMH A;  1T17 A;  2Q3Q A;  2WQL A;  3OQU A;  3OTL A;  2D4R A;  1XN6 A;  3C0V A;  4IH0 A;  1JSS A;  3H3T A;  4IGY A;  1QMR A;  3P51 A;  4BK7 A;  1XFS A;  2FLH A;  4A80 A;  4BKD A;  1T27 A;  3Q6A A;  2RES A;  1FSK A;  4REJ A;  2QPV A;  2A1L A;  4C9I A;  4JHI A;  3IJT A;  4IGW A;  1XDF A;  4LA7 A;  2VNE A;  2E3P A;  4N3E A;  3KDH A;  2IL5 A;  2RER A;  4MA6 A;  4REI A;  3F08 A;  1LN1 A;  2K7H A; 
#chains in the Genus database with same CATH topology
 3P9V A;  3KDI A;  3GB4 A;  4XRW A;  2EJX A;  2E3O A;  3PUT A;  2M89 A;  2M47 A;  3UJL A;  3CNW A;  3Q63 A;  2LCG A;  5I9J A;  3W9K A;  4N76 A;  1BV1 A;  2LGH A;  3JRQ B;  4FPW A;  4PSB A;  2L8O A;  4N47 A;  1LN2 A;  2LE1 A;  2KTE A;  3KDJ A;  4R7K A;  3RT2 A;  3DLH A;  1TXC A;  1FM4 A;  4A85 A;  1EM2 A;  3KL1 A;  3KLX A;  2I9Y A;  2GKD A;  2LEQ A;  4A88 A;  4JHG A;  3GTE A;  5E4M A;  4Z3L A;  3ELI A;  2LPX A;  4JHY A;  4A81 A;  3JRS A;  1XN5 A;  2NN5 A;  4Q0K A;  5AMW A;  3TVR A;  4LG5 A;  3NJ1 A;  3NMP A;  4DSC A;  2BK0 A;  4A86 A;  1UW5 A;  3TL1 A;  4GY9 A;  1E09 A;  2LIO A;  2LF2 A;  3UID A;  4N0G C;  2FFS A;  2LUZ A;  3H3R A;  3H3Q A;  4IH2 A;  3GOB A;  4N41 A;  3P0L A;  3KAY A;  2QIM A;  2E3Q A;  5JO1 A;  3KAZ A;  2Z9Z A;  3NJ0 A;  4A8G A;  3F73 A;  2N4A A;  3HM9 A;  1LLT A;  1TW0 A;  3Q64 A;  4REH A;  4A8V A;  3NMV A;  4QDF A;  3KB3 A;  4BTZ A;  3K90 A;  4JDL A;  4OIC A;  3K3K A;  5E46 A;  3NJO A;  1IFV A;  3KB0 A;  2E3R A;  2VQ5 A;  2YH6 A;  3QN1 A;  4DS8 A;  4MNS A;  4KPY A;  4NCB A;  1XUV A;  4JDA A;  4XRT A;  3R6P A;  3ZVU A;  5E4D A;  3GTS A;  4QDF B;  4QDC A;  4LGA A;  5E4B A;  2LAF A;  3OH8 A;  4IHR A;  2Z9Y A;  4A84 A;  4B9R A;  4DSB A;  4LGB A;  2E3S A;  3RT0 C;  3NMN A;  3HXM A;  3GGN A;  4A87 A;  2E3N A;  4IGV A;  4E6F A;  4QIP A;  3GKE A;  3OJI A;  3PU2 A;  4WVO A;  1ZXF A;  3DLB A;  5JNN A;  3HO1 A;  1B6F A;  1BTV A;  2R55 A;  3H3S A;  5C9Y A;  2PSO A;  4IGX A;  3NMT A;  4Y31 A;  4C9C A;  3HK2 A;  4NCA A;  3FO5 A;  3RD6 A;  2ZYL A;  2PCS A;  2REZ A;  4QCK A;  3W9R A;  3TFZ A;  4JHH A;  3GL2 A;  1LN3 A;  3IE5 A;  1H2O A;  1Z94 A;  1KCM A;  1X53 A;  2NS9 A;  3E85 A;  3NEF A;  3TVQ A;  4A8U A;  5JO2 A;  3HVR A;  3NR4 A;  4RYV A;  3TGO C;  5BRL A;  4BKC A;  4C94 A;  2LAK A;  3GL0 A;  3NEG A;  3NI8 A;  3UQH A;  4M9W A;  1VJH A;  2KF2 A;  2KCZ A;  2K5G A;  2KEW A;  4QDD A;  3WG8 A;  4A83 A;  2LDK A;  2E3M A;  4M9B A;  2L9P A;  1ICX A;  2L65 A;  2N4B A;  5I8F A;  3QSZ A;  4BK6 A;  3NS2 A;  2MOU A;  4MAP A;  3NMH A;  1T17 A;  2Q3Q A;  2WQL A;  3OQU A;  3OTL A;  2D4R A;  5EKQ C;  1XN6 A;  3C0V A;  4IH0 A;  1JSS A;  3H3T A;  4IGY A;  1QMR A;  3P51 A;  4BK7 A;  1XFS A;  2FLH A;  4A80 A;  4BKD A;  1T27 A;  3Q6A A;  2RES A;  1FSK A;  4REJ A;  2QPV A;  2A1L A;  4C9I A;  4JHI A;  3IJT A;  4IGW A;  1XDF A;  4LA7 A;  2VNE A;  2E3P A;  4N3E A;  3KDH A;  2IL5 A;  2RER A;  3NQN A;  4MA6 A;  3F08 A;  4REI A;  3HJF A;  1LN1 A;  2K7H A; 
#chains in the Genus database with same CATH homology
 3P9V A;  3KDI A;  3GB4 A;  4XRW A;  2EJX A;  2E3O A;  3PUT A;  2M89 A;  2M47 A;  3UJL A;  3CNW A;  3Q63 A;  2LCG A;  5I9J A;  3W9K A;  4N76 A;  1BV1 A;  2LGH A;  3JRQ B;  4FPW A;  4PSB A;  2L8O A;  4N47 A;  1LN2 A;  2LE1 A;  2KTE A;  3KDJ A;  4R7K A;  3RT2 A;  3DLH A;  1TXC A;  1FM4 A;  4A85 A;  1EM2 A;  3KL1 A;  3KLX A;  2I9Y A;  2GKD A;  2LEQ A;  4A88 A;  4JHG A;  3GTE A;  5E4M A;  4Z3L A;  3ELI A;  2LPX A;  4JHY A;  4A81 A;  3JRS A;  1XN5 A;  2NN5 A;  4Q0K A;  5AMW A;  3TVR A;  4LG5 A;  3NJ1 A;  3NMP A;  4DSC A;  2BK0 A;  4A86 A;  1UW5 A;  3TL1 A;  4GY9 A;  1E09 A;  2LIO A;  2LF2 A;  3UID A;  4N0G C;  2FFS A;  2LUZ A;  3H3R A;  3H3Q A;  4IH2 A;  3GOB A;  4N41 A;  3P0L A;  3KAY A;  2QIM A;  2E3Q A;  5JO1 A;  3KAZ A;  2Z9Z A;  3NJ0 A;  4A8G A;  3F73 A;  2N4A A;  3HM9 A;  1LLT A;  1TW0 A;  3Q64 A;  4REH A;  4A8V A;  3NMV A;  4QDF A;  3KB3 A;  4BTZ A;  3K90 A;  4JDL A;  4OIC A;  3K3K A;  5E46 A;  3NJO A;  1IFV A;  3KB0 A;  2E3R A;  2VQ5 A;  2YH6 A;  3QN1 A;  4DS8 A;  4MNS A;  4KPY A;  4NCB A;  1XUV A;  4JDA A;  4XRT A;  3R6P A;  3ZVU A;  5E4D A;  3GTS A;  4QDF B;  4QDC A;  4LGA A;  5E4B A;  2LAF A;  3OH8 A;  4IHR A;  2Z9Y A;  4A84 A;  4B9R A;  4DSB A;  4LGB A;  2E3S A;  3RT0 C;  3NMN A;  3HXM A;  3GGN A;  4A87 A;  2E3N A;  4IGV A;  4E6F A;  4QIP A;  3GKE A;  3OJI A;  3PU2 A;  4WVO A;  1ZXF A;  3DLB A;  5JNN A;  3HO1 A;  1B6F A;  1BTV A;  2R55 A;  3H3S A;  5C9Y A;  2PSO A;  4IGX A;  3NMT A;  4Y31 A;  4C9C A;  3HK2 A;  4NCA A;  3FO5 A;  3RD6 A;  2ZYL A;  2PCS A;  2REZ A;  4QCK A;  3W9R A;  3TFZ A;  4JHH A;  3GL2 A;  1LN3 A;  3IE5 A;  1H2O A;  1Z94 A;  1KCM A;  1X53 A;  2NS9 A;  3E85 A;  3NEF A;  3TVQ A;  4A8U A;  5JO2 A;  3HVR A;  3NR4 A;  4RYV A;  3TGO C;  5BRL A;  4BKC A;  4C94 A;  2LAK A;  3GL0 A;  3NEG A;  3NI8 A;  3UQH A;  4M9W A;  1VJH A;  2KF2 A;  2KCZ A;  2K5G A;  2KEW A;  4QDD A;  3WG8 A;  4A83 A;  2LDK A;  2E3M A;  4M9B A;  2L9P A;  1ICX A;  2L65 A;  2N4B A;  5I8F A;  3QSZ A;  4BK6 A;  3NS2 A;  2MOU A;  4MAP A;  3NMH A;  1T17 A;  2Q3Q A;  2WQL A;  3OQU A;  3OTL A;  2D4R A;  5EKQ C;  1XN6 A;  3C0V A;  4IH0 A;  1JSS A;  3H3T A;  4IGY A;  1QMR A;  3P51 A;  4BK7 A;  1XFS A;  2FLH A;  4A80 A;  4BKD A;  1T27 A;  3Q6A A;  2RES A;  1FSK A;  4REJ A;  2QPV A;  2A1L A;  4C9I A;  4JHI A;  3IJT A;  4IGW A;  1XDF A;  4LA7 A;  2VNE A;  2E3P A;  4N3E A;  3KDH A;  2IL5 A;  2RER A;  3NQN A;  4MA6 A;  3F08 A;  4REI A;  3HJF A;  1LN1 A;  2K7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...