3NMRA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords CUGBP Elav-like family member 1
total genus 35
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nmrA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nmrA02
2DNLA 2FC9A 4FXWA 2KRRA 2DGTA 4UQTA 1B7FA 3ULHA 2DISA 1WF1A 3CC2S 1UW4A 2EVZA 2KYXA 3UWTA 1U6BA 2I2YA 2LEBA 1U1QA 2KT5A 2MXYA 2XS2A 2DIVA 3S7RA 2MB0B 3CMES 2DNOA 2CQHA 2GHPA 3VAFA 1D8ZA 2DNZA 2SXLA 2MY7A 2DK2A 2CPJA 2KXFA 3JB9k 1OWXA 1Q86T 2FC8A 4EGLA 2DHGA 3MUMP 4WFAQ 1VQNS 1WG1A 1DRZA 2L41A 1O0PA 2LCWA 4V19X 1KQSR 2N82B 3J7ZT 3UCZP 1X4GA 2KG1A 1K8AT 2G4BA 2F3JA 3US5A 4IOCQ 5D77A 1CVJA 2MQNA 2HGMA 1FO1A 1M5VC 2CPZA 1UFWA 4QU6A 2BZ2A 3TO8A 4YOEA 2FPHX 2KHCA 3VAHA 2X1BA 2E5IA 4Y0FA 3Q2SC 4P6QA 2DNKA 2DNPA 2EK6A 2AD9A 2E5HA 1X4FA 5DM6Q 4ED5A 2X1GA 2KVIA 1WHYA 3CCJS 3CCSS 2QEXS 5LJ3Y 2CPYA 3EGNA 2RU3A 1DZ5A 1IQTA 5JVGQ 1FJ7A 3CF5Q 1JJHA 3EX7B 3P5TL 3MDFA 2CPHA 1H2UX 2DNYA 2DGSA 1SJ4P 2LKZA 1Q81T 2LMIA 3SDEA 1X5TA 5CYJA 1WEZA 1FJEB 1PGZA 2KG0A 4F26A 1VC0A 1FJCA 2M88A 3U1MA 4BS2A 2CQCA 2U2FA 1FNXH 1AUDA 1WHXA 2F9DA 3P3DA 2CPDA 2MMYA 2HGLA 1QVFR 3S01A 2MZTA 4TU7A 3VAIA 2MZQA 2AYMA 2LQ5A 5HO4A 2L9WA 3THPA 3UCGA 1SJRA 3NS5A 2KXNB 1PO6A 3MOJB 3S8SA 2MZRA 2DH7A 4IUFA 1VQ7S 4OZ1A 1WG4A 1XN9A 2MQQA 1WF2A 2AYBA 4YB1P 1H6KX 5CXTA 2J8AA 2KU7A 1X5OA 4YUDA 2LYVA 5LXRA 4WFNQ 5DETA 4WCEQ 3CXCR 1YJ9S 2MKHA 1M5OC 2OIHA 3UCUP 3BO4A 2NZ4A 1WWHA 3CC4S 2CQ2A 2DO0A 1X4HA 2HGNA 3LQVA 1X5PA 2LXUA 5DDRC 4U67Q 2E5JA 3THTA 1HD1A 3L3CA 2DHAA 2MPUA 2MQOA 2OSQA 2KH9A 4WKRA 1F9FA 5IFMA 2AYEA 1VQPS 1YITS 4LMZA 3U1LA 5IM0B 1HL6A 3CCQS 5LXYA 2A3JA 2LECA 1FT8A 1WHWA 3BEGB 3VF0B 3EGZA 1U1RA 1Q82T 5IQQA 1OPIA 2CQ0A 3H2UB 2ADCA 1RK8A 4A8XA 3VAJA 1WF0A 1NJIT 1W2BR 1FHTA 1VQ9S 1VBYA 2WBRA 2MJUA 2J0SD 2M7SA 3TP2A 1M1KT 2D9OA 2JVRA 1QM9A 2CJKA 2XNRA 2DNGA 2DGXA 1KOOA 2RUGA 1N8RT 2VOOA 4UY8T 2DH9A 2M0GB 1SJQA 1WG5A 2Q79A 3P6YC 2MYFA 4ERDA 5D78A 4QQBA 1K73T 2OTJS 3J7YU 4F25A 1RKJA 2RVJA 4PRFA 5DDPC 2OSRA 2MGZA 2J76E 3NNAA 1VQMS 1KC8T 2MKSA 1URNA 1NO8A 5H1SV 2D3OR 2BOPA 3CMAS 2CQ3A 4WFBQ 4ZKAA 1VQKS 2ADBA 1X5SA 2DH8A 5DDOC 2YH0A 4CIOA 2GO9A 2RS8A 1X0FA 1M5KC 4J5OA 1U1PA 4W90B 2V94A 3HI9A 2EK1A 3MXHP 2LA4A 4CH1A 1G2EA 2YTCA 2FY1A 5GAHU 2DNNA 3VAMA 5FJ4A 2MKCA 3CCES 2E5GA 3G6ES 2RRBA 4WF9Q 4IO9Q 1N52B 2LA6A 1A7GE 3IRWP 1YTYA 2HVZA 2J0QD 2RT3A 2KM8B 1D9AA 2KI2A 4LIRA 3CCLS 3ZZZA 2KRBA 1L3KA 5ITHA 1A9NB 1YJWS 2DGVA 1WI8A 5LSOA 2X1FA 3BS9A 3DLLQ 1ZZFA 2VONA 3V4MA 3CCVS 1SXLA 2M52A 1S72S 1VQ6S 5CA5A 3NNCA 2AYGA 2N3OA 3I55S 5GVQA 1WELA 2KN4A 3B4MA 1X4BA 2DNMA 1U1LA 3MUTP 2MQMA 2M4MA 1VQOS 2YH1A 2YWKA 3FEXB 5LSLA 5JVHQ 1YI2S 1VC5A 3CCMS 2X1AA 3CC7S 3UE2A 3UD4P 2M8DB 3K0JA 2O3DA 1UAWA 4QPTA 3PIOQ 2OTLS 3G8TA 1WI6A 2NLWA 2XSFA 2KM8C 4TU8A 2DITA 2K3KA 2CQBA 1X4CA 3MI7X 5LJ5Y 2ERRA 2KXHA 1N88A 2CQ4A 3SXLA 2XS5A 2DHSA 3FEYB 4LJMA 3D2WA 2UP1A 2ZJRQ 2XNQA 5MLCV 3I56S 2MSTA 1JMTA 1WEXA 2DGOA 2DNQA 2JRSA 3MURP 3LPYA 3G4SS 3VALA 4M5DB 3NNHA 3VAKA 4W92B 1OO0B 3BO2A 2M9KA 3CTRA 1DHMA 3DXBA 2MY8A 2PE8A 1ZZNA 2OJ3A 4OZ0A 2CPXA 1VBXA 2MKKA 2DGWA 2MZJA 1KD1T 5GAGU 1VQ4S 1VQ8S 3OW2R 3R1HA 2N7CA 1P1TA 3BO3A 1M5PC 2JX2A 2MQLA 1SJ3P 2F9JA 4PKDB 2CQGA 2DGUA 2RQ4A 1VC6A 2HZCA 3G8SA 3P49B 1R8HA 3SDEB 1U6FA 2MQPA 2M70A 4RU2A 1H2VZ 2XS7A 2DHXA 3R27A 5HL7Q 3B4DA 4FXVA 2MZSA 1NU4A 5GAEU 2E44A 2FHOB 2KFYA 2MSSA 2CQ1A 1U1KA 4PR6A 4WIIA 3G96A 1VQ5S 2ZJPQ 1YIJS 2M2BA 4IOAQ 1VQLS 3NS6A 1X4EA 5DDQC 1K9MT 3TYTA 2DIUA 3NMRA 1HA1A 4C7QA 3CPWR 2RQCA 2PEHA 2CQPA 2LEAA 1JJ2R 1KOHA 3CD6S 1H2TZ 2G0CA 3UD3P 2I38A 4C0OC 3S6EA 1X4AA 5DM7Q 2U1AA 2JVOA 2CQIA 3Q2TC 2G1DA 1YJNS 1U1OA 5EN1A 3N9UC 1M90T 4F02A 4Y00A 2XB2D 4CH0S 4CQ1A 1DBDA 4TU9A 3HHNB 2RS2A 3VAGA 3MUVP 2QFJA 3SMZA 5IM0A 3PIPQ 1Q7YT 3MD1A 2N3LA 1WEYA 2ZJQQ 1U2FA 2HYIB 2CPIA 2K8GA 2VODA 3G9CA 1BY9A 2CQDA 1UP1A 3CCUS 2YKAA 2CPEA 2JWNA 2DGQA 2MHNA 1YWXA 3CCRS 1S79A 1QVGR 1ZH5A 4C4WA 1WHVA 3R1LA 3CUNA 5GMKa 1HD0A 4QU7A 3RW7A 1P27B 2RRAA 3IWNC 2DNRA 1OIAA 2D9PA 3MD3A 1X4DA 1U1NA 2B0GA 1WTBA 1JJ4A 3RW6A 2QA4S 2DO4A 3H2VE 5BJRA 2VOPA 2MKIA 2RNEA 3CULA 1U1MA 4Z2XA 2DNHA 2L08A 3G71S 1YHQS 2MZ1A 2MGZB 4TLQA 1R8PA 1N54B 2CPFA 2MKJA 2MJNA 2M8HA 5GADU 2DB1A 1SJFA 1VBZA 1FXLA 3ZZYA 2LXIA
chains in the Genus database with same CATH superfamily
3PXGa 1T11A 2DNLA 4ZJLA 5I3UB 4ECUA 2HEKA 4LF2A 5K8OA 1FKOA 1C1CB 2ZDOA 2R4FA 1REVA 3ULHA 2DISA 1WF1A 4JYAF 1VISA 3QATA 3M8PB 3QLHB 3PZPA 1F60B 2EVZA 1R0BG 1F5BA 3I0SA 5L9NA 2OP5A 2X7IA 3PNIA 4KR0B 1NPPA 4IQXA 1D09B 4D3HA 1OSDA 3PYDA 3JSMB 3D0IE 2LEBA 3BKTA 4DJBA 2MXYA 1VR6A 4HT7A 5THWA 2DIVA 3DRRA 3MM6A 4NCGA 3S7RA 2AEMA 2V2ZA 4BWJA 5KT6A 1VRUB 1WACA 4TXSA 2GHPA 1LW0B 2AJQA 3R5BA 2NCKL 1D8ZA 1TR0A 1R89A 3C15A 4RW8B 1C4AA 3GIIA 2B9YA 1HNZJ 3T9NA 5KFDA 3GIKA 3JB9k 1OWXA 5CQGA 4G65A 3JSMA 1CJUB 3RJMB 2G13A 2N7YA 2DHGA 3T5HA 2HHQA 1HMVA 1WG1A 1YSJA 1RLDA 2VHGA 4Q0BB 4RJVA 4FKYA 3R5CA 1KQSR 4I7FB 2N82B 3J7ZT 4IFYA 3HKZD 1D8YA 1RTZA 4WZMA 1DLOB 2DCUB 1VLYA 3BREA 2PN6A 1HNIB 3M8ZA 1JKHB 4U8YA 3TX8A 4RUAA 3BH6B 2YWHA 2Z30B 1LFPA 2V4RA 4DPTA 5D77A 4Y34A 2HGMA 1V6HA 1M5VC 2CPZA 4Q45A 3RR7A 1JLEA 1UFWA 7FD1A 3R6GB 1NHKL 3KHGA 3FVYA 4FN5A 1G6BA 2ZITA 4MK7A 1U02A 3IRXB 3PKYA 2WONB 2XWYA 3I31A 1NSPA 2KHCA 3Q22A 2LEPA 4B9NA 2H4YB 4IDKA 2JOQA 3MZIA 5L8RC 2HZAA 4CLYA 4O0IA 1RCXB 2X1BA 3NS7B 3VWSA 4DUYJ 1XR7A 3Q2SC 4GO7X 1MU2B 1YBTA 1VHFA 1K47A 5CCLA 3RB4A 5IT0A 4ITSA 1XK8A 4KIAA 4YB6A 4ZVPB 1JLBB 3GFHA 3DLEB 4WFZA 1S1UB 2Y0BB 2KVIA 1WHYA 3A8JA 3CJ2A 4PAAA 3CCSS 2HIQA 3EGNA 1HQEB 5A6WA 3UVJA 3ZZ0A 1AXQA 4DV4J 1H3DA 1U0HA 4HT5A 3TZXA 1FJ7A 4KFBA 4NLYA 5ETVA 4DU7A 3EPIA 1JJHA 2EG2A 2ZWOA 3CF5Q 1ZS6A 4K4WA 4X66J 2HHXA 4I69A 3PRVA 2IM1A 3CDWA 2HAFA 1K1QA 1H2UX 2V67A 5CHCB 3UW1A 3VV2B 3RAQA 1DTTB 5CYMB 5J1EA 1S12A 3HSDA 4K50A 1X5TA 4OQJA 3RRGA 4NLSA 4J9UE 4ES2A 3OFFA 5B0BA 2YKPA 3BN7A 4PYDA 3KK3A 2QA4G 3MECA 2FLPA 4F2RA 1E6YB 1SH0A 2KG0A 1F3VA 1QAJA 3GYGA 3DLBA 1SH3A 2GIQA 1F9EB 3EM1A 4OJGA 1UVLA 3PV8A 4BS2A 1NK9A 3GZ7A 4C48A 2WSEC 5CYQB 1WC5A 2BEFA 3B54A 1Q8KA 3BGRB 2L48A 1NSKL 4WP8A 4HACA 3OR1B 3QIPB 3EVOA 3WIVA 3P3DA 5G4DA 1T9YA 3JYTA 4H4KA 2HGLA 4YHHF 1QVFR 1HBNB 4JP8A 3S01A 1NSQA 1JX4A 3CMQA 2OELA 2WRMA 3I9ZA 4G6VB 4JI4J 1SJRA 4I4BA 3D6HB 2WB4A 1GXLA 3IR6B 4K2JA 4U6PA 2B7BB 4URQU 1I51B 2DH7A 4IUFA 1F5AA 1N5TA 2YX7A 3KHHA 2RSQA 2MQQA 1XN9A 2A6MA 1NKEA 2FLNA 4DV5F 4E0DA 4ELUA 4HTJA 4H4KC 3KK1A 1WF2A 3R5JB 3PYFA 2G0IA 4TN2A 2EFOA 4YB1P 2GA7A 4ZITA 3CSKA 2OPQA 3M1VB 4ANDA 3T1YJ 1RHKB 1PJ7A 2AZ1A 2B8PA 1KHWA 1QSSA 5DETA 4WCEQ 2I0XA 2ZVSA 3D7SB 4CLKA 2GMJA 3BO4A 2XBPA 1WWHA 4LSNA 2ZD1B 2ZHBA 3GV5B 2R7WA 3QWUA 1X4HA 3NBPA 3CDBA 4QWDA 1FEEA 3MM7B 2I1RA 2CFXA 1VBKA 2HRYA 1UWAA 1P1LA 3H59A 2MPUA 5A8RB 2YNIB 3VQSA 4EFAC 5J2MB 1HNVA 3IBFB 4MTPA 1ZBTA 1MMNA 2HURA 4USWA 4WK1A 2AYEA 1Y3JA 2YWEA 1Y5IB 3D6FB 3M6XA 3NGUA 4DXLA 3CJSA 1VQPS 2R8JA 2V4QA 1HPZA 4ILRA 3NOCA 2AGOA 4R5PA 3AB2B 1LK7A 4DU8A 5KFBA 4ED0A 4MFBA 1S6PA 3A1YG 1M5HA 3IAS9 2D69A 1WHWA 2EPIA 2JL9A 3HCXA 3HLUA 3M2VB 2V8DA 1S9EB 1RWMB 3QBCA 4KGZB 1GH8A 3RTVA 1IJFB 2VA3A 1PKUA 5IQQA 2RF2B 2NXUA 2ZOGA 3LPEA 2CQ0A 5T7LA 3DDNA 2CNLB 1TK5A 4LF4F 1HWKA 3RBDA 2GGPB 4A8XA 2FJVA 4DR2J 5IWAF 1I5OB 3A8KA 2FGCA 3BKFA 3HSZA 1FCAA 1UJ4A 4Y28C 3ZO7A 1NM2A 2WBRA 4AUKA 4N7TA 1VMBA 4ZDNA 5A76A 2R2RA 3E2EA 1LWFA 2R7OA 3AJ2A 2XG8A 1Q8BA 1RCOB 2D3ZA 4L73A 2JVRA 1QM9A 4OV6A 2VF3A 3UQSA 2W9AA 3TZZA 3OSPA 1N34F 3PX4A 1AW0A 2E7VA 1FK9B 1NSAA 2DNGA 3OVAA 2W8KA 4A8KA 3LAMA 3N6MA 1HBMB 4LFCF 2E7XA 3CWJA 3H4DA 2QMUB 4HH1A 4AXJA 3J7A1 1R8CA 4TY8B 3IO1A 4HDGA 3C66A 2BJ1A 1GXUA 1ZAVA 2RKIA 2WOMA 2BX6A 1RABB 3CD0A 4KY3A 3NLCA 3UNYA 5GMKa 4M5JA 3P6YC 1AUSL 5J1NA 2FQQB 2MYFA 3OXFA 2LDYA 2AGQA 5ETOA 1K73T 4DSKA 4FYDA 1RJJA 3ISNC 3OVSA 4XAKA 2OTJS 5F0UA 4FNIA 1MROB 4F25A 2IIHA 4WTOB 1ZTWA 4B3OA 1BUXA 2VH7A 5DDPC 4PRFA 1LWEB 4G3IA 2MGZA 4USKA 2BQ3A 2DKOB 4JUZA 1UVMA 1JLFB 4M94A 1VQMS 1RYRA 1S0VA 3QRQA 4NLXA 1IKVA 1NO8A 2BJ3A 5KG3A 2AQ4A 4LF7J 1LW2B 5LSRA 5T14A 1QTNB 3O3LA 3QAUA 1RT4A 3IBCB 3GTYX 2ADBA 1NJZA 2V0NA 5C42B 1IJEB 4CIOA 1GX5A 2GO9A 2HNDB 2I5JB 1O8BA 4WJBA 4OX9F 2XQCA 1X0FA 3ZTOA 1U1PA 1MW7A 1Q7LB 2A2DA 1J2VA 4KO0A 1FDAA 3HI9A 3RZAA 2GMHA 3MXHP 3GILA 2LA4A 2VBXA 2H54B 4BDPA 4NCAA 1R6YA 3NAIA 3F0NA 2R9LA 3AD8C 2E29A 3JQJA 5GAHU 2RIJA 4NI2A 2MKCA 3EYZA 3CCES 1D1UA 3UN5A 2BV3A 5FJ4A 2E1PA 4O4RA 4ZVFA 4Q44A 2LA6A 3KKFA 1TVRB 3SCLE 3ZTPA 3NMAA 3DOMA 3P8BB 1BE4A 2BKNA 2YXLA 4Q5VA 4UUXA 5J2QA 4I67A 1BWVA 1GAOA 2ALZA 3KMSA 2HVZA 3H5YA 2RT3A 4X4SA 1RYSA 2OLWA 2RE1A 4BC7A 2VQEF 1SCJB 2KI2A 3KFWX 4R8UA 3J7AN 4L3NA 5F3ZA 3E8OA 1L3KA 2HQIA 5KFKA 3IR5B 1A9NB 4IH6A 4ZPVR 1WDDA 1Y4ZB 1AT1B 1ZM9A 2O1PA 2DGVA 2KHDA 3DN9A 3GFYA 1EARA 1F6TA 4KAIA 3PRBA 3T19A 5LSOA 4PUOB 1L5UA 1XWLA 1EP4A 3EZOA 4M8LA 2OMOA 2XZDB 3VZHA 4ID5A 1ZZFA 3KMQA 3X1LB 2C2NA 1S1VB 4LBHA 5BYRA 3CCVS 1C1CA 1K1SA 3MMAA 2YNGA 1KDNA 2XYGB 1WKKA 3MCOA 5DS7A 2UVRA 1S97A 4IR9A 4KGKA 4JI8F 4D3GA 4O0NA 4TYAA 4E98A 1ZPWX 2XYPB 4C3KA 3RRKA 3SQGB 1RTJB 2VD3A 4PXBA 1RAEB 1S9GB 1VFJA 1RWUA 2HFSA 1WELA 3H5SA 2VDIA 5U47A 5KFWA 2J5AA 1NMEB 1KQGB 1HHQA 2LQ9A 3FCHA 1FD8A 2QRRA 3R3TA 4PG4A 3P96A 4Z7YA 4ZPTR 4A8QA 4KE5A 1S1XB 3W1YC 3GB0A 4NRTA 3ENWA 4ED2A 3UPFA 2YWKA 3FEXB 1IBMJ 5LSLA 4N56A 2F4VF 3T1HF 1YI2S 2VKRA 3BN4A 3CCMS 1YX2A 3CC7S 2C2KB 3HD1A 4DN0A 3UD4P 2UXDF 2AGPA 3OL7A 1RT3A 3SIPB 2HLUA 4HHUA 3G8TA 4L74A 1E6VB 3DDKA 5KFVA 4MIAA 4ZCIA 2W4DA 3CJ8A 3POTA 2KM8C 1NB7A 4F2SA 2DITA 2F4VJ 4YR0A 2CQBA 4K4XA 2EI5A 1DLOA 1QD1A 2Z2MA 3DYAA 4RWWA 3Q23A 1KNZA 1AA1B 2KXHA 4GMKA 3GR0A 3PHTA 2UXDJ 1JKHA 2AWZA 3MTJA 2RU9A 3LO3A 5L9XA 5HBMB 2OUGA 1X9MA 2XS5A 3D2WA 5IC4B 2H5EA 1B4SA 2IFXA 4J9VA 2UP1A 2F8HA 1SC4B 2ZJRQ 2XCPA 2XNQA 3MR7A 3I56S 2MSTA 3NL0A 2VQFF 2C2MB 2JHEA 3I96A 2JRSA 8AT1B 1ZPVA 5G0RA 1NPKA 3MM8A 1GMWA 1TKXB 3CTRA 2MHEA 3DXBA 4M95A 5DLFA 1ZZNA 1TKTA 1GTEA 1DQAA 1LKZA 1IR2A 1Q0NA 4P2XA 2LDIA 1T9VA 2MZJA 3BSOA 2GMLA 3L7UA 4CI0B 3R2DJ 2CJYB 5A8WB 4JV5F 1VQ8S 2V5HG 1BQXA 4NLRA 2YNHA 2N7CA 4LF9J 5CZXA 2Y3YA 2FTRA 2OGUA 3VCDA 4MIWA 4DS4A 2PI5A 1U47A 1OPZA 3ZZOA 1Z1ZA 4LF1A 2DYAA 1M5PC 2HNYB 3EICA 3LW5C 1BGXT 3CCWA 2W4PA 4N41A 1N0UA 4NLGA 1VLOA 1FFGB 1IBKF 4OI1A 1IBKJ 2CQGA 1V9OA 2Z2LA 4UT4A 4KV8B 3CJQA 2BANB 2XGQA 1O51A 1UFLA 2BQRA 2NXCA 9ATCB 1RB0A 4DN9A 4MMOA 4CO3A 4K7QA 1TL7A 3AA8A 5DLGA 2HBRB 3UDCA 2MQPA 1W2BR 2UUCJ 2AJ2A 4QR0A 4W98A 5HN0A 3DI6B 2BKPA 5EGYA 5DQIA 1H2VZ 3DLKB 1R0AB 2XS7A 3PW2A 2QYCA 2YWFA 3M30B 4ZLPA 3BGFA 1S6QA 3M8SA 4WFXA 1NK6A 1Q8IA 3NGRA 2UUTA 3HHLC 4YN3B 4NXNF 2VZ9A 3DCAA 1ZM4A 2CQ1A 3MHYA 3QIPA 5HK4A 4X66F 4OLPA 4WIIA 3G96A 1VQ5S 4GKKJ 1HYSA 4RW6B 4ZVUB 1Q8LA 4OHYA 1BC6A 2ZJPQ 1WD6A 4LR7A 2ASYA 1OQ6A 1OY6A 1R3NA 3GIRA 6FD1A 4UZBA 1B0VA 4JI7J 1IM6A 1VQLS 1UETA 3NS6A 1S77D 2HVHA 3MCSA 1X4EA 2D3O1 4XIUA 4ZHRA 1KR4A 2YX4A 5I42B 4Z37A 3OL8A 4B9LA 2LU1A 3D3CJ 5D15A 1KP6A 2R7VA 1HA1A 2ROEA 2R42A 3I0RB 3CPWR 4QR2A 4P52A 2D74B 2VFTA 1T0TV 4M5NA 2OPRA 4O23A 2EFGA 4KKOB 4MIBA 1SQFA 2IBOA 2FJDB 2JEFA 4USHA 4LSLA 5J2NB 4DL0C 1HHTP 2V8GA 1HNZF 2EEYA 2E9TA 1KWMA 4ZP8A 1W25A 1X4AA 2RDDA 5DM7Q 3NBPB 3W63A 1WC6A 1NK7A 3HXMA 2G1DA 1GNKA 1YJNS 1U1OA 3DRPA 4DQQA 3C6UB 3RUBL 5EN1A 3N9UC 4C11B 5J2MA 2F65A 5CABA 1JB0C 1FE4A 3IS9B 2WVFA 3M2UA 1M90T 5AE1A 4DPWA 3TZYA 2R7SA 1APSA 1OQ3A 1TTHB 4TU9A 3V2UC 4ECTA 3VAGA 1BHNA 2RS2A 2QFJA 3OTOF 4DX5A 3C6TB 3SMZA 4NWBA 5IM0A 2GIRA 2QTWA 2CJBA 3AQOA 1H7XA 3MD1A 3I87A 4NA1A 4RW9A 5HAOA 4ZVSB 1WEYA 2XMJA 4MFBB 2RQMA 3M6WA 4RPFA 2PMZD 2HYIB 1N33J 3A3NB 2VODA 2W2QP 3N5BA 5ETNA 2VC0A 1RT7A 3IG1A 1TAUA 3CCUS 3Q8SB 2A6OA 4NEYA 2JWNA 2MLZA 2UUWA 2QA1A 2VPXB 3ISZA 4CLSA 3TEGA 3VGVA 3IWXA 3ET6B 4RNNA 3T5LA 1JLGA 3CNQP 2CADA 5F9LA 4PCQA 1I1GA 4DCOB 2EKYA 3BBFA 1S79A 4J91A 4JI3J 3CJ3A 5F0WA 1VK8A 2Y9HA 1YJVA 2IDLA 2V2KA 5EWEA 4C4WA 3FZ2A 3ITHB 4B3RF 3CUNA 3M4XA 5AJ3F 4HLBA 3B82A 1RWXB 1HD0A 3MMCA 3NEKA 2ROPA 5K9FA 7FDRA 4URGA 1VRTA 1YRTA 1P27B 4W4MA 5KFEA 1IWAA 2FLLA 3Q8UA 4FYYB 1RT2A 4LVNP 1OIAA 1CSJA 4DR1J 4KRWA 3AY0A 2JFKA 3HPOA 3W2VB 2YKNB 1VI7A 3WIUA 5MAOA 1EAYC 5F8NA 3RW6A 2J9CA 4B3RJ 4I0WA 2DO4A 2J9EA 4PG5A 4CP5A 5M2UA 4Q2MA 2RMLA 4X4QA 1V5IB 3D1QA 5B09A 3MAAA 2MKIA 2AW0A 5HLFA 2RNEA 1XNQJ 4FYVB 4FVMA 4DI6A 4IFVA 1M5SA 1MROA 2JJ4D 2LVWA 2ZVIA 3QWPA 3S1TA 1NKBA 1MMLA 2L08A 4B3OB 2IRXA 3G71S 2OPSB 2HHVA 3J81j 1IBLJ 1Z4UA 2CPFA 1N0VC 2QMXA 4P74A 1S48A 1Q4RA 3C8YA 2BDPA 5JJBA 1VBZA 2EG1A 3C14A 4QIEA 3PDNA 9RUBA 3LANA 3FBCA 2HNDA 4B9SA 3PR4A 2FC9A 3GG0A 4HI1A 2H4WB 3IAM9 4N8OA 1S7HA 3M32A 2ATLA 3G87A 3V81A 3CC2S 3G82A 1PAEX 1UW4A 3EMTA 1FKPA 2KYXA 5D3GB 1U6BA 1QSYA 4DWIA 2C2ZB 1X31C 2CYYA 4MKBA 2ILYA 4LF8J 3IRXA 3JXOA 1DQ9A 3V4IA 3MR5A 1U1QA 2KT5A 5KAKA 3DOMB 2W2NP 3NRBA 2ZDPA 5KT4A 4YR2A 1KKHA 3PR5B 1Q79A 3H25A 2XS2A 3QQCD 2DNOA 5D4LA 1A0OB 4O3OA 4DR6J 3TNVA 2PFFB 2MY7A 4AYBD 1RAGB 4R8UB 3BB5A 5KG5A 3AQPA 5B0AA 2KXFA 2HS4A 2AU0A 6FDRA 2BUNA 3RB3A 1S1WA 2ZBIA 4WFAQ 1N56A 3TQ1A 3LP1B 1VQNS 2V9KA 3D6MB 1U48A 4K4SA 3MPUB 1FDNA 2WVEA 4NLPA 3TWZA 1T03A 1O0PA 4P75A 2XO6A 1DRZA 4PG7A 1CULA 4U96A 3BGUA 1S1VA 3T5KA 5E41A 1UKUA 3D6TB 4NLDA 4Y2IA 3NGDA 2EKNA 1YJ7A 5GMDA 2KG1A 3NKYA 1ROFA 3IGNA 4ZIWA 3US5A 2G4BA 1V5VA 1DTTA 5CYMA 1PJ6A 5J1EB 2YVSA 2B9XA 2MQNA 3DC2A 3OLBA 4GO5X 1U24A 1FHTA 4F36A 3DM2B 1RT5B 4CO0A 3BDEA 3SQGA 2VC1A 4QU6A 2BZ2A 3M8QA 3GSIA 3QNWB 4YOEA 4CM2A 2VIHA 2NS1B 3F44A 2VASA 2WSFC 1HQUA 1VYAA 4OI6A 3OV7A 3GPAA 3OTOJ 5FDLA 3SFGA 1S1XA 6AT1B 2VU5A 2E5HA 3BQ0A 4I1TA 1IKXB 3BGRA 1V3RA 1UEKA 4EO6A 5E0OA 4CT9A 5LMNJ 1HBNA 4NZ7A 3B6BA 1V3ZA 2GVDB 5AXMA 5CCMA 2RU3A 4CLPA 4EYIB 1DZ5A 1F2HA 3FQKA 1J5OB 2Q1LA 2GX8A 2MLXA 3W5ZA 3AD7C 3GMGA 1U09A 2XGPA 4TQSA 3N5FA 2BQUA 1XERA 3KLHA 1D9FA 4EI2A 4L76A 4BHQA 2Y1IA 5HBMA 1HNXJ 1SV5A 4OHXA 4EUVA 4DUTA 3BQ2A 4X2BA 2CPHA 1XMQJ 4C8NA 4CLLA 4U95A 1CC8A 2YKMB 1X9SA 2BW7A 2QLBB 3HFZB 4ENOA 1Y00A 3HFVA 4DFPA 1RA6A 3W2WB 4LBIA 4OYBA 4QIWD 3KK2B 1G3OA 1FJEB 4Q2LA 4WE1A 3SSQA 3QZ8A 3P5BP 3KYLA 1IBLF 1HR0J 1EJ7L 2DT9A 1KLNA 2GHWA 3TAQA 1SB6A 2V4JB 3M8YA 4O3QA 1YG0A 4U7UK 4CYUB 4B02A 1FJCA 5H9EJ 3L9ZA 3BYRA 2NPFA 1OMSA 2CVIA 2AJ4A 1Q5YA 4USJC 3WZ0A 4CNZA 3BZQA 4BWMA 4FF3A 2CQCA 1C0TB 2EC0A 3R9LA 1HNVB 3NY0A 4MKYA 5HMXA 3PIPQ 4DBQA 1AUDA 2E66A 2G1HA 2HIYA 4JV1A 2MMYA 1RU1A 3RRHA 1TZ0A 2BOAA 4BCAA 2W8LA 1HPZB 4R25A 2BA9A 4NZ6A 4OI3A 3VAIA 3OL9A 2LQ5A 2L9WA 4IO1A 4QIGA 3U7JA 4MJKA 3J81U 3PY8A 2KXNB 2DEIA 1GX6A 3MOJB 2AKWB 1HBOB 3I6PA 2BE9B 3IBWA 3FSIA 2EBGA 3EXYA 4NLQA 1H0HB 5IZHA 1X8DA 1JLQA 1WC0A 4KV8A 4FYWB 3VVTA 4JI6J 4F0HA 2RF2A 4MH8A 4ALZA 4A8SA 1CJKB 1X5OA 3LGNA 4OJ3A 3I5BA 1DJ0A 3HT0A 2LYVA 4Y2KA 3DGPB 5E33A 5EX0A 3CXCR 1XBWA 4C8LA 4AT1B 4ZK7M 3PW4A 2NZ4A 4F4KA 1N48A 4CH7A 2XHWA 1UPMB 1IR1A 1FESA 3DLJA 2LXUA 5KG0A 3D5MA 2R2UA 2K1RB 4ZVRB 2D7SA 2R7XA 2E5JA 3HDSA 4LR8A 1DQ8A 3UNGC 3L3CA 2DHAA 1NKCA 4LF5J 1HD1A 4CLZA 3QT7A 3W5XA 2EW9A 2I9SA 4CCHA 3SSSA 3R7NB 1T05B 1HFEL 3ILIA 2W2PP 1Y10A 2WOMB 1BLUA 1FRIA 1PBAA 1RUSA 3OQ2A 2Q43A 3RGIA 3R5DA 3TX0A 4JI0F 3OXLA 5L39A 1XJWB 4RW7A 1LV5A 4RNOA 3CCQS 5LXYA 3W66A 2YKQA 2W2MP 2ZEJA 4O4GA 4ZVQB 4ED4A 4EYHB 3BEGB 3OFGA 3PJWA 1N5QA 4E2FB 4Q8EA 1T9UA 1RWWB 3LP2A 5KOWA 1DTQB 3GLJA 3MEGA 1U1RA 1ZA2B 2EXUA 2IRYA 2ZM6J 3RB6A 5C25B 4KPCA 4KKOA 2C2OB 4U9RA 2ASLA 4JI0J 4J9OA 3DOLB 3K17A 3NCRA 1RE1B 5KFSA 2YX1A 4NCBA 3DLGA 2UXCF 1T7PA 1WF0A 2XMMA 5M2PA 1K0VA 3Q24A 3FSXA 1UL3A 4DX7A 3K5OA 1VBYA 4PWDB 3AH6A 1WSVA 1UTAA 2FHKA 2K3IA 3NCQA 5C42A 4X4OA 4ED1A 4LF8F 2QYGA 1QAYA 1ELOA 1N5VA 2A10A 3H90A 3GR1A 4DL3A 4JB8B 4AXIA 2ZE2B 5I4MA 2DGXA 4GKJF 1PJ5A 5HP1A 2ZFHA 2DY1A 3TAPA 3QIDA 2BVZA 2HBZB 2DH9A 4NLOA 3HULA 1SJQA 1U26A 5K14A 4P71A 5D4OA 2NXEA 4B3SJ 1TVRA 3WX8A 1LQ9A 4HTIA 4JI4F 2E1MC 1S6UA 4UZCA 4ZS6A 1SC3B 5J2QB 1S10A 1S7IA 5K8NA 2VQEJ 2DXDA 4IYQA 1TFYA 1RT7B 1VDHA 3J7YU 2V2VA 3EE3A 5C2GA 3J81Y 3RG6A 2R8HA 2ZZNA 4LVOP 2WAQD 1FRMA 2OSRA 1Y9OA 3QFHA 4WXOA 1JLGB 1RT6B 4ES3A 2CZVC 3UR0A 1KC8T 4ED8A 2MKSA 5H1SV 1C1BA 4PUOA 2B5JB 1JK9B 4YEAA 4C9DA 3CMAS 1RHMB 4ANEA 1AYEA 1KBRA 4WFBQ 4KHPJ 4MYTA 3OFHA 5DDOC 2DH8A 4P7VA 1H73A 2BE7D 2H5JB 2HHHJ 1G7CB 2EFPA 4F0MA 4WXWA 1MWQA 3U02A 1TU0B 2D1CA 3AA9A 3DRSA 4PPDA 4ED6A 3H5UA 2VBZA 2QJ3A 4KH0B 2FJAB 5KFQA 2PA8D 4ZPBA 4CH1A 3ISND 1RBLA 1MG7A 2IM3A 3ONQA 4YQWA 3MAQA 2ZH5A 4DZ6A 2DNNA 3PJ9A 3C16B 3ZFVA 2R7QA 4WYWA 3WHIA 1FXDA 2E5GA 1RTJA 2OH2A 2RRBA 4Z7CA 1N36F 4DSIA 1XMOJ 2B4UA 1A7GE 3IRWP 2AEFA 3SV4A 3MAAB 3W9IA 3V6KA 4ZA1A 5LOQA 3L7PA 2WK4A 2HWHA 3AJDA 4IFVB 4OFZA 2HWIA 4WPAA 2J0QD 4UY85 1HW9A 1TL1B 2BE2B 2Y8WA 1KQFB 4RBVA 3KG1A 5C24B 2KM8B 2IRUA 2W9BB 2HK3A 1H7WA 1TMJA 3CCLS 2X3GA 2QO3A 4UTGA 1RBAA 3DHWC 2KDOA 2BW2A 2Y1RI 3G86A 3ZTRA 1I94J 1YJWS 1IBMF 4K0KF 2DXFA 1CJTA 2E1RA 3EZUA 3F56A 4K8RA 4ZPAA 4DL4A 3POTB 1BQNB 4ELTA 2X1FA 2OHDA 1KLMA 3FBEA 3WX4A 3MM5A 2QX0A 2RILA 5ETPA 1HHSA 3V4MA 1L3TA 2J0WA 4JV2A 3CEDA 3P4UB 4JI8J 1SXLA 2AP6A 1UWBB 2HK2A 3MMJA 4ANCA 3M8PA 1VQ6S 4C8ZA 2K2PA 3NWRA 4PG6A 5D3GA 3I0SB 2VJUA 3IMQJ 4NA2A 2BJ7A 2VV5A 3E01B 4YFUA 1XIQA 5D6GA 3OJSA 2AF6A 2HS0A 3V4IB 2JH3A 4LSZB 4M5GA 3OHBA 4B08A 3IC1A 5B0EA 1TKXA 3TAMB 4NCGB 4MKAA 2IVFB 5H9FJ 4XPCA 3B4MA 1SKSA 1NZAA 2VQFJ 4Q8FA 2GZOA 3KUEA 3TARA 2XTJP 4CO2A 2YH1A 3EUNA 3IR7B 3C15B 4RW8A 1VQSA 1IKYA 2W2OP 3UE2A 1K0TA 2M8DB 3K0JA 4EBDA 1U0SA 2YNHB 1TAQA 2XY5A 2ASJA 2OTLS 1WI6A 3GFXA 1TL3B 4C8YA 5D0EA 4CTAA 4EU0A 2DRBA 2K3KA 2PC6A 1RWKB 2HRTA 1ZOTA 3BF4A 4IFYB 3FQLA 1X4CA 3L95X 1CS4A 2GJFA 3MI7X 4H4MB 3V6JA 3R2CJ 2WSCC 4TQRA 4ATNA 5RUBA 2CQ4A 2H51B 3PHEA 4X4VA 3CJKA 5A8KB 3QPIA 4ZN3A 4LJMA 4B3MF 1SQEA 2KJVA 1NLKL 2NZCA 2ZUAA 3HT3A 3JTOA 2IC3B 4DG1A 5MLCV 4DSEA 3ZZUA 4JI2J 1WEXA 1VC0A 2HNZB 1FNOA 2DNQA 5DG8A 2Y0SD 5GAHI 3VALA 1NK8A 1JWWA 4IDKB 3HVWA 3CT9A 5SUHA 4A8OA 1GTHA 5EDWA 3BO2A 4GVLA 2CZ4A 4FZVA 2UUCF 2PE8A 1S4EA 1J27A 1N6QA 3W9JA 3HP6A 3FK4A 1VOMA 4ZPWR 3DLEA 4KGVB 1TELA 4OZ0A 4CM0A 2OEJA 3BSNA 3KNGA 4ED7A 1GMWD 1VQ4S 1KSPA 1T02A 4K5RA 3UO0A 2GVDA 3B8HA 4NPOA 1XMQF 1O6XA 1HQEA 4EEYA 3HJFA 5KFCA 1KS2A 2FHMA 2C28A 3OD2A 3MFHA 2JX2A 1N4LA 3KLHB 1RZMA 1JXEA 1XR5A 2XHCA 1DY3A 5AXKA 4LF6F 2DGUA 2DRDA 4FF4A 2P2CB 1VC6A 1HR0F 3N6NA 1S76D 4OYPA 3G8SA 3ZC4A 2OPRB 2QSFA 3KG0A 4J9RA 3W2WA 5KFNA 5C2CA 1REGX 3THVA 1IBCB 1FDDA 1Q53A 1R8AA 2OEMA 2QL9B 4WE1B 1HNXF 2UXCJ 1VIXA 5L1JA 2ALYB 3JTPA 2GCFA 5KFUA 2DHXA 3DRYA 3AOBA 3CJ5A 2DPJA 2OFGX 2YNFB 4DQRA 5HL7Q 3CIZA 5HANA 3DRPB 5KT5A 4DL6A 4B3SF 3BKUA 2VKZG 1PYTA 2IYGA 2WW8A 4P10A 4E8UA 4AFFA 2KFYA 3G6XA 3M2UB 3QJPA 1U1KA 4WKYA 3DGVA 3UFCX 4CLUA 5K8MA 1OYEA 3JYTB 4DV7J 4GKJJ 1OYDA 1T9XA 2E1CA 5FLXY 3UI3A 1HBUB 1YIJS 3KG4A 3N79A 2MLYA 4H54A 5KG1A 2AJ0A 4X4UA 1H98A 4C2MA 2FVRA 4YS2A 1RT1B 1VJWA 2HAIA 1K9MT 2DIUA 1RU2A 2HQGA 1FFWB 5HI7A 3IG1B 3QYYA 2E5LJ 2XEXA 1LXNA 5KFMA 1TKZA 2RQCA 1HW8A 4R0JA 2QLJB 5EUHA 2JLGA 2F40A 1ZA1B 3ET6A 5KFAA 1MMDA 2LEAA 3M1VA 4ECRA 1FJGJ 3W8PA 2QFIA 4F3MA 4LF5F 1WNEA 5KFXA 1ZM2A 1N5SA 1S4FA 2G0CA 2VPWB 1VHIA 3MMBB 2C2DA 4DOZA 2ZD1A 2JNJA 1O5JA 4KYZA 1R8BA 2CDRB 5ETSA 2IM0A 2U1AA 2CQIA 3H8YA 1PCAA 4ILLA 1FJGF 3U27A 4BBYA 3TJAA 4WFYA 5A8RA 1JJ4A 4EWTA 1LOUA 2OPPB 4ZMMA 3OT9A 3QSYB 4F02A 1Q16B 3G2XA 5DGAA 2H48B 4CH0S 3OTDA 2PO4A 2V6AA 3GYXB 1NJYA 2KJWA 1T9TA 4R5PB 1Q7YT 1Q78A 4V1Ak 4C3LA 4ES1A 3D66A 4U8VA 3TJ8A 4O4GB 3ADAC 2ZJQQ 4PXDA 2V63A 4O3RA 3KLEA 2CPIA 4J9QA 3G9CA 1DTQA 2CQDA 2HKEA 3MEGB 2B8QA 2HVEA 2APOA 3MEEB 2CPEA 2ZH3A 2ZZMA 2EFQA 2HS3A 1YZ6A 2B6AB 3NNHA 5T7LB 3CO9A 3TANA 3QJJA 2PIIA 4IH7A 2IHR1 3VVUA 2MHNA 4JI6F 5IT9U 1YWXA 4RLEA 2HFZA 3HX9A 5DG7A 4RU9A 2L9DA 2OD4A 3TA0A 1RXOB 4MKVA 3C14B 4RWXA 4F4AA 1SUQB 4DPUA 1WKJA 5B08A 1N5YB 3OVBA 4GKKF 5IT4A 3R1LA 1LFWA 5E5NA 2EC2A 1IWGA 3IWLA 3KDOA 4UOFA 3KHRA 3DNCA 5KG2A 3SYZA 2DPIA 3CJRA 2Y1LB 4P73A 5HP1B 3CDEA 3MEDB 3IWNC 3OUYA 2CA9A 1ZAXA 3BSCA 4TY8A 1UJ5A 3MD3A 1X4DA 1U1NA 2B0GA 4QBUA 5KFZA 3D54A 2E1AA 3K59A 4OHWA 4CLFA 2FJBB 2QA4S 1YKWA 3H2VE 1GMVA 1RAIB 3CCTA 2N4DA 3MM6B 1M1GA 4OX9J 4DV0J 3NAHA 1TMMA 2QE5A 3A3PB 3D3BJ 4Y2CA 1Q95G 2DNHA 4ZVGA 3FFIB 2MGZB 1XNRF 4LREA 1JLFA 1HWJA 1R8PA 1T3NA 3KOAA 1GT8A 4ZLJA 1C1BB 1HMVB 1S99A 2M8HA 2OO4A 2ZKUA 1SL1A 2A2CA 2DB1A 4ZLLA 8RUCA 1YDLA 2CWKA 1CULB 3WDOA 4FNHA 4I7FA 4OI0A 3ZZYA 4ETZA 2C2EA 2LXIA 3T5JA 2F1FA 3HZGA 3FC9A 1VIOA 4WWSA 1FE0A 1ZM3A 2DR6A 2V68A 2DGTA 2JEIA 1NEEA 2VBYA 4F4WA 1UA0A 1B7FA 3NGTA 4XTTA 1HI1A 1AZSB 4DV4F 1K44A 3PW7A 1JLEB 3AXMA 4IKAA 3ZNUA 4PWWA 2IPOB 5DG9A 1XC9A 2B51A 3M8QB 4L6V3 4OZJA 2WONA 4NYPA 5EHHA 4JI1F 4KJIA 4PZVA 2VG5B 1NPRA 2K7KA 4X4RA 3FZBA 1LWCB 2WBMA 1IVZA 2VB6A 3PO4A 1MU2A 5H9FK 2BXJA 2MB0B 4O3SA 3CMES 1KFSA 2B9EA 1IKXA 4IG0A 5KG4A 2W9CB 3VAFA 2HMIB 3TUPA 1KVKA 2SXLA 3EVWA 3M6UA 3ENVA 2DK2A 2RJZA 4LRBA 2QL5B 3TI0A 1RGVA 3DMJA 1ZTTA 5DQHA 4ZOSA 1Q86T 1RI7A 3GJTB 3LUYA 3MUMP 2R7TA 2I6WA 1P6TA 1DURA 2NYIA 1P8GA 2J0XA 3H42A 3UVJB 4A48A 1UEUA 3EZ5A 1FKAF 2L41A 1RTDA 2ZBRA 3PEHA 4V19X 1TV6B 4CDIA 2HRUA 3GFZA 4KGMA 3TVZA 1S1TB 4RBUA 4JI3F 3C2PA 3AD9C 1T95A 2RHQB 4J9KA 5I3UA 5M2RA 4X64F 2Z8QA 1HIYA 1UWBA 2F3JA 5F8IA 1REVB 4ECQA 3QGIA 3J7Z5 4IOCQ 4UOCA 3KNAA 4WK3A 1FO1A 2F7VA 3VR1A 5KT3A 3LTOA 3KK3B 3C46A 2IAJA 4OYZA 4P2FA 5IV4A 2PI4A 5LMUF 5IC6B 2IY5B 3TO8A 1JXLA 2R7RA 4DL5A 3SCIE 4M5DA 3FKBA 1PC5A 3TAMA 3VAHA 4OI2A 1ZAWA 2E5IA 1RKIA 2C3MA 3DRRB 2DNKA 2EK6A 2PMWA 2ABYA 4USVA 5DM6Q 4HACB 3T3FA 2X1GA 1JIHA 2M3DA 3A8IA 1NB2A 3O6QA 4JOUA 1WSRA 3CCJS 4DFJA 2QEXS 1F2GA 1TUVA 5HQLA 4N77A 5F3TA 4RUCA 2RDJA 3QRRA 5L38A 4HDHA 1HNWJ 4CTAB 1IQTA 3IM9A 4FF1A 4Y65A 2UVUA 4QPXA 1HBOA 2Z0GA 3DOKA 1NCLA 1TFWA 2B4OA 3CJTA 3RB0A 3ILOA 4YHHJ 2V8VA 2XZTB 3CJ4A 3P5TL 1EHWA 4WTYA 3MDFA 1Y7PA 2DNYA 1N34J 3WC2A 1S57A 3KLIB 3F73A 1C2PA 2DGSA 1CJKA 2FVCA 4FYXB 2OPQB 4LUBA 1SJ4P 1B99A 1QUPA 4QOTA 3SDEA 1WDTA 3AB4B 1WEZA 1VS3A 3FDSA 4FPIA 5CYJA 3H40A 1RHJB 1PGZA 1PILA 2CNKB 1MN9A 3OTBA 3AAWB 4RBTA 4DV5J 1W7WA 3HSGA 1QE1A 4M5IA 4DQPA 1Y3KA 3U1MA 5IS2A 4PXEA 4S0MA 3IN5A 3GV7B 3ILLA 4KT0C 2O67A 2KTQA 4Y3CA 3GG1A 4B9MA 1FNXH 4MT1A 2W7AA 2F9DA 3OPKA 4ZVOB 5B0CA 2CPDA 5A8WA 3PW5A 3E3XA 3PRDA 4NA3A 1F3FA 1NXIA 1EX8A 3PFOA 2MZTA 2KT3A 4ECWA 1ULRA 2AYMA 4J9LA 2JEJA 2AJFE 4OL8A 3THPA 1N32F 4RW7B 4WP9A 2NYHA 4M63A 3BR9A 1PO6A 1XEZA 4KFBB 4ZCLA 2KZZA 3S8SA 4LFBJ 3BBCA 3MR6A 1VQ7S 4OZ1A 3G6VA 1WG4A 2QA2A 4OZ3A 4DR5F 3C19A 2E9RX 2LLZA 5CD4A 2AYBA 4PABA 1H6KX 3FJ2A 1VJQA 3DOLA 3OR2B 1YLXA 4UW2A 4AL6A 2X51A 5CXTA 3KXDA 4LF6J 1ACMB 2P9EA 3DI6A 1YJ9S 1M5OC 4KBIA 3DLKA 3UCUP 1R0AA 1KTQA 4XO0A 3M30A 2YNFA 3HVTB 4X65J 4LFCJ 1EETB 2GO8A 3LQVA 4LQ9A 2O66A 1RLCL 3SQOP 2BM1A 2ZE2A 2IYIA 1FK9A 4U67Q 2R2TA 3THTA 3FBBA 2VFUA 2MQOA 4AL7A 1CQMA 1HYSB 2QLWA 1RAJA 1GXTA 2OSQA 2YQ1A 4WKRA 1HBUA 1YBAA 5D0GA 1YITS 1UZHA 1NDPA 3TA1A 1FEHA 1GMUA 3U1LA 2HVDA 3HHDA 1SC6A 3OBIA 3NP5A 4J90A 2FVQA 3AOAA 4NEZA 1HL6A 1UA1A 2V50A 3LP0B 2A3JA 2LECA 1FT8A 3VF0B 2HFNA 4DR3J 4DR3F 3EGZA 1NRKA 1QAIA 2XMUA 1OJ4A 4XDDA 1Q82T 1GK8A 3M6VA 5I3PA 1HI8A 3HHEA 1UW9A 2IVYA 2QL7B 2Z2ZA 4EK2A 1QUVA 3GP9A 3PX0A 2WTFA 1IKVB 2B5JA 1IKWA 1L3SA 3TRGA 3MMBA 3VAJA 2DVIA 3DLHA 2PD1A 4C98A 4DV3F 1R6VA 1XNRJ 4NLVA 1FX2A 4R0EA 4QJVA 2FJEB 3RAMA 1F5CA 2MJUA 2ZC3A 2A18A 2I5JA 2RRNA 2M7SA 4USIA 3TP2A 4G1QB 3C6UA 3TVYA 3TUIC 5BXIA 4I2QA 4DV2J 2CJKA 2XNRA 4GC6A 3H2LA 4L72B 4KTQA 1WTFA 4DPYA 3SI8A 4UUWA 4OV1A 3W61A 1KOOA 2NREA 2RUGA 3R8YA 3OLAA 4K5SA 4RL1A 1VRQC 5KG6A 1QY7A 1U7LA 1WG5A 4FKXA 3C6TA 4I64A 2Q66A 3ETMA 5E3AA 2Q79A 3EGWB 3PJXA 4RW9B 3HVRA 2GJIA 2IJFA 5K8PA 2BYCA 4DQSA 3HO1A 1NK4A 4ERDA 3UD5A 5D78A 2HFVA 1J5EJ 4QQBA 1BQMB 4U7CA 4TLRA 2IBKA 1PAUB 5AJ3J 2IA0A 2ZZTA 1TL1A 2BE2A 2D3UA 1RWPB 2RVJA 1B0PA 2W4CA 1KHVA 2FDNA 4FDFA 3V6DA 3NNAA 4G1PA 1T8EA 1OY9A 3O8WA 3E51A 2VICA 1URNA 4X62J 1PSDA 2BOPA 3ZTSA 1RA7A 1SUQA 4N47A 4CRJA 1MWYA 4CNYA 4YB5A 5J2PA 1X5SA 2UUAF 1PIEA 3FRZA 2FUG9 3KLFA 3ITHA 4K4YA 3MM9B 3Q8PB 1YJUA 4NLUA 1LWFB 1EKSA 2RS8A 3GYNA 4IRKA 4DR1F 2NSCA 1LWXA 1VRTB 4J5OA 1CC7A 1RP5A 3GWCA 3IFEA 3MEDA 5DJBA 2V94A 3D28A 2EK1A 3RBXA 2ZHAA 1IN0A 4W90B 1RTHA 1CQNA 1YZ7A 1G2EA 2YTCA 2FY1A 3T41A 3D67A 1YQHA 2VFSA 2XC9A 2C2RA 2DR9A 2RD5C 3KJVB 3G6ES 3LWLA 5BR8F 4A8MP 4QCLA 1N52B 2LQJA 3P45B 3T9ZA 3ZZTA 2H5IB 5HJYA 1PYOB 2HHTA 1YTYA 1G4CA 2RAQA 1RBOB 1XQIA 7AT1B 4KC5A 1FI4A 1H72C 1VRUA 2HG4A 3IP0A 3WBZA 1TQLA 5KT7A 4LIRA 5FLXU 3ZZZA 2GVZB 3Q8YA 1QLNA 2OEKA 4NXMF 3PVXA 2J9DA 3FMWA 2FIUA 1E6VA 3CIMA 1WI8A 2CJXB 3MAHA 1Q81T 1SC1B 2NR0A 4QYZK 3TEHB 3QRPA 4Q0BA 4HYKA 3FRYA 3BS9A 3DLLQ 4A8FA 1CS4B 1RT4B 4ZPCA 3DYAB 2VONA 5E3CA 3W3SA 1M1HA 1D9DA 2P8IA 3HHLD 1HLWA 4HEA9 2DCLA 3CJKB 5A0YB 5A8KA 1X7VA 2UU9F 5E3RA 3VGUA 1C0UA 4GC7A 2RHSB 4DUYF 1CLFA 4KO0B 5CA5A 2JSXA 2YPYA 1SKUB 1TKDA 3NNCA 2N3OA 2LQ8A 2C3OA 2HNZA 4JI7F 4M1KA 1AROP 4OYMA 4P72A 3MWBA 5L46A 2V9WA 2VG5A 4B3MJ 2POKA 4C97A 3TJ9A 1NDKA 2AJ1A 5AXLA 1N6QB 3MUTP 4EZ6A 2MQMA 2GQQA 1VQOS 3I32A 1FFSB 2BJ9A 2J7WA 4KB7A 2FJWA 2HMIA 2PEBA 3BYPA 5ETLA 4B9VA 4FF2A 1VC5A 3GONA 5FD1A 1JLBA 3HK2A 2X1AA 3TUJC 4Y2MA 1S1WB 3BGLA 2GV1A 2O3DA 3A3OB 2RH3A 3N6LA 3VZIA 2VJVA 1UAWA 4DR5J 1B3TA 1S5ZA 4M5HA 1T03B 2OKQA 1RTDB 5F8MA 1Y0HA 1QTMA 2XSFA 4CT8A 2MDAA 1M0SA 5IXUA 4F3OA 2JZ5A 1T94A 3OTCA 1U0HB 1S1TA 4OYXA 2Y8YA 1IUJA 5LJ5Y 4B9TA 1N88A 2GQ2A 5ETTA 1FRXA 3MMAB 2H3EB 2XYHB 3ZNJ1 2YNGB 1X60A 2AZ3A 2KFZA 2BABA 3QGHA 1S9FA 3HSJA 3CCZA 2XMAA 2I8EA 5B7WA 3N0VA 3DM2A 4NOHA 2AT1B 2YWGA 4KGXB 2K06A 3T1AA 4DLEA 2NXNA 5E3PA 4X4TA 4QWBA 1L3VA 4DQIA 3I4HX 5B0FA 1YK9A 2HHPA 4F4ZA 1S49A 3MECB 4M5DB 4FS1A 1AFIA 2YQ3A 4EMDA 3VAKA 1S9GA 4NE9C 1N36J 3J80U 3MPYA 5KTQA 4XDCA 1FRHA 4QYZJ 1RAHB 3J7YI 2MTLA 2NUHA 2EBEA 2OJ3A 4LR9A 2XM3A 3W60A 2D41A 2ZH8A 2CPXA 4PG8A 4RNMA 2MKKA 4WZQA 3UN2A 1YGYA 5GAGU 2YBVA 4L75A 4FPRA 2VBWA 4OZ5A 2V8HA 2XWXA 3R1HA 4DHVA 1EIYB 3MCNA 1ZETA 4ZJQA 4ZHRB 5BYSA 5I42A 1P1TA 3BO3A 2MQLA 1MSWD 4OLOA 1KRPA 3GQCA 2HHUA 1S59A 1WC1A 2RQ4A 2HZCA 1BXNA 2ZH4A 2V34A 4LMZA 1H74A 3P49B 2LFVA 3W5YA 2WCXA 3C3LA 2BBEA 3KWMA 3GJQB 2J7KA 1DFDA 4ELVA 2M70A 4OHVA 4ZN1A 4A8WA 2B43A 2QLFB 3M9OB 1FTCA 4LSNB 4OZNA 3TZWA 1HNWF 1EB0A 3PYGA 4ZP7A 3L7OA 3Q0AA 4RZRA 5GAEU 2E44A 2FHOB 5L1KA 4RUBA 2PFDA 4KHMA 1DAXA 2QMWA 4M5MA 3W7BA 4AQYF 2YNIA 4ED3A 5D0HA 2DY9A 3W9HA 4A8YA 1FVQA 2QV6A 4DCJB 2ASDA 1IXKA 3QO9A 4JI5J 4ZP6A 3PFEA 3DU5A 3BR8A 3KDNA 2WVDA 4A46A 2WHOA 3H0PA 3AODA 2BACA 2IDEA 2P6SA 3DHXA 2HNYA 5DDQC 1RTIB 3M8RA 2HVIA 4LRDA 1JLQB 1V3SA 2DXEA 2H1YA 5HVFA 4M5LA 4C7QA 1HARA 3MEEA 4N5SA 4UQGA 2IM2A 2E9ZA 1FERA 1YBUA 1S9EA 4O44B 2ZNZA 5KT2A 2PEHA 2BANA 1S0MA 2JDJA 3D68A 1BWEA 4AL5A 3R7SB 2Z58B 3A4TA 3HZEA 5DQGA 2KB2A 1KOHA 2XO7A 3CD6S 1SL0A 4DR6F 3HHKA 1H2TZ 4ICLA 4ID8A 4UOGA 1U2CA 1PC4A 2GGPA 4P2SA 2I38A 3CVKA 3EXCX 3S6EA 3UD3P 2BJDA 1KONA 1N5YA 4I56A 3VGSA 2XLIA 2JVOA 2KVQE 4Q7AA 2XSJA 4JV0A 5HMZA 4C8MA 3Q8QB 4DZDA 1S6QB 3QSIA 1VQYA 1WORA 4FBUA 4HHJA 3IA0A 3K5MA 4EZ9A 2CXEA 1B70B 1RWVB 2A1BA 3OUYB 4F8RA 2CKWA 1MWZA 4Y00A 1T3OA 5EWFA 2XB2D 1JLAA 1GQEA 1DBDA 2EWHA 2YKNA 4HI2A 1RSCA 3QGGA 4I68A 3NGSA 4LIWA 5F8GA 3EPGA 4NLWA 4KPYA 4CWBA 1NH8A 3MOZA 3OFEA 2XMTA 3LP0A 3Q83A 1FX4A 1HQ2A 5D8HB 1R31A 1FDBA 4PYAA 1TUWA 1U8SA 2K8GA 1N32J 2RQKA 3K8VA 2YKAA 1S0NA 3A8EA 3D9BA 2ZH2A 4DUZF 2DGQA 4ZJOA 1X9WA 2AMCB 4KSEB 4UOHA 4LF7F 4MK9A 1YJRA 2FYXA 2ZC4A 1F0XA 5F9NA 3PTWA 1NDCA 2WB1D 4K4VA 3TUZC 1ZH5A 1WHVA 4DV1J 3LA0A 2AX1A 4I6YA 3GJRB 3L4BC 4I2QB 4RUHA 1KN6A 4CO4A 3RYLA 3M32B 2KKHA 3MEKA 4QU7A 3RW7A 4X65F 3OXGA 4OYOA 3KJNB 1RISA 2IMWP 2DNRA 4NYZA 1JJCB 2ROGA 3CDAA 2VG7A 3ENQA 5JXSA 5K14B 3K58A 2J9DE 4TVAB 2QLXA 1RAOA 5D4PA 1LXJA 5HJXA 1UCNA 1WOPA 4ECVA 1SBRA 5AE3A 1SKWA 2C22A 2CNNB 5CH7B 1H38A 1NAQA 5FIIA 4OYIA 4DMZA 1LWCA 1Q1KA 5BJRA 2R3VA 2K7JA 4MAKA 4X62F 3V6HA 4K4ZA 1BQMA 4HH0A 2W9CA 2HHHF 1U1MA 3CULA 4NL5A 2R8GA 2C1EB 5IT9Y 3PX6A 4KHPF 1YHQS 4IH5A 2MZ1A 3DMJB 5JUMA 2R7UA 4ZVEA 2NUUG 5GMEA 2L9NA 4TLQA 2Q6BA 4DS5A 1XR6A 2MKJA 3IGVA 2C42A 1RQ0A 3LP1A 1FWLA 2MJNA 1JXVA 4FP9A 2DRAA 2VA2A 4OZ2A 1FRKA 5GADU 1SJFA 5GAGI 3CD5A 3FSYA 5D4NA 5C7PA 1FXLA 3J80Y 4XPEA 3KLFB 1EP4B 1Y5LB 2WVCA 3OTEA 2XMWA 4FXWA 5F8JA 3QJLA 1IM4A 4QZVB 2KRRA 3JAMU 4UQTA 3MMCB 5KFRA 4ED5A 4HKQA 5EWGA 1FRLA 4HR2A 1RTHB 1UVJA 3D0GE 1UPPA 1WOSA 2NXJA 1RT2B 4OJHA 1FXRA 4NMXA 3UWTA 3VTIA 3KHLA 3N01A 1U49A 3M2RA 4I2PA 3HHLB 5LT5A 4EO8A 2I2YA 4Q43A 3R7BB 1I3OB 2DTJA 4DR2F 2LQBA 4USTA 5L1IA 2GHVC 3IXQA 4GVBB 2XCAA 2QIFA 5HLFB 1NK0A 2G9OA 4V19J 2EFNA 2CQHA 2UZAA 2C3UA 4OJ1A 5KFYA 1YRUA 2DNZA 4A4JA 4F0KA 1FNMA 1HWUA 4USUA 3UDVA 2W9BA 1SI9A 1SIWB 2GVZA 2CPJA 2BKOA 2JLFA 2OPSA 4F50A 4IR1A 1RWNB 5E2QA 2FC8A 4EGLA 3NCPA 2W1BA 2QZ8A 1BQNA 2DR5A 4B3TJ 2LCWA 3HMJG 3O1LA 5B0DA 3DOKB 3DXSX 4JBCA 2ZOFA 1DARA 4RW4B 4ECXA 1NHUA 2VUGA 4QWEA 5EX3A 2J8SA 4OHZA 1X4GA 3UCZP 2VL1A 1B64A 3FEZA 1C0UB 3DRXA 4ZVHA 2PA3A 4KHRA 3EVMA 2YQ0A 3NG8A 1K8AT 5HATA 3DFEA 4DSLA 3V81B 5HVGA 2XULA 5LMUJ 4B3TF 1CVJA 3QLHA 5DZ6A 1FKPB 4XK8C 5DRKA 5KG7A 5HQMA 2BRLA 1TP7A 3K89A 3ZTQA 1N33F 3EJMA 3VGTA 2V4JA 2FPHX 2KT2A 2J7UA 2X3DA 1IQZA 1EZZB 2O01C 5G0RB 3SBMA 5KFPA 2MEWA 1U8WA 1U2RA 2WW4A 8ATCB 1YRXA 2QGFB 4P6QA 4Y0FA 2Y1JA 2DNPA 3CD7A 1UVNA 2P6TA 1JLCA 3K7RA 5E7OB 1X4FA 1T9WA 3SV3A 1TKTB 1SJ1A 1UEVA 1LW0A 3GCXP 5ETMA 4K2XA 3OSNA 1L3UA 1AB8A 3QMQA 4I6AA 1WC3A 4NRUA 1RACB 1YVFA 4K4UA 2EFVA 5DGBA 3MGJA 2AIRB 5LJ3Y 4EBCA 2CPYA 1F9HA 2FLOA 4EBEA 4JI5F 2VFVA 3FCVA 3K8WA 2HSEB 5JVGQ 3MPDA 4IQMA 4OYWA 1UVKA 3RBZA 4NXMJ 4CLWA 2CWXA 3IM8A 2QN6B 4WBFA 4WP3A 3QT8A 3EX7B 3FMBA 3H5XA 4K4TA 3TW0A 4LF9F 4AD6A 3PCOB 1MLAA 3NOGA 3M9MB 3OR2A 4YB7A 2LKZA 3K5PA 4WU2A 4LRFA 3TR5A 2LMIA 1HWLA 1WOOA 4URSA 4DPXA 3KLGA 2B56A 4FXDA 3DGPA 1NDLA 5T41A 1XNQF 1KVJA 2FHJA 3MF5A 2HBYB 4F26A 2P9CA 1EETA 1ICEB 2M88A 3B78A 4PEOA 5LL6d 3G6YA 4B17A 4OIXA 4F4YA 1B0TA 4JI2F 2Z4PA 2F5GA 2ACYA 2U2FA 3BPSP 5E3QA 5HMYA 1WHXA 4X64J 2IJRA 3RU0A 1CG2A 1SIZA 2CNOB 1LNQA 3AT1B 4UF4A 4TU7A 4C8OA 5IQ6A 3K5NA 2MZQA 2FZKB 5HO4A 3BPDA 3H20A 1PYSB 3UCGA 1J5OA 1JNZB 3NS5A 3A12A 4HVZA 4H4OB 3LWMA 3H4BA 2DR7A 2ZKTA 2UVVA 3QGPA 4K0KJ 2GC8A 2MZRA 1FRJA 4ETXA 4GRSA 2GAHC 1PBUA 3VQTA 2PT0A 1SV5B 3GSDA 3WC0A 1LEOA 2H65B 4OI4A 3M9NB 4DV6F 2ZWPA 4QIVA 3T1HJ 2J8AA 2KU7A 1OY8A 2OI2A 3R5AA 3I5AA 4YUDA 1TK0A 3RBEA 4WFNQ 2M5YA 3PACA 5LXRA 3KK2A 2OIHA 2MKHA 3GU0A 4LFAF 1P9QC 2V8PA 2V69A 2DHHA 4X84A 4NLTA 4DF8A 3CC4S 2CQ2A 2DO0A 4BC9A 2Z2YB 2HGNA 4G1QA 4CYUA 4DX6A 1X5PA 2R2SA 4IG3B 4TKTA 1RADB 5DDRC 4QYRA 1JQGA 4C11A 2CIMA 1XTZA 2XZWA 2XLJA 4DPOA 4L3KA 2KH9A 2HQDA 1F9FA 3FUYA 3JQKA 3OR1A 4AE5A 5IFMA 4YP3A 4JI1J 2UXBF 3QO9B 3TA2A 2RB7A 1D3WA 4QW8A 3CDUA 4A47A 2E5LF 1R0CB 3FCWA 1KTVA 5IM0B 5JMNA 3DU6A 4U7UD 4NYOA 2J0SD 1QJHA 3KLVA 4ECYA 1RTIA 3O2IA 2VDHA 4RNHA 4RNFA 1CJVB 4MK8A 1TKZB 3HFKA 2CG8A 2CUYA 4O44A 2HZVA 1RAFB 2J6UA 4ZLNA 5KFLA 2YKOA 3BH7B 3ZZRA 4F4XA 2B7CB 2HQCA 1QDUB 1OPIA 1Y11A 1KFDA 2VG6B 2UV8A 3H2UB 2ADCA 4YDDB 1RK8A 3HM9A 4DF4A 4LRCA 1HI0P 4ICLB 4F67A 4RKUC 3PKMA 4PQUA 2HQ3A 1NJIT 5J2PB 3X3UA 1VQ9S 4C0BA 3PYEA 1SVDA 4X4PA 4WYLA 3W65A 1M1KT 2D9OA 3M8WA 5K20B 1KVIA 4OX7A 5DZ7A 3R6LB 2K1RA 3UR3C 3DRSB 4CO1A 2FVSA 1NNDA 4QR1A 2UVWA 2FZGB 2OAUA 4DDFA 5HROA 2FVPA 1ITPA 3GIJA 3JTNA 1JLAB 3QT5A 4AQYJ 1N8RT 2VOOA 4ZCKA 4UY8T 1VK3A 1B7YB 2M0GB 2CZ9A 5ETRA 3Q8VA 3W2VA 2H9ZA 3KJVA 1FWKA 4JV5J 3K2YA 1G1XA 2YPZA 2G2YA 4C6AA 4YDXA 3MPVA 2UU9J 2UUBF 1WUUA 4NASA 2XMKA 3NGKA 2G2OA 2AX0A 3PEJA 3M2VA 2C3PA 4LFBF 5BYQA 2WZ1A 4DV1F 4OYAA 2ZH6A 1RKJA 3EWGA 2B6AA 3AFGA 1A6LA 3L09A 3I82A 1HKAA 1XMOF 4DR7J 2J76E 5I3QA 3ENAA 3NXZA 2ZH1A 1OS5A 2XY7A 3K5LA 2D3OR 1NK5A 2QSWA 3D1OA 2VFRA 2CQ3A 4P7TA 1KLMB 2ATCB 4ZKAA 2P5VA 1X0PA 1VQKS 3MM5B 2ZH9A 4DR4J 2FZCB 2XY6A 2ZUGA 3Q89A 2YH0A 3Q86A 3BDPA 3SCKE 5DO2A 3T6BA 5A0YA 4DFKA 1SQGA 2BJEA 5HQ8A 1FKOB 2GNKA 3CO0P 1UZDA 4NMLA 4DL2A 1M5KC 1CPZA 3QAEA 4CO5A 2G2ZA 3FBFA 2VG7B 3F41A 1UJ6A 2Z56B 3G82B 1HBMA 3PW0A 4DR4F 2HLTA 3VAMA 2GFFA 2RKIB 4WF9Q 2G0JA 3SEOA 4IO9Q 2CJQA 2R8IA 2VPYB 4IOBA 3DDIA 5H9EK 3BBBA 5HVHA 4ECSA 1TL4A 1CBKA 4HHHA 3MFIA 2MKYA 4F04B 1IR0A 2OMLA 3EGVA 3I5CA 4QWAA 3TVKA 1D9AA 3FFIA 5C5JA 4ER8A 3H98A 1OSCA 2KRBA 3KUGA 5KFOA 5ITHA 1LWEA 3AHPA 4C0HA 1RT6A 3A13A 1CJUA 3LGMA 3H7HB 5HMWA 4DCPB 4P9SA 1TL3A 5ETKA 4DEZA 5CD4H 5KFJA 4LBPA 2ZH7A 2KO1A 2Z57B 1R43A 2RDIA 3MTKA 4H4MA 2BR0A 4J9SA 3OL6A 2KFNA 1NHVA 2HHWA 4DV2F 5KFTA 1S72S 1HNIA 2M52A 2XLKA 1AZSA 2GJ2A 2IC3A 4G1IA 2RUSA 1FVSA 5KFIA 4DG1B 2AYGA 4QWCA 3M2RB 4I2PB 3HHLA 2Q6CA 2JLEA 2FY8A 2IMOA 1RT5A 3C16A 3PG9A 3SSRA 4X4NA 3K57A 2LU2A 3O5TB 3I55S 2HPUA 5AE2A 5GVQA 2GAGC 3MPWA 4OX8A 2KN4A 1WKLA 2ZM6F 3EDRB 4RX6A 1X4BA 1HQUB 1NBEB 1XMBA 2DNMA 1U1LA 4NXNJ 4PQUB 2M4MA 3BM7A 5FDLB 4OMFG 5GADI 2W7OA 2CAJA 2LP4A 1Z2ZA 3QT6A 2AV5A 1W2IA 5AT1B 5JVHQ 1D0EA 1S1UA 4PPZA 4PXCA 3T6JA 2Q3PA 4OX6A 1AFJA 4QPTA 3PIOQ 2IVMA 4CLTA 2NLWA 2OD6A 1CJTB 3AOCA 4I6WA 3OJUA 4YR3A 4TU8A 4J9NA 2CJAA 1WC4A 1S6OA 4TYBA 4RW4A 4ID5B 2GIFA 2QC3A 2OFHX 2ERRA 1U4BA 1I94F 3HD2A 1FTRA 2PSZA 2XI2A 2ILZA 2QG9B 3SXLA 4LQ3A 2N4CA 2DHSA 3FEYB 4DV6J 4IRCA 2YKMA 4DSJA 2BRKA 3LH2S 2QT7A 1R7IA 2IAJB 2ZHOA 1I6JA 1SPBP 2WVBA 5AXNA 3E01A 3JQMA 1JMTA 2DGOA 2HFUA 4CZCA 3M7VA 2CJ9A 3LPYA 3M05A 3MURP 4F3QA 3G4SS 1E6YA 4DV7F 3T1YF 4DR7F 4W92B 1OO0B 1BMQB 1Z2LA 3KUHA 2M9KA 3JAMY 4JYAJ 1R27B 3CJ0A 3ZZPA 1DHMA 1P9YA 1JLCB 2V2QA 2MY8A 1FD2A 3BV8A 4F7VA 3W62A 4TNOA 5LM7E 2FJXA 2GQCA 3LGHA 5CYQA 1C0TA 1VBXA 1KD1T 2DGWA 1IKYB 1NZ8A 2IJNA 2VPZB 3FGVA 3GJSB 5KFFA 1U45A 1U25A 3MCMA 3CB4A 4J9PA 1EQ0A 2JC0A 4NZ0A 2F4FA 3OW2R 5F8HA 1GEHA 3HF5A 1SL2A 1FF2A 1U6ZA 1UMJA 1RT3B 2YWWA 2CRLA 2W7PA 4FBTA 3HKWA 1HWIA 1RT1A 3PO5A 3W8GA 4Y2AA 5K5MA 1QSLA 1EQMA 4ZP9A 1SJ3P 4Y6IA 2F9JA 4PKDB 1KQKA 4TY9A 5IV3A 2AEJA 3KLIA 1R8HA 1ZYQA 1S0OA 1NJWA 2NQPA 3KK1B 3KLGB 3D4JA 2COLA 2ZBQA 3SDEB 1TL5A 1URRA 5J1PA 1GFWB 3LOUA 1U6FA 2JFDA 3I4PA 4DSFA 3LALA 1JNRB 1RHRB 1UFKA 1VGYA 4RU2A 3D1HA 3SCJE 3ELHA 3R27A 5A2QU 2FGOA 3TQEA 1QE1B 2FB0A 2XSJB 3KJQB 3B4DA 4ECZA 4FXVA 3MM8B 4HL9A 5F41A 3GCWP 5IWAJ 2MZSA 1NU4A 3MM7A 3RR8A 3NWGA 3ILJA 3BJYA 2HW3A 2FD2A 2MSSA 3BGOP 3LAKA 1RHUB 5KOXA 3MR3A 2A0FB 2HWTA 1RHQB 2HFOA 3EDQB 4PR6A 4O3NA 1RAAB 2F8EX 3FNNA 1MN7A 5CAAA 5HSPA 3Q8RB 3O44A 1MNEA 5F8LA 1NH7A 2M2BA 3N28A 1T05A 2J6SA 4IOAQ 2W01A 3BSAA 2UUAJ 2ZOMA 1RWOB 3JS9A 2HQFA 4H4OA 4DUZJ 4C8KA 3NMRA 3TYTA 3I9V9 3KLEB 2HHSA 1S6PB 2GS8A 3KJFB 2DJWA 2UV8G 4P2MA 4ZIVA 4LF4J 2PMHA 5ADZA 2YY3A 3LP2B 4WIQA 2B3TB 2CQPA 5C25A 1Q5VA 3KTQA 2B9WA 1SKRA 1JJ2R 4YY3F 3PM9A 1TL7B 5L1LA 3JSYA 2JC1A 5CZVA 3DLGB 3ETOA 4RO0A 5GAEI 3HVTA 4C0OC 3ZXWA 3BQ1A 4WU3A 3RAXA 5KFHA 3Q2TC 4PWDA 2ZBPA 4IG3A 3R5GA 4PQAA 4KQZA 2BMBA 5ETQA 4YY3J 1UVIA 1BD6A 2F8MA 5KFGA 4M5KA 3CW2C 1LK5A 1Y5NB 1NUEA 2KYZA 4USMA 4RW6A 4CQ1A 4ILMA 2W25A 3ICLA 3JSBA 4DFMA 3HHNB 3MUVP 4B9UA 3HJVA 3U1NA 4LRAA 3GIMA 5B0GA 2N3LA 1W26A 2L3MA 4KH1B 1FA0A 3UN3A 4DV3J 2CG4A 2BJ8A 5BR8J 3TOQA 1U2FA 3CGIA 2PDAA 2ZBCA 4LT6A 4LFAJ 1SH2A 1CJVA 5IOLA 4C3MA 4DX8H 4ZCMA 2AD9A 2DEJA 1BY9A 1TUGB 4QIFA 1UP1A 3I0RA 3AJ1A 3OHAA 4DL7A 3GE9A 2P9GA 3QZ7A 2VG6A 3UDEA 2CVEA 1IKWB 4J7CA 2AHOB 3R97A 1EKRA 4FS2A 2E7WA 3CE8A 2DBBA 2XI3A 3CCRS 4LSLB 3V5RA 4DV0F 5J2NA 1LW2A 1QVGR 1F1BB 1FWPA 2F63A 4N76A 2ZNYA 2J6TA 2B4VA 4N8NA 4ZPDA 2R8KA 1YJTA 2UXBJ 5A2QY 5HROB 2UUBJ 1CEZA 2RRAA 2JEGA 3IS9A 4OZLA 2OPPA 3MR2A 2D9PA 1TK8A 1VCTA 2ACMA 2GW8A 1WTBA 1QAXA 2CDQA 2PGCA 3JSRA 4K59A 5D0RA 4ZVTB 4NI2B 3SFUA 4DLGA 2DD8S 1C4CA 2NSBA 2KL8A 1RDRA 2XMVA 3D0HE 2B4PA 3HVAA 4GVBA 5A6PA 2HBQB 3VHQA 5SZTA 2MQ8A 2NPIA 4IRDA 2VOPA 3SZ2A 4YMEA 4IG0B 4O3PA 4J37A 4Z2XA 2KZMA 2BM0A 4J9MA 3UDLA 3LF0A 5LMNF 5C24A 3W64A 4RR5A 2W24A 3V6DB 2IA6A 1N54B 3WQPA 2DR8A 2C3YA 3G8QA 3DKDA 3QFWA 4MYUA 4NX9A 1KEKA 4QW9A 1J5EF 2LXFA 1WJ9A 3AXKA 3N4WA 4BLGA 2O5DA 3GV8B 2FHJD 4PWUA 1TV6A 1PG5B 1NJXA 4FVCA 3MM9A
chains in the Genus database with same CATH topology
3PXGa 2DNLA 5I3UB 4ECUA 5K8OA 1FKOA 1C1CB 2ZDOA 2R4FA 1REVA 3ULHA 2DISA 1WF1A 4JYAF 3M8PB 3QLHB 3PZPA 1F60B 2EVZA 1F5BA 3I0SA 5L9NA 2OP5A 3PNIA 4KR0B 4D3HA 1OSDA 3JSMB 3D0IE 2LEBA 4DJBA 2MXYA 4HT7A 5THWA 2DIVA 3DRRA 3MM6A 4NCGA 3S7RA 1HR0F 5KT6A 4BWJA 1VRUB 1WACA 4TXSA 2GHPA 1LW0B 2AJQA 3R5BA 1D8ZA 1TR0A 1R89A 4RW8B 3GIIA 1C4AA 2B9YA 3T9NA 5KFDA 3GIKA 3JB9k 1OWXA 5CQGA 2G13A 2N7YA 2DHGA 3T5HA 2HHQA 1HMVA 1WG1A 1YSJA 4Q0BB 3R5CA 1KQSR 4I7FB 2N82B 3J7ZT 4IFYA 3HKZD 1D8YA 4WZMA 1DLOB 2DCUB 1VLYA 3BREA 2PN6A 1HNIB 3TX8A 1JKHB 4RUAA 2YWHA 1LFPA 2V4RA 5D77A 4Y34A 2HGMA 1V6HA 1M5VC 2CPZA 4Q45A 3RR7A 1JLEA 1UFWA 7FD1A 3KHGA 3FVYA 4FN5A 1G6BA 2ZITA 4MK7A 3RAXA 3IRXB 3PKYA 2WONB 2XWYA 3I31A 2KHCA 3Q22A 4B9NA 2LEPA 4IDKA 2JOQA 3MZIA 5L8RC 4O0IA 2X1BA 3VWSA 1XR7A 3Q2SC 4GO7X 1MU2B 1VHFA 5CCLA 3RB4A 5IT0A 4ITSA 1XK8A 4KIAA 4YB6A 1JLBB 3GFHA 3DLEB 4WFZA 1S1UB 2KVIA 1WHYA 3CJ2A 3CCSS 2HIQA 3EGNA 1HQEB 5A6WA 3ZZ0A 1AXQA 1H3DA 4HT5A 1FJ7A 4KFBA 4NLYA 3EPIA 3CF5Q 4K4WA 1JJHA 2EG2A 2HHXA 4I69A 2IM1A 3CDWA 1K1QA 1H2UX 5CHCB 3UW1A 3RAQA 1DTTB 5CYMB 5J1EA 4K50A 1X5TA 4OQJA 3RRGA 4NLSA 4ES2A 5B0BA 3OFFA 3KK3A 2YKPA 3BN7A 2QA4G 2FLPA 2IA6A 3MECA 4F2RA 1E6YB 1SH0A 2KG0A 1QAJA 3DLBA 1SH3A 2GIQA 1UVLA 4OJGA 3PV8A 4BS2A 1NK9A 3GZ7A 2WSEC 5CYQB 3BGRB 5BR8F 2L48A 3OR1B 3QIPB 3P3DA 5G4DA 3JYTA 4H4KA 2HGLA 4YHHF 1QVFR 1HBNB 3S01A 1JX4A 3I9ZA 2WRMA 4G6VB 1SJRA 4I4BA 2WB4A 1GXLA 3IR6B 4U6PA 2B7BB 4URQU 2DH7A 4IUFA 1F5AA 1N5TA 2YX7A 3KHHA 2RSQA 2MQQA 1XN9A 1NKEA 2FLNA 2R8KA 4DV5F 4ELUA 4HTJA 4H4KC 3KK1A 1WF2A 4TN2A 4YB1P 2EFOA 2GA7A 3CSKA 2OPQA 3M1VB 1KHWA 1QSSA 5DETA 4WCEQ 2I0XA 2ZVSA 2GMJA 3BO4A 2XBPA 1WWHA 4LSNA 2ZD1B 2ZHBA 3GV5B 2R7WA 3QWUA 1X4HA 3NBPA 3CDBA 4QWDA 1FEEA 3MM7B 2I1RA 2CFXA 2HRYA 3H59A 1P1LA 2MPUA 5A8RB 2YNIB 3VQSA 4EFAC 5J2MB 1HNVA 4MTPA 1ZBTA 1MMNA 4WK1A 1Y3JA 2AYEA 2YWEA 1Y5IB 3M6XA 1VQPS 2R8JA 4LMZA 2V4QA 1HPZA 4ILRA 2AGOA 4R5PA 3AB2B 1LK7A 5KFBA 4ED0A 4MFBA 1S6PA 3A1YG 1M5HA 3IAS9 1WHWA 2EPIA 2JL9A 3HLUA 3M2VB 2V8DA 1S9EB 1GH8A 3RTVA 1IJFB 2VA3A 5IQQA 2RF2B 2NXUA 2ZOGA 2CQ0A 5T7LA 3DDNA 1TK5A 4LF4F 1HWKA 3RBDA 2GGPB 4A8XA 2FJVA 5IWAF 2FGCA 1W2BR 1FHTA 1FCAA 1UJ4A 4Y28C 4AUKA 3E2EA 2WBRA 1VMBA 4ZDNA 2R2RA 1LWFA 3AJ2A 2R7OA 2XG8A 1Q8BA 2D3ZA 2W9AA 3UQSA 2JVRA 1QM9A 3OSPA 3PX4A 1AW0A 3OVAA 1FK9B 2DNGA 4A8KA 2W8KA 3LAMA 3N6MA 1HBMB 4LFCF 2E7XA 3CWJA 3H4DA 4HH1A 4AXJA 3J7A1 1R8CA 4TY8B 3IO1A 4HDGA 3C66A 2WOMA 1GXUA 1ZAVA 2RKIA 3CD0A 3NLCA 3P6YC 5J1NA 2MYFA 3OXFA 2LDYA 2AGQA 1K73T 4DSKA 4FYDA 1RJJA 3ISNC 3OVSA 4XAKA 2OTJS 5F0UA 4FNIA 1MROB 4F25A 1ZTWA 4B3OA 2VH7A 5DDPC 4PRFA 1LWEB 4G3IA 2MGZA 2BQ3A 4JUZA 1UVMA 1JLFB 4M94A 1VQMS 1RYRA 1S0VA 4NLXA 1IKVA 1NO8A 5KG3A 2AQ4A 1LW2B 5LSRA 5T14A 3O3LA 3QAUA 1RT4A 2ADBA 1NJZA 2V0NA 5C42B 1IJEB 4CIOA 1GX5A 2GO9A 2HNDB 2I5JB 1O8BA 4WJBA 4OX9F 1X0FA 1U1PA 1MW7A 1Q7LB 2A2DA 1J2VA 4KO0A 1FDAA 3HI9A 3RZAA 2GMHA 3MXHP 3GILA 2LA4A 2VBXA 4BDPA 4NCAA 1R6YA 3NAIA 4QYZJ 2R9LA 2E29A 5GAHU 2RIJA 3EYZA 2MKCA 1D1UA 3CCES 5FJ4A 2BV3A 4O4RA 4ZVFA 4Q44A 2LA6A 3KKFA 1TVRB 3SCLE 3NMAA 3DOMA 4Q5VA 4UUXA 5J2QA 4I67A 1GAOA 2ALZA 3KMSA 2HVZA 3H5YA 2RT3A 4X4SA 1RYSA 2OLWA 2RE1A 4BC7A 2VQEF 2KI2A 3KFWX 4R8UA 4L3NA 5F3ZA 3E8OA 1L3KA 2HQIA 5KFKA 3IR5B 1A9NB 4IH6A 4ZPVR 1Y4ZB 1ZM9A 2O1PA 2DGVA 2KHDA 3DN9A 3GFYA 5LSOA 4KAIA 3T19A 3PRBA 4PUOB 1L5UA 1XWLA 1EP4A 4M8LA 3VZHA 2OMOA 3KMQA 4ID5A 1ZZFA 3X1LB 1S1VB 5BYRA 3CCVS 1C1CA 1K1SA 3MMAA 2YNGA 5DS7A 2UVRA 1S97A 4IR9A 4KGKA 4JI8F 4D3GA 4TYAA 4E98A 1ZPWX 4C3KA 3RRKA 3SQGB 1RTJB 2VD3A 4PXBA 1S9GB 3H5SA 1VFJA 1RWUA 5KFWA 1WELA 5U47A 4DL4A 2J5AA 1KQGB 2LQ9A 3FCHA 4PG4A 1FD8A 2QRRA 3R3TA 4ZPTR 3P96A 4A8QA 4ED2A 4KE5A 1S1XB 3GB0A 4NRTA 3ENWA 3UPFA 2YWKA 3FEXB 5LSLA 4N56A 2F4VF 3T1HF 1YI2S 2VKRA 3BN4A 3CCMS 3CC7S 4DN0A 3UD4P 2UXDF 2AGPA 3OL7A 1RT3A 2HLUA 3G8TA 1E6VB 3DDKA 5KFVA 4MIAA 4ZCIA 2W4DA 2KM8C 3POTA 1NB7A 4F2SA 2DITA 4YR0A 2CQBA 4K4XA 2EI5A 1DLOA 2Z2MA 3DYAA 4RWWA 3Q23A 1KNZA 2KXHA 4GMKA 3GR0A 1JKHA 2AWZA 3MTJA 2RU9A 3LO3A 5L9XA 5HBMB 1X9MA 2XS5A 3D2WA 2H5EA 2IFXA 2UP1A 2F8HA 2ZJRQ 2XCPA 2XNQA 3I56S 2MSTA 3NL0A 2VQFF 2JHEA 3I96A 2JRSA 1ZPVA 5G0RA 3MM8A 1TKXB 3CTRA 2MHEA 3DXBA 4M95A 5DLFA 1ZZNA 1TKTA 1GTEA 1DQAA 1LKZA 2LDIA 2MZJA 3BSOA 2GMLA 4CI0B 5A8WB 4JV5F 1VQ8S 2V5HG 1BQXA 4NLRA 2YNHA 2N7CA 5CZXA 2FTRA 3VCDA 4MIWA 4DS4A 2PI5A 1U47A 1OPZA 3ZZOA 1Z1ZA 1M5PC 2HNYB 3LW5C 1BGXT 3CCWA 2W4PA 4N41A 1N0UA 4NLGA 1IBKF 4OI1A 2CQGA 1V9OA 2Z2LA 4KV8B 2BANB 2XGQA 1O51A 1UFLA 2BQRA 4DN9A 4MMOA 4CO3A 3AA8A 5DLGA 3UDCA 2MQPA 4QR0A 5HN0A 3DI6B 5EGYA 5DQIA 1H2VZ 3DLKB 1R0AB 2XS7A 3PW2A 2QYCA 2YWFA 3M30B 4ZLPA 3BGFA 1S6QA 3M8SA