3NMRA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
b'SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUGBP Elav-like family member 1
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 35
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nmrA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nmrA02
3UWTA 4CIOA 3U1LA 2EK6A 1QM9A 1AUDA 3THTA 3J7ZT 3VAFA 2KT5A 3CMES 2MZ1A 3MUVP 3Q2TC 2CPEA 4UQTA 2M8HA 2RUGA 1RKJA 3I55S 3P5TL 3U1MA 1VQ5S 2D3OR 3MUMP 2V94A 1SJ4P 3LQVA 3NNHA 2L9WA 2RT3A 4PR6A 2B0GA 3CC2S 4QU7A 3CPWR 1S79A 1FXLA 2D9PA 2X1GA 1P1TA 1FJCA 4BS2A 1N8RT 2D9OA 3JB9k 2CPYA 2DIUA 2DNGA 1WF1A 4EGLA 2AYBA 2OTJS 1WEZA 2F3JA 5ITHA 2J8AA 2HYIB 1R8HA 3B4DA 3IWNC 2MGZB 1DZ5A 4C4WA 3MXHP 5EN1A 3CXCR 4OZ0A 2XNQA 3G6ES 1X4BA 1VQ4S 2MY8A 1VQOS 3VAIA 2CPZA 3VAKA 1U1QA 2DHAA 1DHMA 2JVOA 2KXFA 3RW7A 1WF0A 1BY9A 1U1KA 3SMZA 1HA1A 3BO4A 2A3JA 1OWXA 2OJ3A 3S7RA 2DNOA 5LXYA 4QPTA 2HZCA 2CJKA 5MLCV 1H6KX 3TYTA 2MKHA 1X5SA 1NU4A 2DH7A 2CQ1A 4WCEQ 2FY1A 1M90T 2LMIA 3CD6S 4WFBQ 1YJ9S 2DGSA 2N3OA 1X4HA 2G1DA 1OPIA 1X4AA 2KG0A 4TU9A 1X5PA 1K9MT 2MXYA 1RK8A 2HGLA 1FT8A 3CCQS 3MOJB 2RVJA 3UE2A 2YTCA 1U6BA 1UFWA 1VQ7S 1HL6A 3MUTP 1WG4A 1YTYA 1XN9A 2ERRA 2DIVA 1VQ8S 1WWHA 2MZSA 5LJ3Y 4U67Q 2RNEA 1O0PA 1JJHA 5DDRC 4ZKAA 2XSFA 2RRAA 2CPIA 3UD4P 4IO9Q 2AD9A 1KD1T 3G4SS 2E5IA 2QFJA 3MD1A 1A9NB 1ZZFA 1VQKS 2AYGA 1KOHA 2PEHA 3UCZP 2CQ3A 1D9AA 1W2BR 2DNNA 4OZ1A 2DNHA 2KYXA 2J76E 1K73T 2DNYA 4C7QA 1OO0B 1SXLA 4QU6A 2DH9A 2MB0B 2CQBA 5LXRA 2ZJRQ 2K8GA 2KM8C 2X1FA 5IFMA 2DGXA 1WI8A 2E5HA 2MJUA 1ZH5A 1WHYA 1YITS 3LPYA 2LYVA 1NJIT 2KG1A 2CQHA 1Q81T 1HD1A 3R1LA 5GMKa 3ULHA 1Q7YT 2DNZA 2GHPA 1X4FA 2VONA 5GAHU 1WI6A 2N7CA 3I56S 2SXLA 4LIRA 2KI2A 1KC8T 1YJWS 3NNCA 5JVGQ 2L41A 2MZRA 2VOPA 2MSSA 2DO4A 1VC6A 1PO6A 1JMTA 3MI7X 1M5OC 3CC7S 2MZJA 1A7GE 2DHGA 5IM0A 5LSLA 2DNPA 3PIOQ 3VAJA 2LEBA 2N3LA 2DHSA 3R27A 1WHVA 3TO8A 4RU2A 4UY8T 3Q2SC 2FC9A 2DGUA 3CMAS 1CVJA 3DLLQ 2MQOA 1DRZA 1H2TZ 4WIIA 1QVGR 2KHCA 1VBYA 3CCJS 1B7FA 2LKZA 2DISA 1ZZNA 5DETA 1UW4A 2RQCA 4F26A 1U1LA 2CQ0A 2Q79A 3FEXB 1URNA 4LJMA 1F9FA 2U1AA 2DNKA 1VBXA 4Y00A 2DGWA 4M5DB 3S01A 5GVQA 3G71S 1OIAA 3P3DA 1FNXH 1WTBA 3CUNA 1VC0A 3VAMA 2MYFA 3UCUP 5LSOA 3L3CA 2ADCA 4FXVA 3CCMS 5GADU 4IOAQ 2DNLA 5IQQA 3K0JA 1U6FA 3IRWP 3MDFA 3G96A 2E5JA 2FHOB 2QEXS 4Y0FA 4TU7A 2YKAA 1YHQS 2M52A 5CYJA 2DITA 1WG5A 1M5KC 4P6QA 4YOEA 1QVFR 3VF0B 2YH1A 2X1BA 4TLQA 1R8PA 2BZ2A 2RS8A 2MKKA 3CTRA 1FJEB 3ZZZA 5HO4A 2DO0A 5IM0B 5GAGU 2ADBA 1NO8A 2M70A 4ERDA 2LQ5A 1M5VC 2LECA 2KRRA 2LXIA 3DXBA 2CQGA 1VC5A 1U1MA 3MD3A 2XNRA 1WEXA 3NS5A 2GO9A 2CPXA 1N54B 1UP1A 4ED5A 2MHNA 3CULA 4CH0S 3VAHA 2XS5A 2ZJQQ 5CXTA 3P6YC 2XS2A 1U1NA 1FO1A 1X4CA 2MSTA 3G9CA 3CF5Q 1SJQA 2J0QD 5DDPC 1WHXA 2CPJA 2CQCA 3CC4S 5D77A 2RQ4A 4CH1A 2MKSA 2CQ4A 2DB1A 3CCUS 4WF9Q 2LA4A 1WHWA 2G0CA 3UCGA 2BOPA 1SJ3P 2LCWA 2KXNB 3SDEA 3CCVS 3PIPQ 2OSQA 2M7SA 2CQPA 4V19X 2O3DA 2RRBA 1X4EA 1X4GA 2M0GB 2M4MA 3FEYB 3SXLA 2XB2D 2DGTA 4W90B 1PGZA 5DDQC 3RW6A 1X0FA 2LXUA 3P49B 2OIHA 1WG1A 2MY7A 4C0OC 5HL7Q 2YH0A 1VQMS 1Q86T 2HVZA 1G2EA 2LEAA 3HHNB 1WEYA 5H1SV 2KU7A 3BEGB 2HGMA 2N82B 2F9DA 4F02A 3BO2A 1X5TA 2UP1A 1YJNS 2CPHA 4YUDA 1X5OA 3CCES 2LA6A 2DGQA 3US5A 1N52B 4Z2XA 1JJ4A 4TU8A 1JJ2R 4PRFA 2JX2A 2MMYA 5DDOC 3ZZYA 1SJFA 1KQSR 4J5OA 1S72S 1N88A 2CQIA 1M1KT 5LJ5Y 2J0SD 2MQQA 4W92B 4WFNQ 5DM7Q 2DNMA 2MZQA 3EGNA 1D8ZA 5BJRA 2QA4S 1U1OA 2CQ2A 1Q82T 2ZJPQ 3CCLS 2KRBA 2DGVA 1L3KA 4LMZA 2MPUA 3BO3A 2EK1A 3H2VE 3D2WA 2M9KA 2OSRA 1FJ7A 2DNQA 2KM8B 4IOCQ 2WBRA 3NS6A 1YI2S 2E5GA 2OTLS 1IQTA 2PE8A 5JVHQ 4YB1P 2FPHX 3SDEB 2DH8A 2X1AA 2DK2A 3G8SA 1H2VZ 2DHXA 3NMRA 3EX7B 2M2BA 3V4MA 1SJRA 3TP2A 2NZ4A 1VBZA 3G8TA 3UD3P 4F25A 2MQNA 2JVRA 1K8AT 2KFYA 2MKCA 2DNRA 5D78A 2MZTA 4FXWA 2M8DB 2VODA 3VALA 2E44A 2NLWA 3OW2R 1KOOA 2AYMA 2CPFA 5DM6Q 5GAEU 3J7YU 2YWKA 2MKJA 1VQPS 2MKIA 2JWNA 3B4MA 2RS2A 1HD0A 2I2YA 2KXHA 5FJ4A 2KH9A 4A8XA 2M88A 2MQLA 3R1HA 3HI9A 3THPA 3VAGA 2MQMA 1H2UX 2RU3A 3N9UC 1WF2A 2MGZA 1YIJS 2XS7A 2EVZA 3NNAA 4WKRA 1VQLS 2CPDA 2FC8A 1DBDA 3BS9A 2U2FA 4IUFA 3S6EA 1VQNS 2AYEA 2CQDA 1U1PA 2L08A 2VOOA 2F9JA 2I38A 2MJNA 2JRSA 2DGOA 4PKDB 3EGZA 5CA5A 1VQ9S 2K3KA 3S8SA 3CCSS 1UAWA 1YWXA 2MQPA 2KN4A 3MURP 1P27B 1FHTA 1WELA 2KVIA 1X4DA 1M5PC 4QQBA 3CCRS 1U2FA 1VQ6S 4WFAQ 1U1RA 4CQ1A 2HGNA 3H2UB 2G4BA
chains in the Genus database with same CATH superfamily
3MR5A 2C28A 3THTA 3MM5B 2HHPA 5B09A 2K7JA 1Q8KA 4AL6A 5FLXU 1UVLA 2EW9A 1HYSB 1KTQA 2BW7A 4WJBA 1RTIA 3TZZA 2B0GA 4DUYF 3DOMA 3QJLA 4QPXA 1WC1A 2QMUB 2R8HA 5D8HB 4KGMA 4I7FB 2NPFA 4J9MA 1X4BA 1UPPA 2A6MA 3A4TA 1HMVB 1U1QA 2FVSA 3M30A 2B4UA 1SI9A 2WB4A 2MKHA 5CH7B 2YPZA 5B0BA 3MMAB 2WBMA 3CD6S 3I9ZA 2VB6A 1X9MA 2IHR1 2DGSA 2W8KA 1NXIA 2HHWA 4IQMA 4M5LA 2MXYA 4OYWA 1JNZB 3HULA 2GJFA 4RR5A 1SKSA 1RT4B 1WG4A 5DZ7A 1XMQF 2OUGA 4JI2F 4O3QA 4C8ZA 5HJXA 3KJVB 4ZKAA 3MEEB 4YHHF 2P9EA 2ZHOA 3RZAA 4OLOA 1BQXA 4A8QA 1U8WA 4ZVOB 2WVFA 4ZCIA 3I9V9 4NA2A 2YXLA 2R7QA 3M9OB 4CNZA 3RJMB 3SYZA 1BUXA 4ANDA 4ZPCA 2MKYA 2DXEA 2BA9A 2GHPA 4OYIA 1WI6A 2G2ZA 1ICEB 4F0MA 5AE3A 4BWJA 3LP1A 3PG9A 3PRVA 3CJ3A 3A3PB 2VU5A 3EXCX 5J2MA 1Q78A 3RR8A 4WYLA 3PIOQ 3PTWA 5AE1A 4OJHA 4M95A 3KLEA 7AT1B 5CYMB 1LW0A 1TFWA 1DQAA 4QZVB 4RUHA 4TYBA 3BSOA 1FDBA 1EP4B 2VJUA 3H0PA 2OH2A 5GVQA 1OIAA 3CUNA 2VBWA 3HFKA 4UT4A 4YS2A 1DTTA 1D9FA 2B7CB 3R5GA 1AB8A 4DZDA 1AZSA 2FHOB 2QEXS 2NQPA 3GIRA 4P74A 3GCWP 3PV8A 2Q66A 1D1UA 3UN5A 2PD1A 3B78A 1VRTA 3NCRA 1CJUB 3UDVA 5IM0B 2IA0A 2LDIA 2NZCA 3DDNA 4NASA 4NLDA 4XDCA 3M2RB 3D3CJ 1C1CA 3GFXA 2X3GA 2ZD1A 1T95A 3SQGB 2CWKA 3D7SB 2RH3A 1AT1B 3V6DA 2GA7A 2MSTA 3G9CA 2HVDA 2W4DA 2UXBJ 3CC4S 2CPJA 5D77A 3CDUA 1O5JA 3D28A 2YKPA 2RSQA 1UJ4A 1S9GA 3GCXP 4NA1A 3TAMA 4RW6A 4J37A 1X4GA 3QATA 4B08A 4JI4F 1FX4A 2HBRB 2JL9A 1S1WB 1SL0A 4N5SA 4F02A 3CDAA 3L9ZA 2CADA 3H4DA 3E3XA 3MWBA 3EVOA 5G4DA 3VVUA 4ZA1A 4LF7J 2RAQA 3RGIA 1N56A 4ECQA 1N0VC 2A0FB 3DLHA 3GE9A 4O23A 4IH6A 4ZLPA 1UZDA 1HNXJ 3HSZA 4JOUA 2KM8B 4E98A 4ZMMA 1YI2S 4KV8A 1DLOA 1HBUB 4FKXA 2FZGB 1VBZA 4DR5F 3IAS9 2DNRA 5BYSA 1FKOA 1XBWA 3T6JA 3H5YA 1RYSA 2BACA 1K44A 3HZGA 3B4MA 3F41A 5DLFA 3OSPA 3DOLA 3HSJA 2KH9A 4HKQA 2I5JA 3N9UC 1LEOA 2VG5B 2XWYA 4CO0A 2U2FA 2ZM6J 4MIBA 4ZCKA 2AYEA 4ECTA 2AZ3A 1T9UA 2JRSA 4W98A 4JI6F 5CA5A 3PEJA 3PYFA 5BR8F 3W5XA 2JEFA 3PXGa 1E6YB 1CQNA 4CQ1A 1FDDA 1T9TA 2K1RB 3VAFA 2KT5A 2HFNA 1RTDA 1R0AB 1RKJA 1MROA 3P5TL 3JQMA 2RT3A 2XMAA 2GW8A 4P2MA 4BS2A 1N8RT 1WC3A 1CS4A 5A8WA 4RX6A 1R8HA 3PDNA 1B99A 1RHUB 1T0TV 3EZUA 4L6V3 4RPFA 4KGXB 1MWZA 3K5PA 5IT9Y 2C3OA 3N01A 5HP1B 2UUTA 3BSAA 3O3LA 1XIQA 1X5SA 2DR8A 3MTKA 2CQ1A 2M5YA 2FY1A 4DEZA 1X4HA 2PFFB 3L95X 1Q1KA 2R8IA 1K9MT 2F5GA 1T02A 5KOXA 2Z4PA 3GIMA 3HM9A 2H4WB 2AEJA 1KHVA 2W2QP 2I8EA 4KJIA 4U95A 2O66A 1WWHA 1JXVA 4I69A 3R5DA 4NLGA 1JNRB 3ZC4A 1CPZA 2VG6A 2F4VJ 4TY9A 1ZZFA 4HTJA 5J2PA 4M8LA 1AFIA 4Y65A 4DX6A 3W2VA 2WAQD 2ACYA 3M9NB 3DRRA 4O3SA 1FRKA 3EDRB 4OI3A 2E5HA 4LSLA 3KK1A 3PY8A 1Q81T 4PWDA 1TL1B 4IH5A 5AT1B 3SEOA 3G6XA 3CJKB 3ZNUA 3NNCA 2GIFA 2IYIA 2MSSA 4DV4J 4KPYA 1ZM3A 4HACA 3V6KA 3CIZA 2B56A 1HWLA 2XLKA 1N0UA 4RU2A 1JKHA 4EI2A 2E5LJ 3D3BJ 4F4YA 4B3MJ 1F3FA 2FJBB 2KFZA 1TUWA 2DNKA 2ZWOA 1ZPVA 1XMBA 4B3RF 1REVA 2W9BB 2R2TA 4AD6A 1GQEA 5LSOA 1H7XA 2Z2LA 5DG7A 3DC2A 2AGQA 3OUYB 2P8IA 1C0TA 3DOKA 1V3SA 2ZH8A 1T11A 3QRRA 2M52A 5CHCB 4I4BA 1R43A 4JV5J 1T94A 2HFZA 2JFDA 4DV0J 3I96A 1KTVA 4Y28C 1S12A 3ISNC 2PI4A 2ROEA 1TP7A 3CD7A 5KFAA 2YNIA 4ERDA 2ACMA 2OHDA 3DXBA 1TVRA 3BB5A 1DAXA 2GO9A 1NJZA 2ZH4A 4MKAA 1V3ZA 1QUVA 3QAEA 3LOUA 4NXNF 2VQEF 1NKBA 4ED4A 1B0PA 1WOPA 2F8HA 1B70B 4ECZA 1IKWB 2BOPA 5KT7A 4CO5A 2JOQA 3CCVS 4WZQA 2J0XA 4V19X 1X4EA 4WP3A 2FIUA 3DI6A 3MEGA 2E9TA 2EPIA 5EWGA 3D9BA 2CKWA 3AOCA 2X3DA 4YN3B 3DRSB 2QA2A 2HRUA 4KQZA 3WDOA 1BMQB 2YX7A 4LBIA 2IAJB 4KO0B 2V69A 2XGPA 4DCPB 2YKMA 3MEDA 4YUDA 4DN0A 3QIPB 4PRFA 2O1PA 3LANA 1NDKA 2BANA 3OXFA 4DSJA 3DGVA 2BW2A 4DL0C 2B7BB 2RDDA 1NK8A 4PQUB 2RQMA 5HAOA 3QAUA 3D2WA 1K0VA 3IBWA 3OL8A 1LW2B 3K8VA 2GJIA 3TUZC 2JC0A 3MR3A 3M2UA 4DWIA 3FCVA 2R8KA 4KB7A 2VH7A 2C2RA 3DRPB 2PFDA 1MMDA 3OD2A 4DV6F 5A2QY 1G6BA 1U6ZA 1HD0A 4AFFA 4N8NA 1URRA 3TAPA 1S1UA 5HLFB 2YWHA 1RT1B 4YDXA 6FD1A 2IC3A 4FF4A 3R6GB 3K5OA 1VQNS 2F9JA 4OIXA 5CCLA 2UU9J 4WE1B 3POTB 2XCPA 3CCSS 4EBEA 3X1LB 4ECYA 2VQFF 4FN5A 4A8FA 1T9XA 2R2UA 2HGNA 1U45A 1MLAA 2BJ3A 4NCGA 3Q83A 3TWZA 2EC0A 5L9NA 3MUVP 4PXEA 4UQTA 1FESA 2W7AA 3OL6A 2FJXA 4QIWD 3I55S 3R7SB 1VS3A 3T1HF 1SKRA 2X1GA 3AFGA 5AXLA 1NK9A 4QJVA 4WXOA 3AJDA 1WF1A 3DDKA 3I0RB 1PKUA 4CT8A 3FMWA 2UVWA 1Q8BA 5HQMA 3A8EA 1LV5A 1LQ9A 4LR8A 2JVOA 2KXFA 4WYWA 2XWXA 3HKWA 1KQFB 4PXCA 1H6KX 3TYTA 1IJEB 5KFKA 1Q4RA 4O0IA 4X64J 2Y9HA 1ZETA 5CZXA 2V68A 4DG1A 1NAQA 3PR4A 2N3OA 4KHPF 5HBMB 2MDAA 2KG0A 3QLHA 2AEMA 2J7KA 5B0EA 1S6UA 4LR7A 1FT8A 1HNZJ 4P9SA 1NK5A 1N6QA 2QRRA 3PW4A 1HL6A 3O8WA 4ICLB 3DRYA 1FXDA 1Q7LB 2ERRA 2PMHA 5KT2A 3TJ9A 4C8NA 1SV5A 2XSJB 2RRAA 1VJQA 2H48B 2POKA 3BN7A 4FDFA 2DNHA 1K73T 4M5DA 4LRAA 1UWBB 3W9IA 4URQU 2CQBA 3TR5A 4O4GA 3LPYA 3M2VB 1IVZA 2CQHA 2BVZA 3ULHA 5C42A 2W7PA 2HNZB 1F60B 4I6YA 1RABB 1YBUA 1X4FA 3PHTA 3QJJA 1HWJA 3HXMA 2DO4A 2GC8A 1VC6A 2GAHC 1T3OA 4X62J 1M5OC 1MNEA 2Z2ZA 3R2CJ 5A8RB 4C9DA 2DNPA 2LEBA 1T9YA 1GNKA 2BJ7A 3TO8A 3Q2SC 2FC9A 5IOLA 1TKTA 1ZTTA 3N5FA 1FERA 2VASA 3I0SA 2C2MB 1V5IB 2UXDF 1S6OA 1JLQB 2B5JA 2EFVA 1SC3B 3FEXB 4EEYA 2R8JA 1L3TA 3FSYA 5T14A 3ZTSA 5BXIA 3MM7A 4RWWA 3UCUP 3L3CA 5KFEA 4U7UD 3RAXA 1EIYB 2OP5A 1RT2A 2UVVA 4I6WA 1I5OB 5KFYA 3ENWA 1RWNB 2DITA 4H54A 3LAMA 2A2CA 1HIYA 1XR7A 2WSEC 3W60A 4I2QB 4DSIA 4JYAF 1HHTP 5HROB 2DHHA 2NXUA 4X66J 2ADBA 4ZVGA 4IG3A 5IWAJ 1ZM2A 4OZJA 2LECA 4KH1B 3IR7B 3MD3A 1UP1A 4FP9A 2COLA 1AYEA 3P6YC 5E3AA 2J0QD 1H74A 4CH1A 7FD1A 4L3KA 4WPAA 1BHNA 5EHHA 2ZH7A 1XJWB 1MMLA 4RLEA 2FQQB 3W9JA 2VC0A 2H54B 4FF3A 1J2VA 2Z0GA 1IR1A 3SCJE 1SCJB 3OTBA 4NYZA 4K4WA 1Q8IA 2HSEB 5KFFA 3Q8YA 3VCDA 1EQ0A 3BO2A 1IKXA 3US5A 1JJ2R 5DDOC 1S10A 1P6TA 1S72S 1N88A 4IO1A 3ZZOA 4PPZA 3DMJB 4YFUA 3VR1A 5LJ5Y 4NMXA 2DNMA 2MZQA 1D8ZA 2IVYA 2HZVA 4LMZA 4I56A 3KK2B 5L1KA 2WB1D 2M9KA 1Q5YA 4P71A 1BLUA 2VHGA 4DV2F 3ZTPA 2BJ8A 4ZJLA 3K17A 1RZMA 4R0EA 5AE2A 5J2MB 2ZBPA 5M2RA 2WOMA 4Q5VA 3JTNA 1RTHB 4WP8A 2CPFA 5GAEU 3HHDA 1IQZA 1MU2A 4KHRA 5FLXY 1N34F 3VAGA 1APSA 4DL2A 3WX8A 2IBOA 2MGZA 3J80Y 2BMBA 2ROPA 1VQLS 4ES2A 1DBDA 3MAHA 2HVEA 3GJRB 3HK2A 1DTTB 4PKDB 2H1YA 2W01A 1ZA2B 4DL6A 1NHKL 4DDFA 4C2MA 1CC7A 4YB6A 4ZJQA 4WU2A 1Y00A 1S4FA 3TRGA 3CMES 3HF5A 3RRKA 3OJUA 4Y2AA 1CJKA 4MTPA 1FI4A 2V94A 2IJFA 3LP2A 3LQVA 3NNHA 3CC2S 4QU7A 4LFBJ 5IV4A 2UUCF 2PO4A 4OX7A 1I1GA 4TNOA 2HBQB 3IWNC 1WDTA 1R27B 4MJKA 1S1XA 1TV6B 3OFEA 1DFDA 3JAMU 5J2NB 1GMVA 2FHKA 1CJVB 2APOA 2QTWA 2E9ZA 3THVA 5DG9A 1C2PA 2E1RA 2CDQA 2N7YA 4RW6B 4G65A 1OPZA 4RBUA 2CWXA 1QAIA 3OTEA 3M8PA 3D0HE 2HIQA 1YTYA 3CVKA 4GO7X 4BHQA 5KFQA 1KD1T 1YLXA 3UCZP 1N5TA 1W2BR 2W25A 3HVTA 1DJ0A 4U6PA 2HWHA 1S99A 1RSCA 4M94A 1KDNA 4LFAJ 2DGXA 4Y2IA 9ATCB 2LYVA 1N33J 1X31C 1VHFA 2B9EA 2V50A 2E7XA 3A3NB 3R1LA 3NGUA 1S6PB 4ITSA 5B7WA 1IR0A 3H42A 2GNKA 4YY3F 2IPOB 3D1HA 2ZVSA 2XMTA 4JBCA 1FD8A 1IKYA 1B0VA 1WHVA 1TAQA 4ZIVA 2HS3A 3KTQA 1KSPA 2HIYA 2RD5C 3KLHA 3ENAA 1URNA 2HQIA 4USUA 5CABA 3S01A 3B8HA 5A6WA 1NKCA 2J6TA 2W9AA 2QA1A 2VBZA 3GJSB 1R31A 1YX2A 4NXMF 4ELVA 1UJ6A 2RQKA 1RTDB 3CCMS 4JV0A 1Q5VA 3G6YA 4RUAA 1MROB 3H8YA 4DQRA 2W4CA 1YVFA 5C25A 4AYBD 5HATA 1FRJA 4N41A 2YNGA 2C3UA 1QD1A 4Q0BA 1UFLA 3W7BA 5A8WB 5L38A 1SUQA 4RW4A 5F8LA 1Y4ZB 2M70A 4DUZF 4ZP8A 3MEKA 4CO1A 1VGYA 4DFPA 4IR9A 1YJVA 1XC9A 2CPXA 3T5HA 2MHNA 3M1VA 1S0NA 4P2XA 2ILZA 3KLFB 1SH0A 4GVBA 2XS2A 5C2CA 1SJQA 3NXZA 3W9HA 3NRBA 5KT3A 5HANA 4OMFG 3OV7A 3UCGA 3FCHA 2ZBRA 4ETZA 2XLJA 4OHXA 4JI3J 2G1HA 2O3DA 4JI0F 3UVJB 3FKBA 2VFRA 2XI3A 4ILRA 3FEYB 6FDRA 3F56A 2DCLA 4DL4A 3PX4A 5I42A 2YNHA 2OKQA 4FXDA 2VKZG 1M1GA 3C6UA 2F9DA 2GIQA 1Y10A 3U7JA 2VV5A 3DGPA 1BQMA 2AJ0A 2MMYA 3NWRA 3OT9A 2A6OA 1JXEA 3VZIA 4X4VA 5DM7Q 4EBCA 4LSLB 1YKWA 4LF2A 4D3HA 4KH0B 2QMWA 3KHGA 4PWDB 3JSMA 4DR3F 2CA9A 2H65B 3CJ2A 2V4JB 1BD6A 5DO2A 3JTPA 3CMQA 4UF4A 4CLZA 4HACB 4BLGA 1OS5A 3IGNA 1HR0F 2J9EA 3NKYA 4AQYJ 1FTRA 2FLNA 3EPIA 1PBUA 4A8XA 1PCAA 2IFXA 4ED2A 2MQLA 4NEZA 1JQGA 1J27A 1IBKJ 4DUTA 1HBOA 2C2OB 1WF2A 1YIJS 4LVNP 1S49A 5KFDA 3JTOA 4U8YA 1U0SA 1FWKA 3C15B 4HI2A 3S8SA 1HNIA 2GHWA 3AB4B 3DOKB 1QDUB 4S0MA 4CO2A 2GMLA 2EK6A 4F36A 1B3TA 3A13A 3WBZA 4F4XA 2RF2B 3U1MA 4F4KA 1RBLA 1NDLA 4CYUA 2J9CA 1IM4A 4USTA 2B43A 2D9PA 2HMIB 2D9OA 1WC6A 3QFWA 2XI2A 5CZVA 2AYBA 4DQQA 1IBMF 3CJSA 2UVUA 1B4SA 1PG5B 4OZ0A 1OSCA 3VHQA 2MY8A 4YB5A 2H5JB 5D0EA 1S1VB 2GAGC 4XDDA 3GIKA 3CO9A 2Y1IA 3IWXA 1PBAA 5G0RA 2CUYA 4M5HA 1TL5A 3N0VA 3T1YJ 4JI5J 2IM0A 1I51B 2VPZB 3MR7A 4AL5A 4V19J 4NRUA 2DPJA 1S0OA 3MOJB 5I3UB 4KKOA 3WC0A 3IN5A 4OYMA 4OZ2A 5LJ3Y 2YKMB 1GK8A 4BCAA 4LF5J 2F65A 4HYKA 2GVDB 1EHWA 2CG4A 2GX8A 1P9YA 1JJCB 4QWBA 2FJVA 2VPYB 4DCOB 2J76E 1N36J 2B3TB 2IYGA 2AV5A 1SXLA 2R4FA 3IAM9 3H59A 4ID8A 2BDPA 2UZAA 4XK8C 3A12A 4QOTA 2KG1A 2W24A 3N5BA 1N32J 4PAAA 2UUWA 2V2VA 4EUVA 2W2NP 5J2QB 2UV8A 1JMTA 4DPOA 1S1UB 1GH8A 4ZJOA 4KAIA 3FBBA 4D3GA 1SJ1A 1VOMA 4UY8T 3QMQA 1CVJA 3ZTOA 4CLTA 1Q0NA 4RJVA 5DGAA 5H9EJ 5HJYA 5DZ6A 3GSIA 3OR2B 5ETQA 1NBEB 1VBXA 3R3TA 4B9UA 3ZZTA 4JI8J 2NUHA 1PJ7A 3P3DA 2UXCJ 4I67A 3FDSA 4ZCMA 3PX6A 5ETRA 2V63A 2DKOB 3K0JA 3JSRA 4OQJA 3HLUA 5GAEI 1M5KC 4YOEA 4DXLA 2YQ0A 2BZ2A 1OQ6A 3E8OA 4NLTA 3CIMA 1JLCA 3OLAA 1WKJA 2GIRA 4G1QB 2KVQE 4FYXB 1LK7A 1RT7A 5J1EB 1QTNB 4KFBB 3QPIA 4KBIA 2AHOB 4ED5A 3CULA 2EBEA 4OX9J 3MFIA 3GPAA 2NREA 1WHXA 5IXUA 3QLHB 2DY9A 2KXNB 3IGVA 1S57A 1T05A 4RW8B 2CYYA 4N47A 2M0GB 3ZZ0A 4CM2A 1PGZA 4PUOA 3OL9A 2ZM6F 5L8RC 3ZZPA 2YH0A 5HL7Q 1TKXB 1JLFA 3RBDA 3M8QB 4K4TA 2LEAA 4NLXA 3I5BA 2AGOA 5H1SV 5B0DA 1IKVA 2N82B 3MGJA 5T41A 1N48A 2AW0A 2DGQA 3UNYA 2GQCA 3M32A 3ZFVA 4J5OA 1JB0C 1WTFA 4X2BA 2KL8A 1F6TA 3OFGA 3W66A 4O4GB 4NMLA 5F3TA 5BYQA 4CLUA 1RACB 1L3KA 2DD8S 1XNQJ 3Q22A 4QIVA 4IOCQ 1FX2A 4Y34A 3V81A 2OTLS 3IM9A 4QWEA 5LT5A 2X1AA 2DK2A 2ZH9A 3SV4A 2M2BA 3DHWC 3QSYB 5KFXA 2M8DB 4ZVEA 2E1CA 4J9OA 5A8KA 2MKJA 4JI7F 2PIIA 4F0KA 1R3NA 1TKTB 2KJVA 2IRYA 3T5JA 4A8KA 2B5JB 2ZOMA 4CLSA 4EYHB 5LMNJ 2KB2A 2O5DA 1RAAB 4NLUA 2EKNA 2OMLA 3TUJC 3IBCB 5JMNA 1YWXA 3R2DJ 1TFYA 4M1KA 3C8YA 5KFPA 1U2FA 3BKUA 2B51A 2IMWP 2YWEA 1WD6A 5AJ3J 4USJC 2F4VF 5FDLB 3MM8A 1HWUA 2LXFA 4R8UB 1BGXT 1P1TA 4ED7A 2BJEA 1GXTA 5JXSA 5DLGA 4PXBA 3QGPA 5D3GA 4A8OA 4NI2A 3ET6A 3BZQA 4LQ3A 4HH0A 4ZP9A 1DHMA 1EJ7L 2J9DA 4DV4F 3VZHA 4UQGA 2R8GA 3G82A 1S9FA 5LSRA 1M90T 1ITPA 3GWCA 4WTOB 1HQ2A 1XTZA 3C16A 1X4AA 1VJWA 3CDBA 3RRGA 3DM2A 3L4BC 1UFWA 4ELUA 3LP0A 3ELHA 4DR6F 1D9DA 1GEHA 3HVWA 4IFYB 3R7NB 4DF8A 2HBYB 1KONA 4IFVA 4ENOA 1LFPA 4WK3A 5C24A 5KG0A 4L76A 3VVTA 1AROP 2F63A 3UR0A 1W26A 2DH9A 2Q6BA 3MCOA 1HNWF 5IFMA 3QT6A 4J9SA 3IO1A 2EG2A 4DV0F 4ER8A 4LIWA 3UQSA 5GMKa 4DPTA 2XCAA 3I4HX 3UD5A 2CNLB 2CIMA 3DLEA 5HVHA 2H51B 3HZEA 2L41A 1G7CB 1MU2B 3QGGA 4JUZA 2W4PA 3DU6A 4NLWA 1JLGB 2VG7A 4BDPA 2B4OA 3IS9A 4LF4J 2WW8A 4QBUA 1SVDA 1TELA 2W2MP 2ZNYA 5E5NA 1VRUB 4PG7A 2YKNA 2PGCA 3EM1A 4RZRA 3G71S 2BABA 2YNFB 1FNXH 4ZPDA 4K5SA 3VAMA 3MAQA 2Z2YB 2DNLA 1XQIA 2G0JA 3NMAA 2CVIA 6AT1B 1QSYA 3MCNA 2ZHBA 1U47A 3KXDA 2FVPA 2RE1A 5HO4A 4I1TA 5GAGU 4NLYA 1S1XB 3AQOA 1NK7A 4AL7A 4YMEA 3F44A 4DQPA 1TR0A 5KT5A 3EMTA 4QCLA 2IDEA 1TL3A 4QW8A 5KG1A 4DSFA 1LWEA 1K47A 2NSCA 3CCUS 1S1TB 1YGYA 4IG0B 3OHBA 4UZCA 1CEZA 3ZTQA 2LCWA 3PFEA 2QMXA 2XYHB 3T5KA 2HHVA 4RW7A 4R25A 4RW9A 2DGTA 4W90B 4FBTA 4ED1A 4J90A 1D0EA 2XGQA 2JHEA 2UU9F 4OV1A 1RDRA 2OFGX 3QQCD 3HD2A 3L09A 2V6AA 1RAFB 1VFJA 3HVTB 5KFZA 1JJ4A 3GJQB 4TU8A 3HHLB 2XY7A 2D1CA 1RWXB 3KMSA 2MQQA 3B82A 4WBFA 1RHJB 4YHHJ 1VK8A 2Z56B 2ZJPQ 4P7TA 2W2PP 3D5MA 3JQKA 1ZTWA 2EK1A 4DBQA 4WP9A 1SC4B 3KDOA 2X7IA 1HQEB 2C42A 1NDPA 2DHXA 3UW1A 3V4MA 4UOCA 2A1BA 2KFYA 2NS1B 4P7VA 5D78A 3CNQP 2XC9A 4GC7A 2B4VA 4LBHA 4FNIA 3GSDA 1RHQB 3AA8A 1OY9A 3Q8SB 3CJ0A 2GCFA 3BV8A 4KT0C 1HW8A 1U1PA 4J9LA 2DR6A 1HARA 4MKYA 1FA0A 2DGOA 3EGZA 3G86A 4M5GA 4B9NA 3H98A 4ZPBA 3JAMY 5E7OB 4JV2A 1HBMA 2K06A 2HWIA 2HVIA 2QX0A 2OPSA 2HZAA 2XBPA 3HDSA 2E1MC 2ASDA 2D3OR 3EE3A 4RW4B 3FQKA 3KOAA 4PR6A 1IN0A 3DLKA 1JWWA 2XO7A 1WEZA 1Z1ZA 5ITHA 3D1OA 3M1VB 3MXHP 4PCQA 1XEZA 3LALA 4WIQA 3DLBA 5DQIA 3BBCA 2R7UA 1ACMB 4G3IA 1TZ0A 3NL0A 1FF2A 3BO4A 4B3SF 3DDIA 3WIUA 5MLCV 3QJPA 4OI2A 2MHEA 1DY3A 1BXNA 2HFSA 4MAKA 4DN9A 1NRKA 5KAKA 3M8YA 2OPRB 5I42B 2YNHB 4DV5J 3J7YI 3D1QA 5DG8A 1VQ7S 1TMJA 2IRUA 4K4XA 3GQCA 2RRNA 3M05A 1RT5A 2WVDA 1U2RA 3MZIA 2FJWA 2HK3A 1XMOF 2DBBA 1K0TA 1S6QA 1HI0P 1REGX 2C3MA 4UOFA 2CQ3A 2D7SA 3FSIA 2AKWB 4K0KJ 3KWMA 4NEYA 2KYXA 3GYGA 3AD7C 3JSMB 4DV3J 3SIPB 1T03B 4P2FA 1N5YB 1PSDA 2Y1LB 2HKEA 4ZVUB 3W8PA 2OI2A 1RXOB 3IXQA 4B9VA 1Q7YT 4IOBA 4X66F 3OL7A 2MLYA 2EKYA 4X65F 2SXLA 4IDKA 1Z2LA 3AXKA 3PKMA 1U02A 1YZ7A 2EWHA 1FWLA 4ANEA 1YJUA 3Q23A 5A0YB 3HSDA 2B6AA 2VIHA 2VJVA 4DR5J 4QIGA 2E1PA 1QVGR 2WK4A 4X4PA 1T9VA 2J0WA 2RQCA 2V8GA 1HNIB 4ZPTR 4C11B 2CFXA 2P2CB 3W3SA 2FD2A 3GB0A 4LFCF 1SL2A 1VCTA 1VIXA 5GADU 2YQ3A 2FVCA 4Z7CA 4JI6J 1I94J 5M2UA 4PG6A 2XY5A 3TA1A 2Q6CA 4NRTA 5CYJA 1EZZB 2XZWA 4P6QA 1LWCA 3MMBA 3UI3A 3NGSA 1J5EF 2C2DA 1BWEA 3VGSA 3UDCA 2LQ5A 4HL9A 1U0HB 1RE1B 1MSWD 1UEUA 1TK5A 3BQ1A 4F0HA 4NPOA 1U49A 3T5LA 2RMLA 3NS5A 1NB7A 1UL3A 2XS5A 2ATLA 2BOAA 5KFIA 4ID5B 2YKOA 4F50A 2MKSA 2R7SA 2HBZB 2HHSA 4FYYB 1BWVA 3CJTA 3PIPQ 4KKOB 2CQPA 2NXEA 2EG1A 1UWAA 3RRHA 4ZVTB 5ADZA 4C0OC 2HURA 3WZ0A 1WEYA 1W7WA 3CD5A 1TAUA 1RHKB 1VISA 2GV1A 2FHJD 2UP1A 1F5BA 2V9KA 2LA6A 4LF9F 2AZ1A 4DLEA 2HVHA 1YK9A 2CQIA 2KJWA 4RUBA 2J0SD 1CBKA 2UUAF 2DR5A 2LQBA 4PZVA 2KRBA 3O44A 2GVZA 1QAJA 1UW9A 1TL7B 3BSCA 3OFHA 5K9FA 2WBRA 4LFBF 2HEKA 1JLEA 2GMJA 1N4LA 3NGKA 3MM5A 2YY3A 1SJRA 4KC5A 1FFGB 5L1LA 2D69A 3AHPA 2O67A 2NSBA 4EWTA 1NMEB 2JWNA 2RS2A 3KNAA 1N5QA 3IMQJ 1E6VB 2RU3A 4I7FA 2VL1A 1WKKA 2ZH3A 4TY8B 1HMVA 2ZH1A 2MJNA 3BREA 4URSA 2K3KA 5HSPA 2MQPA 1UKUA 4KPCA 2WONA 2XULA 1F5AA 1VQ6S 3CDWA 3A8JA 3MMAA 3BGLA 4B3RJ 3AB2B 5K20B 3PR5B 2MZ1A 3DYAB 1Y5IB 2ASYA 1JLCB 3BH6B 4CWBA 3R6LB 3MM9B 3GYXB 2HLUA 3IR6B 5J1PA 2IY5B 2DNGA 1SC6A 2KT3A 2OPQB 1KQGB 1NZAA 3PFOA 1H38A 1OQ3A 3KJVA 4LFAF 4FS2A 1DZ5A 1SH2A 3MEEA 3CXCR 2C2ZB 1N33F 1CLFA 2GS8A 2IMOA 2AX1A 4A4JA 5DGBA 1UVNA 2DY1A 3HCXA 4ZN1A 1MMNA 2A3JA 2NYIA 1RT6A 5LXYA 4CLFA 1NU4A 4ZN3A 4O44A 1T05B 3EYZA 5HMZA 2LMIA 4NXNJ 3MMJA 2GHVC 2G1DA 3TNVA 4EYIB 2BM0A 3K8WA 3AD9C 5GAGI 4DL3A 4G6VB 1MN7A 3OBIA 2G0IA 2CZ4A 1VQ8S 2CDRB 2HNDB 2RB7A 5D4LA 4WFYA 2YBVA 2IM2A 4AUKA 5CYMA 5KG2A 4RWXA 1MG7A 4RBTA 2DNNA 1EP4A 2P5VA 4DF4A 4I68A 3IFEA 2DTJA 1NNDA 3GG1A 3MOZA 3V81B 3SI8A 3QRPA 5IT0A 1YITS 4CRJA 1HD1A 1U2CA 1IR2A 4CP5A 2DRAA 1HI8A 2DXDA 4XAKA 2ZE2B 1KLMB 4P73A 1TKZA 5THWA 2BQUA 2XMMA 3VGVA 4O0NA 5H9FK 1VLOA 1CJUA 5IM0A 4UUXA 3TJ8A 3M2RA 3K5LA 4BWMA 1ZZNA 1UW4A 3DU5A 2F1FA 1F9FA 2Z8QA 1GMWD 1NM2A 3OVSA 4OX8A 4JI3F 3N28A 5FD1A 1LNQA 1XNRF 1X9WA 1NK6A 1NJYA 4ZVRB 2AT1B 1UVMA 2QO3A 3BGRB 3MM8B 3KUGA 4NLQA 2VQFJ 4C97A 3VF0B 1EETA 1R8PA 1FJEB 8AT1B 3ZZZA 5IT9U 4K8RA 3ET6B 5L46A 1S1WA 3TX0A 3OVBA 3HHLD 3CT9A 3MECB 4CO4A 1CJTB 2ZUAA 4EZ9A 3LWLA 3FBFA 5KFHA 4CH0S 4LRBA 4I6AA 3DLGB 3E51A 1ZM9A 1FO1A 1X4CA 3G82B 2CQCA 1SL1A 2EFQA 2QSFA 3CD0A 2CQ4A 4QWDA 1X7VA 4HTIA 4AQYF 2FYXA 2QYGA 2WZ1A 3HP6A 2NXNA 3X3UA 2JC1A 4JI1J 2I1RA 1HBUA 1IBKF 1F1BB 2HQCA 3LP0B 4E8UA 2XZTB 2BKNA 3H25A 3V6HA 1X0FA 5CYQA 4Q44A 5SUHA 4ATNA 3OR1B 1LFWA 1JX4A 1NLKL 2CJAA 4C8KA 3LO3A 2YPYA 5C24B 3QSIA 4IKAA 2B9XA 4FBUA 1SIWB 1NJXA 1W25A 1QUPA 3U27A 2VG5A 5EWEA 5RUBA 3EGNA 4GKJJ 2BYCA 3D0IE 2E9RX 2NXJA 3CJ5A 1S5ZA 1NKEA 3M6WA 1LOUA 1YZ6A 1E6YA 2FLLA 1RLCL 2BE2A 4DX5A 4NWBA 1IQTA 1RHRB 4FKYA 5H9EK 3DLEB 3SDEB 3IR5B 3G8SA 1L3VA 5KG5A 3R97A 3EX7B 4FYDA 2RKIB 2FDNA 3Q0AA 1R0AA 5AXNA 1K8AT 3IRXB 2E44A 3KHHA 3EGVA 4HT5A 2PMZD 4HR2A 3NCPA 3FMBA 1KR4A 2HNYB 4DV1J 3TW0A 4B02A 3QNWB 5KTQA 2MQMA 2H5IB 2FGCA 2V4RA 3T1YF 5M2PA 5HMXA 3QO9B 3NNAA 4JI5F 1J5OB 3BS9A 4GMKA 4U96A 2XMKA 1FDNA 3LUYA 2UXDJ 3O5TB 1FHTA 5HP1A 4ZLLA 1FE0A 2IM3A 4A48A 1RTJA 2G4BA 1JLAA 1AUDA 1QM9A 4DQIA 4B3TJ 3P45B 5HMYA 3JXOA 2DCUB 2CPEA 2VPXB 4TXSA 3PACA 4Y2MA 2VBXA 3MUMP 1KBRA 1HBNA 3FK4A 4A8MP 1S79A 2BRKA 4PWWA 3D66A 3MF5A 4JYAJ 2VDIA 1Z2ZA 2VUGA 1FXRA 4BC9A 2ZFHA 3QGIA 1HQUB 5GADI 3HX9A 4XIUA 1FTCA 1VYAA 3S7RA 4PYDA 4U7CA 2HZCA 1U7LA 4DJBA 2ZZTA 2UUBJ 1EKRA 2PN6A 1NH7A 2YKQA 3SCIE 1B64A 4DMZA 1GMUA 3UPFA 1RUSA 4QIFA 1CSJA 3QT5A 3CJKA 1FE4A 3QZ7A 1C0UB 3AA9A 1XN9A 5IC6B 2ZH2A 2HHHJ 4JI8F 3LW5C 2RNEA 3NBPA 2UXCF 1O0PA 5DDRC 1HPZA 3TZYA 2CPIA 1EB0A 2HFOA 3TAQA 1F3VA 1VQKS 2PEHA 2YVSA 4OHZA 5T7LB 1ZOTA 2WVCA 4CCHA 1RLDA 1VK3A 4DQSA 1R6VA 1D8YA 2W9BA 4U9RA 3MPYA 2MEWA 5A2QU 1NJIT 3A8IA 3T9NA 3KJNB 2ABYA 2BE7D 2KI2A 5JVGQ 2OELA 5F0WA 2L48A 1SQGA 5D4PA 3GILA 5K8NA 3T1AA 4YR2A 5EDWA 1WDDA 1NB2A 2C2KB 3EUNA 3PO4A 4O3RA 1IBCB 2DISA 2ZH6A 2VFSA 4Q45A 1VIOA 2J6UA 4DPUA 3HMJG 1Y3JA 3MPWA 3FEZA 4HDGA 3HJVA 2G13A 1S0VA 2WVBA 5F9NA 3ILIA 1U26A 2CJQA 4QR2A 1YRXA 3H7HB 3IRWP 3MDFA 5DRKA 3CSKA 2EFOA 1O6XA 1N5VA 4LVOP 4USVA 2FUG9 3AQPA 1QVFR 2NXCA 4TLQA 2C2EA 3Q8VA 2IRXA 4MFBA 2QL5B 2F40A 2BR0A 3EZ5A 3DRSA 3LA0A 1JLBA 1XNQF 2HQFA 2IAJA 3QYYA 2LEPA 3R5CA 2RIJA 4P10A 4WU3A 2HW3A 1U1NA 2K3IA 3LPEA 3CE8A 4LREA 1X9SA 3JSYA 2GGPB 3PW5A 4WF9Q 1LW2A 1FKPA 3RU0A 3P96A 2QFIA 4GKKF 4MK9A 4M5KA 1EARA 2XYPB 3M6VA 1NSQA 4RNOA 4M5NA 1RT5B 3W5YA 3DRPA 3DLJA 3P49B 3JSBA 2OIHA 4JV1A 1IBLJ 3I5CA 4ES3A 3PHEA 3C6TB 1PC4A 1RU1A 1H7WA 1YJNS 4CTAA 1FD2A 3O1LA 1RT1A 5ETNA 4NYPA 3W2WB 2JX2A 4B9TA 4L74A 1KQSR 2DRBA 2BUNA 1AA1B 1TU0B 1UMJA 4J9NA 4NCAA 2WSFC 1EKSA 4F04B 4WE1A 5AJ3F 2MPUA 2PC6A 4H4OB 2D74B 4K4SA 3EWGA 2PI5A 2C2NA 3BGFA 1YSJA 4YB1P 4IDKB 3SZ2A 1VBKA 3R8YA 1Y3KA 3EGWB 1WSVA 1PYOB 3GZ7A 2VODA 3VALA 3E01B 2FZCB 1UCNA 1RT3B 3OHAA 3OFFA 2KZZA 2QSWA 4YB7A 1RWVB 3NY0A 2RILA 4XPCA 4FPRA 3KK3A 3R1HA 3A8KA 4F7VA 1WSRA 3I0RA 4NE9C 1GXLA 3CCZA 3KKFA 2BV3A 3BM7A 5KOWA 4Q7AA 3AAWB 3FRYA 2KVIA 1VMBA 3H5XA 5JUMA 3H2UB 1RBOB 3KUHA 1LWCB 4GVLA 3RYLA 2A2DA 2W1BA 1OMSA 3BGOP 5ETTA 2QJ3A 5L1IA 4NXMJ 5KG7A 3BR8A 1PYTA 3TVZA 4YDDB 1TQLA 2BJ9A 1FJCA 2QG9B 1RA6A 4ICLA 4AXIA 2DIUA 2XSJA 1S4EA 4B9LA 2DRDA 3DRXA 5EN1A 2E7VA 1NDCA 3G6ES 3GR1A 2Q43A 4ZVHA 4RNFA 3IWLA 3S1TA 1U1KA 3FVYA 1UWBA 2QGFB 4QPTA 4J9VA 2QLWA 5KFRA 5F8IA 2KT2A 3M2VA 4HHHA 2AP6A 1X60A 1OPIA 1RK8A 2B9YA 4LF4F 1RTIB 4LSNA 3O6QA 2V8HA 2R2SA 3H5UA 3KHRA 5LMUJ 2CJBA 3DOMB 4CNYA 4DU7A 2IDLA 5A8RA 4U67Q 4JI0J 4Z37A 4B9SA 4ETXA 4ZITA 2P6TA 1RISA 3PRBA 2AWZA 2AD9A 4RUCA 2E5IA 1FDAA 2QFJA 4NLOA 1D9AA 3I87A 3M30B 5IQ6A 2PDAA 2CRLA 5MAOA 2DNYA 3R5JB 4ZDNA 4K4VA 2OO4A 4N8OA 1KFSA 4EMDA 3VQSA 2HK2A 1WHYA 2R7OA 3RAMA 3KDNA 5HVGA 3DNCA 3TQ1A 1KLNA 3MR6A 2LP4A 1HFEL 2DJWA 3J80U 1PJ5A 2QLXA 4DR3J 3SSQA 3MPDA 5L39A 3PJXA 3CC7S 4I2QA 4DR1J 3J7Z5 3KJFB 3AOBA 5HROA 2P9CA 2N3LA 1KVIA 3CCTA 2DGUA 5LL6d 1DRZA 1HR0J 5AXKA 3N6LA 2CG8A 2ATCB 2Q79A 2EEYA 4LJMA 4PABA 5IV3A 1OY6A 2WONB 4K2XA 1VC0A 2QN6B 3NGRA 4USMA 2ADCA 3N79A 4IRKA 1JIHA 3FRZA 4DV7F 3NCQA 2QYCA 4ZPAA 1YHQS 3BN4A 3LP1B 2ALYB 2I6WA 1AW0A 4CLLA 4Y6IA 1S76D 4QWAA 3M4XA 5E3RA 2ASJA 5DS7A 1HWIA 2DT9A 4ILMA 5L9XA 3KLEB 4ZVQB 4XPEA 1LW0B 3CW2C 3I4PA 4C3LA 3RUBL 4K50A 1FNOA 1N54B 1UVKA 5EX3A 4J9KA 4ZP7A 1O51A 2KTQA 4OI6A 3OTOJ 1IBMJ 3DMJA 2M3DA 5CXTA 1RT6B 2DR9A 3BDPA 4O44B 2YX1A 3KK2A 3MR2A 4MYUA 3K7RA 1AZSB 2LA4A 1HNVA 1KEKA 2Z58B 2OSQA 1KKHA 4Q43A 4LF8J 1VRTB 3LF0A 2HHQA 3PW0A 2LXUA 1RTHA 1RAJA 2FLOA 4X4OA 2BXJA 2R3VA 1V5VA 4WZMA 2JH3A 3NAHA 2C3YA 4HEA9 2CPHA 1C1CB 2ZD1B 2XZDB 4FF2A 4G1PA 4NLPA 2CNOB 3MAAA 4DR4F 2OEJA 3V6DB 5IT4A 1NHVA 4ZHRA 3CCLS 3UNGC 3FSXA 4NA3A 3H2VE 1FRXA 1VHIA 2J7UA 1Y5LB 4OZNA 3MCMA 4WWSA 2E5GA 3HVAA 1TKZB 1S9GB 4WFZA 2AQ4A 3TAMB 3UN3A 3TP2A 1NZ8A 5F8NA 2MQNA 4C8YA 2VA2A 3W63A 2J6SA 2ZBQA 2RDJA 2NLWA 3NOGA 3E2EA 5KFVA 5F8MA 2MLZA 3M6XA 2OLWA 2FLPA 2G2YA 4NYOA 4DR2J 4ALZA 4XTTA 3HT3A 2QV6A 1FVSA 3HVRA 3ETMA 1TV6A 1RA7A 2JFKA 2CJYB 4IUFA 3I6PA 1B7YB 2FVQA 4R5PA 4PXDA 4LR9A 1U8SA 2B9WA 4EU0A 5J2NA 1VQ9S 3ADAC 4DV5F 1CJVA 4DPYA 1T3NA 2VPWB 4C8LA 4KV8B 2DEIA 4QR1A 1DLOB 4CT9A 3VQTA 1XK8A 1EETB 5ETLA 1SPBP 3SFGA 1FKOB 2FB0A 4N76A 4NL5A 4TN2A 1BE4A 3FGVA 2CAJA 4B3OA 1GXUA 3DOLB 4K0KF 2CPYA 1I3OB 4DV3F 2OTJS 2KHDA 2OPPA 2I5JB 2F3JA 3TARA 4L3NA 4X4UA 4PG4A 1FVQA 2N4DA 1VQOS 3H4BA 1FFWB 4NLRA 3ISZA 3SMZA 4HLBA 4RU9A 2DVIA 3ENVA 2CJKA 4RL1A 2DH7A 2FJDB 2H5EA 4HI1A 4DS5A 1YJRA 3EJMA 3TA2A 1X5PA 1S6PA 3KLGA 5CYQB 3NGDA 2RVJA 2HQ3A 3J7AN 5HQLA 1R8BA 1RWMB 3GP9A 1CS4B 4C3MA 1JJHA 3F73A 2WRMA 5ETSA 1A9NB 1V6HA 1FEEA 3QT7A 1L5UA 2V5HG 1I94F 5DJBA 4OZ1A 1RCOB 3ILOA 2H4YB 2BE2B 5LXRA 5DQHA 2X1FA 1R8AA 1VQSA 2JSXA 4WTYA 4NLSA 4Y2KA 3P4UB 2DNZA 2AMCB 3RAQA 3HFZB 1IWAA 2N7CA 2XY6A 2ZNZA 3M9MB 5HK4A 2H9ZA 1MW7A 4USIA 3BR9A 1GTHA 1UFKA 2XG8A 4EBDA 3HFVA 3K59A 2Y0BB 4RO0A 2DHGA 4CZCA 3V2UC 5LSLA 4ZK7M 4G1IA 3OPKA 2VG6B 1NPKA 3RBZA 1YRTA 4RNHA 5J2PB 4JI7J 4K4UA 2F8EX 1MN9A 3KLIA 3DN9A 2V4QA 5E3QA 3W2VB 4DZ6A 3DHXA 2QT7A 4Y00A 3KLFA 3LGHA 3DRRB 2VFVA 3VV2B 1RTJB 1JLAB 1UTAA 5I4MA 3KK1B 3KLVA 5KT4A 3HHEA 2KFNA 1U6FA 4MIAA 2YWFA 4TU7A 2YKAA 4DPXA 1HBNB 1H3DA 4C48A 1UJ5A 3UVJA 3K89A 4N77A 2RS8A 3GMGA 1JKHB 1RWKB 1TK8A 5KG3A 4USWA 2FJEB 1M0SA 2VFUA 2W9CA 1KWMA 5KFLA 4ECRA 1GAOA 1REVB 1H73A 5HN0A 4FNHA 1SH3A 5H9FJ 2QE5A 3GIJA 1C0TB 1YRUA 1BQNA 2V4JA 1Q8LA 1C4AA 1TMMA 2V8VA 3NBPB 2GO8A 4ED8A 1HPZB 5D0HA 2HVZA 3HHNB 2ZEJA 1RP5A 2F4FA 2YNIB 2E66A 1TVRB 2C1EB 3V6JA 3T6BA 4Z2XA 4PYAA 4DR6J 2NYHA 4H4MA 3GFYA 5L1JA 1SJFA 4P2SA 5B0GA 1M1KT 4AE5A 4W92B 3C15A 3K5NA 4UOGA 3PW2A 3AODA 3T3FA 2VICA 1FNMA 1GFWB 4ES1A 1P9QC 3IM8A 3ZZRA 2KZMA 3KYLA 4L73A 2FPHX 4H4KA 3BQ2A 1R6YA 4KYZA 1H2VZ 5IS2A 1HNWJ 4B9MA 3D0GE 3DI6B 3NAIA 3MEGB 3Q86A 2RF2A 3I5AA 5KT6A 3FZ2A 4NLVA 4GC6A 1KOOA 4L75A 2MKIA 4DHVA 2HMIA 1HW9A 3U1NA 4A8SA 4PG5A 2MLXA 4F2SA 3MEDB 4OZ3A 1AUSL 2CPDA 1R8CA 2Q1LA 3S6EA 1S1VA 4IRDA 2BANB 5B0CA 2CQDA 4ILLA 2L08A 1T7PA 3IC1A 1UAWA 2XYGB 1ELOA 3CCWA 4WK1A 4OYZA 2ZDOA 4F2RA 1M5PC 3M2UB 1QAYA 4CIOA 4MMOA 1QE1A 1UA0A 4KGKA 2UV8G 3D6FB 2AJ2A 4C8OA 2M8HA 4MFBB 4DR7J 2QC3A 5B0AA 1VQ5S 4DL5A 2PT0A 5I3UA 4GO5X 4DL7A 4EK2A 1JLBB 3FZBA 2YX4A 4EGLA 2N4CA 4NCBA 2EFNA 2IC3B 2GVDA 1VQ4S 1V3RA 2UXBF 5C2GA 4MYTA 3VAIA 2PEBA 3GR0A 3PZPA 4I2PA 3VAKA 4RNNA 4UY85 4LF6J 3ZO7A 2L9DA 3GJTB 1K1QA 4LT6A 1RJJA 1UZHA 1FKPB 4X4NA 4NCGB 2XLIA 4WFBQ 1YJ9S 1RB0A 1ULRA 1S48A 4KR0B 2Y1JA 3W8GA 2V0NA 3FFIA 1YBAA 1GX5A 3SBMA 2B8QA 4W4MA 5A76A 3JS9A 4ZLNA 2YTCA 5J2QA 3PYGA 3BKFA 2XHWA 1KRPA 1L3SA 1TUGB 3B54A 4CTAB 1QJHA 2MZSA 4LF7F 1OSDA 4HH1A 3UD4P 2VA3A 1HNXF 2ZUGA 3SCLE 3OR2A 5ETVA 2RUSA 4UUWA 3T19A 3UDLA 2ZJRQ 4X4TA 2AEFA 2MJUA 2XMJA 2NUUG 4OFZA 4DG1B 3O2IA 1X8DA 4MKBA 4C3KA 4GRSA 2VONA 2K2PA 5GAHU 4DFMA 3AOAA 2L3MA 2HQGA 3AJ1A 1N6QB 1R7IA 3KK3B 4OJ3A 1SKUB 3IBFB 1SV5B 4KRWA 4G1QA 2FJAB 2X51A 5K5MA 4A46A 3R27A 4DOZA 2BJ1A 3GV7B 2KYZA 5J1NA 5J1EA 7FDRA 5HQ8A 1NSKL 4KFBA 1HKAA 4C6AA 3C14A 3TZWA 2BQ3A 5DETA 2CQ0A 4EO6A 1TKDA 4JI1F 3VWSA 4M5DB 1KVKA 4QR0A 1FJGJ 2H3EB 3KG1A 3PEHA 3MHYA 4OHWA 3N4WA 2P6SA 3CEDA 1SC1B 4FXVA 4I0WA 5C42B 4IOAQ 5A6PA 2VZ9A 1SQFA 4NZ6A 1U48A 2CJXB 3RG6A 2CZVC 1YQHA 5U47A 1FKAF 4RW8A 4RBVA 4OJGA 2A18A 2BJDA 3MFHA 3ZXWA 2X1BA 4EFAC 1Q95G 5ETPA 2CNKB 1TKXA 4GKJF 5D6GA 3M8QA 4UW2A 3ISND 3GV5B 1M5VC 2EI5A 3I0SB 2CQGA 1VLYA 1S9EA 1RAGB 3M6UA 3BKTA 3OXLA 1NK0A 4OYOA 4ZVPB 2XMVA 2XM3A 2AF6A 3TQEA 3R9LA 3VAHA 4A47A 3BPDA 1A6LA 3TEHB 3MM7B 5DDPC 2WW4A 3Q8PB 1XERA 1CULA 4TQSA 2UVRA 1RT2B 1DURA 1D09B 5ETMA 3M8WA 1M5HA 4B3SJ 4DV1F 4LSNB 4ZOSA 4ZPVR 2RRBA 2XQCA 1KN6A 2KDOA 3SXLA 3TZXA 2GQ2A 1F0XA 5DDQC 4ELTA 1VQMS 5B08A 1ZAVA 2HHUA 1QLNA 2ROGA 4IG3B 3W62A 5KFNA 3RR7A 1X5TA 2HWTA 2V2KA 4F4WA 2FHJA 1C4CA 4B3TF 4L72B 2EFGA 4IYQA 2BRLA 4CM0A 1XMOJ 4WFNQ 5BJRA 2BKOA 2PA8D 1PYSB 3J81U 5KFUA 4IR1A 4H4KC 1MWYA 2BKPA 2D41A 3BO3A 2DR7A 1LXJA 2RU9A 2OSRA 3KJQB 5HVFA 3MM6A 3NS6A 3C19A 2O01C 2PE8A 4NZ7A 4OLPA 4EO8A 2DH8A 3HHKA 2XMUA 4E0DA 5KFMA 2NZ4A 3JYTA 5I3QA 2KKHA 2MZTA 4FXWA 5FDLA 1CG2A 2E5LF 4R8UA 2AIRB 4E2FB 4B3MF 3FBCA 4X65J 2HHTA 2V67A 1I6JA 4MT1A 3BSNA 2M88A 2V8PA 3MMCA 1IKXB 3OQ2A 4UZBA 2UUBF 1ZAWA 4WKRA 3G2XA 5K8OA 1M5SA 3BGUA 2VOOA 1TTHB 1XR5A 2ZC3A 3CO0P 4MIWA 4ZS6A 4FS1A 5EX0A 4DLGA 3GFZA 1P27B 1AFJA 2RJZA 1X4DA 1ZA1B 1G4CA 5ETKA 3CCRS 3L7PA 4JV5F 3UWTA 3U1LA 2HHHF 3J7ZT 3UFCX 4K4ZA 4DFJA 5K8MA 4LFCJ 4QYZK 2YQ1A 1Z4UA 2WOMB 1PAUB 2BX6A 3PJ9A 1FXLA 2HG4A 1UPMB 2Y1RI 1QTMA 2CNNB 5E3PA 3DFEA 2J7WA 2HRYA 4IFYA 1RCXB 3B4DA 2MGZB 3LWMA 1J5EJ 3LAKA 2LU2A 2VDHA 1TUVA 3QWPA 4LQ9A 3KG4A 2AJ1A 2DNOA 1HNVB 4P75A 2IVMA 1FEHA 3LH2S 3RB4A 4WCEQ 2WSCC 1FK9A 3RTVA 2HS4A 2VBYA 2CJ9A 2LQ8A 3EXYA 1CJKB 1WJ9A 1WKLA 3LP2B 5GMEA 2FY8A 3R5AA 3GV8B 4Q2MA 1S59A 2C3PA 2HHXA 4MH8A 1JLGA 2Z30B 1WOOA 2XEXA 3A3OB 3SFUA 3MAAB 1DARA 4IO9Q 2LVWA 1U25A 4M5JA 2YWWA 4I64A 3ICLA 1WUUA 4ZHRB 3BYPA 2MQ8A 2R7XA 4DUYJ 1VRUA 3IP0A 1UVJA 4C7QA 4QU6A 2YNFA 4LF9J 1WORA 3TEGA 3TUIC 1ZH5A 1EAYC 4IQXA 5K8PA 2QL7B 2UUAJ 2JJ4D 2Z2MA 4X4QA 1Q79A 3N6MA 3HSGA 4C0BA 3M8PB 3OJSA 1YJWS 4LBPA 4IRCA 1FCAA 4F4ZA 1PO6A 2V9WA 1JK9B 4O3OA 2XMWA 2K7KA 3SCKE 4YP3A 3PRDA 1QAXA 2MQOA 2KHCA 1VBYA 1A0OB 1HI1A 1ZPWX 1B7FA 4R5PB 3MPUB 4IH7A 1XMQJ 2E7WA 4JI2J 1T9WA 1M1HA 1WTBA 2JEGA 4OX6A 3BDEA 1GMWA 1ZBTA 2J8SA 1NPPA 1CC8A 2IJRA 1IBLF 1S1TA 4DSLA 4IG0A 3J81j 2E5JA 4Y0FA 5SZTA 4JB8B 3SV3A 1KNZA 3CDEA 5K14A 4B3OB 3J7A1 1Q16B 3L7OA 2R9LA 5KFWA 2OPPB 1IKYB 3FQLA 4DX8H 3EZOA 1TL4A 2HFUA 3PKYA 2W2OP 4F67A 3KLHB 4QWCA 3HHLA 1OJ4A 1MWQA 2JEJA 1VQYA 2AJ4A 4NZ0A 4X64F 3KG0A 1GT8A 2CVEA 8RUCA 2DB1A 1HNZF 1IJFB 1WNEA 1LXNA 3KLGB 1HQEA 5EGYA 5C25B 4CLYA 1RU2A 1N5SA 1Y11A 2M7SA 2YNGB 4Q0BB 3QZ8A 4HHJA 1SUQB 2R7TA 2OD4A 3BEGB 2DEJA 4OL8A 3SQOP 5KFCA 4MK7A 4ED6A 1N52B 3DKDA 2L9NA 4X4RA 5E3CA 5E0OA 2ILYA 4GVBB 3D6MB 3UR3C 3HO1A 4FZVA 3EPGA 1Q82T 2DGVA 3GYNA 4ECSA 5CD4H 3TI0A 4TVAB 1V9OA 4F3OA 2ZZMA 4X62F 1UETA 4DPWA 1KFDA 1LWFA 2ZOFA 3NMRA 4FVMA 2ZOGA 4F25A 5FIIA 2JVRA 1C1BA 2VFTA 3IG1A 1RAOA 2YWKA 4KY3A 1VQPS 1XWLA 3MCSA 4Q8FA 2OEKA 2I2YA 4FVCA 3C6UB 5F3ZA 3KLIB 1H2UX 3DGPB 1BQMB 1R0CB 2QZ8A 4LRFA 4CLWA 2EVZA 4JI4J 3ITHA 3PCOB 2FC8A 5E2QA 3EVMA 4A8YA 2WHOA 2HQDA 1WC4A 1ZM4A 2FTRA 3V5RA 2HPUA 1T8EA 4ANCA 2CZ9A 4OJ1A 2W8LA 4WFAQ 4J9QA 1U1RA 5LMUF 5GAHI 3CJQA 3ONQA 2ZBCA 5C5JA 1XNRJ 3ZTRA 4USKA 2BBEA 2RUGA 4Q8EA 3EVWA 5IWAF 2OPRA 1OY8A 4PG8A 3U02A 4AXJA 1UA1A 3CJ8A 5KFBA 1DTQA 3IA0A 1HBOB 3CJRA 3SSRA 4TLRA 2W9CB 2D3UA 1F2GA 2VF3A 1FWPA 2LDYA 3DXSX 2DHAA 4M5IA 3F0NA 3K57A 1BQNB 1RHMB 1T03A 1N5YA 3TVKA 1S77D 1SBRA 3W61A 4DR1F 4N56A 1PILA 3EDQB 3MPVA 2BQRA 1YJ7A 2G9OA 4ZLJA 3QRQA 5KG6A 3M7VA 2EC2A 4OV6A 2GQQA 3GFHA 4R0JA 2HGLA 3CCQS 2LQ9A 4CYUB 5BR8J 3UE2A 1U6BA 3G87A 3Q89A 4KGZB 3MUTP 5A0YA 4DU8A 3FC9A 1HHSA 4BC7A 1S7HA 2V34A 2F8MA 4H4MB 2HAIA 4ZVSB 3GLJA 3G4SS 3NS7B 4ECWA 4DCJB 1KOHA 2OFHX 5D4NA 5G0RB 4K7QA 4C11A 1OO0B 3QGHA 4ED3A 1VR6A 5E33A 2K8GA 3TA0A 1PC5A 2Y8WA 3V4IA 3I56S 2CXEA 2ZC4A 3RB0A 1KC8T 2VOPA 4CH7A 1RBAA 4KTQA 1A7GE 3B6BA 3OTOF 3HD1A 5LM7E 3VAJA 4QYRA 4DFKA 1AXQA 2G2OA 1NHUA 4FPIA 1U0HA 2LKZA 3PYDA 4J7CA 1Y0HA 2KO1A 2JLEA 3TVYA 2DGWA 4O3PA 4ID5A 2AJQA 4LF8F 4A8WA 5CQGA 2MYFA 1QE1B 1SQEA 4WXWA 3C66A 5KFSA 4FYWB 4OI1A 2VKRA 2ZZNA 3PYEA 2Y0SD 2FZKB 2ZBIA 3FUYA 5F8HA 2YH1A 3D4JA 3UN2A 2MKKA 3CTRA 1HYSA 3I31A 2Y3YA 2ZHAA 5D0RA 1H0HB 3HHLC 4I2PB 2R7RA 2AU0A 1VC5A 2BE9B 1KQKA 2JLGA 2WVEA 2XNRA 4MKVA 2ZH5A 3LGMA 4X4SA 3BJYA 4RNMA 1Y9OA 2HS0A 1X0PA 4ED0A 1NPRA 3SSSA 2RQ4A 1TL7A 3AT1B 3CGIA 5KFJA 3FFIB 1GTEA 5HMWA 1SJ3P 2LLZA 4DR2F 4Y3CA 5F41A 1TK0A 3NG8A 5E41A 1H98A 4LSZB 1W2IA 2MY7A 1Q86T 2A10A 2QLBB 1RT7B 2KU7A 3H90A 1RT4A 4WFXA 1NH8A 2IA6A 1E6VA 1EQMA 5AXMA 4J9PA 3D6HB 3H2LA 4TY8A 5F8GA 3VGTA 1U1OA 2CQ2A 4V1Ak 3Q8UA 2EFPA 3FCWA 1ZS6A 2IIHA 1O8BA 2ZKUA 2DNQA 1ZYQA 3G8QA 2YWGA 2BEFA 1GX6A 4HHUA 2VC1A 4X84A 3DYAA 2VQEJ 3Q24A 2MKCA 3P5BP 1KVJA 4PUOB 2AYMA 2E1AA 3J7YU 1KS2A 1JLFB 1NUEA 2GZOA 2J9DE 3MM9A 5LOQA 1IKVB 2IM1A 5D0GA 2OPQA 3C14B 3MTJA 1Y7PA 1SB6A 4OI4A 4U8VA 4NOHA 3M32B 4JP8A 1HWKA 2V2QA 5JJBA 2I38A 4YR3A 1RADB 1HHQA 1RAEB 5IC4B 1G3OA 1WELA 1WC0A 2LQJA 2NPIA 3PM9A 3W64A 1QY7A 1NJWA 2QLFB 4KSEB 1KP6A 4DX7A 4N7TA 3D68A 2B4PA 1SJ4P 1F2HA 3K2YA 4DSEA 5A8KB 4OYAA 2L9WA 1FRMA 3CPWR 3JB9k 2QIFA 1S9EB 2J5AA 2HNDA 1K1SA 2WTFA 3BF4A 3PVXA 2J8AA 3ENQA 2HYIB 4C4WA 4ZPWR 1UEKA 5C7PA 1B0TA 4DV6J 2Q3PA 1F9EB 3SQGA 1WF0A 1CULB 4Y2CA 3LGNA 3NOCA 1OWXA 2OJ3A 1BC6A 1ZAXA 1RWWB 4OZ5A 1PJ6A 4CO3A 3KNGA 3H20A 4C0HA 4OZLA 1UEVA 2ZKTA 1RAHB 3QT8A 4TU9A 2ZE2A 1KLMA 1OYEA 4TQRA 2JNJA 4CLPA 2DYAA 4KGVB 1ROFA 3Q8RB 3AH6A 4GKKJ 4O3NA 3I32A 2PSZA 4M63A 2ZVIA 5D3GB 4NI2B 1NK4A 3MD1A 3T1HJ 2JZ5A 3W65A 2F7VA 3MM6B 1WI8A 3AY0A 2P9GA 3JYTB 1SKWA 2WCXA 3C16B 4EZ6A 3BGRA 3RB3A 4LIRA 3DM2B 5I3PA 4FF1A 2MZJA 4DSKA 3MMCB 4F3QA 3NWGA 5CAAA 3C2PA 4KHPJ 2B8PA 3BBFA 1FRLA 4WIIA 4IFVB 3W1YC 1WC5A 3MECA 2E29A 3UO0A 3CCJS 1CJTA 2XTJP 4F26A 3GONA 3L7UA 4LF1A 3DLGA 4K2JA 3ZNJ1 5KG4A 4URGA 3PX0A 5KFOA 3K5MA 3KFWX 4ECUA 4M5MA 3WHIA 2GMHA 4RKUC 1RI7A 4C8MA 2XHCA 2HRTA 1WG5A 2K1RA 1FRHA 2GJ2A 2FGOA 3NGTA 3NEKA 5CCMA 3RBEA 2AGPA 2DO0A 2VG7B 3CB4A 4BBYA 3OR1A 4OHVA 3BPSP 3WX4A 5EUHA 2KRRA 5F0UA 2OD6A 3IS9B 3ILLA 5F8JA 1WEXA 2R7WA 5D4OA 3T41A 2ASLA 2YKNB 2DPIA 3R5BA 2ZJQQ 4OI0A 4K4YA 3CF5Q 3Q8QB 3HT0A 3BQ0A 1FK9B 3D54A 4ECVA 2G0CA 2V2ZA 3SDEA 3J81Y 3PNIA 2I9SA 2RKIA 4LF5F 2M4MA 2QL9B 2XB2D 4XO0A 3IRXA 4UTGA 3EICA 3W5ZA 3TOQA 1G2EA 3BYRA 2HGMA 4CDIA 2HNYA 1N36F 3TANA 1X5OA 3CCES 3QO9A 3BH7B 3ZZYA 4OHYA 1R0BG 1TL3B 1J5OA 2MTLA 3QIDA 1N32F 1LWEB 4DR7F 3BBBA 2W7OA 2D3O1 5KFGA 2VD3A 4F4AA 1LWXA 4RW7B 3DCAA 2Y8YA 4RW9B 3G8TA 1TL1A 3ZZUA 3AXMA 4U7UK 3OW2R 2NCKL 4LF6F 2PA3A 2XO6A 5FJ4A 1RWUA 3HI9A 3TX8A 4HVZA 3G6VA 1RGVA 4PWUA 1S7IA 2IBKA 1U4BA 5ETOA 3AJ2A 2EBGA 1HQUA 2KN4A 3MURP 1S0MA 5HI7A 2IJNA 4PEOA 2OAUA 5K14B 3D67A 4CLKA 3OUYA 3Q2TC 1VRQC 1Y5NB 3RBXA 4DV7J 1DQ8A 3KUEA 1C0UA 4NX9A 1Q53A 4DV2J 4OX9F 1NSAA 4UOHA 2XNQA 3NP5A 2CPZA 3CJ4A 4K5RA 5T7LA 4LUBA 4ZVFA 3RW7A 1G1XA 4B17A 1BY9A 3OSNA 8ATCB 1U24A 1HA1A 4HT7A 1N34J 1OYDA 9RUBA 3OTCA 5GMDA 5EWFA 1RQ0A 3M8ZA 1HBMB 2OPSB 3C3LA 1IKWA 1CQMA 4TYAA 2RHSB 3DLKB 2NR0A 4HDHA 3C46A 4YQWA 2DIVA 1L3UA 3ETOA 5D15A 4QIEA 1FJGF 2I0XA 5DQGA 1WOSA 3GIIA 2XSFA 1FRIA 2Z57B 1QSSA 2RHQB 4ZP6A 4O4RA 3N6NA 2JEIA 1NCLA 2AYGA 2AX0A 4KO0A 1KHWA 2QLJB 2IVFB 2HLTA 2UUCJ 1WACA 4PQAA 3QIPA 2LFVA 4QYZJ 2MB0B 4LRCA 2KM8C 1JXLA 4DR4J 1LWFB 1UVIA 4PQUA 3TUPA 1S97A 4OYBA 1C1BB 3IG1B 2V8DA 3UDEA 3AD8C 2MZRA 2GFFA 3WQPA 1YG0A 3MI7X 1VI7A 3I82A 5LMNF 1H72C 3VTIA 1F9HA 2ALZA 2DHSA 3HKZD 3ITHB 3CMAS 3DLLQ 1S6QB 1H2TZ 3OTDA 3HJFA 4MK8A 2ZWPA 5HLFA 1U1LA 2U1AA 4PPDA 2R42A 1PIEA 4J9UE 4YEAA 3QBCA 4TKTA 2QA4G 1P8GA 1NEEA 2R7VA 1RWPB 3POTA 4P52A 4YR0A 2GGPA 3M8RA 5IQQA 2OEMA 1DQ9A 3GTYX 3G96A 3GU0A 3M8SA 5BYRA 5KFTA 1FFSB 1YDLA 3T9ZA 1DTQB 1YJTA 2FVRA 3RB6A 3PW7A 2HFVA 1XR6A 3H40A 1IXKA 2B6AB 4USHA 1NO8A 3C6TA 3WIVA 3OXGA 3WC2A 2LXIA 1U1MA 1RWOB 4ZCLA 3W2WA 4YY3J 4C98A 3GG0A 3OVAA 3PO5A 3R7BB 3TJAA 4CI0B 4P72A 2OMOA 4H4OA 1F5CA 2D3ZA 2OGUA 1LKZA 1WHWA 4DI6A 4KE5A 1IWGA 4AT1B 2DXFA 2R2RA 3FNNA 1RYRA 2JLFA 4K59A 3MMBB 2BM1A 3QWUA 1IM6A 5HBMA 3RW6A 1QSLA 1HLWA 3E01A 3K58A 1WG1A 1RT3A 2ZDPA 4J9RA 5IZHA 3A1YG 4KIAA 1PAEX 5CD4A 3NLCA 5B0FA 3JQJA 4OYXA 3H5SA 3PJWA 2AJFE 1IUJA 2QA4S 4KHMA 4DUZJ 2PMWA 2JDJA 4Z7YA 3CWJA 1RTZA 5F9LA 2HAFA 1FJ7A 1SIZA 3V4IB 1D3WA 5JVHQ 4FYVB 1LK5A 4DS4A 2HNZA 3UD3P 4F8RA 3HPOA 1P1LA 1NSPA 5DM6Q 2ZITA 3P8BB 3D6TB 2KXHA 1R89A 3ILJA 2C22A 4J91A 2RDIA 1YBTA 3THPA 2FHMA 3KMQA 3VGUA 2XS7A 4F3MA 4Q2LA 3KHLA 4ZIWA 3FJ2A 3OLBA 1U09A 1JLQA 4WKYA 1EX8A 4LRDA 1VDHA 1RKIA 3FBEA 2LU1A 4ECXA 2GVZB 4OYPA 1RAIB 2EXUA 3LTOA 4QW9A 4QQBA 3QFHA 1JLEB
chains in the Genus database with same CATH topology
3MR5A 3UWTA 2GMLA 2EK6A 1QM9A 3U1LA 2C28A 1AUDA 4DQIA 3THTA 2HHHF 3J7ZT 3UFCX 3MM5B 2HHPA 4K4ZA 5B09A 5HMYA 4DFJA 2K7JA 5K8MA 2DCUB 4AL6A 3WBZA 2CPEA 1UVLA 2VPXB 1Z4UA 4TXSA 4F4XA 2RF2B 3PACA 2WOMB 2EW9A 3U1MA 4F4KA 1HYSB 1KTQA 4Y2MA 2VBXA 3MUMP 1HBNA 4WJBA 1RTIA 2B0GA 2J9CA 4A8MP 1IM4A 1S79A 2B43A 1FXLA 2D9PA 2HG4A 2HMIB 4DUYF 2BRKA 2D9OA 1QTMA 2Y1RI 2XI2A 3DOMA 3QJLA 5CZVA 5E3PA 4QPXA 3DFEA 2J7WA 2HRYA 2AYBA 2R8HA 4DQQA 1IBMF 4IFYA 5D8HB 4KGMA 3B4DA 3MF5A 2UVUA 2MGZB 3LWMA 4I7FB 3LAKA 2NPFA 4OZ0A 1OSCA 4J9MA 2LU2A 1X4BA 2MY8A 1Z2ZA 2VUGA 1FXRA 4YB5A 4BC9A 1S1VB 1TUVA 4XDDA 1HMVB 2ZFHA 3GIKA 3QWPA 4LQ9A 3CO9A 2Y1IA 3IWXA 5G0RA 1U1QA 2FVSA 3QGIA 3M30A 2B4UA 1HQUB 5GADI 3HX9A 3KG4A 4XIUA 1FTCA 1SI9A 3S7RA 1TL5A 2AJ1A 2WB4A 2DNOA 4U7CA 1HNVB 2HZCA 1U7LA 3N0VA 4DJBA 2MKHA 5CH7B 2IVMA 5B0BA 1FEHA 3MMAB 3LH2S 2PN6A 3RB4A 4WCEQ 1NH7A 2IM0A 2WBMA 2VPZB 2WSCC 2YKQA 2VB6A 3I9ZA 1X9MA 3CD6S 2IHR1 1FK9A 3SCIE 2DGSA 3RTVA 4AL5A 2HS4A 4DMZA 2W8KA 1B64A 2VBYA 4V19J 4NRUA 2HHWA 3UPFA 2CJ9A 4IQMA 4QIFA 2DPJA 3EXYA 1CSJA 2MXYA 3CJKA 1S0OA 3MOJB 3LP2B 5I3UB 1FE4A 1JNZB 3QZ7A 4KKOA 3R5AA 1C0UB 3WC0A 3IN5A 3AA9A 3GV8B 4Q2MA 1SKSA 1RT4B 2C3PA 2HHXA 1WG4A 1XN9A 2ZH2A 1XMQF 4MH8A 1JLGA 4JI8F 5LJ3Y 2YKMB 3LW5C 4JI2F 4O3QA 2RNEA 3NBPA 4BCAA 4C8ZA 2UXCF 2XEXA 3KJVB 1O0PA 3SFUA 5DDRC 1HPZA 4ZKAA 1DARA 2CPIA 4HYKA 3MEEB 4YHHF 2P9EA 4IO9Q 2LVWA 2ZHOA 2HFOA 3RZAA 2CG4A 4OLOA 3TAQA 1VQKS 1BQXA 1U25A 2GX8A 4I64A 4QWBA 2PEHA 2FJVA 3ICLA 2YVSA 4OHZA 5T7LB 4ZHRB 4A8QA 2VPYB 2R7XA 2J76E 1VRUA 1ZOTA 2B3TB 4ZCIA 2IYGA 4CCHA 3I9V9 1UVJA 4C7QA 2AV5A 1SXLA 1VK3A 2YNFA 4NA2A 4DQSA 2R4FA 3IAM9 4QU6A 1D8YA 3H59A 2W9BA 2R7QA 4ID8A 3M9OB 4U9RA 4CNZA 2UZAA 2BDPA 3MPYA 3TUIC 1ZH5A 4XK8C 4IQXA 4QOTA 5K8PA 1NJIT 3SYZA 2KG1A 2W24A 3N5BA 4ZPCA 3T9NA 2BA9A 2JJ4D 2ABYA 2GHPA 2UUWA 2Z2MA 4X4QA 1Q79A 4EUVA 1WI6A 3N6MA 4C0BA 3M8PB 2KI2A 3OJSA 5AE3A 1YJWS 4BWJA 5J2QB 5JVGQ 3LP1A 3CJ3A 4IRCA 1FCAA 4F4ZA 2UV8A 1PO6A 2V9WA 5F0WA 1JMTA 4DPOA 2L48A 3EXCX 5J2MA 1JK9B 1Q78A 4O3OA 1S1UB 5D4PA 3RR8A 1GH8A 2XMWA 3GILA 2K7KA 4KAIA 4WYLA 4D3GA 3PIOQ 5K8NA 3SCKE 3T1AA 5AE1A 4YP3A 3PRDA 4OJHA 4YR2A 4M95A 1SJ1A 5EDWA 1QAXA 1VOMA 4UY8T 3QMQA 1CVJA 3KLEA 2MQOA 3EUNA 2KHCA 1VBYA 3PO4A 5DGAA 5CYMB 5H9EJ 1HI1A 1LW0A 1ZPWX 4O3RA 1TFWA 1B7FA 1DQAA 4QZVB 4R5PB 4RUHA 2DISA 4TYBA 3BSOA 2ZH6A 3OR2B 1FDBA 1EP4B 2VFSA 4IH7A 4Q45A 1VBXA 3R3TA 1VIOA 4B9UA 3ZZTA 2J6UA 2OH2A 5GVQA 3HMJG 2E7WA 1OIAA 2NUHA 1Y3JA 3P3DA 1WTBA 3MPWA 3FEZA 3CUNA 2JEGA 4I67A 4HDGA 3FDSA 4OX6A 3BDEA 4ZCMA 2VBWA 3HFKA 1ZBTA 1DTTA 1D9FA 2B7CB 2G13A 1S0VA 1CC8A 3PX6A 1IBLF 1S1TA 5F9NA 4DSLA 1U26A 2CJQA 4QR2A 1YRXA 3K0JA 3IRWP 3JSRA 4IG0A 3MDFA 5DRKA 2E5JA 3CSKA 2FHOB 2QEXS 2NQPA 4Y0FA 2EFOA 5SZTA 4OQJA 3HLUA 1N5VA 5GAEI 4LVOP 3SV3A 1M5KC 3PV8A 1KNZA 4YOEA 2Q66A 1D1UA 2PD1A 3CDEA 2FUG9 3AQPA 5K14A 1QVFR 4B3OB 3J7A1 3B78A 1Q16B 1VRTA 3NCRA 4TLQA 2BZ2A 2C2EA 1OQ6A 2IRXA 3E8OA 3L7OA 3CIMA 1JLCA 4MFBA 4NLTA 2R9LA 5KFWA 2OPPB 3OLAA 2F40A 5IM0B 1IKYB 2GIRA 2IA0A 3FQLA 4G1QB 4DX8H 2BR0A 2LDIA 3EZ5A 3DDNA 3DRSA 1LK7A 1RT7A 4NLDA 5J1EB 1JLBA 4XDCA 1XNQF 3M2RB 1TL4A 4KFBB 2IAJA 3QYYA 3QPIA 4KBIA 3PKYA 1C1CA 2LEPA 3GFXA 4F67A 2X3GA 2ZD1A 3R5CA 3KLHB 4CO2A 1T95A 3SQGB 4QWCA 3HHLA 4ED5A 2RIJA 3CULA 2JEJA 2EBEA 1VQYA 2AJ4A 4NZ0A 4WU3A 2RH3A 4X64F 3MFIA 2HW3A 3V6DA 3KG0A 2GA7A 1U1NA 1GT8A 2CVEA 2K3IA 2MSTA 3G9CA 2W4DA 2NREA 3CE8A 1WHXA 2CPJA 3CC4S 5D77A 2DB1A 5IXUA 1X9SA 3JSYA 3CDUA 1HNZF 1O5JA 2GGPB 3PW5A 1IJFB 4WF9Q 1LW2A 3QLHB 1LXNA 1WNEA 3KLGB 1FKPA 3RU0A 3P96A 3D28A 1HQEA 2YKPA 5EGYA 2KXNB 4GKKF 2RSQA 1UJ4A 3IGVA 4MK9A 1S9GA 4NA1A 5C25B 3TAMA 1N5SA 2M7SA 4J37A 4RW6A 1T05A 4RW8B 2CYYA 4N47A 1X4GA 2M0GB 2YNGB 4B08A 3M6VA 3ZZ0A 4Q0BB 4RNOA 1RT5B 1PGZA 4JI4F 3QZ8A 3DRPA 4PUOA 3OL9A 2JL9A 3DLJA 2ZM6F 3JSBA 2OIHA 4JV1A 3P49B 5L8RC 3ZZPA 2YH0A 3I5CA 1TKXB 1JLFA 1SUQB 4HHJA 5HL7Q 3RBDA 4A48A 3M8QB 4K4TA 2LEAA 3PHEA 4NLXA 4ES3A 3I5BA 3C6TB 2R7TA 2AGOA 1PC4A 5H1SV 2OD4A 1S1WB 3BEGB 5B0DA 1IKVA 2N82B 1SL0A 4N5SA 4F02A 4OL8A 1H7WA 5KFCA 3CDAA 1YJNS 4MK7A 4CTAA 4ED6A 1FD2A 3O1LA 3MGJA 5T41A 1N48A 2AW0A 2DGQA 3H4DA 1N52B 1RT1A 3E3XA 3MWBA 4NYPA 2GQCA 3W2WB 2JX2A 4B9TA 5G4DA 3M32A 2L9NA 3ZFVA 1KQSR 4J5OA 4X4RA 2DRBA 1JB0C 5E3CA 4ZA1A 1WTFA 5E0OA 4X2BA 2BUNA 1N56A 4ECQA 2ILYA 3OFGA 1N0VC 3DLHA 1UMJA 3UR3C 4J9NA 4NCAA 2WSFC 3HO1A 3GE9A 4FZVA 4O23A 3EPGA 1Q82T 4O4GB 4NMLA 4WE1A 5F3TA 4IH6A 5BYQA 4ZLPA 5AJ3F 2DGVA 1L3KA 2DD8S 2MPUA 2PC6A 4H4OB 3Q22A 4JOUA 2D74B 3GYNA 4K4SA 4QIVA 4ECSA 5CD4H 3TI0A 2KM8B 4IOCQ 4Y34A 4E98A 1V9OA 4ZMMA 1YI2S 3V81A 4KV8A 2OTLS 2PI5A 4F3OA 4QWEA 3BGFA 1YSJA 5LT5A 4Y