3NMTA

Crystal structure of pyrabactin bound abscisic acid receptor pyl2 mutant a93f in complex with type 2c protein phosphatase hab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
176
structure length
176
Chain Sequence
SEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPFSTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Identification and mechanism of ABA receptor antagonism.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 43
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nmtA00
2L9PA 2WQLA 3TFZA 2N4AA 2VNEA 4A85A 2L65A 3P0LA 5AMWA 3RT0C 3NJ0A 2QPVA 3KLXA 3Q64A 4B9RA 3OQUA 4REJA 4M9WA 5E4DA 4A80A 1Z94A 2E3RA 2KCZA 4A84A 1FSKA 2REZA 4FPWA 2FLHA 4LGBA 5BRLA 3UJLA 2N4BA 1TW0A 3KB0A 4IH2A 2E3SA 4BK7A 2E3MA 1LN1A 4C9CA 2FFSA 2GKDA 3IE5A 4OICA 3OH8A 2E3QA 3NEFA 1LLTA 2LF2A 3H3TA 2Q3QA 3H3RA 3PU2A 3IJTA 3Q6AA 3TVQA 3ELIA 3W9RA 2MOUA 3H3QA 4JHHA 1EM2A 2LCGA 4C94A 3TVRA 2BK0A 3KAYA 3PUTA 4M9BA 1XDFA 4MNSA 1QMRA 2PCSA 3JRSA 3JRQB 2KF2A 3NMNA 4IGXA 1H2OA 3UIDA 3KAZA 3P51A 4LG5A 4REHA 1XUVA 2NS9A 4REIA 4Z3LA 2IL5A 3NI8A 4BKDA 4PSBA 4N0GC 5JO2A 2RESA 4A83A 4JDLA 2LGHA 1BV1A 3TL1A 4QIPA 4IGYA 3NR4A 4N3EA 5JO1A 5E46A 3KDIA 3NEGA 4R7KA 2M89A 3F08A 4A86A 2K7HA 2R55A 3R6PA 4JDAA 1TXCA 5E4MA 3KB3A 1FM4A 1ICXA 1XN6A 2RERA 1UW5A 3QSZA 5C9YA 3K3KA 1BTVA 2Z9ZA 3KL1A 2KEWA 3W9KA 3NJ1A 2D4RA 4Y31A 3P9VA 2LDKA 4A81A 1XN5A 1KCMA 3RD6A 4XRTA 4BKCA 2LIOA 4MA6A 4DSBA 1LN2A 3E85A 1B6FA 3OTLA 3NMTA 4JHGA 2EJXA 1XFSA 4A87A 2LAKA 2Z9YA 3ZVUA 2PSOA 4DS8A 2E3NA 4DSCA 4A8UA 2L8OA 3NJOA 3QN1A 1X53A 4WVOA 5JNNA 4BK6A 4IHRA 3OJIA 1T17A 1IFVA 4A88A 5E4BA 2M47A 3Q63A 1JSSA 2E3PA 5I9JA 4LA7A 5I8FA 2LE1A 4RYVA 3KDHA 2K5GA 2A1LA 2KTEA 4IGVA 1LN3A 2E3OA 3RT2A 3CNWA 2QIMA 2I9YA 3GGNA 3NS2A 4MAPA 3C0VA 4Q0KA 4C9IA 1T27A 4A8GA 2NN5A 3K90A 4GY9A 4A8VA 2VQ5A 4XRWA 4LGAA 1ZXFA 4JHIA 4IH0A 2LEQA 2LUZA 4BTZA 3NMHA 3H3SA 3NMVA 3UQHA 1E09A 2LPXA 1VJHA 4IGWA 3NMPA 3FO5A 3KDJA 3WG8A
chains in the Genus database with same CATH superfamily
3F73A 2L9PA 2WQLA 3TFZA 2N4AA 2VNEA 4A85A 2L65A 3P0LA 5AMWA 3RT0C 3DLHA 3NJ0A 2QPVA 3KLXA 3Q64A 4QDFA 3OQUA 4REJA 4B9RA 3HM9A 4M9WA 5E4DA 4A80A 1Z94A 2E3RA 2KCZA 2ZYLA 4A84A 1FSKA 2REZA 4FPWA 3TGOC 2FLHA 4LGBA 5BRLA 3UJLA 2N4BA 1TW0A 3KB0A 3GOBA 4IH2A 2E3SA 4BK7A 2E3MA 1LN1A 4C9CA 2FFSA 2GKDA 3IE5A 4OICA 3OH8A 2E3QA 3DLBA 3NEFA 1LLTA 2LF2A 3H3TA 2Q3QA 3H3RA 3PU2A 3IJTA 3Q6AA 3TVQA 5EKQC 3ELIA 3W9RA 2MOUA 3H3QA 4JHHA 1EM2A 2LCGA 4C94A 3TVRA 3HJFA 2BK0A 3KAYA 3PUTA 4M9BA 1XDFA 4MNSA 1QMRA 2PCSA 3JRSA 3JRQB 2KF2A 3NMNA 3NQNA 4IGXA 1H2OA 3UIDA 3KAZA 3P51A 4LG5A 4REHA 4JHYA 1XUVA 2NS9A 4REIA 4Z3LA 2IL5A 3NI8A 4BKDA 4E6FA 3GKEA 4N0GC 4PSBA 2RESA 5JO2A 4A83A 4JDLA 2LGHA 1BV1A 3TL1A 4QIPA 4IGYA 3HXMA 3NR4A 4N3EA 4QCKA 5JO1A 5E46A 3KDIA 3NEGA 4R7KA 2LAFA 2M89A 3F08A 4A86A 2K7HA 2R55A 3R6PA 4JDAA 1TXCA 5E4MA 3KB3A 1FM4A 1ICXA 1XN6A 2RERA 1UW5A 3QSZA 5C9YA 3K3KA 3HK2A 1BTVA 2Z9ZA 3KL1A 2KEWA 3W9KA 3NJ1A 2D4RA 4Y31A 3P9VA 4QDCA 4N47A 2LDKA 4A81A 1XN5A 1KCMA 3RD6A 4KPYA 4XRTA 4BKCA 2LIOA 4MA6A 3HO1A 4DSBA 1LN2A 4NCAA 3E85A 1B6FA 3OTLA 3NMTA 4JHGA 2EJXA 1XFSA 4A87A 2LAKA 3HVRA 2Z9YA 3ZVUA 2PSOA 4DS8A 2E3NA 4N41A 3GB4A 3GL2A 4DSCA 4A8UA 4QDFB 2L8OA 3NJOA 3QN1A 1X53A 3GTSA 4WVOA 4BK6A 5JNNA 4IHRA 3OJIA 1T17A 1IFVA 4A88A 5E4BA 4QDDA 2M47A 3Q63A 1JSSA 2E3PA 4N76A 5I9JA 4LA7A 5I8FA 2LE1A 4RYVA 3KDHA 2K5GA 2A1LA 4NCBA 3GTEA 2KTEA 4IGVA 1LN3A 2E3OA 3RT2A 3CNWA 2QIMA 2I9YA 2YH6A 3GGNA 3NS2A 3C0VA 4MAPA 4Q0KA 4C9IA 1T27A 3GL0A 2NN5A 3K90A 4GY9A 4A8GA 4A8VA 2VQ5A 4XRWA 4LGAA 1ZXFA 4JHIA 4IH0A 2LEQA 2LUZA 4BTZA 3NMHA 3H3SA 3NMVA 3UQHA 1E09A 2LPXA 1VJHA 4IGWA 3NMPA 3FO5A 3KDJA 3WG8A
chains in the Genus database with same CATH topology
3F73A 2L9PA 2WQLA 3TFZA 2N4AA 2VNEA 4A85A 2L65A 3P0LA 5AMWA 3RT0C 3DLHA 3NJ0A 2QPVA 3KLXA 3Q64A 4QDFA 3OQUA 4REJA 4B9RA 3HM9A 4M9WA 5E4DA 4A80A 1Z94A 2E3RA 2KCZA 2ZYLA 4A84A 1FSKA 2REZA 4FPWA 3TGOC 2FLHA 4LGBA 5BRLA 3UJLA 2N4BA 1TW0A 3KB0A 3GOBA 4IH2A 2E3SA 4BK7A 2E3MA 1LN1A 4C9CA 2FFSA 2GKDA 3IE5A 4OICA 3OH8A 2E3QA 3DLBA 3NEFA 1LLTA 2LF2A 3H3TA 2Q3QA 3H3RA 3PU2A 3IJTA 3Q6AA 3TVQA 5EKQC 3ELIA 3W9RA 2MOUA 3H3QA 4JHHA 1EM2A 2LCGA 4C94A 3TVRA 3HJFA 2BK0A 3KAYA 3PUTA 4M9BA 1XDFA 4MNSA 1QMRA 2PCSA 3JRSA 3JRQB 2KF2A 3NMNA 3NQNA 4IGXA 1H2OA 3UIDA 3KAZA 3P51A 4LG5A 4REHA 4JHYA 1XUVA 2NS9A 4REIA 4Z3LA 2IL5A 3NI8A 4BKDA 4E6FA 3GKEA 4N0GC 4PSBA 2RESA 5JO2A 4A83A 4JDLA 2LGHA 1BV1A 3TL1A 4QIPA 4IGYA 3HXMA 3NR4A 4N3EA 4QCKA 5JO1A 5E46A 3KDIA 3NEGA 4R7KA 2LAFA 2M89A 3F08A 4A86A 2K7HA 2R55A 3R6PA 4JDAA 1TXCA 5E4MA 3KB3A 1FM4A 1ICXA 1XN6A 2RERA 1UW5A 3QSZA 5C9YA 3K3KA 3HK2A 1BTVA 2Z9ZA 3KL1A 2KEWA 3W9KA 3NJ1A 2D4RA 4Y31A 3P9VA 4QDCA 4N47A 2LDKA 4A81A 1XN5A 1KCMA 3RD6A 4KPYA 4XRTA 4BKCA 2LIOA 4MA6A 3HO1A 4DSBA 1LN2A 4NCAA 3E85A 1B6FA 3OTLA 3NMTA 4JHGA 2EJXA 1XFSA 4A87A 2LAKA 3HVRA 2Z9YA 3ZVUA 2PSOA 4DS8A 2E3NA 4N41A 3GB4A 3GL2A 4DSCA 4A8UA 4QDFB 2L8OA 3NJOA 3QN1A 1X53A 3GTSA 4WVOA 4BK6A 5JNNA 4IHRA 3OJIA 1T17A 1IFVA 4A88A 5E4BA 4QDDA 2M47A 3Q63A 1JSSA 2E3PA 4N76A 5I9JA 4LA7A 5I8FA 2LE1A 4RYVA 3KDHA 2K5GA 2A1LA 4NCBA 3GTEA 2KTEA 4IGVA 1LN3A 2E3OA 3RT2A 3CNWA 2QIMA 2I9YA 2YH6A 3GGNA 3NS2A 3C0VA 4MAPA 4Q0KA 4C9IA 1T27A 3GL0A 2NN5A 3K90A 4GY9A 4A8GA 4A8VA 2VQ5A 4XRWA 4LGAA 1ZXFA 4JHIA 4IH0A 2LEQA 2LUZA 4BTZA 3NMHA 3H3SA 3NMVA 3UQHA 1E09A 2LPXA 1VJHA 4IGWA 3NMPA 3FO5A 3KDJA 3WG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9P A;  2WQL A;  3TFZ A;  2N4A A;  2VNE A;  4A85 A;  2L65 A;  3P0L A;  5AMW A;  3RT0 C;  3NJ0 A;  2QPV A;  3KLX A;  3Q64 A;  4B9R A;  3OQU A;  4REJ A;  4M9W A;  5E4D A;  4A80 A;  1Z94 A;  2E3R A;  2KCZ A;  4A84 A;  1FSK A;  2REZ A;  4FPW A;  2FLH A;  4LGB A;  5BRL A;  3UJL A;  2N4B A;  1TW0 A;  3KB0 A;  4IH2 A;  2E3S A;  4BK7 A;  2E3M A;  1LN1 A;  4C9C A;  2FFS A;  2GKD A;  3IE5 A;  4OIC A;  3OH8 A;  2E3Q A;  3NEF A;  1LLT A;  2LF2 A;  3H3T A;  2Q3Q A;  3H3R A;  3PU2 A;  3IJT A;  3Q6A A;  3TVQ A;  3ELI A;  3W9R A;  2MOU A;  3H3Q A;  4JHH A;  1EM2 A;  2LCG A;  4C94 A;  3TVR A;  2BK0 A;  3KAY A;  3PUT A;  4M9B A;  1XDF A;  4MNS A;  1QMR A;  2PCS A;  3JRS A;  3JRQ B;  2KF2 A;  3NMN A;  4IGX A;  1H2O A;  3UID A;  3KAZ A;  3P51 A;  4LG5 A;  4REH A;  1XUV A;  2NS9 A;  4REI A;  4Z3L A;  2IL5 A;  3NI8 A;  4BKD A;  4PSB A;  4N0G C;  5JO2 A;  2RES A;  4A83 A;  4JDL A;  2LGH A;  1BV1 A;  3TL1 A;  4QIP A;  4IGY A;  3NR4 A;  4N3E A;  5JO1 A;  5E46 A;  3KDI A;  3NEG A;  4R7K A;  2M89 A;  3F08 A;  4A86 A;  2K7H A;  2R55 A;  3R6P A;  4JDA A;  1TXC A;  5E4M A;  3KB3 A;  1FM4 A;  1ICX A;  1XN6 A;  2RER A;  1UW5 A;  3QSZ A;  5C9Y A;  3K3K A;  1BTV A;  2Z9Z A;  3KL1 A;  2KEW A;  3W9K A;  3NJ1 A;  2D4R A;  4Y31 A;  3P9V A;  2LDK A;  4A81 A;  1XN5 A;  1KCM A;  3RD6 A;  4XRT A;  4BKC A;  2LIO A;  4MA6 A;  4DSB A;  1LN2 A;  3E85 A;  1B6F A;  3OTL A;  3NMT A;  4JHG A;  2EJX A;  1XFS A;  4A87 A;  2LAK A;  2Z9Y A;  3ZVU A;  2PSO A;  4DS8 A;  2E3N A;  4DSC A;  4A8U A;  2L8O A;  3NJO A;  3QN1 A;  1X53 A;  4WVO A;  5JNN A;  4BK6 A;  4IHR A;  3OJI A;  1T17 A;  1IFV A;  4A88 A;  5E4B A;  2M47 A;  3Q63 A;  1JSS A;  2E3P A;  5I9J A;  4LA7 A;  5I8F A;  2LE1 A;  4RYV A;  3KDH A;  2K5G A;  2A1L A;  2KTE A;  4IGV A;  1LN3 A;  2E3O A;  3RT2 A;  3CNW A;  2QIM A;  2I9Y A;  3GGN A;  3NS2 A;  4MAP A;  3C0V A;  4Q0K A;  4C9I A;  1T27 A;  4A8G A;  2NN5 A;  3K90 A;  4GY9 A;  4A8V A;  2VQ5 A;  4XRW A;  4LGA A;  1ZXF A;  4JHI A;  4IH0 A;  2LEQ A;  2LUZ A;  4BTZ A;  3NMH A;  3H3S A;  3NMV A;  3UQH A;  1E09 A;  2LPX A;  1VJH A;  4IGW A;  3NMP A;  3FO5 A;  3KDJ A;  3WG8 A; 
#chains in the Genus database with same CATH topology
 3F73 A;  2L9P A;  2WQL A;  3TFZ A;  2N4A A;  2VNE A;  4A85 A;  2L65 A;  3P0L A;  5AMW A;  3RT0 C;  3DLH A;  3NJ0 A;  2QPV A;  3KLX A;  3Q64 A;  4QDF A;  3OQU A;  4REJ A;  4B9R A;  3HM9 A;  4M9W A;  5E4D A;  4A80 A;  1Z94 A;  2E3R A;  2KCZ A;  2ZYL A;  4A84 A;  1FSK A;  2REZ A;  4FPW A;  3TGO C;  2FLH A;  4LGB A;  5BRL A;  3UJL A;  2N4B A;  1TW0 A;  3KB0 A;  3GOB A;  4IH2 A;  2E3S A;  4BK7 A;  2E3M A;  1LN1 A;  4C9C A;  2FFS A;  2GKD A;  3IE5 A;  4OIC A;  3OH8 A;  2E3Q A;  3DLB A;  3NEF A;  1LLT A;  2LF2 A;  3H3T A;  2Q3Q A;  3H3R A;  3PU2 A;  3IJT A;  3Q6A A;  3TVQ A;  5EKQ C;  3ELI A;  3W9R A;  2MOU A;  3H3Q A;  4JHH A;  1EM2 A;  2LCG A;  4C94 A;  3TVR A;  3HJF A;  2BK0 A;  3KAY A;  3PUT A;  4M9B A;  1XDF A;  4MNS A;  1QMR A;  2PCS A;  3JRS A;  3JRQ B;  2KF2 A;  3NMN A;  3NQN A;  4IGX A;  1H2O A;  3UID A;  3KAZ A;  3P51 A;  4LG5 A;  4REH A;  4JHY A;  1XUV A;  2NS9 A;  4REI A;  4Z3L A;  2IL5 A;  3NI8 A;  4BKD A;  4E6F A;  3GKE A;  4N0G C;  4PSB A;  2RES A;  5JO2 A;  4A83 A;  4JDL A;  2LGH A;  1BV1 A;  3TL1 A;  4QIP A;  4IGY A;  3HXM A;  3NR4 A;  4N3E A;  4QCK A;  5JO1 A;  5E46 A;  3KDI A;  3NEG A;  4R7K A;  2LAF A;  2M89 A;  3F08 A;  4A86 A;  2K7H A;  2R55 A;  3R6P A;  4JDA A;  1TXC A;  5E4M A;  3KB3 A;  1FM4 A;  1ICX A;  1XN6 A;  2RER A;  1UW5 A;  3QSZ A;  5C9Y A;  3K3K A;  3HK2 A;  1BTV A;  2Z9Z A;  3KL1 A;  2KEW A;  3W9K A;  3NJ1 A;  2D4R A;  4Y31 A;  3P9V A;  4QDC A;  4N47 A;  2LDK A;  4A81 A;  1XN5 A;  1KCM A;  3RD6 A;  4KPY A;  4XRT A;  4BKC A;  2LIO A;  4MA6 A;  3HO1 A;  4DSB A;  1LN2 A;  4NCA A;  3E85 A;  1B6F A;  3OTL A;  3NMT A;  4JHG A;  2EJX A;  1XFS A;  4A87 A;  2LAK A;  3HVR A;  2Z9Y A;  3ZVU A;  2PSO A;  4DS8 A;  2E3N A;  4N41 A;  3GB4 A;  3GL2 A;  4DSC A;  4A8U A;  4QDF B;  2L8O A;  3NJO A;  3QN1 A;  1X53 A;  3GTS A;  4WVO A;  4BK6 A;  5JNN A;  4IHR A;  3OJI A;  1T17 A;  1IFV A;  4A88 A;  5E4B A;  4QDD A;  2M47 A;  3Q63 A;  1JSS A;  2E3P A;  4N76 A;  5I9J A;  4LA7 A;  5I8F A;  2LE1 A;  4RYV A;  3KDH A;  2K5G A;  2A1L A;  4NCB A;  3GTE A;  2KTE A;  4IGV A;  1LN3 A;  2E3O A;  3RT2 A;  3CNW A;  2QIM A;  2I9Y A;  2YH6 A;  3GGN A;  3NS2 A;  3C0V A;  4MAP A;  4Q0K A;  4C9I A;  1T27 A;  3GL0 A;  2NN5 A;  3K90 A;  4GY9 A;  4A8G A;  4A8V A;  2VQ5 A;  4XRW A;  4LGA A;  1ZXF A;  4JHI A;  4IH0 A;  2LEQ A;  2LUZ A;  4BTZ A;  3NMH A;  3H3S A;  3NMV A;  3UQH A;  1E09 A;  2LPX A;  1VJH A;  4IGW A;  3NMP A;  3FO5 A;  3KDJ A;  3WG8 A; 
#chains in the Genus database with same CATH homology
 3F73 A;  2L9P A;  2WQL A;  3TFZ A;  2N4A A;  2VNE A;  4A85 A;  2L65 A;  3P0L A;  5AMW A;  3RT0 C;  3DLH A;  3NJ0 A;  2QPV A;  3KLX A;  3Q64 A;  4QDF A;  3OQU A;  4REJ A;  4B9R A;  3HM9 A;  4M9W A;  5E4D A;  4A80 A;  1Z94 A;  2E3R A;  2KCZ A;  2ZYL A;  4A84 A;  1FSK A;  2REZ A;  4FPW A;  3TGO C;  2FLH A;  4LGB A;  5BRL A;  3UJL A;  2N4B A;  1TW0 A;  3KB0 A;  3GOB A;  4IH2 A;  2E3S A;  4BK7 A;  2E3M A;  1LN1 A;  4C9C A;  2FFS A;  2GKD A;  3IE5 A;  4OIC A;  3OH8 A;  2E3Q A;  3DLB A;  3NEF A;  1LLT A;  2LF2 A;  3H3T A;  2Q3Q A;  3H3R A;  3PU2 A;  3IJT A;  3Q6A A;  3TVQ A;  5EKQ C;  3ELI A;  3W9R A;  2MOU A;  3H3Q A;  4JHH A;  1EM2 A;  2LCG A;  4C94 A;  3TVR A;  3HJF A;  2BK0 A;  3KAY A;  3PUT A;  4M9B A;  1XDF A;  4MNS A;  1QMR A;  2PCS A;  3JRS A;  3JRQ B;  2KF2 A;  3NMN A;  3NQN A;  4IGX A;  1H2O A;  3UID A;  3KAZ A;  3P51 A;  4LG5 A;  4REH A;  4JHY A;  1XUV A;  2NS9 A;  4REI A;  4Z3L A;  2IL5 A;  3NI8 A;  4BKD A;  4E6F A;  3GKE A;  4N0G C;  4PSB A;  2RES A;  5JO2 A;  4A83 A;  4JDL A;  2LGH A;  1BV1 A;  3TL1 A;  4QIP A;  4IGY A;  3HXM A;  3NR4 A;  4N3E A;  4QCK A;  5JO1 A;  5E46 A;  3KDI A;  3NEG A;  4R7K A;  2LAF A;  2M89 A;  3F08 A;  4A86 A;  2K7H A;  2R55 A;  3R6P A;  4JDA A;  1TXC A;  5E4M A;  3KB3 A;  1FM4 A;  1ICX A;  1XN6 A;  2RER A;  1UW5 A;  3QSZ A;  5C9Y A;  3K3K A;  3HK2 A;  1BTV A;  2Z9Z A;  3KL1 A;  2KEW A;  3W9K A;  3NJ1 A;  2D4R A;  4Y31 A;  3P9V A;  4QDC A;  4N47 A;  2LDK A;  4A81 A;  1XN5 A;  1KCM A;  3RD6 A;  4KPY A;  4XRT A;  4BKC A;  2LIO A;  4MA6 A;  3HO1 A;  4DSB A;  1LN2 A;  4NCA A;  3E85 A;  1B6F A;  3OTL A;  3NMT A;  4JHG A;  2EJX A;  1XFS A;  4A87 A;  2LAK A;  3HVR A;  2Z9Y A;  3ZVU A;  2PSO A;  4DS8 A;  2E3N A;  4N41 A;  3GB4 A;  3GL2 A;  4DSC A;  4A8U A;  4QDF B;  2L8O A;  3NJO A;  3QN1 A;  1X53 A;  3GTS A;  4WVO A;  4BK6 A;  5JNN A;  4IHR A;  3OJI A;  1T17 A;  1IFV A;  4A88 A;  5E4B A;  4QDD A;  2M47 A;  3Q63 A;  1JSS A;  2E3P A;  4N76 A;  5I9J A;  4LA7 A;  5I8F A;  2LE1 A;  4RYV A;  3KDH A;  2K5G A;  2A1L A;  4NCB A;  3GTE A;  2KTE A;  4IGV A;  1LN3 A;  2E3O A;  3RT2 A;  3CNW A;  2QIM A;  2I9Y A;  2YH6 A;  3GGN A;  3NS2 A;  3C0V A;  4MAP A;  4Q0K A;  4C9I A;  1T27 A;  3GL0 A;  2NN5 A;  3K90 A;  4GY9 A;  4A8G A;  4A8V A;  2VQ5 A;  4XRW A;  4LGA A;  1ZXF A;  4JHI A;  4IH0 A;  2LEQ A;  2LUZ A;  4BTZ A;  3NMH A;  3H3S A;  3NMV A;  3UQH A;  1E09 A;  2LPX A;  1VJH A;  4IGW A;  3NMP A;  3FO5 A;  3KDJ A;  3WG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...