3NN0X

Complex of 6-hydroxy-l-nicotine oxidase with nicotinamide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 138
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nn0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nn0X02
2YG6A 1QLBA 3ATRA 1HYUA 3V3NA 4GDEA 5BRTA 2C70A 2CFYA 2V60A 1UKVG 3NYCA 3NN0X 1QO8A 4FK1C 4B69A 3FPZA 2VVLA 1OJTA 2YR6A 1DODA 1KSUA 2EQ8A 3O0HA 1EBDA 3DA1A 5JCLA 1XANA 5EBKA 4DSHA 1FECA 4EQWA 5KVHA 2APGA 2GVCA 3FIMB 4REKA 2X8GA 3AB1A 4ADWA 1YKJA 1CJ2A 1F8RA 3ALMA 2YLXA 1NDAA 4U2LA 5U1OA 4NTEA 3II4A 3UKPA 2EQ7A 1Z6LA 3ALLA 5FS7A 1N1PA 2QAEA 2GQWA 1OJDA 2R45A 4OPDA 2V61A 2AR8A 2YG4A 2Z5YA 3KLJA 2PYXA 4MJWA 2E4GA 3F8RA 3B6DA 1D4EA 3I3LA 1E39A 2WS3A 2XVIA 1H86A 2J3NA 3BI5A 5JCNA 2ZZ0A 3UTGA 5J7XA 1CC6A 4ECHA 1ELIA 2OAMA 1ZOVA 1PXAA 4YSZA 5HXIA 4NZHA 2WEUA 1D4CA 4K2XA 4U8MA 2A87A 2XFOA 2BK5A 3AE1A 1PBFA 2ARDA 2WPCA 1KNPA 3EAOA 3CNJA 4NEWA 2OA1A 1JU2A 2FJBA 2YLZA 1VRQB 4EIPA 4AP1A 2XCGA 3FMWA 1KNRA 2BC0A 2GR0A 5GRTA 4H4ZA 1K0LA 3VRBA 4CY8A 4A6NB 2R4EA 4EM3A 1VQWA 4Z43A 1TDEA 5M0ZA 1LQTA 3ADAB 3GDNA 1KF6A 1Q1RA 1PS9A 2XLUA 1O5WA 4FK1A 4YT0A 2GAGB 1PJ7A 4Z44A 3GDPA 2BCPA 2R46A 1E1MA 2XFUA 4BJZA 4C3XA 4YTNA 1F3PA 2YVFA 5M10A 1BF3A 3AD8B 5HYMA 3LZWA 2VRLA 4GUVA 3IHGA 4GDPA 3K7TA 1O94A 3WE0A 3CNPA 5C3JA 2HQMA 3Q6JA 2BC1A 4U8NA 1JNRA 2EQ9A 4TM4A 4P9SA 1PDHA 4H4TA 4U8IA 2NPXA 1TDOA 5EB4A 1E1KA 1EL7A 1NG4A 5J60A 1BZLA 1LJ1A 3M0OA 2YM1A 3UOVA 4BJYA 4J33A 3H8IA 4TM1A 2WPEA 5JCKA 3AE9A 1B37A 2R0PA 2WU5A 2WP5A 1GRGA 3OC4A 1F6MA 1DJNA 4CRTA 2BA9A 4YTMA 1E7PA 1GXFA 1VDCA 3RP7A 1NHSA 3M12A 4KPRA 3VR9A 1DXLA 5CKUA 1TDFA 2BS2A 3P4PA 4AOXA 4OPCA 4JNAA 1IUWA 1DNCA 2JB3A 4U8OA 4AT2A 4YSHA 4GR1A 1LTXR 3GRTA 2BABA 3DGZA 2XYOA 3K7QX 1Y0PA 4UDQA 3AEEA 3FG2P 1B5QA 1KDGA 4TLXA 4YKFA 3BNMA 4OVIA 4U8LA 4FDCB 4JQ9A 3SGLA 5BUKA 3AEBA 4DGKA 2C76A 3ICTA 4DNAA 3SQPA 4Z2RA 5L46A 2B9WA 3QVRA 2JB2A 3NK2X 1TYTA 3ISHA 2RABA 2WETA 5HHFA 2C64A 1XHCA 1S2YA 4A65A 3P4RA 3PO7A 2NVKX 4IVMB 2X8CA 3DMEA 3KVEA 3AEAA 3QSMA 4ICYA 1V59A 3DJDA 3ICSA 4Z24A 2GH5A 4NTDA 2V6OA 2DKIA 3BNUA 5IQ4A 4J57A 3Q9TA 2RGHA 3BI4A 4Y4NA 4JN9A 1D4DA 2IVDA 1ZP0A 2C7GA 2FJEA 1GT8A 3AE8A 3AE6A 3BHKA 2TMDA 3H8LA 2Q6UA 3CNDA 4ZCCA 2YAUA 2C67A 2YG3A 3DK4A 1GV4A 4D04A 5KOXA 2ZZBA 4EIQA 4H4YA 1GALA 3NYEA 1S2QA 2BCGG 2GRTA 4EQRA 5JCIA 2Q0LA 4EM4A 4K5SA 4U2TA 4B1BA 4AP3A 4BURA 4CCRA 2FJDA 3C4NA 4J2WA 1ZX9A 3GYJA 2Z5XA 4H4RA 2YVJA 1OJCA 1IJHA 2AAQA 2WP9A 2B7SA 4XWZA 1GPEA 1LQUA 2BACA 3QFAA 1GREA 2B76A 3NG7X 4CY6A 4X9MA 4CCQA 3CGDA 3LB8A 1NHRA 2JAEA 4IV9A 4O5UA 1GOSA 4NTCA 1NENA 2VQ7A 3IF9A 1PBEA 4AOSA 2GQFA 3GD3A 4EQXA 2DKHA 3GRSA 3IWAA 2YLRA 3NGCX 1GESA 4OPGA 3AE4A 1JRZA 3AEFA 3AYJA 3GSIA 4JY2A 3UP4A 1COYA 3DH9A 2XVEA 2VQBA 3GWDA 4TM0A 5KXJA 1D5TA 1N4UA 2C73A 3CPIG 1E1LA 3SFDA 3AD7B 4PAAA 5TR3A 1P2EA 4K22A 4H7UA 1E6EA 4UDRA 1B4VA 1OJAA 4X4JA 1MXTA 4RG3A 4H2PA 4D03A 1L9EA 3NYFA 3LADA 1JRXA 3ITJA 4OCGA 3UKKA 3QFBA 4N9XA 3GMCA 3COXA 4EMJA 1BGJA 3NTAA 1D7LA 3AYIA 4JY3A 1PHHA 1CC4A 3LJPA 4C5OA 3CGBA 3AEGA 3C96A 2JBVA 2X99A 2YWLA 1Q9IA 1D7YA 5EB5A 3ZDNA 1ZY8A 2Y6QA 2C3DA 3UKFA 2Y6RA 4GF7A 2O9ZA 1IUVA 4H4QA 1L9CA 5KWFA 4J56A 3GD4A 4PABA 3VR8A 2V3BA 1H6VA 3V76A 1K4QA 1ZMCA 1GRBA 4I59A 4KX6A 4YXDA 1ZMDA 1PN0A 1CJCA 2VVLG 2X3NA 5U25A 5FMHA 3CIRA 2C3CA 1GRHA 2ACZA 4CBQA 1FEAA 2GR3A 1B8SA 2BS3A 4H4PA 3UTFA 4C77A 2YG5A 4U8PA 4A6NA 3K7MX 4H4VA 2OALA 3GWFA 2CULA 4B64A 2OLNA 4H4WA 2QA1A 2WU2A 1TYPA 1CJ3A 3UKQA 4GCMA 1VG9A 1ZDLA 1NEKA 4CNJA 3S5WA 2WDRA 3D8XA 2WHDA 3NIXA 1PBBA 4ZN0A 1H83A 1XDIA 2FJAA 5ER0A 3UTEA 3AXBA 5JCMA 1GNDA 3QJ4A 2Q7VA 2YR4A 3NKSA 3EF6A 4H2NA 1FEBA 2UZZA 4B66A 4Z25A 3AE5A 3RP6A 4EMIA 3V3OA 2YLTA 3AYLA 5IQ1A 4A79A 1BGNA 2C66A 5DBJA 3BHFA 1GRTA 1JRYA 1PBDA 1PBCA 3L1RA 4Z26A 1H81A 3E1TA 3AWIA 4H4SA 4B67A 4K5RA 3AECA 1IUUA 2V3AA 4IVOB 4J34A 1QJDA 3CPJG 3ICRA 4OPLA 1S3EA 4Z2TA 2A8XA 2IVEA 2GR1A 2JK6A 1IUSA 1IUXA 4RG4A 4U2SA 4H4UA 1PJ5A 2AQJA 2WBAA 3AE7A 1CC2A 5FS9A 4J31A 4AT0A 1N4VA 2V5ZA 3RP8A 1S3BA 3DJGX 1CBOA 2BXRA 5BVAA 5LV9A 2ZBWA 1LVLA 3C4AA 2RGJA 3B3RA 1DOCA 2BYBA 1NPXA 2GV8A 3OZ2A 4O5QA 4B65A 4BK3A 3LZXA 3KPFA 4FX9A 1XPQA 3QSEA 1PXBA 1LPFA 4K7ZA 3GYIA 2XLRA 2GB0A 2OLOA 3NTDA 1LV0A 3NLCA 1GEUA 2YG7A 1GTEA 4H2QA 3NH3X 3UOYA 3VQRA 3REDA 1YQ4A 4NEVA 1RP0A 2B7RA 4Y4MA 1JEHA 4IA6A 1MO9A 1TRBA 3P4QA 3KD9A 3EANA 3DJEA 4WX1A 1AOGA 2JKCA 4LA1A 1ONFA 2GAHB 3P4SA 4UDPA 2FBWA 2F5ZA 1FOHA 4BV6A 5CQFA 1K0IA 2WDVA 2I0ZA 2XVJA 3PVCA 5KRQA 2WQYA 3GMBA 2XFNA 3URHA 3JSKA 3NT6A 2YVGA 1FL2A 1NHQA 3P1WA 4U8JA 3F8DA 4X9NA 3UOXA 1JOAA 1CL0A 3LXDA 2QCUA 1VG0A 3ATQA 3CTYA 2WESA 2PHHA 2WOWA 1O95A 3PS9A 1GERA 1H84A 2XVHA 2YM2A 4JDRA 4WCTA 3ABVA 2GF3A 4J36A 4APNA 5U63A 3AD9B 3VRDB 3HZLA 1NAAA 3LOVA 3KA7A 3BI2A 2EQ6A 3CPHG 3IC9A 1JNZA 5C2TA 1K0JA 2XLTA 1BKWA 1NG3A 3NRNA 4USQA 4UP3A 4C74A 4EMWA 3M13A 4DSGA 3NK1X 5HY5A 4XWRA 3NN6X 3SM8A 1REOA 2YR5A 5EOWA 2XDOA 1TDKA 3NNEA 1W4XA 3NK0X 4U8KA 4ZCDA 3I6DA 3CNSA 2GMHA 3KU9A 2XLPA 2RGOA 2H89A 3UOZA 4HA6A 2R9ZA 1ZK7A 3ALJA 2IIDA 2R0GA 4H4XA 1GETA 4LIIA 1L9DA 1Y56B 3G5QA 1Y56A 2WPFA 4BK2A 1L0VA 1ZOYA 2H88A 1Q1WA 3S61A 2GMJA 3FBSA 2Q0KA 3AE3A 1YQZA 1H7WA 2X50A 3DGHA 3QSSA 4TLZA 2YLSA 2C72A 1M64A 2A89A 3RHAA 2C65A 1YQ3A 3UKAA 4YSXA 1ZKQA 1IUTA 5KOWA 4TM3A 1X31B 1CF3A 1CJ4A 4OPIA 1F8WA 2B9YA 4RSLA 4B68A 1EL9A 2YQUA 1NHPA 4IA5A 2B9XA 4H50A 4JNQA 3UCLA 1BWCA 1GRAA 4YWOA 2WDQA 1GSNA 3DK9A 2QA2A 3H4KA 1PJ6A 4CNKA 4HB9A 1GRFA 4H2RA 2BS4A 3DK8A 3RNMA 3QVPA 3VRAA 2GEWA 2XLSA 1RSGA 1H7XA 4E0VA 1DOBA 2BXSA 1CHUA 4EQSA 2W0HA 4I58A 1KSSA 1GTHA 2JB1A 1H82A 3CGCA 4B63A 2E1MA 4LU6A 2VRMA 3L8KA 1KFYA 1E1NA 1RYIA 1YY5A 4M52A 3UTHA 4YKGA 2WOIA 2XFQA 2WP6A 3NHOX 3UKHA 4K8DA 2E5VA 4YTPA 4A5LA 1M6IA 1PXCA 3ZYXA 2BK4A 2CDUA 2WOVA 4YSYA 2VVMA 4GRTA 2GR2A 2XFPA 3UKLA 4A7AA 1EL8A 3G5SA 2BK3A 5BULA 3P9UA 1P2HA 4XXGA 3AEDA 1F8SA 2R4JA 4USRA 4OPTA 3T37A 1OJ9A 3UP5A 1MOKA 1SEZA 3CGEA 4OPUA 4A9WA 4A99A 2YLWA 4BK1A 3AE2A 2R0CA 3CNTA 3CN8A 3SFEA 5IPYA 3G5RA 2VZ2A 3D1CA 2ZZCA 5KVIA 2C75A 4Y4LA 1DOEA 5FS8A 1DJQA 5FS6A 3F8PA 3IHMA 3K30A 2X8HA 3R9UA 2CVJA 4Z2UA 1N4WA 2TPRA 4C3YA 3DJJA 1FCDA 3EPTA 5GSNA 3KKJA 2XVFA 2VOUA 1TDNA 1EL5A
chains in the Genus database with same CATH superfamily
2YG6A 1QLBA 3ATRA 1HYUA 3V3NA 4GDEA 5BRTA 2C70A 2CFYA 3T2YA 2V60A 1UKVG 3NYCA 3NN0X 1QO8A 4FK1C 4B69A 3FPZA 2VVLA 1OJTA 2YR6A 1DODA 1KSUA 2EQ8A 3O0HA 1EBDA 3T31A 3DA1A 5JCLA 1XANA 5EBKA 4DSHA 1FECA 4EQWA 5KVHA 2APGA 2GVCA 3FIMB 4REKA 2X8GA 3AB1A 4ADWA 1YKJA 1CJ2A 1F8RA 3ALMA 2YLXA 1NDAA 4U2LA 5U1OA 4NTEA 4CNJA 3II4A 3UKPA 2EQ7A 1Z6LA 3ALLA 5FS7A 1N1PA 2QAEA 2GQWA 1OJDA 2R45A 4OPDA 2V61A 2AR8A 2YG4A 2Z5YA 3KLJA 2PYXA 4MJWA 2E4GA 3F8RA 3B6DA 1D4EA 3I3LA 1E39A 2WS3A 4G9KA 2XVIA 1H86A 2J3NA 3BI5A 5JCNA 4G74A 2ZZ0A 3UTGA 5J7XA 1CC6A 4ECHA 1ELIA 2OAMA 1ZOVA 1PXAA 4YSZA 5HXIA 4NZHA 2WEUA 1D4CA 4K2XA 4U8MA 2A87A 2XFOA 2BK5A 3AE1A 1PBFA 2ARDA 2WPCA 1KNPA 3EAOA 3CNJA 4NEWA 2OA1A 1JU2A 2FJBA 2YLZA 1VRQB 4EIPA 4AP1A 2XCGA 3FMWA 1KNRA 2BC0A 2GR0A 5GRTA 3HYVA 4H4ZA 1K0LA 3VRBA 4CY8A 4A6NB 2R4EA 4EM3A 1VQWA 4Z43A 1TDEA 5M0ZA 1LQTA 3ADAB 3GDNA 1KF6A 1Q1RA 1PS9A 2XLUA 1O5WA 4FK1A 4YT0A 2GAGB 1PJ7A 4NWZA 4Z44A 3GDPA 2BCPA 2R46A 1E1MA 2XFUA 4BJZA 4C3XA 4YTNA 1F3PA 2YVFA 5M10A 1BF3A 3AD8B 5HYMA 3SYIA 3LZWA 2VRLA 4GUVA 3IHGA 4GDPA 3K7TA 1O94A 3WE0A 3CNPA 5C3JA 2BRYA 2HQMA 3Q6JA 2BC1A 4U8NA 1JNRA 2EQ9A 4TM4A 4P9SA 1PDHA 4H4TA 4U8IA 2NPXA 1TDOA 5EB4A 1E1KA 1EL7A 1NG4A 5J60A 1BZLA 1LJ1A 3M0OA 2YM1A 3UOVA 4BJYA 4J33A 3H8IA 4TM1A 2WPEA 5JCKA 3AE9A 1B37A 2R0PA 2WU5A 2WP5A 1GRGA 3OC4A 1F6MA 1DJNA 4CRTA 2BA9A 4G6HA 4YTMA 1E7PA 1GXFA 1VDCA 3RP7A 1NHSA 3M12A 4KPRA 3VR9A 1DXLA 5CKUA 1TDFA 2BS2A 3P4PA 4AOXA 4OPCA 4JNAA 1IUWA 1DNCA 2JB3A 4U8OA 4II2A 4AT2A 4YSHA 4GR1A 1LTXR 3GRTA 2BABA 3DGZA 2XYOA 3K7QX 1Y0PA 4UDQA 3AEEA 3FG2P 1B5QA 1KDGA 4TLXA 4YKFA 3BNMA 4OVIA 4U8LA 4FDCB 4JQ9A 3SGLA 5BUKA 3AEBA 4DGKA 2C76A 3ICTA 4DNAA 3SQPA 4Z2RA 5L46A 2B9WA 3QVRA 2JB2A 3NK2X 1TYTA 3ISHA 2RABA 2WETA 5HHFA 2C64A 1XHCA 1S2YA 4A65A 5KMRA 3P4RA 3PO7A 2NVKX 4IVMB 3T2KA 2X8CA 3DMEA 3KVEA 3AEAA 3QSMA 4ICYA 1V59A 3DJDA 3ICSA 4Z24A 2GH5A 4NTDA 2V6OA 2DKIA 3BNUA 5IQ4A 4J57A 3Q9TA 2RGHA 3BI4A 2BRAA 4Y4NA 4JN9A 3KPKA 1D4DA 2IVDA 1ZP0A 2C7GA 2FJEA 1GT8A 3AE8A 3AE6A 3BHKA 2TMDA 3H8LA 2Q6UA 3CNDA 4ZCCA 2YAUA 2C67A 2YG3A 3DK4A 1GV4A 4D04A 5KOXA 2ZZBA 4EIQA 4H4YA 1GALA 3NYEA 1S2QA 2BCGG 2GRTA 4EQRA 5JCIA 2Q0LA 4EM4A 4K5SA 4U2TA 4B1BA 4AP3A 4BURA 4CCRA 2FJDA 3C4NA 4J2WA 1ZX9A 3GYJA 2Z5XA 4H4RA 2YVJA 1OJCA 1IJHA 2AAQA 2WP9A 2B7SA 4XWZA 1GPEA 1LQUA 2BACA 3QFAA 1GREA 2B76A 3NG7X 4CY6A 4X9MA 4CCQA 3CGDA 3LB8A 1NHRA 2JAEA 2C4CA 4IV9A 1GOSA 4NTCA 4O5UA 3SX6A 1NENA 2VQ7A 3IF9A 1PBEA 4AOSA 2GQFA 3HYWA 3GD3A 4EQXA 2DKHA 3GRSA 3IWAA 2YLRA 3NGCX 1GESA 4OPGA 3AE4A 1JRZA 3AEFA 3AYJA 3GSIA 4JY2A 3UP4A 1COYA 3DH9A 4G6GA 2XVEA 2VQBA 3GWDA 4TM0A 5KXJA 1D5TA 1N4UA 2C73A 3CPIG 1E1LA 3SFDA 3AD7B 4PAAA 5TR3A 1P2EA 4K22A 4H7UA 1E6EA 4UDRA 1B4VA 1OJAA 4X4JA 1MXTA 4RG3A 5KMPA 4H2PA 4D03A 1L9EA 3NYFA 3LADA 1JRXA 3ITJA 4OCGA 3UKKA 3QFBA 4N9XA 3GMCA 3COXA 4EMJA 1BGJA 3NTAA 1D7LA 3AYIA 4JY3A 1PHHA 1CC4A 3LJPA 4C5OA 3CGBA 3AEGA 3C96A 2JBVA 2X99A 2YWLA 1Q9IA 1D7YA 5EB5A 3ZDNA 1ZY8A 2Y6QA 2C3DA 3UKFA 2Y6RA 4GF7A 4NNJA 2O9ZA 1IUVA 4H4QA 1L9CA 5KWFA 4J56A 3GD4A 4PABA 3VR8A 2V3BA 1H6VA 3V76A 1K4QA 1ZMCA 1GRBA 4I59A 4KX6A 4YXDA 1ZMDA 1PN0A 1CJCA 2VVLG 2X3NA 5U25A 5FMHA 3CIRA 2C3CA 1GRHA 2ACZA 4CBQA 1FEAA 2GR3A 1B8SA 2BS3A 4H4PA 3UTFA 4C77A 2YG5A 4U8PA 4A6NA 3K7MX 4H4VA 2OALA 3GWFA 2CULA 5KMQA 4B64A 2OLNA 4H4WA 2QA1A 2WU2A 1TYPA 1CJ3A 3UKQA 4GCMA 1VG9A 1ZDLA 1NEKA 4GAPA 3S5WA 2WDRA 3D8XA 2WHDA 3NIXA 1PBBA 4ZN0A 1H83A 1XDIA 2FJAA 5ER0A 3UTEA 3AXBA 5JCMA 1GNDA 3QJ4A 2Q7VA 2YR4A 3NKSA 3EF6A 4H2NA 1FEBA 2UZZA 4B66A 4Z25A 3AE5A 3RP6A 4EMIA 3V3OA 2YLTA 3AYLA 5IQ1A 4A79A 1BGNA 2C66A 5DBJA 3GYXA 3BHFA 1GRTA 1JRYA 1PBDA 1PBCA 3L1RA 4Z26A 1H81A 3E1TA 3AWIA 4H4SA 4B67A 4K5RA 3AECA 1IUUA 2V3AA 4IVOB 4J34A 1QJDA 3CPJG 3ICRA 4OPLA 1S3EA 3T0KA 4Z2TA 2A8XA 2IVEA 3SZ0A 2GR1A 2JK6A 1IUSA 1IUXA 4RG4A 4U2SA 4H4UA 1PJ5A 2AQJA 2WBAA 3AE7A 1CC2A 5FS9A 4J31A 4AT0A 1N4VA 2V5ZA 3RP8A 1S3BA 3DJGX 1CBOA 2BXRA 5BVAA 5LV9A 2ZBWA 1LVLA 3C4AA 2RGJA 3B3RA 1DOCA 2BYBA 1NPXA 2GV8A 3OZ2A 4O5QA 4B65A 4BK3A 3LZXA 3KPFA 4FX9A 1XPQA 3QSEA 1PXBA 1LPFA 4K7ZA 3T2ZA 3GYIA 2XLRA 2GB0A 2OLOA 3NTDA 1LV0A 3NLCA 1GEUA 2YG7A 1GTEA 4H2QA 3NH3X 3UOYA 3VQRA 3REDA 1YQ4A 4NEVA 1RP0A 2B7RA 4Y4MA 1JEHA 4IA6A 1MO9A 1TRBA 3P4QA 3KD9A 4GAVA 3EANA 3DJEA 4WX1A 1AOGA 2JKCA 4LA1A 1ONFA 2GAHB 3P4SA 4UDPA 2FBWA 2F5ZA 1FOHA 4BV6A 5CQFA 1K0IA 2WDVA 2I0ZA 2XVJA 3PVCA 5KRQA 2WQYA 3GMBA 2XFNA 3URHA 3JSKA 3NT6A 2YVGA 1FL2A 1NHQA 3P1WA 4U8JA 3F8DA 4X9NA 3UOXA 1JOAA 1CL0A 3LXDA 2QCUA 1VG0A 3ATQA 3CTYA 2WESA 2PHHA 2WOWA 1O95A 3PS9A 1GERA 1H84A 2XVHA 2YM2A 4JDRA 4WCTA 3ABVA 2GF3A 4J36A 4APNA 5U63A 3AD9B 3VRDB 3HZLA 1NAAA 3LOVA 3KA7A 3BI2A 2EQ6A 3CPHG 3T14A 3IC9A 1JNZA 5C2TA 1K0JA 2XLTA 1BKWA 1NG3A 3NRNA 4USQA 4UP3A 3SXIA 4C74A 4EMWA 3M13A 3SZWA 4DSGA 3NK1X 5HY5A 4XWRA 3NN6X 3SM8A 1REOA 2YR5A 5EOWA 2XDOA 1TDKA 3NNEA 1W4XA 3NK0X 4U8KA 4ZCDA 3I6DA 3CNSA 2GMHA 3KU9A 2XLPA 2RGOA 2H89A 3UOZA 4HA6A 2R9ZA 1ZK7A 3ALJA 2IIDA 2R0GA 4H4XA 1GETA 4LIIA 1L9DA 1Y56B 3G5QA 1Y56A 2WPFA 4BK2A 1L0VA 1ZOYA 2H88A 1Q1WA 3S61A 2GMJA 3FBSA 2Q0KA 3AE3A 1YQZA 1H7WA 2X50A 3DGHA 3QSSA 4TLZA 5KNLA 2YLSA 2C72A 1M64A 2A89A 3RHAA 2C65A 5KMSA 1YQ3A 3UKAA 4YSXA 1ZKQA 1IUTA 5KOWA 4TM3A 1X31B 1CF3A 1CJ4A 3HYXA 4OPIA 1F8WA 2B9YA 4RSLA 4B68A 1EL9A 2YQUA 1NHPA 4IA5A 2B9XA 4H50A 4JNQA 3UCLA 1BWCA 1GRAA 4YWOA 2WDQA 1GSNA 3DK9A 2QA2A 3H4KA 1PJ6A 4CNKA 4HB9A 1GRFA 4H2RA 2BS4A 3DK8A 3RNMA 3QVPA 3VRAA 2GEWA 2XLSA 1RSGA 1H7XA 4E0VA 1DOBA 2BXSA 1CHUA 4EQSA 2W0HA 4I58A 1KSSA 1GTHA 2JB1A 1H82A 3CGCA 4B63A 2E1MA 4LU6A 2VRMA 3L8KA 1KFYA 3CMMA 4G73A 1E1NA 1RYIA 1YY5A 4M52A 3UTHA 4YKGA 2WOIA 2XFQA 2WP6A 3NHOX 3UKHA 4K8DA 2E5VA 4YTPA 4A5LA 1M6IA 1PXCA 3ZYXA 2BK4A 2CDUA 2WOVA 4YSYA 2VVMA 4GRTA 2GR2A 2XFPA 3UKLA 4A7AA 1EL8A 3G5SA 2BK3A 5BULA 3P9UA 1P2HA 4XXGA 3AEDA 1F8SA 2R4JA 4USRA 4OPTA 3T37A 1OJ9A 3UP5A 1MOKA 1SEZA 3CGEA 4II3A 4OPUA 3SY4A 4A9WA 2YLWA 3SZFA 4A99A 4BK1A 3AE2A 2R0CA 3CNTA 3CN8A 3SFEA 5IPYA 3G5RA 2VZ2A 3D1CA 2ZZCA 5KVIA 2C75A 4Y4LA 1DOEA 5FS8A 1DJQA 5FS6A 3SZCA 3F8PA 3IHMA 3K30A 2X8HA 3R9UA 2CVJA 4Z2UA 1N4WA 2TPRA 4C3YA 3DJJA 1FCDA 3EPTA 5GSNA 3KKJA 2XVFA 2VOUA 1TDNA 1EL5A
chains in the Genus database with same CATH topology
2YG6A 1QLBA 3ATRA 1HYUA 3V3NA 4GDEA 5BRTA 2C70A 2CFYA 3T2YA 2V60A 1UKVG 3NYCA 3NN0X 1QO8A 4FK1C 4B69A 3FPZA 2VVLA 1OJTA 2YR6A 1DODA 1KSUA 2EQ8A 3O0HA 1EBDA 3T31A 3DA1A 5JCLA 1XANA 5EBKA 4DSHA 1FECA 4EQWA 5KVHA 2APGA 2GVCA 3FIMB 4REKA 2X8GA 3AB1A 4ADWA 1YKJA 1CJ2A 1F8RA 3ALMA 2YLXA 1NDAA 4U2LA 5U1OA 4NTEA 4CNJA 3II4A 3UKPA 2EQ7A 1Z6LA 3ALLA 5FS7A 1N1PA 2QAEA 2GQWA 1OJDA 2R45A 4OPDA 2V61A 2AR8A 2YG4A 2Z5YA 3KLJA 2PYXA 4MJWA 2E4GA 3F8RA 3B6DA 1D4EA 3I3LA 1E39A 2WS3A 4G9KA 2XVIA 1H86A 2J3NA 3BI5A 5JCNA 4G74A 2ZZ0A 3UTGA 5J7XA 1CC6A 4ECHA 1ELIA 2OAMA 1ZOVA 1PXAA 4YSZA 5HXIA 4NZHA 2WEUA 1D4CA 4K2XA 4U8MA 2A87A 2XFOA 2BK5A 3AE1A 1PBFA 2ARDA 2WPCA 1KNPA 3EAOA 3CNJA 4NEWA 2OA1A 1JU2A 2FJBA 2YLZA 1VRQB 4EIPA 4AP1A 2XCGA 3FMWA 1KNRA 2BC0A 2GR0A 5GRTA 3HYVA 4H4ZA 1K0LA 3VRBA 4CY8A 4A6NB 2R4EA 4EM3A 1VQWA 4Z43A 1TDEA 5M0ZA 1LQTA 3ADAB 3GDNA 1KF6A 1Q1RA 1PS9A 2XLUA 1O5WA 4FK1A 4YT0A 2GAGB 1PJ7A 4NWZA 4Z44A 3GDPA 2BCPA 2R46A 1E1MA 2XFUA 4BJZA 4C3XA 4YTNA 1F3PA 2YVFA 5M10A 1BF3A 3AD8B 5HYMA 3SYIA 3LZWA 2VRLA 4GUVA 3IHGA 4GDPA 3K7TA 1O94A 3WE0A 3CNPA 5C3JA 2BRYA 2HQMA 3Q6JA 2BC1A 4U8NA 1JNRA 2EQ9A 4TM4A 4P9SA 1PDHA 4H4TA 4U8IA 2NPXA 1TDOA 5EB4A 1E1KA 1EL7A 1NG4A 5J60A 1BZLA 1LJ1A 3M0OA 2YM1A 3UOVA 4BJYA 4J33A 3H8IA 4TM1A 2WPEA 5JCKA 3AE9A 1B37A 2R0PA 2WU5A 2WP5A 1GRGA 3OC4A 1F6MA 1DJNA 4CRTA 2BA9A 4G6HA 4YTMA 1E7PA 1GXFA 1VDCA 3RP7A 1NHSA 3M12A 4KPRA 3VR9A 1DXLA 5CKUA 1TDFA 2BS2A 3P4PA 4AOXA 4OPCA 4JNAA 1IUWA 1DNCA 2JB3A 4U8OA 4II2A 4AT2A 4YSHA 4GR1A 1LTXR 3GRTA 2BABA 3DGZA 2XYOA 3K7QX 1Y0PA 4UDQA 3AEEA 3FG2P 1B5QA 1KDGA 4TLXA 4YKFA 3BNMA 4OVIA 4U8LA 4FDCB 4JQ9A 3SGLA 5BUKA 3AEBA 4DGKA 2C76A 3ICTA 4DNAA 3SQPA 4Z2RA 5L46A 2B9WA 3QVRA 2JB2A 3NK2X 1TYTA 3ISHA 2RABA 2WETA 5HHFA 2C64A 1XHCA 1S2YA 4A65A 5KMRA 3P4RA 3PO7A 2NVKX 4IVMB 3T2KA 2X8CA 3DMEA 3KVEA 3AEAA 3QSMA 4ICYA 1V59A 3DJDA 3ICSA 4Z24A 2GH5A 4NTDA 2V6OA 2DKIA 3BNUA 5IQ4A 4J57A 3Q9TA 2RGHA 3BI4A 2BRAA 4Y4NA 4JN9A 3KPKA 1D4DA 2IVDA 1ZP0A 2C7GA 2FJEA 1GT8A 3AE8A 3AE6A 3BHKA 2TMDA 3H8LA 2Q6UA 3CNDA 4ZCCA 2YAUA 2C67A 2YG3A 3DK4A 1GV4A 4D04A 5KOXA 2ZZBA 4EIQA 4H4YA 1GALA 3NYEA 1S2QA 2BCGG 2GRTA 4EQRA 5JCIA 2Q0LA 4EM4A 4K5SA 4U2TA 4B1BA 4AP3A 4BURA 4CCRA 2FJDA 3C4NA 4J2WA 1ZX9A 3GYJA 2Z5XA 4H4RA 2YVJA 1OJCA 1IJHA 2AAQA 2WP9A 2B7SA 4XWZA 1GPEA 1LQUA 2BACA 3QFAA 1GREA 2B76A 3NG7X 4CY6A 4X9MA 4CCQA 3CGDA 3LB8A 1NHRA 2JAEA 2C4CA 4IV9A 1GOSA 4NTCA 4O5UA 3SX6A 1NENA 2VQ7A 3IF9A 1PBEA 4AOSA 2GQFA 3HYWA 3GD3A 4EQXA 2DKHA 3GRSA 3IWAA 2YLRA 3NGCX 1GESA 4OPGA 3AE4A 1JRZA 3AEFA 3AYJA 3GSIA 4JY2A 3UP4A 1COYA 3DH9A 4G6GA 2XVEA 2VQBA 3GWDA 4TM0A 5KXJA 1D5TA 1N4UA 2C73A 3CPIG 1E1LA 3SFDA 3AD7B 4PAAA 5TR3A 1P2EA 4K22A 4H7UA 1E6EA 4UDRA 1B4VA 1OJAA 4X4JA 1MXTA 4RG3A 5KMPA 4H2PA 4D03A 1L9EA 3NYFA 3LADA 1JRXA 3ITJA 4OCGA 3UKKA 3QFBA 4N9XA 3GMCA 3COXA 4EMJA 1BGJA 3NTAA 1D7LA 3AYIA 4JY3A 1PHHA 1CC4A 3LJPA 4C5OA 3CGBA 3AEGA 3C96A 2JBVA 2X99A 2YWLA 1Q9IA 1D7YA 5EB5A 3ZDNA 1ZY8A 2Y6QA 2C3DA 3UKFA 2Y6RA 4GF7A 4NNJA 2O9ZA 1IUVA 4H4QA 1L9CA 5KWFA 4J56A 3GD4A 4PABA 3VR8A 2V3BA 1H6VA 3V76A 1K4QA 1ZMCA 1GRBA 4I59A 4KX6A 4YXDA 1ZMDA 1PN0A 1CJCA 2VVLG 2X3NA 5U25A 5FMHA 3CIRA 2C3CA 1GRHA 2ACZA 4CBQA 1FEAA 2GR3A 1B8SA 2BS3A 4H4PA 3UTFA 4C77A 2YG5A 4U8PA 4A6NA 3K7MX 4H4VA 2OALA 3GWFA 2CULA 5KMQA 4B64A 2OLNA 4H4WA 2QA1A 2WU2A 1TYPA 1CJ3A 3UKQA 4GCMA 1VG9A 1ZDLA 1NEKA 4GAPA 3S5WA 2WDRA 3D8XA 2WHDA 3NIXA 1PBBA 4ZN0A 1H83A 1XDIA 2FJAA 5ER0A 3UTEA 3AXBA 5JCMA 1GNDA 3QJ4A 2Q7VA 2YR4A 3NKSA 3EF6A 4H2NA 1FEBA 2UZZA 4B66A 4Z25A 3AE5A 3RP6A 4EMIA 3V3OA 2YLTA 3AYLA 5IQ1A 4A79A 1BGNA 2C66A 5DBJA 3GYXA 3BHFA 1GRTA 1JRYA 1PBDA 1PBCA 3L1RA 4Z26A 1H81A 3E1TA 3AWIA 4H4SA 4B67A 4K5RA 3AECA 1IUUA 2V3AA 4IVOB 4J34A 1QJDA 3CPJG 3ICRA 4OPLA 1S3EA 3T0KA 4Z2TA 2A8XA 2IVEA 3SZ0A 2GR1A 2JK6A 1IUSA 1IUXA 4RG4A 4U2SA 4H4UA 1PJ5A 2AQJA 2WBAA 3AE7A 1CC2A 5FS9A 4J31A 4AT0A 1N4VA 2V5ZA 3RP8A 1S3BA 3DJGX 1CBOA 2BXRA 5BVAA 5LV9A 2ZBWA 1LVLA 3C4AA 2RGJA 3B3RA 1DOCA 2BYBA 1NPXA 2GV8A 3OZ2A 4O5QA 4B65A 4BK3A 3LZXA 3KPFA 4FX9A 1XPQA 3QSEA 1PXBA 1LPFA 4K7ZA 3T2ZA 3GYIA 2XLRA 2GB0A 2OLOA 3NTDA 1LV0A 3NLCA 1GEUA 2YG7A 1GTEA 4H2QA 3NH3X 3UOYA 3VQRA 3REDA 1YQ4A 4NEVA 1RP0A 2B7RA 4Y4MA 1JEHA 4IA6A 1MO9A 1TRBA 3P4QA 3KD9A 4GAVA 3EANA 3DJEA 4WX1A 1AOGA 2JKCA 4LA1A 1ONFA 2GAHB 3P4SA 4UDPA 2FBWA 2F5ZA 1FOHA 4BV6A 5CQFA 1K0IA 2WDVA 2I0ZA 2XVJA 3PVCA 5KRQA 2WQYA 3GMBA 2XFNA 3URHA 3JSKA 3NT6A 2YVGA 1FL2A 1NHQA 3P1WA 4U8JA 3F8DA 4X9NA 3UOXA 1JOAA 1CL0A 3LXDA 2QCUA 1VG0A 3ATQA 3CTYA 2WESA 2PHHA 2WOWA 1O95A 3PS9A 1GERA 1H84A 2XVHA 2YM2A 4JDRA 4WCTA 3ABVA 2GF3A 4J36A 4APNA 5U63A 3AD9B 3VRDB 3HZLA 1NAAA 3LOVA 3KA7A 3BI2A 2EQ6A 3CPHG 3T14A 3IC9A 1JNZA 5C2TA 1K0JA 2XLTA 1BKWA 1NG3A 3NRNA 4USQA 4UP3A 3SXIA 4C74A 4EMWA 3M13A 3SZWA 4DSGA 3NK1X 5HY5A 4XWRA 3NN6X 3SM8A 1REOA 2YR5A 5EOWA 2XDOA 1TDKA 3NNEA 1W4XA 3NK0X 4U8KA 4ZCDA 3I6DA 3CNSA 2GMHA 3KU9A 2XLPA 2RGOA 2H89A 3UOZA 4HA6A 2R9ZA 1ZK7A 3ALJA 2IIDA 2R0GA 4H4XA 1GETA 4LIIA 1L9DA 1Y56B 3G5QA 1Y56A 2WPFA 4BK2A 1L0VA 1ZOYA 2H88A 1Q1WA 3S61A 2GMJA 3FBSA 2Q0KA 3AE3A 1YQZA 1H7WA 2X50A 3DGHA 3QSSA 4TLZA 5KNLA 2YLSA 2C72A 1M64A 2A89A 3RHAA 2C65A 5KMSA 1YQ3A 3UKAA 4YSXA 1ZKQA 1IUTA 5KOWA 4TM3A 1X31B 1CF3A 1CJ4A 3HYXA 4OPIA 1F8WA 2B9YA 4RSLA 4B68A 1EL9A 2YQUA 1NHPA 4IA5A 2B9XA 4H50A 4JNQA 3UCLA 1BWCA 1GRAA 4YWOA 2WDQA 1GSNA 3DK9A 2QA2A 3H4KA 1PJ6A 4CNKA 4HB9A 1GRFA 4H2RA 2BS4A 3DK8A 3RNMA 3QVPA 3VRAA 2GEWA 2XLSA 1RSGA 1H7XA 4E0VA 1DOBA 2BXSA 1CHUA 4EQSA 2W0HA 4I58A 1KSSA 1GTHA 2JB1A 1H82A 3CGCA 4B63A 2E1MA 4LU6A 2VRMA 3L8KA 1KFYA 3CMMA 4G73A 1E1NA 1RYIA 1YY5A 4M52A 3UTHA 4YKGA 2WOIA 2XFQA 2WP6A 3NHOX 3UKHA 4K8DA 2E5VA 4YTPA 4A5LA 1M6IA 1PXCA 3ZYXA 2BK4A 2CDUA 2WOVA 4YSYA 2VVMA 4GRTA 2GR2A 2XFPA 3UKLA 4A7AA 1EL8A 3G5SA 2BK3A 5BULA 3P9UA 1P2HA 4XXGA 3AEDA 1F8SA 2R4JA 4USRA 4OPTA 3T37A 1OJ9A 3UP5A 1MOKA 1SEZA 3CGEA 4II3A 4OPUA 3SY4A 4A9WA 2YLWA 3SZFA 4A99A 4BK1A 3AE2A 2R0CA 3CNTA 3CN8A 3SFEA 5IPYA 3G5RA 2VZ2A 3D1CA 2ZZCA 5KVIA 2C75A 4Y4LA 1DOEA 5FS8A 1DJQA 5FS6A 3SZCA 3F8PA 3IHMA 3K30A 2X8HA 3R9UA 2CVJA 4Z2UA 1N4WA 2TPRA 4C3YA 3DJJA 1FCDA 3EPTA 5GSNA 3KKJA 2XVFA 2VOUA 1TDNA 1EL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YG6 A;  1QLB A;  3ATR A;  1HYU A;  3V3N A;  4GDE A;  5BRT A;  2C70 A;  2CFY A;  2V60 A;  1UKV G;  3NYC A;  3NN0 X;  1QO8 A;  4FK1 C;  4B69 A;  3FPZ A;  2VVL A;  1OJT A;  2YR6 A;  1DOD A;  1KSU A;  2EQ8 A;  3O0H A;  1EBD A;  3DA1 A;  5JCL A;  1XAN A;  5EBK A;  4DSH A;  1FEC A;  4EQW A;  5KVH A;  2APG A;  2GVC A;  3FIM B;  4REK A;  2X8G A;  3AB1 A;  4ADW A;  1YKJ A;  1CJ2 A;  1F8R A;  3ALM A;  2YLX A;  1NDA A;  4U2L A;  5U1O A;  4NTE A;  3II4 A;  3UKP A;  2EQ7 A;  1Z6L A;  3ALL A;  5FS7 A;  1N1P A;  2QAE A;  2GQW A;  1OJD A;  2R45 A;  4OPD A;  2V61 A;  2AR8 A;  2YG4 A;  2Z5Y A;  3KLJ A;  2PYX A;  4MJW A;  2E4G A;  3F8R A;  3B6D A;  1D4E A;  3I3L A;  1E39 A;  2WS3 A;  2XVI A;  1H86 A;  2J3N A;  3BI5 A;  5JCN A;  2ZZ0 A;  3UTG A;  5J7X A;  1CC6 A;  4ECH A;  1ELI A;  2OAM A;  1ZOV A;  1PXA A;  4YSZ A;  5HXI A;  4NZH A;  2WEU A;  1D4C A;  4K2X A;  4U8M A;  2A87 A;  2XFO A;  2BK5 A;  3AE1 A;  1PBF A;  2ARD A;  2WPC A;  1KNP A;  3EAO A;  3CNJ A;  4NEW A;  2OA1 A;  1JU2 A;  2FJB A;  2YLZ A;  1VRQ B;  4EIP A;  4AP1 A;  2XCG A;  3FMW A;  1KNR A;  2BC0 A;  2GR0 A;  5GRT A;  4H4Z A;  1K0L A;  3VRB A;  4CY8 A;  4A6N B;  2R4E A;  4EM3 A;  1VQW A;  4Z43 A;  1TDE A;  5M0Z A;  1LQT A;  3ADA B;  3GDN A;  1KF6 A;  1Q1R A;  1PS9 A;  2XLU A;  1O5W A;  4FK1 A;  4YT0 A;  2GAG B;  1PJ7 A;  4Z44 A;  3GDP A;  2BCP A;  2R46 A;  1E1M A;  2XFU A;  4BJZ A;  4C3X A;  4YTN A;  1F3P A;  2YVF A;  5M10 A;  1BF3 A;  3AD8 B;  5HYM A;  3LZW A;  2VRL A;  4GUV A;  3IHG A;  4GDP A;  3K7T A;  1O94 A;  3WE0 A;  3CNP A;  5C3J A;  2HQM A;  3Q6J A;  2BC1 A;  4U8N A;  1JNR A;  2EQ9 A;  4TM4 A;  4P9S A;  1PDH A;  4H4T A;  4U8I A;  2NPX A;  1TDO A;  5EB4 A;  1E1K A;  1EL7 A;  1NG4 A;  5J60 A;  1BZL A;  1LJ1 A;  3M0O A;  2YM1 A;  3UOV A;  4BJY A;  4J33 A;  3H8I A;  4TM1 A;  2WPE A;  5JCK A;  3AE9 A;  1B37 A;  2R0P A;  2WU5 A;  2WP5 A;  1GRG A;  3OC4 A;  1F6M A;  1DJN A;  4CRT A;  2BA9 A;  4YTM A;  1E7P A;  1GXF A;  1VDC A;  3RP7 A;  1NHS A;  3M12 A;  4KPR A;  3VR9 A;  1DXL A;  5CKU A;  1TDF A;  2BS2 A;  3P4P A;  4AOX A;  4OPC A;  4JNA A;  1IUW A;  1DNC A;  2JB3 A;  4U8O A;  4AT2 A;  4YSH A;  4GR1 A;  1LTX R;  3GRT A;  2BAB A;  3DGZ A;  2XYO A;  3K7Q X;  1Y0P A;  4UDQ A;  3AEE A;  3FG2 P;  1B5Q A;  1KDG A;  4TLX A;  4YKF A;  3BNM A;  4OVI A;  4U8L A;  4FDC B;  4JQ9 A;  3SGL A;  5BUK A;  3AEB A;  4DGK A;  2C76 A;  3ICT A;  4DNA A;  3SQP A;  4Z2R A;  5L46 A;  2B9W A;  3QVR A;  2JB2 A;  3NK2 X;  1TYT A;  3ISH A;  2RAB A;  2WET A;  5HHF A;  2C64 A;  1XHC A;  1S2Y A;  4A65 A;  3P4R A;  3PO7 A;  2NVK X;  4IVM B;  2X8C A;  3DME A;  3KVE A;  3AEA A;  3QSM A;  4ICY A;  1V59 A;  3DJD A;  3ICS A;  4Z24 A;  2GH5 A;  4NTD A;  2V6O A;  2DKI A;  3BNU A;  5IQ4 A;  4J57 A;  3Q9T A;  2RGH A;  3BI4 A;  4Y4N A;  4JN9 A;  1D4D A;  2IVD A;  1ZP0 A;  2C7G A;  2FJE A;  1GT8 A;  3AE8 A;  3AE6 A;  3BHK A;  2TMD A;  3H8L A;  2Q6U A;  3CND A;  4ZCC A;  2YAU A;  2C67 A;  2YG3 A;  3DK4 A;  1GV4 A;  4D04 A;  5KOX A;  2ZZB A;  4EIQ A;  4H4Y A;  1GAL A;  3NYE A;  1S2Q A;  2BCG G;  2GRT A;  4EQR A;  5JCI A;  2Q0L A;  4EM4 A;  4K5S A;  4U2T A;  4B1B A;  4AP3 A;  4BUR A;  4CCR A;  2FJD A;  3C4N A;  4J2W A;  1ZX9 A;  3GYJ A;  2Z5X A;  4H4R A;  2YVJ A;  1OJC A;  1IJH A;  2AAQ A;  2WP9 A;  2B7S A;  4XWZ A;  1GPE A;  1LQU A;  2BAC A;  3QFA A;  1GRE A;  2B76 A;  3NG7 X;  4CY6 A;  4X9M A;  4CCQ A;  3CGD A;  3LB8 A;  1NHR A;  2JAE A;  4IV9 A;  4O5U A;  1GOS A;  4NTC A;  1NEN A;  2VQ7 A;  3IF9 A;  1PBE A;  4AOS A;  2GQF A;  3GD3 A;  4EQX A;  2DKH A;  3GRS A;  3IWA A;  2YLR A;  3NGC X;  1GES A;  4OPG A;  3AE4 A;  1JRZ A;  3AEF A;  3AYJ A;  3GSI A;  4JY2 A;  3UP4 A;  1COY A;  3DH9 A;  2XVE A;  2VQB A;  3GWD A;  4TM0 A;  5KXJ A;  1D5T A;  1N4U A;  2C73 A;  3CPI G;  1E1L A;  3SFD A;  3AD7 B;  4PAA A;  5TR3 A;  1P2E A;  4K22 A;  4H7U A;  1E6E A;  4UDR A;  1B4V A;  1OJA A;  4X4J A;  1MXT A;  4RG3 A;  4H2P A;  4D03 A;  1L9E A;  3NYF A;  3LAD A;  1JRX A;  3ITJ A;  4OCG A;  3UKK A;  3QFB A;  4N9X A;  3GMC A;  3COX A;  4EMJ A;  1BGJ A;  3NTA A;  1D7L A;  3AYI A;  4JY3 A;  1PHH A;  1CC4 A;  3LJP A;  4C5O A;  3CGB A;  3AEG A;  3C96 A;  2JBV A;  2X99 A;  2YWL A;  1Q9I A;  1D7Y A;  5EB5 A;  3ZDN A;  1ZY8 A;  2Y6Q A;  2C3D A;  3UKF A;  2Y6R A;  4GF7 A;  2O9Z A;  1IUV A;  4H4Q A;  1L9C A;  5KWF A;  4J56 A;  3GD4 A;  4PAB A;  3VR8 A;  2V3B A;  1H6V A;  3V76 A;  1K4Q A;  1ZMC A;  1GRB A;  4I59 A;  4KX6 A;  4YXD A;  1ZMD A;  1PN0 A;  1CJC A;  2VVL G;  2X3N A;  5U25 A;  5FMH A;  3CIR A;  2C3C A;  1GRH A;  2ACZ A;  4CBQ A;  1FEA A;  2GR3 A;  1B8S A;  2BS3 A;  4H4P A;  3UTF A;  4C77 A;  2YG5 A;  4U8P A;  4A6N A;  3K7M X;  4H4V A;  2OAL A;  3GWF A;  2CUL A;  4B64 A;  2OLN A;  4H4W A;  2QA1 A;  2WU2 A;  1TYP A;  1CJ3 A;  3UKQ A;  4GCM A;  1VG9 A;  1ZDL A;  1NEK A;  4CNJ A;  3S5W A;  2WDR A;  3D8X A;  2WHD A;  3NIX A;  1PBB A;  4ZN0 A;  1H83 A;  1XDI A;  2FJA A;  5ER0 A;  3UTE A;  3AXB A;  5JCM A;  1GND A;  3QJ4 A;  2Q7V A;  2YR4 A;  3NKS A;  3EF6 A;  4H2N A;  1FEB A;  2UZZ A;  4B66 A;  4Z25 A;  3AE5 A;  3RP6 A;  4EMI A;  3V3O A;  2YLT A;  3AYL A;  5IQ1 A;  4A79 A;  1BGN A;  2C66 A;  5DBJ A;  3BHF A;  1GRT A;  1JRY A;  1PBD A;  1PBC A;  3L1R A;  4Z26 A;  1H81 A;  3E1T A;  3AWI A;  4H4S A;  4B67 A;  4K5R A;  3AEC A;  1IUU A;  2V3A A;  4IVO B;  4J34 A;  1QJD A;  3CPJ G;  3ICR A;  4OPL A;  1S3E A;  4Z2T A;  2A8X A;  2IVE A;  2GR1 A;  2JK6 A;  1IUS A;  1IUX A;  4RG4 A;  4U2S A;  4H4U A;  1PJ5 A;  2AQJ A;  2WBA A;  3AE7 A;  1CC2 A;  5FS9 A;  4J31 A;  4AT0 A;  1N4V A;  2V5Z A;  3RP8 A;  1S3B A;  3DJG X;  1CBO A;  2BXR A;  5BVA A;  5LV9 A;  2ZBW A;  1LVL A;  3C4A A;  2RGJ A;  3B3R A;  1DOC A;  2BYB A;  1NPX A;  2GV8 A;  3OZ2 A;  4O5Q A;  4B65 A;  4BK3 A;  3LZX A;  3KPF A;  4FX9 A;  1XPQ A;  3QSE A;  1PXB A;  1LPF A;  4K7Z A;  3GYI A;  2XLR A;  2GB0 A;  2OLO A;  3NTD A;  1LV0 A;  3NLC A;  1GEU A;  2YG7 A;  1GTE A;  4H2Q A;  3NH3 X;  3UOY A;  3VQR A;  3RED A;  1YQ4 A;  4NEV A;  1RP0 A;  2B7R A;  4Y4M A;  1JEH A;  4IA6 A;  1MO9 A;  1TRB A;  3P4Q A;  3KD9 A;  3EAN A;  3DJE A;  4WX1 A;  1AOG A;  2JKC A;  4LA1 A;  1ONF A;  2GAH B;  3P4S A;  4UDP A;  2FBW A;  2F5Z A;  1FOH A;  4BV6 A;  5CQF A;  1K0I A;  2WDV A;  2I0Z A;  2XVJ A;  3PVC A;  5KRQ A;  2WQY A;  3GMB A;  2XFN A;  3URH A;  3JSK A;  3NT6 A;  2YVG A;  1FL2 A;  1NHQ A;  3P1W A;  4U8J A;  3F8D A;  4X9N A;  3UOX A;  1JOA A;  1CL0 A;  3LXD A;  2QCU A;  1VG0 A;  3ATQ A;  3CTY A;  2WES A;  2PHH A;  2WOW A;  1O95 A;  3PS9 A;  1GER A;  1H84 A;  2XVH A;  2YM2 A;  4JDR A;  4WCT A;  3ABV A;  2GF3 A;  4J36 A;  4APN A;  5U63 A;  3AD9 B;  3VRD B;  3HZL A;  1NAA A;  3LOV A;  3KA7 A;  3BI2 A;  2EQ6 A;  3CPH G;  3IC9 A;  1JNZ A;  5C2T A;  1K0J A;  2XLT A;  1BKW A;  1NG3 A;  3NRN A;  4USQ A;  4UP3 A;  4C74 A;  4EMW A;  3M13 A;  4DSG A;  3NK1 X;  5HY5 A;  4XWR A;  3NN6 X;  3SM8 A;  1REO A;  2YR5 A;  5EOW A;  2XDO A;  1TDK A;  3NNE A;  1W4X A;  3NK0 X;  4U8K A;  4ZCD A;  3I6D A;  3CNS A;  2GMH A;  3KU9 A;  2XLP A;  2RGO A;  2H89 A;  3UOZ A;  4HA6 A;  2R9Z A;  1ZK7 A;  3ALJ A;  2IID A;  2R0G A;  4H4X A;  1GET A;  4LII A;  1L9D A;  1Y56 B;  3G5Q A;  1Y56 A;  2WPF A;  4BK2 A;  1L0V A;  1ZOY A;  2H88 A;  1Q1W A;  3S61 A;  2GMJ A;  3FBS A;  2Q0K A;  3AE3 A;  1YQZ A;  1H7W A;  2X50 A;  3DGH A;  3QSS A;  4TLZ A;  2YLS A;  2C72 A;  1M64 A;  2A89 A;  3RHA A;  2C65 A;  1YQ3 A;  3UKA A;  4YSX A;  1ZKQ A;  1IUT A;  5KOW A;  4TM3 A;  1X31 B;  1CF3 A;  1CJ4 A;  4OPI A;  1F8W A;  2B9Y A;  4RSL A;  4B68 A;  1EL9 A;  2YQU A;  1NHP A;  4IA5 A;  2B9X A;  4H50 A;  4JNQ A;  3UCL A;  1BWC A;  1GRA A;  4YWO A;  2WDQ A;  1GSN A;  3DK9 A;  2QA2 A;  3H4K A;  1PJ6 A;  4CNK A;  4HB9 A;  1GRF A;  4H2R A;  2BS4 A;  3DK8 A;  3RNM A;  3QVP A;  3VRA A;  2GEW A;  2XLS A;  1RSG A;  1H7X A;  4E0V A;  1DOB A;  2BXS A;  1CHU A;  4EQS A;  2W0H A;  4I58 A;  1KSS A;  1GTH A;  2JB1 A;  1H82 A;  3CGC A;  4B63 A;  2E1M A;  4LU6 A;  2VRM A;  3L8K A;  1KFY A;  1E1N A;  1RYI A;  1YY5 A;  4M52 A;  3UTH A;  4YKG A;  2WOI A;  2XFQ A;  2WP6 A;  3NHO X;  3UKH A;  4K8D A;  2E5V A;  4YTP A;  4A5L A;  1M6I A;  1PXC A;  3ZYX A;  2BK4 A;  2CDU A;  2WOV A;  4YSY A;  2VVM A;  4GRT A;  2GR2 A;  2XFP A;  3UKL A;  4A7A A;  1EL8 A;  3G5S A;  2BK3 A;  5BUL A;  3P9U A;  1P2H A;  4XXG A;  3AED A;  1F8S A;  2R4J A;  4USR A;  4OPT A;  3T37 A;  1OJ9 A;  3UP5 A;  1MOK A;  1SEZ A;  3CGE A;  4OPU A;  4A9W A;  4A99 A;  2YLW A;  4BK1 A;  3AE2 A;  2R0C A;  3CNT A;  3CN8 A;  3SFE A;  5IPY A;  3G5R A;  2VZ2 A;  3D1C A;  2ZZC A;  5KVI A;  2C75 A;  4Y4L A;  1DOE A;  5FS8 A;  1DJQ A;  5FS6 A;  3F8P A;  3IHM A;  3K30 A;  2X8H A;  3R9U A;  2CVJ A;  4Z2U A;  1N4W A;  2TPR A;  4C3Y A;  3DJJ A;  1FCD A;  3EPT A;  5GSN A;  3KKJ A;  2XVF A;  2VOU A;  1TDN A;  1EL5 A; 
#chains in the Genus database with same CATH topology
 2YG6 A;  1QLB A;  3ATR A;  1HYU A;  3V3N A;  4GDE A;  5BRT A;  2C70 A;  2CFY A;  3T2Y A;  2V60 A;  1UKV G;  3NYC A;  3NN0 X;  1QO8 A;  4FK1 C;  4B69 A;  3FPZ A;  2VVL A;  1OJT A;  2YR6 A;  1DOD A;  1KSU A;  2EQ8 A;  3O0H A;  1EBD A;  3T31 A;  3DA1 A;  5JCL A;  1XAN A;  5EBK A;  4DSH A;  1FEC A;  4EQW A;  5KVH A;  2APG A;  2GVC A;  3FIM B;  4REK A;  2X8G A;  3AB1 A;  4ADW A;  1YKJ A;  1CJ2 A;  1F8R A;  3ALM A;  2YLX A;  1NDA A;  4U2L A;  5U1O A;  4NTE A;  4CNJ A;  3II4 A;  3UKP A;  2EQ7 A;  1Z6L A;  3ALL A;  5FS7 A;  1N1P A;  2QAE A;  2GQW A;  1OJD A;  2R45 A;  4OPD A;  2V61 A;  2AR8 A;  2YG4 A;  2Z5Y A;  3KLJ A;  2PYX A;  4MJW A;  2E4G A;  3F8R A;  3B6D A;  1D4E A;  3I3L A;  1E39 A;  2WS3 A;  4G9K A;  2XVI A;  1H86 A;  2J3N A;  3BI5 A;  5JCN A;  4G74 A;  2ZZ0 A;  3UTG A;  5J7X A;  1CC6 A;  4ECH A;  1ELI A;  2OAM A;  1ZOV A;  1PXA A;  4YSZ A;  5HXI A;  4NZH A;  2WEU A;  1D4C A;  4K2X A;  4U8M A;  2A87 A;  2XFO A;  2BK5 A;  3AE1 A;  1PBF A;  2ARD A;  2WPC A;  1KNP A;  3EAO A;  3CNJ A;  4NEW A;  2OA1 A;  1JU2 A;  2FJB A;  2YLZ A;  1VRQ B;  4EIP A;  4AP1 A;  2XCG A;  3FMW A;  1KNR A;  2BC0 A;  2GR0 A;  5GRT A;  3HYV A;  4H4Z A;  1K0L A;  3VRB A;  4CY8 A;  4A6N B;  2R4E A;  4EM3 A;  1VQW A;  4Z43 A;  1TDE A;  5M0Z A;  1LQT A;  3ADA B;  3GDN A;  1KF6 A;  1Q1R A;  1PS9 A;  2XLU A;  1O5W A;  4FK1 A;  4YT0 A;  2GAG B;  1PJ7 A;  4NWZ A;  4Z44 A;  3GDP A;  2BCP A;  2R46 A;  1E1M A;  2XFU A;  4BJZ A;  4C3X A;  4YTN A;  1F3P A;  2YVF A;  5M10 A;  1BF3 A;  3AD8 B;  5HYM A;  3SYI A;  3LZW A;  2VRL A;  4GUV A;  3IHG A;  4GDP A;  3K7T A;  1O94 A;  3WE0 A;  3CNP A;  5C3J A;  2BRY A;  2HQM A;  3Q6J A;  2BC1 A;  4U8N A;  1JNR A;  2EQ9 A;  4TM4 A;  4P9S A;  1PDH A;  4H4T A;  4U8I A;  2NPX A;  1TDO A;  5EB4 A;  1E1K A;  1EL7 A;  1NG4 A;  5J60 A;  1BZL A;  1LJ1 A;  3M0O A;  2YM1 A;  3UOV A;  4BJY A;  4J33 A;  3H8I A;  4TM1 A;  2WPE A;  5JCK A;  3AE9 A;  1B37 A;  2R0P A;  2WU5 A;  2WP5 A;  1GRG A;  3OC4 A;  1F6M A;  1DJN A;  4CRT A;  2BA9 A;  4G6H A;  4YTM A;  1E7P A;  1GXF A;  1VDC A;  3RP7 A;  1NHS A;  3M12 A;  4KPR A;  3VR9 A;  1DXL A;  5CKU A;  1TDF A;  2BS2 A;  3P4P A;  4AOX A;  4OPC A;  4JNA A;  1IUW A;  1DNC A;  2JB3 A;  4U8O A;  4II2 A;  4AT2 A;  4YSH A;  4GR1 A;  1LTX R;  3GRT A;  2BAB A;  3DGZ A;  2XYO A;  3K7Q X;  1Y0P A;  4UDQ A;  3AEE A;  3FG2 P;  1B5Q A;  1KDG A;  4TLX A;  4YKF A;  3BNM A;  4OVI A;  4U8L A;  4FDC B;  4JQ9 A;  3SGL A;  5BUK A;  3AEB A;  4DGK A;  2C76 A;  3ICT A;  4DNA A;  3SQP A;  4Z2R A;  5L46 A;  2B9W A;  3QVR A;  2JB2 A;  3NK2 X;  1TYT A;  3ISH A;  2RAB A;  2WET A;  5HHF A;  2C64 A;  1XHC A;  1S2Y A;  4A65 A;  5KMR A;  3P4R A;  3PO7 A;  2NVK X;  4IVM B;  3T2K A;  2X8C A;  3DME A;  3KVE A;  3AEA A;  3QSM A;  4ICY A;  1V59 A;  3DJD A;  3ICS A;  4Z24 A;  2GH5 A;  4NTD A;  2V6O A;  2DKI A;  3BNU A;  5IQ4 A;  4J57 A;  3Q9T A;  2RGH A;  3BI4 A;  2BRA A;  4Y4N A;  4JN9 A;  3KPK A;  1D4D A;  2IVD A;  1ZP0 A;  2C7G A;  2FJE A;  1GT8 A;  3AE8 A;  3AE6 A;  3BHK A;  2TMD A;  3H8L A;  2Q6U A;  3CND A;  4ZCC A;  2YAU A;  2C67 A;  2YG3 A;  3DK4 A;  1GV4 A;  4D04 A;  5KOX A;  2ZZB A;  4EIQ A;  4H4Y A;  1GAL A;  3NYE A;  1S2Q A;  2BCG G;  2GRT A;  4EQR A;  5JCI A;  2Q0L A;  4EM4 A;  4K5S A;  4U2T A;  4B1B A;  4AP3 A;  4BUR A;  4CCR A;  2FJD A;  3C4N A;  4J2W A;  1ZX9 A;  3GYJ A;  2Z5X A;  4H4R A;  2YVJ A;  1OJC A;  1IJH A;  2AAQ A;  2WP9 A;  2B7S A;  4XWZ A;  1GPE A;  1LQU A;  2BAC A;  3QFA A;  1GRE A;  2B76 A;  3NG7 X;  4CY6 A;  4X9M A;  4CCQ A;  3CGD A;  3LB8 A;  1NHR A;  2JAE A;  2C4C A;  4IV9 A;  1GOS A;  4NTC A;  4O5U A;  3SX6 A;  1NEN A;  2VQ7 A;  3IF9 A;  1PBE A;  4AOS A;  2GQF A;  3HYW A;  3GD3 A;  4EQX A;  2DKH A;  3GRS A;  3IWA A;  2YLR A;  3NGC X;  1GES A;  4OPG A;  3AE4 A;  1JRZ A;  3AEF A;  3AYJ A;  3GSI A;  4JY2 A;  3UP4 A;  1COY A;  3DH9 A;  4G6G A;  2XVE A;  2VQB A;  3GWD A;  4TM0 A;  5KXJ A;  1D5T A;  1N4U A;  2C73 A;  3CPI G;  1E1L A;  3SFD A;  3AD7 B;  4PAA A;  5TR3 A;  1P2E A;  4K22 A;  4H7U A;  1E6E A;  4UDR A;  1B4V A;  1OJA A;  4X4J A;  1MXT A;  4RG3 A;  5KMP A;  4H2P A;  4D03 A;  1L9E A;  3NYF A;  3LAD A;  1JRX A;  3ITJ A;  4OCG A;  3UKK A;  3QFB A;  4N9X A;  3GMC A;  3COX A;  4EMJ A;  1BGJ A;  3NTA A;  1D7L A;  3AYI A;  4JY3 A;  1PHH A;  1CC4 A;  3LJP A;  4C5O A;  3CGB A;  3AEG A;  3C96 A;  2JBV A;  2X99 A;  2YWL A;  1Q9I A;  1D7Y A;  5EB5 A;  3ZDN A;  1ZY8 A;  2Y6Q A;  2C3D A;  3UKF A;  2Y6R A;  4GF7 A;  4NNJ A;  2O9Z A;  1IUV A;  4H4Q A;  1L9C A;  5KWF A;  4J56 A;  3GD4 A;  4PAB A;  3VR8 A;  2V3B A;  1H6V A;  3V76 A;  1K4Q A;  1ZMC A;  1GRB A;  4I59 A;  4KX6 A;  4YXD A;  1ZMD A;  1PN0 A;  1CJC A;  2VVL G;  2X3N A;  5U25 A;  5FMH A;  3CIR A;  2C3C A;  1GRH A;  2ACZ A;  4CBQ A;  1FEA A;  2GR3 A;  1B8S A;  2BS3 A;  4H4P A;  3UTF A;  4C77 A;  2YG5 A;  4U8P A;  4A6N A;  3K7M X;  4H4V A;  2OAL A;  3GWF A;  2CUL A;  5KMQ A;  4B64 A;  2OLN A;  4H4W A;  2QA1 A;  2WU2 A;  1TYP A;  1CJ3 A;  3UKQ A;  4GCM A;  1VG9 A;  1ZDL A;  1NEK A;  4GAP A;  3S5W A;  2WDR A;  3D8X A;  2WHD A;  3NIX A;  1PBB A;  4ZN0 A;  1H83 A;  1XDI A;  2FJA A;  5ER0 A;  3UTE A;  3AXB A;  5JCM A;  1GND A;  3QJ4 A;  2Q7V A;  2YR4 A;  3NKS A;  3EF6 A;  4H2N A;  1FEB A;  2UZZ A;  4B66 A;  4Z25 A;  3AE5 A;  3RP6 A;  4EMI A;  3V3O A;  2YLT A;  3AYL A;  5IQ1 A;  4A79 A;  1BGN A;  2C66 A;  5DBJ A;  3GYX A;  3BHF A;  1GRT A;  1JRY A;  1PBD A;  1PBC A;  3L1R A;  4Z26 A;  1H81 A;  3E1T A;  3AWI A;  4H4S A;  4B67 A;  4K5R A;  3AEC A;  1IUU A;  2V3A A;  4IVO B;  4J34 A;  1QJD A;  3CPJ G;  3ICR A;  4OPL A;  1S3E A;  3T0K A;  4Z2T A;  2A8X A;  2IVE A;  3SZ0 A;  2GR1 A;  2JK6 A;  1IUS A;  1IUX A;  4RG4 A;  4U2S A;  4H4U A;  1PJ5 A;  2AQJ A;  2WBA A;  3AE7 A;  1CC2 A;  5FS9 A;  4J31 A;  4AT0 A;  1N4V A;  2V5Z A;  3RP8 A;  1S3B A;  3DJG X;  1CBO A;  2BXR A;  5BVA A;  5LV9 A;  2ZBW A;  1LVL A;  3C4A A;  2RGJ A;  3B3R A;  1DOC A;  2BYB A;  1NPX A;  2GV8 A;  3OZ2 A;  4O5Q A;  4B65 A;  4BK3 A;  3LZX A;  3KPF A;  4FX9 A;  1XPQ A;  3QSE A;  1PXB A;  1LPF A;  4K7Z A;  3T2Z A;  3GYI A;  2XLR A;  2GB0 A;  2OLO A;  3NTD A;  1LV0 A;  3NLC A;  1GEU A;  2YG7 A;  1GTE A;  4H2Q A;  3NH3 X;  3UOY A;  3VQR A;  3RED A;  1YQ4 A;  4NEV A;  1RP0 A;  2B7R A;  4Y4M A;  1JEH A;  4IA6 A;  1MO9 A;  1TRB A;  3P4Q A;  3KD9 A;  4GAV A;  3EAN A;  3DJE A;  4WX1 A;  1AOG A;  2JKC A;  4LA1 A;  1ONF A;  2GAH B;  3P4S A;  4UDP A;  2FBW A;  2F5Z A;  1FOH A;  4BV6 A;  5CQF A;  1K0I A;  2WDV A;  2I0Z A;  2XVJ A;  3PVC A;  5KRQ A;  2WQY A;  3GMB A;  2XFN A;  3URH A;  3JSK A;  3NT6 A;  2YVG A;  1FL2 A;  1NHQ A;  3P1W A;  4U8J A;  3F8D A;  4X9N A;  3UOX A;  1JOA A;  1CL0 A;  3LXD A;  2QCU A;  1VG0 A;  3ATQ A;  3CTY A;  2WES A;  2PHH A;  2WOW A;  1O95 A;  3PS9 A;  1GER A;  1H84 A;  2XVH A;  2YM2 A;  4JDR A;  4WCT A;  3ABV A;  2GF3 A;  4J36 A;  4APN A;  5U63 A;  3AD9 B;  3VRD B;  3HZL A;  1NAA A;  3LOV A;  3KA7 A;  3BI2 A;  2EQ6 A;  3CPH G;  3T14 A;  3IC9 A;  1JNZ A;  5C2T A;  1K0J A;  2XLT A;  1BKW A;  1NG3 A;  3NRN A;  4USQ A;  4UP3 A;  3SXI A;  4C74 A;  4EMW A;  3M13 A;  3SZW A;  4DSG A;  3NK1 X;  5HY5 A;  4XWR A;  3NN6 X;  3SM8 A;  1REO A;  2YR5 A;  5EOW A;  2XDO A;  1TDK A;  3NNE A;  1W4X A;  3NK0 X;  4U8K A;  4ZCD A;  3I6D A;  3CNS A;  2GMH A;  3KU9 A;  2XLP A;  2RGO A;  2H89 A;  3UOZ A;  4HA6 A;  2R9Z A;  1ZK7 A;  3ALJ A;  2IID A;  2R0G A;  4H4X A;  1GET A;  4LII A;  1L9D A;  1Y56 B;  3G5Q A;  1Y56 A;  2WPF A;  4BK2 A;  1L0V A;  1ZOY A;  2H88 A;  1Q1W A;  3S61 A;  2GMJ A;  3FBS A;  2Q0K A;  3AE3 A;  1YQZ A;  1H7W A;  2X50 A;  3DGH A;  3QSS A;  4TLZ A;  5KNL A;  2YLS A;  2C72 A;  1M64 A;  2A89 A;  3RHA A;  2C65 A;  5KMS A;  1YQ3 A;  3UKA A;  4YSX A;  1ZKQ A;  1IUT A;  5KOW A;  4TM3 A;  1X31 B;  1CF3 A;  1CJ4 A;  3HYX A;  4OPI A;  1F8W A;  2B9Y A;  4RSL A;  4B68 A;  1EL9 A;  2YQU A;  1NHP A;  4IA5 A;  2B9X A;  4H50 A;  4JNQ A;  3UCL A;  1BWC A;  1GRA A;  4YWO A;  2WDQ A;  1GSN A;  3DK9 A;  2QA2 A;  3H4K A;  1PJ6 A;  4CNK A;  4HB9 A;  1GRF A;  4H2R A;  2BS4 A;  3DK8 A;  3RNM A;  3QVP A;  3VRA A;  2GEW A;  2XLS A;  1RSG A;  1H7X A;  4E0V A;  1DOB A;  2BXS A;  1CHU A;  4EQS A;  2W0H A;  4I58 A;  1KSS A;  1GTH A;  2JB1 A;  1H82 A;  3CGC A;  4B63 A;  2E1M A;  4LU6 A;  2VRM A;  3L8K A;  1KFY A;  3CMM A;  4G73 A;  1E1N A;  1RYI A;  1YY5 A;  4M52 A;  3UTH A;  4YKG A;  2WOI A;  2XFQ A;  2WP6 A;  3NHO X;  3UKH A;  4K8D A;  2E5V A;  4YTP A;  4A5L A;  1M6I A;  1PXC A;  3ZYX A;  2BK4 A;  2CDU A;  2WOV A;  4YSY A;  2VVM A;  4GRT A;  2GR2 A;  2XFP A;  3UKL A;  4A7A A;  1EL8 A;  3G5S A;  2BK3 A;  5BUL A;  3P9U A;  1P2H A;  4XXG A;  3AED A;  1F8S A;  2R4J A;  4USR A;  4OPT A;  3T37 A;  1OJ9 A;  3UP5 A;  1MOK A;  1SEZ A;  3CGE A;  4II3 A;  4OPU A;  3SY4 A;  4A9W A;  2YLW A;  3SZF A;  4A99 A;  4BK1 A;  3AE2 A;  2R0C A;  3CNT A;  3CN8 A;  3SFE A;  5IPY A;  3G5R A;  2VZ2 A;  3D1C A;  2ZZC A;  5KVI A;  2C75 A;  4Y4L A;  1DOE A;  5FS8 A;  1DJQ A;  5FS6 A;  3SZC A;  3F8P A;  3IHM A;  3K30 A;  2X8H A;  3R9U A;  2CVJ A;  4Z2U A;  1N4W A;  2TPR A;  4C3Y A;  3DJJ A;  1FCD A;  3EPT A;  5GSN A;  3KKJ A;  2XVF A;  2VOU A;  1TDN A;  1EL5 A; 
#chains in the Genus database with same CATH homology
 2YG6 A;  1QLB A;  3ATR A;  1HYU A;  3V3N A;  4GDE A;  5BRT A;  2C70 A;  2CFY A;  3T2Y A;  2V60 A;  1UKV G;  3NYC A;  3NN0 X;  1QO8 A;  4FK1 C;  4B69 A;  3FPZ A;  2VVL A;  1OJT A;  2YR6 A;  1DOD A;  1KSU A;  2EQ8 A;  3O0H A;  1EBD A;  3T31 A;  3DA1 A;  5JCL A;  1XAN A;  5EBK A;  4DSH A;  1FEC A;  4EQW A;  5KVH A;  2APG A;  2GVC A;  3FIM B;  4REK A;  2X8G A;  3AB1 A;  4ADW A;  1YKJ A;  1CJ2 A;  1F8R A;  3ALM A;  2YLX A;  1NDA A;  4U2L A;  5U1O A;  4NTE A;  4CNJ A;  3II4 A;  3UKP A;  2EQ7 A;  1Z6L A;  3ALL A;  5FS7 A;  1N1P A;  2QAE A;  2GQW A;  1OJD A;  2R45 A;  4OPD A;  2V61 A;  2AR8 A;  2YG4 A;  2Z5Y A;  3KLJ A;  2PYX A;  4MJW A;  2E4G A;  3F8R A;  3B6D A;  1D4E A;  3I3L A;  1E39 A;  2WS3 A;  4G9K A;  2XVI A;  1H86 A;  2J3N A;  3BI5 A;  5JCN A;  4G74 A;  2ZZ0 A;  3UTG A;  5J7X A;  1CC6 A;  4ECH A;  1ELI A;  2OAM A;  1ZOV A;  1PXA A;  4YSZ A;  5HXI A;  4NZH A;  2WEU A;  1D4C A;  4K2X A;  4U8M A;  2A87 A;  2XFO A;  2BK5 A;  3AE1 A;  1PBF A;  2ARD A;  2WPC A;  1KNP A;  3EAO A;  3CNJ A;  4NEW A;  2OA1 A;  1JU2 A;  2FJB A;  2YLZ A;  1VRQ B;  4EIP A;  4AP1 A;  2XCG A;  3FMW A;  1KNR A;  2BC0 A;  2GR0 A;  5GRT A;  3HYV A;  4H4Z A;  1K0L A;  3VRB A;  4CY8 A;  4A6N B;  2R4E A;  4EM3 A;  1VQW A;  4Z43 A;  1TDE A;  5M0Z A;  1LQT A;  3ADA B;  3GDN A;  1KF6 A;  1Q1R A;  1PS9 A;  2XLU A;  1O5W A;  4FK1 A;  4YT0 A;  2GAG B;  1PJ7 A;  4NWZ A;  4Z44 A;  3GDP A;  2BCP A;  2R46 A;  1E1M A;  2XFU A;  4BJZ A;  4C3X A;  4YTN A;  1F3P A;  2YVF A;  5M10 A;  1BF3 A;  3AD8 B;  5HYM A;  3SYI A;  3LZW A;  2VRL A;  4GUV A;  3IHG A;  4GDP A;  3K7T A;  1O94 A;  3WE0 A;  3CNP A;  5C3J A;  2BRY A;  2HQM A;  3Q6J A;  2BC1 A;  4U8N A;  1JNR A;  2EQ9 A;  4TM4 A;  4P9S A;  1PDH A;  4H4T A;  4U8I A;  2NPX A;  1TDO A;  5EB4 A;  1E1K A;  1EL7 A;  1NG4 A;  5J60 A;  1BZL A;  1LJ1 A;  3M0O A;  2YM1 A;  3UOV A;  4BJY A;  4J33 A;  3H8I A;  4TM1 A;  2WPE A;  5JCK A;  3AE9 A;  1B37 A;  2R0P A;  2WU5 A;  2WP5 A;  1GRG A;  3OC4 A;  1F6M A;  1DJN A;  4CRT A;  2BA9 A;  4G6H A;  4YTM A;  1E7P A;  1GXF A;  1VDC A;  3RP7 A;  1NHS A;  3M12 A;  4KPR A;  3VR9 A;  1DXL A;  5CKU A;  1TDF A;  2BS2 A;  3P4P A;  4AOX A;  4OPC A;  4JNA A;  1IUW A;  1DNC A;  2JB3 A;  4U8O A;  4II2 A;  4AT2 A;  4YSH A;  4GR1 A;  1LTX R;  3GRT A;  2BAB A;  3DGZ A;  2XYO A;  3K7Q X;  1Y0P A;  4UDQ A;  3AEE A;  3FG2 P;  1B5Q A;  1KDG A;  4TLX A;  4YKF A;  3BNM A;  4OVI A;  4U8L A;  4FDC B;  4JQ9 A;  3SGL A;  5BUK A;  3AEB A;  4DGK A;  2C76 A;  3ICT A;  4DNA A;  3SQP A;  4Z2R A;  5L46 A;  2B9W A;  3QVR A;  2JB2 A;  3NK2 X;  1TYT A;  3ISH A;  2RAB A;  2WET A;  5HHF A;  2C64 A;  1XHC A;  1S2Y A;  4A65 A;  5KMR A;  3P4R A;  3PO7 A;  2NVK X;  4IVM B;  3T2K A;  2X8C A;  3DME A;  3KVE A;  3AEA A;  3QSM A;  4ICY A;  1V59 A;  3DJD A;  3ICS A;  4Z24 A;  2GH5 A;  4NTD A;  2V6O A;  2DKI A;  3BNU A;  5IQ4 A;  4J57 A;  3Q9T A;  2RGH A;  3BI4 A;  2BRA A;  4Y4N A;  4JN9 A;  3KPK A;  1D4D A;  2IVD A;  1ZP0 A;  2C7G A;  2FJE A;  1GT8 A;  3AE8 A;  3AE6 A;  3BHK A;  2TMD A;  3H8L A;  2Q6U A;  3CND A;  4ZCC A;  2YAU A;  2C67 A;  2YG3 A;  3DK4 A;  1GV4 A;  4D04 A;  5KOX A;  2ZZB A;  4EIQ A;  4H4Y A;  1GAL A;  3NYE A;  1S2Q A;  2BCG G;  2GRT A;  4EQR A;  5JCI A;  2Q0L A;  4EM4 A;  4K5S A;  4U2T A;  4B1B A;  4AP3 A;  4BUR A;  4CCR A;  2FJD A;  3C4N A;  4J2W A;  1ZX9 A;  3GYJ A;  2Z5X A;  4H4R A;  2YVJ A;  1OJC A;  1IJH A;  2AAQ A;  2WP9 A;  2B7S A;  4XWZ A;  1GPE A;  1LQU A;  2BAC A;  3QFA A;  1GRE A;  2B76 A;  3NG7 X;  4CY6 A;  4X9M A;  4CCQ A;  3CGD A;  3LB8 A;  1NHR A;  2JAE A;  2C4C A;  4IV9 A;  1GOS A;  4NTC A;  4O5U A;  3SX6 A;  1NEN A;  2VQ7 A;  3IF9 A;  1PBE A;  4AOS A;  2GQF A;  3HYW A;  3GD3 A;  4EQX A;  2DKH A;  3GRS A;  3IWA A;  2YLR A;  3NGC X;  1GES A;  4OPG A;  3AE4 A;  1JRZ A;  3AEF A;  3AYJ A;  3GSI A;  4JY2 A;  3UP4 A;  1COY A;  3DH9 A;  4G6G A;  2XVE A;  2VQB A;  3GWD A;  4TM0 A;  5KXJ A;  1D5T A;  1N4U A;  2C73 A;  3CPI G;  1E1L A;  3SFD A;  3AD7 B;  4PAA A;  5TR3 A;  1P2E A;  4K22 A;  4H7U A;  1E6E A;  4UDR A;  1B4V A;  1OJA A;  4X4J A;  1MXT A;  4RG3 A;  5KMP A;  4H2P A;  4D03 A;  1L9E A;  3NYF A;  3LAD A;  1JRX A;  3ITJ A;  4OCG A;  3UKK A;  3QFB A;  4N9X A;  3GMC A;  3COX A;  4EMJ A;  1BGJ A;  3NTA A;  1D7L A;  3AYI A;  4JY3 A;  1PHH A;  1CC4 A;  3LJP A;  4C5O A;  3CGB A;  3AEG A;  3C96 A;  2JBV A;  2X99 A;  2YWL A;  1Q9I A;  1D7Y A;  5EB5 A;  3ZDN A;  1ZY8 A;  2Y6Q A;  2C3D A;  3UKF A;  2Y6R A;  4GF7 A;  4NNJ A;  2O9Z A;  1IUV A;  4H4Q A;  1L9C A;  5KWF A;  4J56 A;  3GD4 A;  4PAB A;  3VR8 A;  2V3B A;  1H6V A;  3V76 A;  1K4Q A;  1ZMC A;  1GRB A;  4I59 A;  4KX6 A;  4YXD A;  1ZMD A;  1PN0 A;  1CJC A;  2VVL G;  2X3N A;  5U25 A;  5FMH A;  3CIR A;  2C3C A;  1GRH A;  2ACZ A;  4CBQ A;  1FEA A;  2GR3 A;  1B8S A;  2BS3 A;  4H4P A;  3UTF A;  4C77 A;  2YG5 A;  4U8P A;  4A6N A;  3K7M X;  4H4V A;  2OAL A;  3GWF A;  2CUL A;  5KMQ A;  4B64 A;  2OLN A;  4H4W A;  2QA1 A;  2WU2 A;  1TYP A;  1CJ3 A;  3UKQ A;  4GCM A;  1VG9 A;  1ZDL A;  1NEK A;  4GAP A;  3S5W A;  2WDR A;  3D8X A;  2WHD A;  3NIX A;  1PBB A;  4ZN0 A;  1H83 A;  1XDI A;  2FJA A;  5ER0 A;  3UTE A;  3AXB A;  5JCM A;  1GND A;  3QJ4 A;  2Q7V A;  2YR4 A;  3NKS A;  3EF6 A;  4H2N A;  1FEB A;  2UZZ A;  4B66 A;  4Z25 A;  3AE5 A;  3RP6 A;  4EMI A;  3V3O A;  2YLT A;  3AYL A;  5IQ1 A;  4A79 A;  1BGN A;  2C66 A;  5DBJ A;  3GYX A;  3BHF A;  1GRT A;  1JRY A;  1PBD A;  1PBC A;  3L1R A;  4Z26 A;  1H81 A;  3E1T A;  3AWI A;  4H4S A;  4B67 A;  4K5R A;  3AEC A;  1IUU A;  2V3A A;  4IVO B;  4J34 A;  1QJD A;  3CPJ G;  3ICR A;  4OPL A;  1S3E A;  3T0K A;  4Z2T A;  2A8X A;  2IVE A;  3SZ0 A;  2GR1 A;  2JK6 A;  1IUS A;  1IUX A;  4RG4 A;  4U2S A;  4H4U A;  1PJ5 A;  2AQJ A;  2WBA A;  3AE7 A;  1CC2 A;  5FS9 A;  4J31 A;  4AT0 A;  1N4V A;  2V5Z A;  3RP8 A;  1S3B A;  3DJG X;  1CBO A;  2BXR A;  5BVA A;  5LV9 A;  2ZBW A;  1LVL A;  3C4A A;  2RGJ A;  3B3R A;  1DOC A;  2BYB A;  1NPX A;  2GV8 A;  3OZ2 A;  4O5Q A;  4B65 A;  4BK3 A;  3LZX A;  3KPF A;  4FX9 A;  1XPQ A;  3QSE A;  1PXB A;  1LPF A;  4K7Z A;  3T2Z A;  3GYI A;  2XLR A;  2GB0 A;  2OLO A;  3NTD A;  1LV0 A;  3NLC A;  1GEU A;  2YG7 A;  1GTE A;  4H2Q A;  3NH3 X;  3UOY A;  3VQR A;  3RED A;  1YQ4 A;  4NEV A;  1RP0 A;  2B7R A;  4Y4M A;  1JEH A;  4IA6 A;  1MO9 A;  1TRB A;  3P4Q A;  3KD9 A;  4GAV A;  3EAN A;  3DJE A;  4WX1 A;  1AOG A;  2JKC A;  4LA1 A;  1ONF A;  2GAH B;  3P4S A;  4UDP A;  2FBW A;  2F5Z A;  1FOH A;  4BV6 A;  5CQF A;  1K0I A;  2WDV A;  2I0Z A;  2XVJ A;  3PVC A;  5KRQ A;  2WQY A;  3GMB A;  2XFN A;  3URH A;  3JSK A;  3NT6 A;  2YVG A;  1FL2 A;  1NHQ A;  3P1W A;  4U8J A;  3F8D A;  4X9N A;  3UOX A;  1JOA A;  1CL0 A;  3LXD A;  2QCU A;  1VG0 A;  3ATQ A;  3CTY A;  2WES A;  2PHH A;  2WOW A;  1O95 A;  3PS9 A;  1GER A;  1H84 A;  2XVH A;  2YM2 A;  4JDR A;  4WCT A;  3ABV A;  2GF3 A;  4J36 A;  4APN A;  5U63 A;  3AD9 B;  3VRD B;  3HZL A;  1NAA A;  3LOV A;  3KA7 A;  3BI2 A;  2EQ6 A;  3CPH G;  3T14 A;  3IC9 A;  1JNZ A;  5C2T A;  1K0J A;  2XLT A;  1BKW A;  1NG3 A;  3NRN A;  4USQ A;  4UP3 A;  3SXI A;  4C74 A;  4EMW A;  3M13 A;  3SZW A;  4DSG A;  3NK1 X;  5HY5 A;  4XWR A;  3NN6 X;  3SM8 A;  1REO A;  2YR5 A;  5EOW A;  2XDO A;  1TDK A;  3NNE A;  1W4X A;  3NK0 X;  4U8K A;  4ZCD A;  3I6D A;  3CNS A;  2GMH A;  3KU9 A;  2XLP A;  2RGO A;  2H89 A;  3UOZ A;  4HA6 A;  2R9Z A;  1ZK7 A;  3ALJ A;  2IID A;  2R0G A;  4H4X A;  1GET A;  4LII A;  1L9D A;  1Y56 B;  3G5Q A;  1Y56 A;  2WPF A;  4BK2 A;  1L0V A;  1ZOY A;  2H88 A;  1Q1W A;  3S61 A;  2GMJ A;  3FBS A;  2Q0K A;  3AE3 A;  1YQZ A;  1H7W A;  2X50 A;  3DGH A;  3QSS A;  4TLZ A;  5KNL A;  2YLS A;  2C72 A;  1M64 A;  2A89 A;  3RHA A;  2C65 A;  5KMS A;  1YQ3 A;  3UKA A;  4YSX A;  1ZKQ A;  1IUT A;  5KOW A;  4TM3 A;  1X31 B;  1CF3 A;  1CJ4 A;  3HYX A;  4OPI A;  1F8W A;  2B9Y A;  4RSL A;  4B68 A;  1EL9 A;  2YQU A;  1NHP A;  4IA5 A;  2B9X A;  4H50 A;  4JNQ A;  3UCL A;  1BWC A;  1GRA A;  4YWO A;  2WDQ A;  1GSN A;  3DK9 A;  2QA2 A;  3H4K A;  1PJ6 A;  4CNK A;  4HB9 A;  1GRF A;  4H2R A;  2BS4 A;  3DK8 A;  3RNM A;  3QVP A;  3VRA A;  2GEW A;  2XLS A;  1RSG A;  1H7X A;  4E0V A;  1DOB A;  2BXS A;  1CHU A;  4EQS A;  2W0H A;  4I58 A;  1KSS A;  1GTH A;  2JB1 A;  1H82 A;  3CGC A;  4B63 A;  2E1M A;  4LU6 A;  2VRM A;  3L8K A;  1KFY A;  3CMM A;  4G73 A;  1E1N A;  1RYI A;  1YY5 A;  4M52 A;  3UTH A;  4YKG A;  2WOI A;  2XFQ A;  2WP6 A;  3NHO X;  3UKH A;  4K8D A;  2E5V A;  4YTP A;  4A5L A;  1M6I A;  1PXC A;  3ZYX A;  2BK4 A;  2CDU A;  2WOV A;  4YSY A;  2VVM A;  4GRT A;  2GR2 A;  2XFP A;  3UKL A;  4A7A A;  1EL8 A;  3G5S A;  2BK3 A;  5BUL A;  3P9U A;  1P2H A;  4XXG A;  3AED A;  1F8S A;  2R4J A;  4USR A;  4OPT A;  3T37 A;  1OJ9 A;  3UP5 A;  1MOK A;  1SEZ A;  3CGE A;  4II3 A;  4OPU A;  3SY4 A;  4A9W A;  2YLW A;  3SZF A;  4A99 A;  4BK1 A;  3AE2 A;  2R0C A;  3CNT A;  3CN8 A;  3SFE A;  5IPY A;  3G5R A;  2VZ2 A;  3D1C A;  2ZZC A;  5KVI A;  2C75 A;  4Y4L A;  1DOE A;  5FS8 A;  1DJQ A;  5FS6 A;  3SZC A;  3F8P A;  3IHM A;  3K30 A;  2X8H A;  3R9U A;  2CVJ A;  4Z2U A;  1N4W A;  2TPR A;  4C3Y A;  3DJJ A;  1FCD A;  3EPT A;  5GSN A;  3KKJ A;  2XVF A;  2VOU A;  1TDN A;  1EL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...