3NMTA

Crystal structure of pyrabactin bound abscisic acid receptor pyl2 mutant a93f in complex with type 2c protein phosphatase hab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
176
structure length
176
Chain Sequence
b'SEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPFSTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Identification and mechanism of ABA receptor antagonism.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 43
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nmtA00
5BRLA 1TW0A 1LN1A 2QIMA 4BK7A 4A88A 2Z9YA 1E09A 4IGYA 3JRQB 1XDFA 2M89A 2L8OA 3CNWA 3NJ1A 4BKCA 4Y31A 5E4DA 4A81A 4MA6A 3UJLA 3NR4A 4XRTA 5JO1A 1IFVA 4JHIA 3NMVA 3NJOA 4RYVA 2N4AA 3QSZA 2E3QA 2FLHA 1ZXFA 2WQLA 3OJIA 3P9VA 4IHRA 2Z9ZA 1XN6A 3Q6AA 4N3EA 4IH2A 4JHGA 2REZA 3K90A 4GY9A 4BK6A 1B6FA 4JHHA 4QIPA 1XUVA 2E3SA 1TXCA 1H2OA 3F08A 1LN2A 3H3TA 4IGWA 4Z3LA 2LAKA 4A8VA 2LDKA 3R6PA 4PSBA 1FSKA 3KB0A 3H3SA 1BV1A 1LLTA 3KDJA 5C9YA 3FO5A 3C0VA 4IGVA 2MOUA 4DSCA 4JDLA 4C9CA 3NJ0A 2LE1A 1FM4A 2NN5A 4MAPA 1T27A 3Q64A 3UIDA 1ICXA 4LGBA 2KCZA 3ELIA 3RT0C 4B9RA 2Q3QA 2KEWA 3K3KA 2QPVA 4N0GC 4MNSA 4A87A 2PCSA 2L9PA 2D4RA 2NS9A 2A1LA 2BK0A 1UW5A 4XRWA 3KDHA 3GGNA 2FFSA 3IJTA 3TFZA 2PSOA 4A8UA 2RESA 4BKDA 4DS8A 1XN5A 4Q0KA 3IE5A 5JNNA 1EM2A 3H3RA 2L65A 3KAYA 5I9JA 5I8FA 4LG5A 2E3OA 1T17A 3NI8A 4FPWA 3RT2A 1LN3A 2K5GA 3ZVUA 3NEGA 2E3PA 2EJXA 3PU2A 4A8GA 1QMRA 4IH0A 4A85A 2LPXA 3KDIA 3JRSA 4WVOA 3OQUA 3W9KA 1XFSA 3P51A 2K7HA 3WG8A 2LEQA 3TVRA 4LGAA 2VNEA 4M9BA 2N4BA 4BTZA 4IGXA 2KTEA 4REHA 3NMPA 4OICA 4A83A 3Q63A 4DSBA 4R7KA 5E4BA 4REJA 2GKDA 1Z94A 1BTVA 2VQ5A 3KAZA 2E3MA 2LUZA 3NMHA 3PUTA 3TVQA 4A86A 4C9IA 2LIOA 3NS2A 4JDAA 2E3RA 1JSSA 3NMTA 4M9WA 5E46A 5E4MA 4C94A 3H3QA 3KL1A 4REIA 3OTLA 1KCMA 3OH8A 2IL5A 2R55A 5JO2A 3NEFA 3P0LA 2I9YA 2M47A 3RD6A 3UQHA 3W9RA 1X53A 3NMNA 3QN1A 3TL1A 2RERA 5AMWA 2LGHA 2LCGA 4A84A 1VJHA 2LF2A 4LA7A 2E3NA 2KF2A 3KLXA 3KB3A 3E85A 4A80A
chains in the Genus database with same CATH superfamily
5BRLA 1TW0A 1LN1A 2QIMA 4BK7A 4A88A 2Z9YA 3HVRA 3GL2A 1E09A 4IGYA 3JRQB 1XDFA 2M89A 2L8OA 3CNWA 3NJ1A 4BKCA 4Y31A 5E4DA 4QDDA 4A81A 4MA6A 3UJLA 3NR4A 4XRTA 5JO1A 1IFVA 4JHIA 4JHYA 3NMVA 3NJOA 4RYVA 2N4AA 3QSZA 2E3QA 2FLHA 1ZXFA 2WQLA 3OJIA 3P9VA 3HM9A 4IHRA 2Z9ZA 1XN6A 3Q6AA 4N3EA 4IH2A 4JHGA 2REZA 3K90A 4GY9A 4BK6A 1B6FA 4JHHA 4QIPA 1XUVA 2E3SA 1TXCA 1H2OA 3F08A 1LN2A 3H3TA 4IGWA 4Z3LA 4QDFA 2LAKA 4A8VA 2LDKA 3R6PA 4PSBA 1FSKA 3KB0A 2ZYLA 3H3SA 1BV1A 1LLTA 3HK2A 3KDJA 5C9YA 3FO5A 3C0VA 4IGVA 2MOUA 4DSCA 4JDLA 4N76A 4C9CA 3NJ0A 3GOBA 2LE1A 1FM4A 2NN5A 4MAPA 1T27A 4QCKA 3Q64A 4QDFB 1ICXA 4LGBA 3UIDA 2KCZA 3ELIA 3RT0C 4B9RA 3HO1A 2Q3QA 2KEWA 3K3KA 2QPVA 3NQNA 4N0GC 4MNSA 4A87A 3GTEA 4N41A 2PCSA 3DLBA 2L9PA 2D4RA 2NS9A 3GL0A 4NCAA 2A1LA 2BK0A 1UW5A 4XRWA 3KDHA 3GGNA 4N47A 2FFSA 3IJTA 3TFZA 2PSOA 4A8UA 2RESA 4BKDA 4DS8A 1XN5A 4Q0KA 3IE5A 5JNNA 4QDCA 3F73A 5EKQC 1EM2A 3H3RA 4NCBA 2L65A 3KAYA 5I9JA 5I8FA 4LG5A 2E3OA 1T17A 3NI8A 4FPWA 3RT2A 1LN3A 2K5GA 3ZVUA 4KPYA 3NEGA 2E3PA 2EJXA 3PU2A 4A8GA 1QMRA 4IH0A 4A85A 2LPXA 3KDIA 3JRSA 4WVOA 3OQUA 3W9KA 1XFSA 3P51A 2K7HA 3WG8A 2LEQA 3TVRA 4LGAA 2VNEA 4M9BA 4E6FA 2N4BA 4BTZA 4IGXA 3TGOC 2KTEA 4REHA 3DLHA 3NMPA 4OICA 4A83A 3Q63A 4DSBA 4R7KA 5E4BA 4REJA 2GKDA 1Z94A 1BTVA 2VQ5A 3KAZA 2E3MA 2LUZA 3NMHA 3PUTA 3TVQA 4A86A 4C9IA 2LIOA 3NS2A 4JDAA 2E3RA 1JSSA 3NMTA 4M9WA 3GTSA 5E46A 5E4MA 4C94A 3H3QA 3KL1A 4REIA 3OTLA 3HXMA 2YH6A 2LAFA 1KCMA 3OH8A 2IL5A 2R55A 5JO2A 3NEFA 3P0LA 2I9YA 2M47A 3RD6A 3HJFA 3UQHA 3GB4A 3W9RA 1X53A 3NMNA 3QN1A 3TL1A 2RERA 5AMWA 2LGHA 3GKEA 2LCGA 4A84A 1VJHA 2LF2A 4LA7A 2E3NA 2KF2A 3KLXA 3KB3A 3E85A 4A80A
chains in the Genus database with same CATH topology
5BRLA 1TW0A 1LN1A 2QIMA 4BK7A 4A88A 2Z9YA 3HVRA 3GL2A 1E09A 4IGYA 3JRQB 1XDFA 2M89A 2L8OA 3CNWA 3NJ1A 4BKCA 4Y31A 5E4DA 4QDDA 4A81A 4MA6A 3UJLA 3NR4A 4XRTA 5JO1A 1IFVA 4JHIA 4JHYA 3NMVA 3NJOA 4RYVA 2N4AA 3QSZA 2E3QA 2FLHA 1ZXFA 2WQLA 3OJIA 3P9VA 3HM9A 4IHRA 2Z9ZA 1XN6A 3Q6AA 4N3EA 4IH2A 4JHGA 2REZA 3K90A 4GY9A 4BK6A 1B6FA 4JHHA 4QIPA 1XUVA 2E3SA 1TXCA 1H2OA 3F08A 1LN2A 3H3TA 4IGWA 4Z3LA 4QDFA 2LAKA 4A8VA 2LDKA 3R6PA 4PSBA 1FSKA 3KB0A 2ZYLA 3H3SA 1BV1A 1LLTA 3HK2A 3KDJA 5C9YA 3FO5A 3C0VA 4IGVA 2MOUA 4DSCA 4JDLA 4N76A 4C9CA 3NJ0A 3GOBA 2LE1A 1FM4A 2NN5A 4MAPA 1T27A 4QCKA 3Q64A 4QDFB 1ICXA 4LGBA 3UIDA 2KCZA 3ELIA 3RT0C 4B9RA 3HO1A 2Q3QA 2KEWA 3K3KA 2QPVA 3NQNA 4N0GC 4MNSA 4A87A 3GTEA 4N41A 2PCSA 3DLBA 2L9PA 2D4RA 2NS9A 3GL0A 4NCAA 2A1LA 2BK0A 1UW5A 4XRWA 3KDHA 3GGNA 4N47A 2FFSA 3IJTA 3TFZA 2PSOA 4A8UA 2RESA 4BKDA 4DS8A 1XN5A 4Q0KA 3IE5A 5JNNA 4QDCA 3F73A 5EKQC 1EM2A 3H3RA 4NCBA 2L65A 3KAYA 5I9JA 5I8FA 4LG5A 2E3OA 1T17A 3NI8A 4FPWA 3RT2A 1LN3A 2K5GA 3ZVUA 4KPYA 3NEGA 2E3PA 2EJXA 3PU2A 4A8GA 1QMRA 4IH0A 4A85A 2LPXA 3KDIA 3JRSA 4WVOA 3OQUA 3W9KA 1XFSA 3P51A 2K7HA 3WG8A 2LEQA 3TVRA 4LGAA 2VNEA 4M9BA 4E6FA 2N4BA 4BTZA 4IGXA 3TGOC 2KTEA 4REHA 3DLHA 3NMPA 4OICA 4A83A 3Q63A 4DSBA 4R7KA 5E4BA 4REJA 2GKDA 1Z94A 1BTVA 2VQ5A 3KAZA 2E3MA 2LUZA 3NMHA 3PUTA 3TVQA 4A86A 4C9IA 2LIOA 3NS2A 4JDAA 2E3RA 1JSSA 3NMTA 4M9WA 3GTSA 5E46A 5E4MA 4C94A 3H3QA 3KL1A 4REIA 3OTLA 3HXMA 2YH6A 2LAFA 1KCMA 3OH8A 2IL5A 2R55A 5JO2A 3NEFA 3P0LA 2I9YA 2M47A 3RD6A 3HJFA 3UQHA 3GB4A 3W9RA 1X53A 3NMNA 3QN1A 3TL1A 2RERA 5AMWA 2LGHA 3GKEA 2LCGA 4A84A 1VJHA 2LF2A 4LA7A 2E3NA 2KF2A 3KLXA 3KB3A 3E85A 4A80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRL A;  1TW0 A;  1LN1 A;  2QIM A;  4BK7 A;  4A88 A;  2Z9Y A;  1E09 A;  4IGY A;  3JRQ B;  1XDF A;  2M89 A;  2L8O A;  3CNW A;  3NJ1 A;  4BKC A;  4Y31 A;  5E4D A;  4A81 A;  4MA6 A;  3UJL A;  3NR4 A;  4XRT A;  5JO1 A;  1IFV A;  4JHI A;  3NMV A;  3NJO A;  4RYV A;  2N4A A;  3QSZ A;  2E3Q A;  2FLH A;  1ZXF A;  2WQL A;  3OJI A;  3P9V A;  4IHR A;  2Z9Z A;  1XN6 A;  3Q6A A;  4N3E A;  4IH2 A;  4JHG A;  2REZ A;  3K90 A;  4GY9 A;  4BK6 A;  1B6F A;  4JHH A;  4QIP A;  1XUV A;  2E3S A;  1TXC A;  1H2O A;  3F08 A;  1LN2 A;  3H3T A;  4IGW A;  4Z3L A;  2LAK A;  4A8V A;  2LDK A;  3R6P A;  4PSB A;  1FSK A;  3KB0 A;  3H3S A;  1BV1 A;  1LLT A;  3KDJ A;  5C9Y A;  3FO5 A;  3C0V A;  4IGV A;  2MOU A;  4DSC A;  4JDL A;  4C9C A;  3NJ0 A;  2LE1 A;  1FM4 A;  2NN5 A;  4MAP A;  1T27 A;  3Q64 A;  3UID A;  1ICX A;  4LGB A;  2KCZ A;  3ELI A;  3RT0 C;  4B9R A;  2Q3Q A;  2KEW A;  3K3K A;  2QPV A;  4N0G C;  4MNS A;  4A87 A;  2PCS A;  2L9P A;  2D4R A;  2NS9 A;  2A1L A;  2BK0 A;  1UW5 A;  4XRW A;  3KDH A;  3GGN A;  2FFS A;  3IJT A;  3TFZ A;  2PSO A;  4A8U A;  2RES A;  4BKD A;  4DS8 A;  1XN5 A;  4Q0K A;  3IE5 A;  5JNN A;  1EM2 A;  3H3R A;  2L65 A;  3KAY A;  5I9J A;  5I8F A;  4LG5 A;  2E3O A;  1T17 A;  3NI8 A;  4FPW A;  3RT2 A;  1LN3 A;  2K5G A;  3ZVU A;  3NEG A;  2E3P A;  2EJX A;  3PU2 A;  4A8G A;  1QMR A;  4IH0 A;  4A85 A;  2LPX A;  3KDI A;  3JRS A;  4WVO A;  3OQU A;  3W9K A;  1XFS A;  3P51 A;  2K7H A;  3WG8 A;  2LEQ A;  3TVR A;  4LGA A;  2VNE A;  4M9B A;  2N4B A;  4BTZ A;  4IGX A;  2KTE A;  4REH A;  3NMP A;  4OIC A;  4A83 A;  3Q63 A;  4DSB A;  4R7K A;  5E4B A;  4REJ A;  2GKD A;  1Z94 A;  1BTV A;  2VQ5 A;  3KAZ A;  2E3M A;  2LUZ A;  3NMH A;  3PUT A;  3TVQ A;  4A86 A;  4C9I A;  2LIO A;  3NS2 A;  4JDA A;  2E3R A;  1JSS A;  3NMT A;  4M9W A;  5E46 A;  5E4M A;  4C94 A;  3H3Q A;  3KL1 A;  4REI A;  3OTL A;  1KCM A;  3OH8 A;  2IL5 A;  2R55 A;  5JO2 A;  3NEF A;  3P0L A;  2I9Y A;  2M47 A;  3RD6 A;  3UQH A;  3W9R A;  1X53 A;  3NMN A;  3QN1 A;  3TL1 A;  2RER A;  5AMW A;  2LGH A;  2LCG A;  4A84 A;  1VJH A;  2LF2 A;  4LA7 A;  2E3N A;  2KF2 A;  3KLX A;  3KB3 A;  3E85 A;  4A80 A; 
#chains in the Genus database with same CATH topology
 5BRL A;  1TW0 A;  1LN1 A;  2QIM A;  4BK7 A;  4A88 A;  2Z9Y A;  3HVR A;  3GL2 A;  1E09 A;  4IGY A;  3JRQ B;  1XDF A;  2M89 A;  2L8O A;  3CNW A;  3NJ1 A;  4BKC A;  4Y31 A;  5E4D A;  4QDD A;  4A81 A;  4MA6 A;  3UJL A;  3NR4 A;  4XRT A;  5JO1 A;  1IFV A;  4JHI A;  4JHY A;  3NMV A;  3NJO A;  4RYV A;  2N4A A;  3QSZ A;  2E3Q A;  2FLH A;  1ZXF A;  2WQL A;  3OJI A;  3P9V A;  3HM9 A;  4IHR A;  2Z9Z A;  1XN6 A;  3Q6A A;  4N3E A;  4IH2 A;  4JHG A;  2REZ A;  3K90 A;  4GY9 A;  4BK6 A;  1B6F A;  4JHH A;  4QIP A;  1XUV A;  2E3S A;  1TXC A;  1H2O A;  3F08 A;  1LN2 A;  3H3T A;  4IGW A;  4Z3L A;  4QDF A;  2LAK A;  4A8V A;  2LDK A;  3R6P A;  4PSB A;  1FSK A;  3KB0 A;  2ZYL A;  3H3S A;  1BV1 A;  1LLT A;  3HK2 A;  3KDJ A;  5C9Y A;  3FO5 A;  3C0V A;  4IGV A;  2MOU A;  4DSC A;  4JDL A;  4N76 A;  4C9C A;  3NJ0 A;  3GOB A;  2LE1 A;  1FM4 A;  2NN5 A;  4MAP A;  1T27 A;  4QCK A;  3Q64 A;  4QDF B;  1ICX A;  4LGB A;  3UID A;  2KCZ A;  3ELI A;  3RT0 C;  4B9R A;  3HO1 A;  2Q3Q A;  2KEW A;  3K3K A;  2QPV A;  3NQN A;  4N0G C;  4MNS A;  4A87 A;  3GTE A;  4N41 A;  2PCS A;  3DLB A;  2L9P A;  2D4R A;  2NS9 A;  3GL0 A;  4NCA A;  2A1L A;  2BK0 A;  1UW5 A;  4XRW A;  3KDH A;  3GGN A;  4N47 A;  2FFS A;  3IJT A;  3TFZ A;  2PSO A;  4A8U A;  2RES A;  4BKD A;  4DS8 A;  1XN5 A;  4Q0K A;  3IE5 A;  5JNN A;  4QDC A;  3F73 A;  5EKQ C;  1EM2 A;  3H3R A;  4NCB A;  2L65 A;  3KAY A;  5I9J A;  5I8F A;  4LG5 A;  2E3O A;  1T17 A;  3NI8 A;  4FPW A;  3RT2 A;  1LN3 A;  2K5G A;  3ZVU A;  4KPY A;  3NEG A;  2E3P A;  2EJX A;  3PU2 A;  4A8G A;  1QMR A;  4IH0 A;  4A85 A;  2LPX A;  3KDI A;  3JRS A;  4WVO A;  3OQU A;  3W9K A;  1XFS A;  3P51 A;  2K7H A;  3WG8 A;  2LEQ A;  3TVR A;  4LGA A;  2VNE A;  4M9B A;  4E6F A;  2N4B A;  4BTZ A;  4IGX A;  3TGO C;  2KTE A;  4REH A;  3DLH A;  3NMP A;  4OIC A;  4A83 A;  3Q63 A;  4DSB A;  4R7K A;  5E4B A;  4REJ A;  2GKD A;  1Z94 A;  1BTV A;  2VQ5 A;  3KAZ A;  2E3M A;  2LUZ A;  3NMH A;  3PUT A;  3TVQ A;  4A86 A;  4C9I A;  2LIO A;  3NS2 A;  4JDA A;  2E3R A;  1JSS A;  3NMT A;  4M9W A;  3GTS A;  5E46 A;  5E4M A;  4C94 A;  3H3Q A;  3KL1 A;  4REI A;  3OTL A;  3HXM A;  2YH6 A;  2LAF A;  1KCM A;  3OH8 A;  2IL5 A;  2R55 A;  5JO2 A;  3NEF A;  3P0L A;  2I9Y A;  2M47 A;  3RD6 A;  3HJF A;  3UQH A;  3GB4 A;  3W9R A;  1X53 A;  3NMN A;  3QN1 A;  3TL1 A;  2RER A;  5AMW A;  2LGH A;  3GKE A;  2LCG A;  4A84 A;  1VJH A;  2LF2 A;  4LA7 A;  2E3N A;  2KF2 A;  3KLX A;  3KB3 A;  3E85 A;  4A80 A; 
#chains in the Genus database with same CATH homology
 5BRL A;  1TW0 A;  1LN1 A;  2QIM A;  4BK7 A;  4A88 A;  2Z9Y A;  3HVR A;  3GL2 A;  1E09 A;  4IGY A;  3JRQ B;  1XDF A;  2M89 A;  2L8O A;  3CNW A;  3NJ1 A;  4BKC A;  4Y31 A;  5E4D A;  4QDD A;  4A81 A;  4MA6 A;  3UJL A;  3NR4 A;  4XRT A;  5JO1 A;  1IFV A;  4JHI A;  4JHY A;  3NMV A;  3NJO A;  4RYV A;  2N4A A;  3QSZ A;  2E3Q A;  2FLH A;  1ZXF A;  2WQL A;  3OJI A;  3P9V A;  3HM9 A;  4IHR A;  2Z9Z A;  1XN6 A;  3Q6A A;  4N3E A;  4IH2 A;  4JHG A;  2REZ A;  3K90 A;  4GY9 A;  4BK6 A;  1B6F A;  4JHH A;  4QIP A;  1XUV A;  2E3S A;  1TXC A;  1H2O A;  3F08 A;  1LN2 A;  3H3T A;  4IGW A;  4Z3L A;  4QDF A;  2LAK A;  4A8V A;  2LDK A;  3R6P A;  4PSB A;  1FSK A;  3KB0 A;  2ZYL A;  3H3S A;  1BV1 A;  1LLT A;  3HK2 A;  3KDJ A;  5C9Y A;  3FO5 A;  3C0V A;  4IGV A;  2MOU A;  4DSC A;  4JDL A;  4N76 A;  4C9C A;  3NJ0 A;  3GOB A;  2LE1 A;  1FM4 A;  2NN5 A;  4MAP A;  1T27 A;  4QCK A;  3Q64 A;  4QDF B;  1ICX A;  4LGB A;  3UID A;  2KCZ A;  3ELI A;  3RT0 C;  4B9R A;  3HO1 A;  2Q3Q A;  2KEW A;  3K3K A;  2QPV A;  3NQN A;  4N0G C;  4MNS A;  4A87 A;  3GTE A;  4N41 A;  2PCS A;  3DLB A;  2L9P A;  2D4R A;  2NS9 A;  3GL0 A;  4NCA A;  2A1L A;  2BK0 A;  1UW5 A;  4XRW A;  3KDH A;  3GGN A;  4N47 A;  2FFS A;  3IJT A;  3TFZ A;  2PSO A;  4A8U A;  2RES A;  4BKD A;  4DS8 A;  1XN5 A;  4Q0K A;  3IE5 A;  5JNN A;  4QDC A;  3F73 A;  5EKQ C;  1EM2 A;  3H3R A;  4NCB A;  2L65 A;  3KAY A;  5I9J A;  5I8F A;  4LG5 A;  2E3O A;  1T17 A;  3NI8 A;  4FPW A;  3RT2 A;  1LN3 A;  2K5G A;  3ZVU A;  4KPY A;  3NEG A;  2E3P A;  2EJX A;  3PU2 A;  4A8G A;  1QMR A;  4IH0 A;  4A85 A;  2LPX A;  3KDI A;  3JRS A;  4WVO A;  3OQU A;  3W9K A;  1XFS A;  3P51 A;  2K7H A;  3WG8 A;  2LEQ A;  3TVR A;  4LGA A;  2VNE A;  4M9B A;  4E6F A;  2N4B A;  4BTZ A;  4IGX A;  3TGO C;  2KTE A;  4REH A;  3DLH A;  3NMP A;  4OIC A;  4A83 A;  3Q63 A;  4DSB A;  4R7K A;  5E4B A;  4REJ A;  2GKD A;  1Z94 A;  1BTV A;  2VQ5 A;  3KAZ A;  2E3M A;  2LUZ A;  3NMH A;  3PUT A;  3TVQ A;  4A86 A;  4C9I A;  2LIO A;  3NS2 A;  4JDA A;  2E3R A;  1JSS A;  3NMT A;  4M9W A;  3GTS A;  5E46 A;  5E4M A;  4C94 A;  3H3Q A;  3KL1 A;  4REI A;  3OTL A;  3HXM A;  2YH6 A;  2LAF A;  1KCM A;  3OH8 A;  2IL5 A;  2R55 A;  5JO2 A;  3NEF A;  3P0L A;  2I9Y A;  2M47 A;  3RD6 A;  3HJF A;  3UQH A;  3GB4 A;  3W9R A;  1X53 A;  3NMN A;  3QN1 A;  3TL1 A;  2RER A;  5AMW A;  2LGH A;  3GKE A;  2LCG A;  4A84 A;  1VJH A;  2LF2 A;  4LA7 A;  2E3N A;  2KF2 A;  3KLX A;  3KB3 A;  3E85 A;  4A80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...