3NN0X

Complex of 6-hydroxy-l-nicotine oxidase with nicotinamide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 138
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nn0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nn0X02
3KA7A 2GAGB 1NAAA 1NDAA 2WPEA 3DJEA 1ZP0A 2R9ZA 2YLZA 1IUXA 4J56A 4BK1A 3FPZA 3UTEA 1M6IA 1D7YA 1D4DA 2WP6A 5U63A 4HB9A 3VR8A 2AR8A 2JB1A 2OLNA 3GDNA 1GNDA 1MO9A 4TLXA 1L9DA 1IUVA 2GVCA 1D5TA 4JY2A 3CPIG 3ADAB 1B37A 1TYPA 4D03A 1TDFA 3GMCA 3LB8A 4OPIA 4C74A 4DSHA 3SM8A 2YLTA 5KOXA 2TMDA 3SFDA 4Y4LA 2QCUA 4Z44A 3E1TA 4LU6A 3NH3X 3NGCX 1K0LA 1O5WA 3EAOA 4H50A 2YAUA 4RG3A 4Z26A 2YG3A 2YG7A 2AQJA 3PO7A 1IUUA 3AE6A 3K30A 3GRSA 5FS7A 4OPUA 2Z5XA 4Z43A 4Z2TA 3DGHA 4AOXA 5EOWA 4D04A 4Z2UA 4PABA 2RGOA 1KDGA 3CN8A 3AE2A 4CY6A 4Z24A 1PBCA 1IUSA 2WEUA 2YVGA 5CKUA 4EMJA 4EQWA 3G5SA 2GF3A 3KPFA 1E39A 3I3LA 5IPYA 1AOGA 2XVJA 3AECA 1E1NA 3DH9A 4O5UA 4APNA 2Y6RA 2AAQA 3GD4A 1K0JA 4OPLA 1GRHA 2RGHA 3LXDA 5LV9A 2BXSA 2XLTA 3GRTA 4U2LA 4KX6A 2BK5A 1VDCA 2BK3A 2WPFA 4K8DA 4NTEA 3AE8A 3C96A 4H4YA 4GDPA 4N9XA 3BI4A 2BACA 5GSNA 4OPGA 5TR3A 4TM4A 1GALA 1PS9A 1GT8A 2EQ8A 2C64A 4IVMB 4U2TA 5C2TA 3NHOX 4EMIA 1TYTA 4M52A 4IA5A 1OJAA 2UZZA 2WDVA 3SFEA 4BJZA 4C3XA 5M0ZA 2HQMA 1CHUA 3RP7A 1E1LA 2WDQA 3KU9A 2GR2A 3AEEA 3UKHA 1E7PA 3F8RA 3DJDA 4Y4MA 3ICSA 3C4AA 2V5ZA 4KPRA 1NPXA 1XHCA 2IVEA 2WQYA 5DBJA 4AT2A 3NK2X 1JU2A 2JB3A 3DJJA 3AD8B 3S5WA 1VRQB 5KVIA 3NK0X 1BF3A 2YLXA 3GMBA 3VR9A 3C4NA 3VRBA 4J36A 2GV8A 3DK8A 4OVIA 2Y6QA 2BCGG 4H4PA 1CJ4A 2C67A 3DK4A 4B68A 4UDPA 2BS4A 4XXGA 1GESA 4BK2A 1COYA 1XANA 4NZHA 4NTCA 1KF6A 1ZY8A 3UKFA 4CBQA 1Y0PA 2B76A 2EQ9A 2XFNA 4H4UA 3CNDA 1CJCA 5FS6A 3AEGA 2CVJA 3ZYXA 2XFUA 2VVLG 1KSUA 4YXDA 1S2YA 3LOVA 3ICRA 1OJDA 3L8KA 4JQ9A 2C72A 2IVDA 3BNMA 2R0GA 4HA6A 2BXRA 2BC0A 3M13A 4K5SA 5CQFA 3DA1A 3ABVA 3NTAA 2CULA 2R0PA 4TM1A 1OJ9A 3IC9A 2B9XA 3NK1X 1Z6LA 3AE1A 3DMEA 3UP5A 4JNQA 2WU5A 3IHGA 5KWFA 1TDKA 4FK1C 1HYUA 1MOKA 3F8DA 2FJDA 5BUKA 3K7TA 1JNZA 1VG9A 1EBDA 1Q1WA 5BULA 1ONFA 1NHQA 2VOUA 4UDRA 4K5RA 1GOSA 5M10A 4B67A 2VZ2A 3H8IA 5JCIA 2OA1A 3B6DA 3Q6JA 3DGZA 1VQWA 4B64A 3P4QA 2EQ7A 3WE0A 1GEUA 1GRAA 1P2EA 2BABA 2XFQA 4OPTA 4B1BA 3RP8A 1CJ2A 4EQSA 2R46A 2WESA 3RHAA 4EIQA 4EQRA 3NG7X 4EM4A 2YLWA 1JRZA 3AYIA 1N4UA 4CNJA 2ZZ0A 2YQUA 2Q0KA 4UDQA 1LQTA 4AP1A 1BZLA 4J34A 2BYBA 4H2NA 1PJ7A 1ZMCA 4B69A 2JK6A 3FG2P 2A89A 3OC4A 4OPDA 2V6OA 1H81A 3BI2A 4ADWA 4C77A 5EB4A 4A6NB 1UKVG 1GSNA 2YR5A 3CGCA 4I59A 4B63A 1S3EA 2X99A 3CNSA 1D4EA 3DJGX 5EB5A 1PDHA 1ZDLA 2Q7VA 1JOAA 1SEZA 4GDEA 1B8SA 3PVCA 1JNRA 1GXFA 3P4PA 2GR0A 3QSMA 1S2QA 2V3AA 3I6DA 4H4RA 2GRTA 3UOZA 1NHPA 5KVHA 2ZZBA 3ALMA 1PXCA 3COXA 4GF7A 4H2QA 3UKPA 5HYMA 3GYJA 4J57A 1DNCA 4C3YA 3AEAA 4H4WA 5J7XA 1L0VA 1EL9A 1F6MA 3D8XA 1BKWA 1FOHA 5KXJA 2GEWA 2IIDA 4FX9A 5EBKA 4XWZA 2APGA 2FJBA 3K7MX 3ALJA 2XVIA 3LZWA 4Z2RA 1CC6A 4YWOA 1ZK7A 2R45A 4RSLA 1DJNA 3QSEA 2ARDA 2XCGA 1Y56B 2YM2A 1K0IA 1Q9IA 1YY5A 1FECA 3AYLA 2WP5A 1XPQA 3P9UA 1TDNA 4CCQA 5JCLA 2ACZA 1PJ6A 1OJTA 3GSIA 2NVKX 1TDOA 3AEFA 2GR3A 3AWIA 3QVRA 1LJ1A 2C7GA 3JSKA 1B4VA 1QLBA 2XVHA 1H7XA 1LTXR 4YSYA 2R0CA 2C3DA 4EMWA 1PN0A 2X8HA 4GUVA 3URHA 4DNAA 2WBAA 4A7AA 3V3OA 4CCRA 4AOSA 3S61A 2W0HA 2GR1A 1MXTA 3DK9A 4H4TA 4ICYA 2VVLA 4ZN0A 5KRQA 1GRTA 4BJYA 1LQUA 1H7WA 2BS3A 2NPXA 3CNTA 4DGKA 1W4XA 2R4EA 1F8WA 1X31B 2YR6A 2WP9A 3ISHA 2RGJA 1TRBA 5IQ4A 1GETA 1NG4A 1L9EA 4A99A 4PAAA 3AD7B 3LZXA 4K2XA 1F8RA 3NTDA 1PBBA 3AEDA 3KKJA 2B7RA 5HY5A 3O0HA 2XYOA 3CNPA 3ALLA 4NEWA 2JBVA 4U8OA 5J60A 1RSGA 1O95A 1OJCA 2BA9A 2C75A 2GH5A 3F8PA 4TM0A 2DKHA 4TM3A 4Y4NA 2YG5A 1DJQA 1RP0A 3ATQA 3NYEA 4USQA 4A65A 1KSSA 3CGEA 2GMHA 1EL8A 4J31A 2WOIA 3QSSA 4H4VA 1E6EA 4BK3A 1CC2A 1JRYA 4OCGA 1GREA 2B9WA 2C3CA 2XFOA 3B3RA 4H4XA 3UOXA 3CPJG 2QAEA 2XLSA 5L46A 1ZOYA 3P4SA 4U8NA 4X4JA 4ZCDA 4ECHA 1ZMDA 1IUTA 5U25A 3HZLA 1PXBA 5JCKA 4YTNA 5BVAA 3AE3A 4A6NA 1VG0A 1PXAA 4LA1A 3BI5A 3UTGA 3UKLA 2C76A 1CBOA 2H88A 4I58A 4LIIA 3AE9A 3LADA 3ZDNA 5HHFA 2GQWA 5U1OA 4CNKA 4YTPA 3EPTA 1FCDA 3NN6X 4U8KA 4EM3A 3ITJA 2OLOA 3FMWA 1YQ3A 2BCPA 4YSXA 2WPCA 4A79A 2EQ6A 1PJ5A 1E1KA 2GQFA 1H6VA 2C73A 3H4KA 3NIXA 3BHKA 4H4QA 4OPCA 2RABA 2VRMA 1F3PA 3AE7A 3CTYA 3UCLA 2CFYA 4H4ZA 4GRTA 4NEVA 4IV9A 4DSGA 2Q6UA 3EANA 4Z25A 2XLPA 5GRTA 5BRTA 3VRAA 3QFAA 2B9YA 1CF3A 1GERA 3REDA 3UKQA 2XLRA 1DODA 2YR4A 4H2RA 1H82A 2X50A 4TLZA 2WS3A 3RNMA 1QO8A 2PHHA 4BV6A 2JB2A 1EL5A 1NG3A 2OAMA 3PS9A 1Y56A 3G5QA 4H4SA 3AD9B 4B65A 2B7SA 1D4CA 1FL2A 1N1PA 1Q1RA 4K7ZA 2VQBA 3QJ4A 3CGBA 3VRDB 4EIPA 5JCMA 1LPFA 4X9NA 5FS8A 1DOCA 3GD3A 2JKCA 2DKIA 1L9CA 2YM1A 3UTHA 4NTDA 1GV4A 1PBEA 2E4GA 4WX1A 4GCMA 1K4QA 1V59A 2I0ZA 3NYFA 1M64A 3L1RA 1DOEA 2GAHB 4U8LA 1RYIA 4AP3A 2FBWA 2WHDA 3D1CA 3GDPA 2PYXA 1FEBA 3IWAA 4AT0A 1XDIA 4X9MA 4IVOB 3UTFA 3FIMB 3IF9A 1GPEA 2YWLA 3GWDA 3BNUA 3GYIA 2X8GA 4J2WA 1YQZA 3M0OA 5JCNA 1PHHA 2VQ7A 3NYCA 3R9UA 2XDOA 2E5VA 5KOWA 4WCTA 4BURA 3FBSA 5ER0A 3P1WA 2FJEA 1H83A 2ZBWA 1CJ3A 2JAEA 1JEHA 1ELIA 1JRXA 2V60A 3QVPA 4C5OA 1TDEA 2ZZCA 1P2HA 3UOYA 1D7LA 1F8SA 4YKGA 2VVMA 2WOVA 1YKJA 1GTHA 1B5QA 1N4WA 1YQ4A 2BS2A 4U8PA 4K22A 1DOBA 3CIRA 1NENA 3H8LA 1LVLA 4YT0A 4H7UA 4USRA 2YVFA 1BWCA 3NNEA 2BC1A 1ZOVA 3RP6A 3G5RA 2GMJA 2WETA 4JY3A 1O94A 4YTMA 1DXLA 2OALA 3CNJA 1NHRA 2WU2A 2XFPA 3VQRA 1QJDA 3NLCA 2YLRA 3T37A 3UP4A 3NN0X 3LJPA 3UKAA 2GB0A 2H89A 3SGLA 3NKSA 4CY8A 2R4JA 2WDRA 4O5QA 3ATRA 4ZCCA 1CL0A 4U8JA 2J3NA 3K7QX 2XVFA 2Z5YA 2QA2A 4YKFA 3AB1A 2WOWA 3II4A 4IA6A 2TPRA 3CPHG 4U8MA 2YLSA 1KNPA 3GWFA 2O9ZA 3EF6A 2QA1A 2Q0LA 4JDRA 2YVJA 4A9WA 1IJHA 1S3BA 4B66A 5IQ1A 1E1MA 3SQPA 1H84A 4JNAA 4P9SA 2X3NA 4FDCB 1KNRA 2C66A 1BGJA 4FK1A 3Q9TA 4UP3A 3UKKA 1H86A 2V61A 3KD9A 5FS9A 3KVEA 4REKA 4A5LA 1BGNA 3NRNA 3NT6A 4CRTA 1FEAA 3P4RA 1IUWA 5FMHA 1GRGA 2V3BA 2XVEA 3AE5A 4YSZA 4MJWA 2C70A 2A8XA 3ICTA 3QFBA 4RG4A 4GR1A 1ZX9A 2XLUA 4XWRA 1GTEA 3AYJA 2C65A 3M12A 2FJAA 1GRFA 3KLJA 1KFYA 1NHSA 4E0VA 3IHMA 4J33A 2YG6A 3AE4A 3V76A 3UOVA 4YSHA 2BK4A 5HXIA 3BHFA 1LV0A 1CC4A 5C3JA 1EL7A 1REOA 4U2SA 1NEKA 4EQXA 2E1MA 2F5ZA 2CDUA 4JN9A 3AXBA 3V3NA 1N4VA 1ZKQA 2YG4A 2VRLA 3CGDA 2X8CA 4U8IA 1GRBA 3OZ2A 3AEBA 4H2PA 2A87A 1PBFA 1PBDA
chains in the Genus database with same CATH superfamily
3SZWA 3KA7A 2GAGB 1NAAA 1NDAA 2WPEA 3DJEA 1ZP0A 2R9ZA 2YLZA 1IUXA 4J56A 4BK1A 3FPZA 3UTEA 1M6IA 1D7YA 1D4DA 2WP6A 5U63A 4HB9A 3VR8A 3T14A 2AR8A 2JB1A 2OLNA 3GDNA 1GNDA 1MO9A 4TLXA 3KPKA 1L9DA 1IUVA 2GVCA 1D5TA 4JY2A 3CPIG 3ADAB 1B37A 1TYPA 4D03A 1TDFA 3GMCA 3LB8A 4OPIA 4C74A 4DSHA 3SM8A 2YLTA 5KOXA 2TMDA 3SFDA 4Y4LA 2QCUA 4Z44A 3E1TA 4LU6A 3NH3X 3NGCX 1K0LA 1O5WA 3EAOA 4H50A 2YAUA 4RG3A 4Z26A 2YG3A 2YG7A 2AQJA 3PO7A 1IUUA 3AE6A 3K30A 3GRSA 5FS7A 4OPUA 2Z5XA 4Z43A 4Z2TA 3DGHA 4AOXA 5EOWA 4II3A 4D04A 3CMMA 4Z2UA 4PABA 2RGOA 1KDGA 3CN8A 3AE2A 4CY6A 4Z24A 1PBCA 1IUSA 2WEUA 2YVGA 5CKUA 3SX6A 4EMJA 4EQWA 3G5SA 2GF3A 3KPFA 1E39A 3I3LA 5IPYA 1AOGA 2XVJA 3AECA 1E1NA 3DH9A 4O5UA 4APNA 2Y6RA 2AAQA 3GD4A 1K0JA 4OPLA 1GRHA 2RGHA 3LXDA 5LV9A 2BXSA 2XLTA 3GRTA 4U2LA 4KX6A 2BK5A 1VDCA 2BK3A 2WPFA 4K8DA 4NTEA 3AE8A 3C96A 4H4YA 4GDPA 4N9XA 3BI4A 2BACA 5GSNA 3SZ0A 3T0KA 4OPGA 5TR3A 4TM4A 1GALA 1PS9A 1GT8A 2EQ8A 2C64A 4IVMB 4U2TA 5C2TA 3NHOX 4EMIA 1TYTA 4M52A 4IA5A 1OJAA 2UZZA 2WDVA 3SFEA 4BJZA 3SZFA 4C3XA 5M0ZA 2HQMA 1CHUA 3RP7A 1E1LA 2WDQA 3KU9A 2GR2A 3AEEA 3UKHA 1E7PA 3F8RA 3DJDA 4Y4MA 3ICSA 3C4AA 2V5ZA 4KPRA 1NPXA 1XHCA 2IVEA 2WQYA 5DBJA 4AT2A 3NK2X 1JU2A 2JB3A 3DJJA 3AD8B 3S5WA 1VRQB 5KVIA 3NK0X 1BF3A 2YLXA 3GMBA 3VR9A 3C4NA 3VRBA 4J36A 2GV8A 3DK8A 4OVIA 2Y6QA 2BCGG 4H4PA 1CJ4A 2C67A 3DK4A 4B68A 4UDPA 2BS4A 4XXGA 1GESA 4BK2A 1COYA 1XANA 4NZHA 4NTCA 1KF6A 1ZY8A 3UKFA 4CBQA 1Y0PA 2B76A 2EQ9A 2XFNA 4H4UA 3CNDA 1CJCA 5FS6A 3AEGA 2CVJA 3ZYXA 2XFUA 2VVLG 1KSUA 4YXDA 1S2YA 3LOVA 5KNLA 3ICRA 1OJDA 3L8KA 4JQ9A 2C72A 2IVDA 3BNMA 2R0GA 4HA6A 2BXRA 2BC0A 4NWZA 3M13A 4K5SA 5CQFA 3DA1A 3SZCA 3ABVA 3NTAA 2CULA 2R0PA 4TM1A 1OJ9A 3IC9A 2B9XA 3NK1X 1Z6LA 3AE1A 3DMEA 3UP5A 4JNQA 2WU5A 3IHGA 5KWFA 1TDKA 4FK1C 1HYUA 1MOKA 3F8DA 2FJDA 5BUKA 2BRAA 3K7TA 1JNZA 1VG9A 1EBDA 1Q1WA 5BULA 1ONFA 1NHQA 2VOUA 4UDRA 3T31A 4K5RA 1GOSA 5M10A 4B67A 2VZ2A 3H8IA 5JCIA 2OA1A 3B6DA 3Q6JA 3DGZA 1VQWA 4B64A 3P4QA 2EQ7A 3WE0A 1GEUA 1GRAA 1P2EA 2BABA 2XFQA 4OPTA 4B1BA 3RP8A 1CJ2A 4EQSA 2R46A 2WESA 3RHAA 4EIQA 3SY4A 3NG7X 4EM4A 4EQRA 2YLWA 1JRZA 3AYIA 3T2ZA 1N4UA 4CNJA 2ZZ0A 2YQUA 2Q0KA 4UDQA 1LQTA 4AP1A 1BZLA 4J34A 2BYBA 4H2NA 1PJ7A 3HYVA 1ZMCA 4B69A 2JK6A 3FG2P 2A89A 3OC4A 4OPDA 2V6OA 1H81A 3BI2A 4ADWA 4C77A 5EB4A 4A6NB 1UKVG 1GSNA 2YR5A 3CGCA 4I59A 4B63A 1S3EA 2X99A 3CNSA 1D4EA 3DJGX 5EB5A 4NNJA 1PDHA 1ZDLA 2Q7VA 1JOAA 1SEZA 4GDEA 1B8SA 3PVCA 1JNRA 1GXFA 3P4PA 2GR0A 3QSMA 1S2QA 2V3AA 3I6DA 4H4RA 4II2A 2GRTA 3UOZA 1NHPA 5KVHA 2ZZBA 3ALMA 1PXCA 3COXA 4GF7A 4H2QA 3UKPA 5HYMA 3GYJA 4J57A 1DNCA 4C3YA 3AEAA 4H4WA 5J7XA 1L0VA 1EL9A 1F6MA 3D8XA 1BKWA 1FOHA 5KXJA 2GEWA 2IIDA 4FX9A 5EBKA 4XWZA 2APGA 2FJBA 3K7MX 3ALJA 2XVIA 3SXIA 3LZWA 4Z2RA 1CC6A 4YWOA 1ZK7A 2R45A 4RSLA 1DJNA 3QSEA 2ARDA 5KMSA 3GYXA 2XCGA 1Y56B 2YM2A 1K0IA 1Q9IA 1YY5A 1FECA 3AYLA 2WP5A 1XPQA 3P9UA 1TDNA 4CCQA 5JCLA 2ACZA 1PJ6A 1OJTA 3GSIA 2NVKX 1TDOA 3AEFA 2GR3A 3AWIA 3QVRA 1LJ1A 2C7GA 3SYIA 3JSKA 1B4VA 1QLBA 2XVHA 1H7XA 1LTXR 4YSYA 2R0CA 2C3DA 4EMWA 1PN0A 2X8HA 4GUVA 3URHA 4DNAA 2WBAA 4A7AA 4GAPA 3V3OA 4CCRA 4AOSA 3S61A 2W0HA 5KMQA 2GR1A 1MXTA 3DK9A 4H4TA 4ICYA 2VVLA 4ZN0A 5KRQA 1GRTA 4BJYA 1LQUA 1H7WA 2BS3A 2NPXA 3CNTA 4DGKA 1W4XA 2R4EA 2C4CA 1F8WA 1X31B 2YR6A 2WP9A 3ISHA 2RGJA 1TRBA 5IQ4A 1GETA 1NG4A 1L9EA 4A99A 4PAAA 3AD7B 3LZXA 4K2XA 1F8RA 3NTDA 1PBBA 3AEDA 3KKJA 2B7RA 5HY5A 3O0HA 2XYOA 3CNPA 3ALLA 4NEWA 2JBVA 4U8OA 5J60A 1RSGA 1O95A 1OJCA 2BA9A 2C75A 2GH5A 3F8PA 4G9KA 4TM0A 2DKHA 4TM3A 4Y4NA 2YG5A 1DJQA 1RP0A 3ATQA 3NYEA 4USQA 4A65A 1KSSA 3CGEA 2GMHA 1EL8A 4J31A 2WOIA 3QSSA 4H4VA 1E6EA 3T2KA 1CC2A 1JRYA 4BK3A 4G73A 1GREA 2B9WA 2C3CA 2XFOA 3B3RA 4H4XA 4OCGA 3CPJG 3UOXA 2QAEA 2XLSA 5L46A 1ZOYA 3P4SA 4U8NA 4X4JA 4ZCDA 4ECHA 1ZMDA 1IUTA 5U25A 3HZLA 1PXBA 4G6HA 5JCKA 4YTNA 5BVAA 3AE3A 4A6NA 1VG0A 1PXAA 4LA1A 3BI5A 3UTGA 3UKLA 2C76A 1CBOA 2H88A 4I58A 4LIIA 3AE9A 3LADA 3ZDNA 5HHFA 2GQWA 5U1OA 4CNKA 4YTPA 3EPTA 1FCDA 3NN6X 4U8KA 4EM3A 3ITJA 5KMPA 2OLOA 3FMWA 1YQ3A 2BCPA 4YSXA 2WPCA 4A79A 2EQ6A 1PJ5A 1E1KA 2GQFA 1H6VA 2C73A 3H4KA 3NIXA 3BHKA 4H4QA 4OPCA 2RABA 2VRMA 1F3PA 3AE7A 3CTYA 3UCLA 2CFYA 4H4ZA 4GRTA 4NEVA 4IV9A 4DSGA 2Q6UA 3EANA 4Z25A 2XLPA 5GRTA 5BRTA 3VRAA 3QFAA 2B9YA 1CF3A 1GERA 3REDA 3UKQA 2XLRA 1DODA 2YR4A 4H2RA 1H82A 2X50A 4TLZA 2WS3A 4G6GA 3RNMA 1QO8A 2PHHA 4BV6A 2JB2A 1EL5A 1NG3A 2OAMA 3PS9A 1Y56A 3G5QA 4H4SA 3AD9B 4B65A 2B7SA 1D4CA 1FL2A 1N1PA 1Q1RA 4K7ZA 2VQBA 3QJ4A 3CGBA 3VRDB 4EIPA 5JCMA 1LPFA 4X9NA 5FS8A 1DOCA 3GD3A 2JKCA 2DKIA 1L9CA 2YM1A 3UTHA 4NTDA 1GV4A 1PBEA 2E4GA 4WX1A 4GCMA 1K4QA 1V59A 2I0ZA 3NYFA 1M64A 3L1RA 1DOEA 2GAHB 4U8LA 1RYIA 4AP3A 2FBWA 2WHDA 3D1CA 3GDPA 2PYXA 1FEBA 3HYWA 3IWAA 1XDIA 4AT0A 4X9MA 4IVOB 3UTFA 3FIMB 3IF9A 1GPEA 2YWLA 3GWDA 3BNUA 3GYIA 2X8GA 4J2WA 1YQZA 3M0OA 5JCNA 1PHHA 2VQ7A 3NYCA 3R9UA 2XDOA 2E5VA 5KOWA 2BRYA 4WCTA 4BURA 3FBSA 5ER0A 3P1WA 2FJEA 1H83A 2ZBWA 1CJ3A 2JAEA 1JEHA 1ELIA 1JRXA 2V60A 3QVPA 4C5OA 1TDEA 2ZZCA 1P2HA 3UOYA 1D7LA 1F8SA 4YKGA 2VVMA 2WOVA 1YKJA 1GTHA 1B5QA 1N4WA 1YQ4A 2BS2A 4U8PA 4K22A 1DOBA 3CIRA 1NENA 3H8LA 1LVLA 4YT0A 4H7UA 4USRA 2YVFA 1BWCA 3NNEA 2BC1A 1ZOVA 3RP6A 3G5RA 2GMJA 2WETA 4JY3A 4G74A 1O94A 4YTMA 1DXLA 2OALA 3CNJA 1NHRA 2WU2A 2XFPA 3VQRA 1QJDA 3NLCA 2YLRA 3T37A 3UP4A 3NN0X 3LJPA 3UKAA 2GB0A 2H89A 3SGLA 3NKSA 4CY8A 2R4JA 2WDRA 4O5QA 3ATRA 4ZCCA 1CL0A 4U8JA 2J3NA 3K7QX 2XVFA 2Z5YA 2QA2A 4YKFA 3AB1A 2WOWA 3II4A 4IA6A 2TPRA 3CPHG 4U8MA 2YLSA 1KNPA 3GWFA 2O9ZA 3EF6A 2QA1A 2Q0LA 4JDRA 2YVJA 4A9WA 1IJHA 1S3BA 4B66A 5IQ1A 1E1MA 3SQPA 1H84A 4JNAA 4P9SA 2X3NA 4FDCB 1KNRA 2C66A 1BGJA 3HYXA 4FK1A 3Q9TA 4UP3A 3UKKA 1H86A 5KMRA 2V61A 3KD9A 5FS9A 3KVEA 4REKA 4A5LA 1BGNA 3NRNA 3NT6A 4CRTA 1FEAA 3P4RA 1IUWA 5FMHA 1GRGA 2V3BA 2XVEA 3AE5A 4YSZA 4MJWA 2C70A 2A8XA 3ICTA 3QFBA 4RG4A 4GR1A 1ZX9A 2XLUA 4XWRA 1GTEA 3AYJA 2C65A 3M12A 2FJAA 1GRFA 3KLJA 1KFYA 3T2YA 1NHSA 4E0VA 3IHMA 4J33A 2YG6A 3AE4A 3V76A 3UOVA 4YSHA 2BK4A 5HXIA 3BHFA 1LV0A 1CC4A 5C3JA 1EL7A 1REOA 4U2SA 4GAVA 1NEKA 4EQXA 2E1MA 2F5ZA 2CDUA 4JN9A 3AXBA 3V3NA 1N4VA 1ZKQA 2YG4A 2VRLA 3CGDA 2X8CA 4U8IA 1GRBA 3OZ2A 3AEBA 4H2PA 2A87A 1PBFA 1PBDA
chains in the Genus database with same CATH topology
3SZWA 3KA7A 2GAGB 1NAAA 1NDAA 2WPEA 3DJEA 1ZP0A 2R9ZA 2YLZA 1IUXA 4J56A 4BK1A 3FPZA 3UTEA 1M6IA 1D7YA 1D4DA 2WP6A 5U63A 4HB9A 3VR8A 3T14A 2AR8A 2JB1A 2OLNA 3GDNA 1GNDA 1MO9A 4TLXA 3KPKA 1L9DA 1IUVA 2GVCA 1D5TA 4JY2A 3CPIG 3ADAB 1B37A 1TYPA 4D03A 1TDFA 3GMCA 3LB8A 4OPIA 4C74A 4DSHA 3SM8A 2YLTA 5KOXA 2TMDA 3SFDA 4Y4LA 2QCUA 4Z44A 3E1TA 4LU6A 3NH3X 3NGCX 1K0LA 1O5WA 3EAOA 4H50A 2YAUA 4RG3A 4Z26A 2YG3A 2YG7A 2AQJA 3PO7A 1IUUA 3AE6A 3K30A 3GRSA 5FS7A 4OPUA 2Z5XA 4Z43A 4Z2TA 3DGHA 4AOXA 5EOWA 4II3A 4D04A 3CMMA 4Z2UA 4PABA 2RGOA 1KDGA 3CN8A 3AE2A 4CY6A 4Z24A 1PBCA 1IUSA 2WEUA 2YVGA 5CKUA 3SX6A 4EMJA 4EQWA 3G5SA 2GF3A 3KPFA 1E39A 3I3LA 5IPYA 1AOGA 2XVJA 3AECA 1E1NA 3DH9A 4O5UA 4APNA 2Y6RA 2AAQA 3GD4A 1K0JA 4OPLA 1GRHA 2RGHA 3LXDA 5LV9A 2BXSA 2XLTA 3GRTA 4U2LA 4KX6A 2BK5A 1VDCA 2BK3A 2WPFA 4K8DA 4NTEA 3AE8A 3C96A 4H4YA 4GDPA 4N9XA 3BI4A 2BACA 5GSNA 3SZ0A 3T0KA 4OPGA 5TR3A 4TM4A 1GALA 1PS9A 1GT8A 2EQ8A 2C64A 4IVMB 4U2TA 5C2TA 3NHOX 4EMIA 1TYTA 4M52A 4IA5A 1OJAA 2UZZA 2WDVA 3SFEA 4BJZA 3SZFA 4C3XA 5M0ZA 2HQMA 1CHUA 3RP7A 1E1LA 2WDQA 3KU9A 2GR2A 3AEEA 3UKHA 1E7PA 3F8RA 3DJDA 4Y4MA 3ICSA 3C4AA 2V5ZA 4KPRA 1NPXA 1XHCA 2IVEA 2WQYA 5DBJA 4AT2A 3NK2X 1JU2A 2JB3A 3DJJA 3AD8B 3S5WA 1VRQB 5KVIA 3NK0X 1BF3A 2YLXA 3GMBA 3VR9A 3C4NA 3VRBA 4J36A 2GV8A 3DK8A 4OVIA 2Y6QA 2BCGG 4H4PA 1CJ4A 2C67A 3DK4A 4B68A 4UDPA 2BS4A 4XXGA 1GESA 4BK2A 1COYA 1XANA 4NZHA 4NTCA 1KF6A 1ZY8A 3UKFA 4CBQA 1Y0PA 2B76A 2EQ9A 2XFNA 4H4UA 3CNDA 1CJCA 5FS6A 3AEGA 2CVJA 3ZYXA 2XFUA 2VVLG 1KSUA 4YXDA 1S2YA 3LOVA 5KNLA 3ICRA 1OJDA 3L8KA 4JQ9A 2C72A 2IVDA 3BNMA 2R0GA 4HA6A 2BXRA 2BC0A 4NWZA 3M13A 4K5SA 5CQFA 3DA1A 3SZCA 3ABVA 3NTAA 2CULA 2R0PA 4TM1A 1OJ9A 3IC9A 2B9XA 3NK1X 1Z6LA 3AE1A 3DMEA 3UP5A 4JNQA 2WU5A 3IHGA 5KWFA 1TDKA 4FK1C 1HYUA 1MOKA 3F8DA 2FJDA 5BUKA 2BRAA 3K7TA 1JNZA 1VG9A 1EBDA 1Q1WA 5BULA 1ONFA 1NHQA 2VOUA 4UDRA 3T31A 4K5RA 1GOSA 5M10A 4B67A 2VZ2A 3H8IA 5JCIA 2OA1A 3B6DA 3Q6JA 3DGZA 1VQWA 4B64A 3P4QA 2EQ7A 3WE0A 1GEUA 1GRAA 1P2EA 2BABA 2XFQA 4OPTA 4B1BA 3RP8A 1CJ2A 4EQSA 2R46A 2WESA 3RHAA 4EIQA 3SY4A 3NG7X 4EM4A 4EQRA 2YLWA 1JRZA 3AYIA 3T2ZA 1N4UA 4CNJA 2ZZ0A 2YQUA 2Q0KA 4UDQA 1LQTA 4AP1A 1BZLA 4J34A 2BYBA 4H2NA 1PJ7A 3HYVA 1ZMCA 4B69A 2JK6A 3FG2P 2A89A 3OC4A 4OPDA 2V6OA 1H81A 3BI2A 4ADWA 4C77A 5EB4A 4A6NB 1UKVG 1GSNA 2YR5A 3CGCA 4I59A 4B63A 1S3EA 2X99A 3CNSA 1D4EA 3DJGX 5EB5A 4NNJA 1PDHA 1ZDLA 2Q7VA 1JOAA 1SEZA 4GDEA 1B8SA 3PVCA 1JNRA 1GXFA 3P4PA 2GR0A 3QSMA 1S2QA 2V3AA 3I6DA 4H4RA 4II2A 2GRTA 3UOZA 1NHPA 5KVHA 2ZZBA 3ALMA 1PXCA 3COXA 4GF7A 4H2QA 3UKPA 5HYMA 3GYJA 4J57A 1DNCA 4C3YA 3AEAA 4H4WA 5J7XA 1L0VA 1EL9A 1F6MA 3D8XA 1BKWA 1FOHA 5KXJA 2GEWA 2IIDA 4FX9A 5EBKA 4XWZA 2APGA 2FJBA 3K7MX 3ALJA 2XVIA 3SXIA 3LZWA 4Z2RA 1CC6A 4YWOA 1ZK7A 2R45A 4RSLA 1DJNA 3QSEA 2ARDA 5KMSA 3GYXA 2XCGA 1Y56B 2YM2A 1K0IA 1Q9IA 1YY5A 1FECA 3AYLA 2WP5A 1XPQA 3P9UA 1TDNA 4CCQA 5JCLA 2ACZA 1PJ6A 1OJTA 3GSIA 2NVKX 1TDOA 3AEFA 2GR3A 3AWIA 3QVRA 1LJ1A 2C7GA 3SYIA 3JSKA 1B4VA 1QLBA 2XVHA 1H7XA 1LTXR 4YSYA 2R0CA 2C3DA 4EMWA 1PN0A 2X8HA 4GUVA 3URHA 4DNAA 2WBAA 4A7AA 4GAPA 3V3OA 4CCRA 4AOSA 3S61A 2W0HA 5KMQA 2GR1A 1MXTA 3DK9A 4H4TA 4ICYA 2VVLA 4ZN0A 5KRQA 1GRTA 4BJYA 1LQUA 1H7WA 2BS3A 2NPXA 3CNTA 4DGKA 1W4XA 2R4EA 2C4CA 1F8WA 1X31B 2YR6A 2WP9A 3ISHA 2RGJA 1TRBA 5IQ4A 1GETA 1NG4A 1L9EA 4A99A 4PAAA 3AD7B 3LZXA 4K2XA 1F8RA 3NTDA 1PBBA 3AEDA 3KKJA 2B7RA 5HY5A 3O0HA 2XYOA 3CNPA 3ALLA 4NEWA 2JBVA 4U8OA 5J60A 1RSGA 1O95A 1OJCA 2BA9A 2C75A 2GH5A 3F8PA 4G9KA 4TM0A 2DKHA 4TM3A 4Y4NA 2YG5A 1DJQA 1RP0A 3ATQA 3NYEA 4USQA 4A65A 1KSSA 3CGEA 2GMHA 1EL8A 4J31A 2WOIA 3QSSA 4H4VA 1E6EA 3T2KA 1CC2A 1JRYA 4BK3A 4G73A 1GREA 2B9WA 2C3CA 2XFOA 3B3RA 4H4XA 4OCGA 3CPJG 3UOXA 2QAEA 2XLSA 5L46A 1ZOYA 3P4SA 4U8NA 4X4JA 4ZCDA 4ECHA 1ZMDA 1IUTA 5U25A 3HZLA 1PXBA 4G6HA 5JCKA 4YTNA 5BVAA 3AE3A 4A6NA 1VG0A 1PXAA 4LA1A 3BI5A 3UTGA 3UKLA 2C76A 1CBOA 2H88A 4I58A 4LIIA 3AE9A 3LADA 3ZDNA 5HHFA 2GQWA 5U1OA 4CNKA 4YTPA 3EPTA 1FCDA 3NN6X 4U8KA 4EM3A 3ITJA 5KMPA 2OLOA 3FMWA 1YQ3A 2BCPA 4YSXA 2WPCA 4A79A 2EQ6A 1PJ5A 1E1KA 2GQFA 1H6VA 2C73A 3H4KA 3NIXA 3BHKA 4H4QA 4OPCA 2RABA 2VRMA 1F3PA 3AE7A 3CTYA 3UCLA 2CFYA 4H4ZA 4GRTA 4NEVA 4IV9A 4DSGA 2Q6UA 3EANA 4Z25A 2XLPA 5GRTA 5BRTA 3VRAA 3QFAA 2B9YA 1CF3A 1GERA 3REDA 3UKQA 2XLRA 1DODA 2YR4A 4H2RA 1H82A 2X50A 4TLZA 2WS3A 4G6GA 3RNMA 1QO8A 2PHHA 4BV6A 2JB2A 1EL5A 1NG3A 2OAMA 3PS9A 1Y56A 3G5QA 4H4SA 3AD9B 4B65A 2B7SA 1D4CA 1FL2A 1N1PA 1Q1RA 4K7ZA 2VQBA 3QJ4A 3CGBA 3VRDB 4EIPA 5JCMA 1LPFA 4X9NA 5FS8A 1DOCA 3GD3A 2JKCA 2DKIA 1L9CA 2YM1A 3UTHA 4NTDA 1GV4A 1PBEA 2E4GA 4WX1A 4GCMA 1K4QA 1V59A 2I0ZA 3NYFA 1M64A 3L1RA 1DOEA 2GAHB 4U8LA 1RYIA 4AP3A 2FBWA 2WHDA 3D1CA 3GDPA 2PYXA 1FEBA 3HYWA 3IWAA 1XDIA 4AT0A 4X9MA 4IVOB 3UTFA 3FIMB 3IF9A 1GPEA 2YWLA 3GWDA 3BNUA 3GYIA 2X8GA 4J2WA 1YQZA 3M0OA 5JCNA 1PHHA 2VQ7A 3NYCA 3R9UA 2XDOA 2E5VA 5KOWA 2BRYA 4WCTA 4BURA 3FBSA 5ER0A 3P1WA 2FJEA 1H83A 2ZBWA 1CJ3A 2JAEA 1JEHA 1ELIA 1JRXA 2V60A 3QVPA 4C5OA 1TDEA 2ZZCA 1P2HA 3UOYA 1D7LA 1F8SA 4YKGA 2VVMA 2WOVA 1YKJA 1GTHA 1B5QA 1N4WA 1YQ4A 2BS2A 4U8PA 4K22A 1DOBA 3CIRA 1NENA 3H8LA 1LVLA 4YT0A 4H7UA 4USRA 2YVFA 1BWCA 3NNEA 2BC1A 1ZOVA 3RP6A 3G5RA 2GMJA 2WETA 4JY3A 4G74A 1O94A 4YTMA 1DXLA 2OALA 3CNJA 1NHRA 2WU2A 2XFPA 3VQRA 1QJDA 3NLCA 2YLRA 3T37A 3UP4A 3NN0X 3LJPA 3UKAA 2GB0A 2H89A 3SGLA 3NKSA 4CY8A 2R4JA 2WDRA 4O5QA 3ATRA 4ZCCA 1CL0A 4U8JA 2J3NA 3K7QX 2XVFA 2Z5YA 2QA2A 4YKFA 3AB1A 2WOWA 3II4A 4IA6A 2TPRA 3CPHG 4U8MA 2YLSA 1KNPA 3GWFA 2O9ZA 3EF6A 2QA1A 2Q0LA 4JDRA 2YVJA 4A9WA 1IJHA 1S3BA 4B66A 5IQ1A 1E1MA 3SQPA 1H84A 4JNAA 4P9SA 2X3NA 4FDCB 1KNRA 2C66A 1BGJA 3HYXA 4FK1A 3Q9TA 4UP3A 3UKKA 1H86A 5KMRA 2V61A 3KD9A 5FS9A 3KVEA 4REKA 4A5LA 1BGNA 3NRNA 3NT6A 4CRTA 1FEAA 3P4RA 1IUWA 5FMHA 1GRGA 2V3BA 2XVEA 3AE5A 4YSZA 4MJWA 2C70A 2A8XA 3ICTA 3QFBA 4RG4A 4GR1A 1ZX9A 2XLUA 4XWRA 1GTEA 3AYJA 2C65A 3M12A 2FJAA 1GRFA 3KLJA 1KFYA 3T2YA 1NHSA 4E0VA 3IHMA 4J33A 2YG6A 3AE4A 3V76A 3UOVA 4YSHA 2BK4A 5HXIA 3BHFA 1LV0A 1CC4A 5C3JA 1EL7A 1REOA 4U2SA 4GAVA 1NEKA 4EQXA 2E1MA 2F5ZA 2CDUA 4JN9A 3AXBA 3V3NA 1N4VA 1ZKQA 2YG4A 2VRLA 3CGDA 2X8CA 4U8IA 1GRBA 3OZ2A 3AEBA 4H2PA 2A87A 1PBFA 1PBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA7 A;  2GAG B;  1NAA A;  1NDA A;  2WPE A;  3DJE A;  1ZP0 A;  2R9Z A;  2YLZ A;  1IUX A;  4J56 A;  4BK1 A;  3FPZ A;  3UTE A;  1M6I A;  1D7Y A;  1D4D A;  2WP6 A;  5U63 A;  4HB9 A;  3VR8 A;  2AR8 A;  2JB1 A;  2OLN A;  3GDN A;  1GND A;  1MO9 A;  4TLX A;  1L9D A;  1IUV A;  2GVC A;  1D5T A;  4JY2 A;  3CPI G;  3ADA B;  1B37 A;  1TYP A;  4D03 A;  1TDF A;  3GMC A;  3LB8 A;  4OPI A;  4C74 A;  4DSH A;  3SM8 A;  2YLT A;  5KOX A;  2TMD A;  3SFD A;  4Y4L A;  2QCU A;  4Z44 A;  3E1T A;  4LU6 A;  3NH3 X;  3NGC X;  1K0L A;  1O5W A;  3EAO A;  4H50 A;  2YAU A;  4RG3 A;  4Z26 A;  2YG3 A;  2YG7 A;  2AQJ A;  3PO7 A;  1IUU A;  3AE6 A;  3K30 A;  3GRS A;  5FS7 A;  4OPU A;  2Z5X A;  4Z43 A;  4Z2T A;  3DGH A;  4AOX A;  5EOW A;  4D04 A;  4Z2U A;  4PAB A;  2RGO A;  1KDG A;  3CN8 A;  3AE2 A;  4CY6 A;  4Z24 A;  1PBC A;  1IUS A;  2WEU A;  2YVG A;  5CKU A;  4EMJ A;  4EQW A;  3G5S A;  2GF3 A;  3KPF A;  1E39 A;  3I3L A;  5IPY A;  1AOG A;  2XVJ A;  3AEC A;  1E1N A;  3DH9 A;  4O5U A;  4APN A;  2Y6R A;  2AAQ A;  3GD4 A;  1K0J A;  4OPL A;  1GRH A;  2RGH A;  3LXD A;  5LV9 A;  2BXS A;  2XLT A;  3GRT A;  4U2L A;  4KX6 A;  2BK5 A;  1VDC A;  2BK3 A;  2WPF A;  4K8D A;  4NTE A;  3AE8 A;  3C96 A;  4H4Y A;  4GDP A;  4N9X A;  3BI4 A;  2BAC A;  5GSN A;  4OPG A;  5TR3 A;  4TM4 A;  1GAL A;  1PS9 A;  1GT8 A;  2EQ8 A;  2C64 A;  4IVM B;  4U2T A;  5C2T A;  3NHO X;  4EMI A;  1TYT A;  4M52 A;  4IA5 A;  1OJA A;  2UZZ A;  2WDV A;  3SFE A;  4BJZ A;  4C3X A;  5M0Z A;  2HQM A;  1CHU A;  3RP7 A;  1E1L A;  2WDQ A;  3KU9 A;  2GR2 A;  3AEE A;  3UKH A;  1E7P A;  3F8R A;  3DJD A;  4Y4M A;  3ICS A;  3C4A A;  2V5Z A;  4KPR A;  1NPX A;  1XHC A;  2IVE A;  2WQY A;  5DBJ A;  4AT2 A;  3NK2 X;  1JU2 A;  2JB3 A;  3DJJ A;  3AD8 B;  3S5W A;  1VRQ B;  5KVI A;  3NK0 X;  1BF3 A;  2YLX A;  3GMB A;  3VR9 A;  3C4N A;  3VRB A;  4J36 A;  2GV8 A;  3DK8 A;  4OVI A;  2Y6Q A;  2BCG G;  4H4P A;  1CJ4 A;  2C67 A;  3DK4 A;  4B68 A;  4UDP A;  2BS4 A;  4XXG A;  1GES A;  4BK2 A;  1COY A;  1XAN A;  4NZH A;  4NTC A;  1KF6 A;  1ZY8 A;  3UKF A;  4CBQ A;  1Y0P A;  2B76 A;  2EQ9 A;  2XFN A;  4H4U A;  3CND A;  1CJC A;  5FS6 A;  3AEG A;  2CVJ A;  3ZYX A;  2XFU A;  2VVL G;  1KSU A;  4YXD A;  1S2Y A;  3LOV A;  3ICR A;  1OJD A;  3L8K A;  4JQ9 A;  2C72 A;  2IVD A;  3BNM A;  2R0G A;  4HA6 A;  2BXR A;  2BC0 A;  3M13 A;  4K5S A;  5CQF A;  3DA1 A;  3ABV A;  3NTA A;  2CUL A;  2R0P A;  4TM1 A;  1OJ9 A;  3IC9 A;  2B9X A;  3NK1 X;  1Z6L A;  3AE1 A;  3DME A;  3UP5 A;  4JNQ A;  2WU5 A;  3IHG A;  5KWF A;  1TDK A;  4FK1 C;  1HYU A;  1MOK A;  3F8D A;  2FJD A;  5BUK A;  3K7T A;  1JNZ A;  1VG9 A;  1EBD A;  1Q1W A;  5BUL A;  1ONF A;  1NHQ A;  2VOU A;  4UDR A;  4K5R A;  1GOS A;  5M10 A;  4B67 A;  2VZ2 A;  3H8I A;  5JCI A;  2OA1 A;  3B6D A;  3Q6J A;  3DGZ A;  1VQW A;  4B64 A;  3P4Q A;  2EQ7 A;  3WE0 A;  1GEU A;  1GRA A;  1P2E A;  2BAB A;  2XFQ A;  4OPT A;  4B1B A;  3RP8 A;  1CJ2 A;  4EQS A;  2R46 A;  2WES A;  3RHA A;  4EIQ A;  4EQR A;  3NG7 X;  4EM4 A;  2YLW A;  1JRZ A;  3AYI A;  1N4U A;  4CNJ A;  2ZZ0 A;  2YQU A;  2Q0K A;  4UDQ A;  1LQT A;  4AP1 A;  1BZL A;  4J34 A;  2BYB A;  4H2N A;  1PJ7 A;  1ZMC A;  4B69 A;  2JK6 A;  3FG2 P;  2A89 A;  3OC4 A;  4OPD A;  2V6O A;  1H81 A;  3BI2 A;  4ADW A;  4C77 A;  5EB4 A;  4A6N B;  1UKV G;  1GSN A;  2YR5 A;  3CGC A;  4I59 A;  4B63 A;  1S3E A;  2X99 A;  3CNS A;  1D4E A;  3DJG X;  5EB5 A;  1PDH A;  1ZDL A;  2Q7V A;  1JOA A;  1SEZ A;  4GDE A;  1B8S A;  3PVC A;  1JNR A;  1GXF A;  3P4P A;  2GR0 A;  3QSM A;  1S2Q A;  2V3A A;  3I6D A;  4H4R A;  2GRT A;  3UOZ A;  1NHP A;  5KVH A;  2ZZB A;  3ALM A;  1PXC A;  3COX A;  4GF7 A;  4H2Q A;  3UKP A;  5HYM A;  3GYJ A;  4J57 A;  1DNC A;  4C3Y A;  3AEA A;  4H4W A;  5J7X A;  1L0V A;  1EL9 A;  1F6M A;  3D8X A;  1BKW A;  1FOH A;  5KXJ A;  2GEW A;  2IID A;  4FX9 A;  5EBK A;  4XWZ A;  2APG A;  2FJB A;  3K7M X;  3ALJ A;  2XVI A;  3LZW A;  4Z2R A;  1CC6 A;  4YWO A;  1ZK7 A;  2R45 A;  4RSL A;  1DJN A;  3QSE A;  2ARD A;  2XCG A;  1Y56 B;  2YM2 A;  1K0I A;  1Q9I A;  1YY5 A;  1FEC A;  3AYL A;  2WP5 A;  1XPQ A;  3P9U A;  1TDN A;  4CCQ A;  5JCL A;  2ACZ A;  1PJ6 A;  1OJT A;  3GSI A;  2NVK X;  1TDO A;  3AEF A;  2GR3 A;  3AWI A;  3QVR A;  1LJ1 A;  2C7G A;  3JSK A;  1B4V A;  1QLB A;  2XVH A;  1H7X A;  1LTX R;  4YSY A;  2R0C A;  2C3D A;  4EMW A;  1PN0 A;  2X8H A;  4GUV A;  3URH A;  4DNA A;  2WBA A;  4A7A A;  3V3O A;  4CCR A;  4AOS A;  3S61 A;  2W0H A;  2GR1 A;  1MXT A;  3DK9 A;  4H4T A;  4ICY A;  2VVL A;  4ZN0 A;  5KRQ A;  1GRT A;  4BJY A;  1LQU A;  1H7W A;  2BS3 A;  2NPX A;  3CNT A;  4DGK A;  1W4X A;  2R4E A;  1F8W A;  1X31 B;  2YR6 A;  2WP9 A;  3ISH A;  2RGJ A;  1TRB A;  5IQ4 A;  1GET A;  1NG4 A;  1L9E A;  4A99 A;  4PAA A;  3AD7 B;  3LZX A;  4K2X A;  1F8R A;  3NTD A;  1PBB A;  3AED A;  3KKJ A;  2B7R A;  5HY5 A;  3O0H A;  2XYO A;  3CNP A;  3ALL A;  4NEW A;  2JBV A;  4U8O A;  5J60 A;  1RSG A;  1O95 A;  1OJC A;  2BA9 A;  2C75 A;  2GH5 A;  3F8P A;  4TM0 A;  2DKH A;  4TM3 A;  4Y4N A;  2YG5 A;  1DJQ A;  1RP0 A;  3ATQ A;  3NYE A;  4USQ A;  4A65 A;  1KSS A;  3CGE A;  2GMH A;  1EL8 A;  4J31 A;  2WOI A;  3QSS A;  4H4V A;  1E6E A;  4BK3 A;  1CC2 A;  1JRY A;  4OCG A;  1GRE A;  2B9W A;  2C3C A;  2XFO A;  3B3R A;  4H4X A;  3UOX A;  3CPJ G;  2QAE A;  2XLS A;  5L46 A;  1ZOY A;  3P4S A;  4U8N A;  4X4J A;  4ZCD A;  4ECH A;  1ZMD A;  1IUT A;  5U25 A;  3HZL A;  1PXB A;  5JCK A;  4YTN A;  5BVA A;  3AE3 A;  4A6N A;  1VG0 A;  1PXA A;  4LA1 A;  3BI5 A;  3UTG A;  3UKL A;  2C76 A;  1CBO A;  2H88 A;  4I58 A;  4LII A;  3AE9 A;  3LAD A;  3ZDN A;  5HHF A;  2GQW A;  5U1O A;  4CNK A;  4YTP A;  3EPT A;  1FCD A;  3NN6 X;  4U8K A;  4EM3 A;  3ITJ A;  2OLO A;  3FMW A;  1YQ3 A;  2BCP A;  4YSX A;  2WPC A;  4A79 A;  2EQ6 A;  1PJ5 A;  1E1K A;  2GQF A;  1H6V A;  2C73 A;  3H4K A;  3NIX A;  3BHK A;  4H4Q A;  4OPC A;  2RAB A;  2VRM A;  1F3P A;  3AE7 A;  3CTY A;  3UCL A;  2CFY A;  4H4Z A;  4GRT A;  4NEV A;  4IV9 A;  4DSG A;  2Q6U A;  3EAN A;  4Z25 A;  2XLP A;  5GRT A;  5BRT A;  3VRA A;  3QFA A;  2B9Y A;  1CF3 A;  1GER A;  3RED A;  3UKQ A;  2XLR A;  1DOD A;  2YR4 A;  4H2R A;  1H82 A;  2X50 A;  4TLZ A;  2WS3 A;  3RNM A;  1QO8 A;  2PHH A;  4BV6 A;  2JB2 A;  1EL5 A;  1NG3 A;  2OAM A;  3PS9 A;  1Y56 A;  3G5Q A;  4H4S A;  3AD9 B;  4B65 A;  2B7S A;  1D4C A;  1FL2 A;  1N1P A;  1Q1R A;  4K7Z A;  2VQB A;  3QJ4 A;  3CGB A;  3VRD B;  4EIP A;  5JCM A;  1LPF A;  4X9N A;  5FS8 A;  1DOC A;  3GD3 A;  2JKC A;  2DKI A;  1L9C A;  2YM1 A;  3UTH A;  4NTD A;  1GV4 A;  1PBE A;  2E4G A;  4WX1 A;  4GCM A;  1K4Q A;  1V59 A;  2I0Z A;  3NYF A;  1M64 A;  3L1R A;  1DOE A;  2GAH B;  4U8L A;  1RYI A;  4AP3 A;  2FBW A;  2WHD A;  3D1C A;  3GDP A;  2PYX A;  1FEB A;  3IWA A;  4AT0 A;  1XDI A;  4X9M A;  4IVO B;  3UTF A;  3FIM B;  3IF9 A;  1GPE A;  2YWL A;  3GWD A;  3BNU A;  3GYI A;  2X8G A;  4J2W A;  1YQZ A;  3M0O A;  5JCN A;  1PHH A;  2VQ7 A;  3NYC A;  3R9U A;  2XDO A;  2E5V A;  5KOW A;  4WCT A;  4BUR A;  3FBS A;  5ER0 A;  3P1W A;  2FJE A;  1H83 A;  2ZBW A;  1CJ3 A;  2JAE A;  1JEH A;  1ELI A;  1JRX A;  2V60 A;  3QVP A;  4C5O A;  1TDE A;  2ZZC A;  1P2H A;  3UOY A;  1D7L A;  1F8S A;  4YKG A;  2VVM A;  2WOV A;  1YKJ A;  1GTH A;  1B5Q A;  1N4W A;  1YQ4 A;  2BS2 A;  4U8P A;  4K22 A;  1DOB A;  3CIR A;  1NEN A;  3H8L A;  1LVL A;  4YT0 A;  4H7U A;  4USR A;  2YVF A;  1BWC A;  3NNE A;  2BC1 A;  1ZOV A;  3RP6 A;  3G5R A;  2GMJ A;  2WET A;  4JY3 A;  1O94 A;  4YTM A;  1DXL A;  2OAL A;  3CNJ A;  1NHR A;  2WU2 A;  2XFP A;  3VQR A;  1QJD A;  3NLC A;  2YLR A;  3T37 A;  3UP4 A;  3NN0 X;  3LJP A;  3UKA A;  2GB0 A;  2H89 A;  3SGL A;  3NKS A;  4CY8 A;  2R4J A;  2WDR A;  4O5Q A;  3ATR A;  4ZCC A;  1CL0 A;  4U8J A;  2J3N A;  3K7Q X;  2XVF A;  2Z5Y A;  2QA2 A;  4YKF A;  3AB1 A;  2WOW A;  3II4 A;  4IA6 A;  2TPR A;  3CPH G;  4U8M A;  2YLS A;  1KNP A;  3GWF A;  2O9Z A;  3EF6 A;  2QA1 A;  2Q0L A;  4JDR A;  2YVJ A;  4A9W A;  1IJH A;  1S3B A;  4B66 A;  5IQ1 A;  1E1M A;  3SQP A;  1H84 A;  4JNA A;  4P9S A;  2X3N A;  4FDC B;  1KNR A;  2C66 A;  1BGJ A;  4FK1 A;  3Q9T A;  4UP3 A;  3UKK A;  1H86 A;  2V61 A;  3KD9 A;  5FS9 A;  3KVE A;  4REK A;  4A5L A;  1BGN A;  3NRN A;  3NT6 A;  4CRT A;  1FEA A;  3P4R A;  1IUW A;  5FMH A;  1GRG A;  2V3B A;  2XVE A;  3AE5 A;  4YSZ A;  4MJW A;  2C70 A;  2A8X A;  3ICT A;  3QFB A;  4RG4 A;  4GR1 A;  1ZX9 A;  2XLU A;  4XWR A;  1GTE A;  3AYJ A;  2C65 A;  3M12 A;  2FJA A;  1GRF A;  3KLJ A;  1KFY A;  1NHS A;  4E0V A;  3IHM A;  4J33 A;  2YG6 A;  3AE4 A;  3V76 A;  3UOV A;  4YSH A;  2BK4 A;  5HXI A;  3BHF A;  1LV0 A;  1CC4 A;  5C3J A;  1EL7 A;  1REO A;  4U2S A;  1NEK A;  4EQX A;  2E1M A;  2F5Z A;  2CDU A;  4JN9 A;  3AXB A;  3V3N A;  1N4V A;  1ZKQ A;  2YG4 A;  2VRL A;  3CGD A;  2X8C A;  4U8I A;  1GRB A;  3OZ2 A;  3AEB A;  4H2P A;  2A87 A;  1PBF A;  1PBD A; 
#chains in the Genus database with same CATH topology
 3SZW A;  3KA7 A;  2GAG B;  1NAA A;  1NDA A;  2WPE A;  3DJE A;  1ZP0 A;  2R9Z A;  2YLZ A;  1IUX A;  4J56 A;  4BK1 A;  3FPZ A;  3UTE A;  1M6I A;  1D7Y A;  1D4D A;  2WP6 A;  5U63 A;  4HB9 A;  3VR8 A;  3T14 A;  2AR8 A;  2JB1 A;  2OLN A;  3GDN A;  1GND A;  1MO9 A;  4TLX A;  3KPK A;  1L9D A;  1IUV A;  2GVC A;  1D5T A;  4JY2 A;  3CPI G;  3ADA B;  1B37 A;  1TYP A;  4D03 A;  1TDF A;  3GMC A;  3LB8 A;  4OPI A;  4C74 A;  4DSH A;  3SM8 A;  2YLT A;  5KOX A;  2TMD A;  3SFD A;  4Y4L A;  2QCU A;  4Z44 A;  3E1T A;  4LU6 A;  3NH3 X;  3NGC X;  1K0L A;  1O5W A;  3EAO A;  4H50 A;  2YAU A;  4RG3 A;  4Z26 A;  2YG3 A;  2YG7 A;  2AQJ A;  3PO7 A;  1IUU A;  3AE6 A;  3K30 A;  3GRS A;  5FS7 A;  4OPU A;  2Z5X A;  4Z43 A;  4Z2T A;  3DGH A;  4AOX A;  5EOW A;  4II3 A;  4D04 A;  3CMM A;  4Z2U A;  4PAB A;  2RGO A;  1KDG A;  3CN8 A;  3AE2 A;  4CY6 A;  4Z24 A;  1PBC A;  1IUS A;  2WEU A;  2YVG A;  5CKU A;  3SX6 A;  4EMJ A;  4EQW A;  3G5S A;  2GF3 A;  3KPF A;  1E39 A;  3I3L A;  5IPY A;  1AOG A;  2XVJ A;  3AEC A;  1E1N A;  3DH9 A;  4O5U A;  4APN A;  2Y6R A;  2AAQ A;  3GD4 A;  1K0J A;  4OPL A;  1GRH A;  2RGH A;  3LXD A;  5LV9 A;  2BXS A;  2XLT A;  3GRT A;  4U2L A;  4KX6 A;  2BK5 A;  1VDC A;  2BK3 A;  2WPF A;  4K8D A;  4NTE A;  3AE8 A;  3C96 A;  4H4Y A;  4GDP A;  4N9X A;  3BI4 A;  2BAC A;  5GSN A;  3SZ0 A;  3T0K A;  4OPG A;  5TR3 A;  4TM4 A;  1GAL A;  1PS9 A;  1GT8 A;  2EQ8 A;  2C64 A;  4IVM B;  4U2T A;  5C2T A;  3NHO X;  4EMI A;  1TYT A;  4M52 A;  4IA5 A;  1OJA A;  2UZZ A;  2WDV A;  3SFE A;  4BJZ A;  3SZF A;  4C3X A;  5M0Z A;  2HQM A;  1CHU A;  3RP7 A;  1E1L A;  2WDQ A;  3KU9 A;  2GR2 A;  3AEE A;  3UKH A;  1E7P A;  3F8R A;  3DJD A;  4Y4M A;  3ICS A;  3C4A A;  2V5Z A;  4KPR A;  1NPX A;  1XHC A;  2IVE A;  2WQY A;  5DBJ A;  4AT2 A;  3NK2 X;  1JU2 A;  2JB3 A;  3DJJ A;  3AD8 B;  3S5W A;  1VRQ B;  5KVI A;  3NK0 X;  1BF3 A;  2YLX A;  3GMB A;  3VR9 A;  3C4N A;  3VRB A;  4J36 A;  2GV8 A;  3DK8 A;  4OVI A;  2Y6Q A;  2BCG G;  4H4P A;  1CJ4 A;  2C67 A;  3DK4 A;  4B68 A;  4UDP A;  2BS4 A;  4XXG A;  1GES A;  4BK2 A;  1COY A;  1XAN A;  4NZH A;  4NTC A;  1KF6 A;  1ZY8 A;  3UKF A;  4CBQ A;  1Y0P A;  2B76 A;  2EQ9 A;  2XFN A;  4H4U A;  3CND A;  1CJC A;  5FS6 A;  3AEG A;  2CVJ A;  3ZYX A;  2XFU A;  2VVL G;  1KSU A;  4YXD A;  1S2Y A;  3LOV A;  5KNL A;  3ICR A;  1OJD A;  3L8K A;  4JQ9 A;  2C72 A;  2IVD A;  3BNM A;  2R0G A;  4HA6 A;  2BXR A;  2BC0 A;  4NWZ A;  3M13 A;  4K5S A;  5CQF A;  3DA1 A;  3SZC A;  3ABV A;  3NTA A;  2CUL A;  2R0P A;  4TM1 A;  1OJ9 A;  3IC9 A;  2B9X A;  3NK1 X;  1Z6L A;  3AE1 A;  3DME A;  3UP5 A;  4JNQ A;  2WU5 A;  3IHG A;  5KWF A;  1TDK A;  4FK1 C;  1HYU A;  1MOK A;  3F8D A;  2FJD A;  5BUK A;  2BRA A;  3K7T A;  1JNZ A;  1VG9 A;  1EBD A;  1Q1W A;  5BUL A;  1ONF A;  1NHQ A;  2VOU A;  4UDR A;  3T31 A;  4K5R A;  1GOS A;  5M10 A;  4B67 A;  2VZ2 A;  3H8I A;  5JCI A;  2OA1 A;  3B6D A;  3Q6J A;  3DGZ A;  1VQW A;  4B64 A;  3P4Q A;  2EQ7 A;  3WE0 A;  1GEU A;  1GRA A;  1P2E A;  2BAB A;  2XFQ A;  4OPT A;  4B1B A;  3RP8 A;  1CJ2 A;  4EQS A;  2R46 A;  2WES A;  3RHA A;  4EIQ A;  3SY4 A;  3NG7 X;  4EM4 A;  4EQR A;  2YLW A;  1JRZ A;  3AYI A;  3T2Z A;  1N4U A;  4CNJ A;  2ZZ0 A;  2YQU A;  2Q0K A;  4UDQ A;  1LQT A;  4AP1 A;  1BZL A;  4J34 A;  2BYB A;  4H2N A;  1PJ7 A;  3HYV A;  1ZMC A;  4B69 A;  2JK6 A;  3FG2 P;  2A89 A;  3OC4 A;  4OPD A;  2V6O A;  1H81 A;  3BI2 A;  4ADW A;  4C77 A;  5EB4 A;  4A6N B;  1UKV G;  1GSN A;  2YR5 A;  3CGC A;  4I59 A;  4B63 A;  1S3E A;  2X99 A;  3CNS A;  1D4E A;  3DJG X;  5EB5 A;  4NNJ A;  1PDH A;  1ZDL A;  2Q7V A;  1JOA A;  1SEZ A;  4GDE A;  1B8S A;  3PVC A;  1JNR A;  1GXF A;  3P4P A;  2GR0 A;  3QSM A;  1S2Q A;  2V3A A;  3I6D A;  4H4R A;  4II2 A;  2GRT A;  3UOZ A;  1NHP A;  5KVH A;  2ZZB A;  3ALM A;  1PXC A;  3COX A;  4GF7 A;  4H2Q A;  3UKP A;  5HYM A;  3GYJ A;  4J57 A;  1DNC A;  4C3Y A;  3AEA A;  4H4W A;  5J7X A;  1L0V A;  1EL9 A;  1F6M A;  3D8X A;  1BKW A;  1FOH A;  5KXJ A;  2GEW A;  2IID A;  4FX9 A;  5EBK A;  4XWZ A;  2APG A;  2FJB A;  3K7M X;  3ALJ A;  2XVI A;  3SXI A;  3LZW A;  4Z2R A;  1CC6 A;  4YWO A;  1ZK7 A;  2R45 A;  4RSL A;  1DJN A;  3QSE A;  2ARD A;  5KMS A;  3GYX A;  2XCG A;  1Y56 B;  2YM2 A;  1K0I A;  1Q9I A;  1YY5 A;  1FEC A;  3AYL A;  2WP5 A;  1XPQ A;  3P9U A;  1TDN A;  4CCQ A;  5JCL A;  2ACZ A;  1PJ6 A;  1OJT A;  3GSI A;  2NVK X;  1TDO A;  3AEF A;  2GR3 A;  3AWI A;  3QVR A;  1LJ1 A;  2C7G A;  3SYI A;  3JSK A;  1B4V A;  1QLB A;  2XVH A;  1H7X A;  1LTX R;  4YSY A;  2R0C A;  2C3D A;  4EMW A;  1PN0 A;  2X8H A;  4GUV A;  3URH A;  4DNA A;  2WBA A;  4A7A A;  4GAP A;  3V3O A;  4CCR A;  4AOS A;  3S61 A;  2W0H A;  5KMQ A;  2GR1 A;  1MXT A;  3DK9 A;  4H4T A;  4ICY A;  2VVL A;  4ZN0 A;  5KRQ A;  1GRT A;  4BJY A;  1LQU A;  1H7W A;  2BS3 A;  2NPX A;  3CNT A;  4DGK A;  1W4X A;  2R4E A;  2C4C A;  1F8W A;  1X31 B;  2YR6 A;  2WP9 A;  3ISH A;  2RGJ A;  1TRB A;  5IQ4 A;  1GET A;  1NG4 A;  1L9E A;  4A99 A;  4PAA A;  3AD7 B;  3LZX A;  4K2X A;  1F8R A;  3NTD A;  1PBB A;  3AED A;  3KKJ A;  2B7R A;  5HY5 A;  3O0H A;  2XYO A;  3CNP A;  3ALL A;  4NEW A;  2JBV A;  4U8O A;  5J60 A;  1RSG A;  1O95 A;  1OJC A;  2BA9 A;  2C75 A;  2GH5 A;  3F8P A;  4G9K A;  4TM0 A;  2DKH A;  4TM3 A;  4Y4N A;  2YG5 A;  1DJQ A;  1RP0 A;  3ATQ A;  3NYE A;  4USQ A;  4A65 A;  1KSS A;  3CGE A;  2GMH A;  1EL8 A;  4J31 A;  2WOI A;  3QSS A;  4H4V A;  1E6E A;  3T2K A;  1CC2 A;  1JRY A;  4BK3 A;  4G73 A;  1GRE A;  2B9W A;  2C3C A;  2XFO A;  3B3R A;  4H4X A;  4OCG A;  3CPJ G;  3UOX A;  2QAE A;  2XLS A;  5L46 A;  1ZOY A;  3P4S A;  4U8N A;  4X4J A;  4ZCD A;  4ECH A;  1ZMD A;  1IUT A;  5U25 A;  3HZL A;  1PXB A;  4G6H A;  5JCK A;  4YTN A;  5BVA A;  3AE3 A;  4A6N A;  1VG0 A;  1PXA A;  4LA1 A;  3BI5 A;  3UTG A;  3UKL A;  2C76 A;  1CBO A;  2H88 A;  4I58 A;  4LII A;  3AE9 A;  3LAD A;  3ZDN A;  5HHF A;  2GQW A;  5U1O A;  4CNK A;  4YTP A;  3EPT A;  1FCD A;  3NN6 X;  4U8K A;  4EM3 A;  3ITJ A;  5KMP A;  2OLO A;  3FMW A;  1YQ3 A;  2BCP A;  4YSX A;  2WPC A;  4A79 A;  2EQ6 A;  1PJ5 A;  1E1K A;  2GQF A;  1H6V A;  2C73 A;  3H4K A;  3NIX A;  3BHK A;  4H4Q A;  4OPC A;  2RAB A;  2VRM A;  1F3P A;  3AE7 A;  3CTY A;  3UCL A;  2CFY A;  4H4Z A;  4GRT A;  4NEV A;  4IV9 A;  4DSG A;  2Q6U A;  3EAN A;  4Z25 A;  2XLP A;  5GRT A;  5BRT A;  3VRA A;  3QFA A;  2B9Y A;  1CF3 A;  1GER A;  3RED A;  3UKQ A;  2XLR A;  1DOD A;  2YR4 A;  4H2R A;  1H82 A;  2X50 A;  4TLZ A;  2WS3 A;  4G6G A;  3RNM A;  1QO8 A;  2PHH A;  4BV6 A;  2JB2 A;  1EL5 A;  1NG3 A;  2OAM A;  3PS9 A;  1Y56 A;  3G5Q A;  4H4S A;  3AD9 B;  4B65 A;  2B7S A;  1D4C A;  1FL2 A;  1N1P A;  1Q1R A;  4K7Z A;  2VQB A;  3QJ4 A;  3CGB A;  3VRD B;  4EIP A;  5JCM A;  1LPF A;  4X9N A;  5FS8 A;  1DOC A;  3GD3 A;  2JKC A;  2DKI A;  1L9C A;  2YM1 A;  3UTH A;  4NTD A;  1GV4 A;  1PBE A;  2E4G A;  4WX1 A;  4GCM A;  1K4Q A;  1V59 A;  2I0Z A;  3NYF A;  1M64 A;  3L1R A;  1DOE A;  2GAH B;  4U8L A;  1RYI A;  4AP3 A;  2FBW A;  2WHD A;  3D1C A;  3GDP A;  2PYX A;  1FEB A;  3HYW A;  3IWA A;  1XDI A;  4AT0 A;  4X9M A;  4IVO B;  3UTF A;  3FIM B;  3IF9 A;  1GPE A;  2YWL A;  3GWD A;  3BNU A;  3GYI A;  2X8G A;  4J2W A;  1YQZ A;  3M0O A;  5JCN A;  1PHH A;  2VQ7 A;  3NYC A;  3R9U A;  2XDO A;  2E5V A;  5KOW A;  2BRY A;  4WCT A;  4BUR A;  3FBS A;  5ER0 A;  3P1W A;  2FJE A;  1H83 A;  2ZBW A;  1CJ3 A;  2JAE A;  1JEH A;  1ELI A;  1JRX A;  2V60 A;  3QVP A;  4C5O A;  1TDE A;  2ZZC A;  1P2H A;  3UOY A;  1D7L A;  1F8S A;  4YKG A;  2VVM A;  2WOV A;  1YKJ A;  1GTH A;  1B5Q A;  1N4W A;  1YQ4 A;  2BS2 A;  4U8P A;  4K22 A;  1DOB A;  3CIR A;  1NEN A;  3H8L A;  1LVL A;  4YT0 A;  4H7U A;  4USR A;  2YVF A;  1BWC A;  3NNE A;  2BC1 A;  1ZOV A;  3RP6 A;  3G5R A;  2GMJ A;  2WET A;  4JY3 A;  4G74 A;  1O94 A;  4YTM A;  1DXL A;  2OAL A;  3CNJ A;  1NHR A;  2WU2 A;  2XFP A;  3VQR A;  1QJD A;  3NLC A;  2YLR A;  3T37 A;  3UP4 A;  3NN0 X;  3LJP A;  3UKA A;  2GB0 A;  2H89 A;  3SGL A;  3NKS A;  4CY8 A;  2R4J A;  2WDR A;  4O5Q A;  3ATR A;  4ZCC A;  1CL0 A;  4U8J A;  2J3N A;  3K7Q X;  2XVF A;  2Z5Y A;  2QA2 A;  4YKF A;  3AB1 A;  2WOW A;  3II4 A;  4IA6 A;  2TPR A;  3CPH G;  4U8M A;  2YLS A;  1KNP A;  3GWF A;  2O9Z A;  3EF6 A;  2QA1 A;  2Q0L A;  4JDR A;  2YVJ A;  4A9W A;  1IJH A;  1S3B A;  4B66 A;  5IQ1 A;  1E1M A;  3SQP A;  1H84 A;  4JNA A;  4P9S A;  2X3N A;  4FDC B;  1KNR A;  2C66 A;  1BGJ A;  3HYX A;  4FK1 A;  3Q9T A;  4UP3 A;  3UKK A;  1H86 A;  5KMR A;  2V61 A;  3KD9 A;  5FS9 A;  3KVE A;  4REK A;  4A5L A;  1BGN A;  3NRN A;  3NT6 A;  4CRT A;  1FEA A;  3P4R A;  1IUW A;  5FMH A;  1GRG A;  2V3B A;  2XVE A;  3AE5 A;  4YSZ A;  4MJW A;  2C70 A;  2A8X A;  3ICT A;  3QFB A;  4RG4 A;  4GR1 A;  1ZX9 A;  2XLU A;  4XWR A;  1GTE A;  3AYJ A;  2C65 A;  3M12 A;  2FJA A;  1GRF A;  3KLJ A;  1KFY A;  3T2Y A;  1NHS A;  4E0V A;  3IHM A;  4J33 A;  2YG6 A;  3AE4 A;  3V76 A;  3UOV A;  4YSH A;  2BK4 A;  5HXI A;  3BHF A;  1LV0 A;  1CC4 A;  5C3J A;  1EL7 A;  1REO A;  4U2S A;  4GAV A;  1NEK A;  4EQX A;  2E1M A;  2F5Z A;  2CDU A;  4JN9 A;  3AXB A;  3V3N A;  1N4V A;  1ZKQ A;  2YG4 A;  2VRL A;  3CGD A;  2X8C A;  4U8I A;  1GRB A;  3OZ2 A;  3AEB A;  4H2P A;  2A87 A;  1PBF A;  1PBD A; 
#chains in the Genus database with same CATH homology
 3SZW A;  3KA7 A;  2GAG B;  1NAA A;  1NDA A;  2WPE A;  3DJE A;  1ZP0 A;  2R9Z A;  2YLZ A;  1IUX A;  4J56 A;  4BK1 A;  3FPZ A;  3UTE A;  1M6I A;  1D7Y A;  1D4D A;  2WP6 A;  5U63 A;  4HB9 A;  3VR8 A;  3T14 A;  2AR8 A;  2JB1 A;  2OLN A;  3GDN A;  1GND A;  1MO9 A;  4TLX A;  3KPK A;  1L9D A;  1IUV A;  2GVC A;  1D5T A;  4JY2 A;  3CPI G;  3ADA B;  1B37 A;  1TYP A;  4D03 A;  1TDF A;  3GMC A;  3LB8 A;  4OPI A;  4C74 A;  4DSH A;  3SM8 A;  2YLT A;  5KOX A;  2TMD A;  3SFD A;  4Y4L A;  2QCU A;  4Z44 A;  3E1T A;  4LU6 A;  3NH3 X;  3NGC X;  1K0L A;  1O5W A;  3EAO A;  4H50 A;  2YAU A;  4RG3 A;  4Z26 A;  2YG3 A;  2YG7 A;  2AQJ A;  3PO7 A;  1IUU A;  3AE6 A;  3K30 A;  3GRS A;  5FS7 A;  4OPU A;  2Z5X A;  4Z43 A;  4Z2T A;  3DGH A;  4AOX A;  5EOW A;  4II3 A;  4D04 A;  3CMM A;  4Z2U A;  4PAB A;  2RGO A;  1KDG A;  3CN8 A;  3AE2 A;  4CY6 A;  4Z24 A;  1PBC A;  1IUS A;  2WEU A;  2YVG A;  5CKU A;  3SX6 A;  4EMJ A;  4EQW A;  3G5S A;  2GF3 A;  3KPF A;  1E39 A;  3I3L A;  5IPY A;  1AOG A;  2XVJ A;  3AEC A;  1E1N A;  3DH9 A;  4O5U A;  4APN A;  2Y6R A;  2AAQ A;  3GD4 A;  1K0J A;  4OPL A;  1GRH A;  2RGH A;  3LXD A;  5LV9 A;  2BXS A;  2XLT A;  3GRT A;  4U2L A;  4KX6 A;  2BK5 A;  1VDC A;  2BK3 A;  2WPF A;  4K8D A;  4NTE A;  3AE8 A;  3C96 A;  4H4Y A;  4GDP A;  4N9X A;  3BI4 A;  2BAC A;  5GSN A;  3SZ0 A;  3T0K A;  4OPG A;  5TR3 A;  4TM4 A;  1GAL A;  1PS9 A;  1GT8 A;  2EQ8 A;  2C64 A;  4IVM B;  4U2T A;  5C2T A;  3NHO X;  4EMI A;  1TYT A;  4M52 A;  4IA5 A;  1OJA A;  2UZZ A;  2WDV A;  3SFE A;  4BJZ A;  3SZF A;  4C3X A;  5M0Z A;  2HQM A;  1CHU A;  3RP7 A;  1E1L A;  2WDQ A;  3KU9 A;  2GR2 A;  3AEE A;  3UKH A;  1E7P A;  3F8R A;  3DJD A;  4Y4M A;  3ICS A;  3C4A A;  2V5Z A;  4KPR A;  1NPX A;  1XHC A;  2IVE A;  2WQY A;  5DBJ A;  4AT2 A;  3NK2 X;  1JU2 A;  2JB3 A;  3DJJ A;  3AD8 B;  3S5W A;  1VRQ B;  5KVI A;  3NK0 X;  1BF3 A;  2YLX A;  3GMB A;  3VR9 A;  3C4N A;  3VRB A;  4J36 A;  2GV8 A;  3DK8 A;  4OVI A;  2Y6Q A;  2BCG G;  4H4P A;  1CJ4 A;  2C67 A;  3DK4 A;  4B68 A;  4UDP A;  2BS4 A;  4XXG A;  1GES A;  4BK2 A;  1COY A;  1XAN A;  4NZH A;  4NTC A;  1KF6 A;  1ZY8 A;  3UKF A;  4CBQ A;  1Y0P A;  2B76 A;  2EQ9 A;  2XFN A;  4H4U A;  3CND A;  1CJC A;  5FS6 A;  3AEG A;  2CVJ A;  3ZYX A;  2XFU A;  2VVL G;  1KSU A;  4YXD A;  1S2Y A;  3LOV A;  5KNL A;  3ICR A;  1OJD A;  3L8K A;  4JQ9 A;  2C72 A;  2IVD A;  3BNM A;  2R0G A;  4HA6 A;  2BXR A;  2BC0 A;  4NWZ A;  3M13 A;  4K5S A;  5CQF A;  3DA1 A;  3SZC A;  3ABV A;  3NTA A;  2CUL A;  2R0P A;  4TM1 A;  1OJ9 A;  3IC9 A;  2B9X A;  3NK1 X;  1Z6L A;  3AE1 A;  3DME A;  3UP5 A;  4JNQ A;  2WU5 A;  3IHG A;  5KWF A;  1TDK A;  4FK1 C;  1HYU A;  1MOK A;  3F8D A;  2FJD A;  5BUK A;  2BRA A;  3K7T A;  1JNZ A;  1VG9 A;  1EBD A;  1Q1W A;  5BUL A;  1ONF A;  1NHQ A;  2VOU A;  4UDR A;  3T31 A;  4K5R A;  1GOS A;  5M10 A;  4B67 A;  2VZ2 A;  3H8I A;  5JCI A;  2OA1 A;  3B6D A;  3Q6J A;  3DGZ A;  1VQW A;  4B64 A;  3P4Q A;  2EQ7 A;  3WE0 A;  1GEU A;  1GRA A;  1P2E A;  2BAB A;  2XFQ A;  4OPT A;  4B1B A;  3RP8 A;  1CJ2 A;  4EQS A;  2R46 A;  2WES A;  3RHA A;  4EIQ A;  3SY4 A;  3NG7 X;  4EM4 A;  4EQR A;  2YLW A;  1JRZ A;  3AYI A;  3T2Z A;  1N4U A;  4CNJ A;  2ZZ0 A;  2YQU A;  2Q0K A;  4UDQ A;  1LQT A;  4AP1 A;  1BZL A;  4J34 A;  2BYB A;  4H2N A;  1PJ7 A;  3HYV A;  1ZMC A;  4B69 A;  2JK6 A;  3FG2 P;  2A89 A;  3OC4 A;  4OPD A;  2V6O A;  1H81 A;  3BI2 A;  4ADW A;  4C77 A;  5EB4 A;  4A6N B;  1UKV G;  1GSN A;  2YR5 A;  3CGC A;  4I59 A;  4B63 A;  1S3E A;  2X99 A;  3CNS A;  1D4E A;  3DJG X;  5EB5 A;  4NNJ A;  1PDH A;  1ZDL A;  2Q7V A;  1JOA A;  1SEZ A;  4GDE A;  1B8S A;  3PVC A;  1JNR A;  1GXF A;  3P4P A;  2GR0 A;  3QSM A;  1S2Q A;  2V3A A;  3I6D A;  4H4R A;  4II2 A;  2GRT A;  3UOZ A;  1NHP A;  5KVH A;  2ZZB A;  3ALM A;  1PXC A;  3COX A;  4GF7 A;  4H2Q A;  3UKP A;  5HYM A;  3GYJ A;  4J57 A;  1DNC A;  4C3Y A;  3AEA A;  4H4W A;  5J7X A;  1L0V A;  1EL9 A;  1F6M A;  3D8X A;  1BKW A;  1FOH A;  5KXJ A;  2GEW A;  2IID A;  4FX9 A;  5EBK A;  4XWZ A;  2APG A;  2FJB A;  3K7M X;  3ALJ A;  2XVI A;  3SXI A;  3LZW A;  4Z2R A;  1CC6 A;  4YWO A;  1ZK7 A;  2R45 A;  4RSL A;  1DJN A;  3QSE A;  2ARD A;  5KMS A;  3GYX A;  2XCG A;  1Y56 B;  2YM2 A;  1K0I A;  1Q9I A;  1YY5 A;  1FEC A;  3AYL A;  2WP5 A;  1XPQ A;  3P9U A;  1TDN A;  4CCQ A;  5JCL A;  2ACZ A;  1PJ6 A;  1OJT A;  3GSI A;  2NVK X;  1TDO A;  3AEF A;  2GR3 A;  3AWI A;  3QVR A;  1LJ1 A;  2C7G A;  3SYI A;  3JSK A;  1B4V A;  1QLB A;  2XVH A;  1H7X A;  1LTX R;  4YSY A;  2R0C A;  2C3D A;  4EMW A;  1PN0 A;  2X8H A;  4GUV A;  3URH A;  4DNA A;  2WBA A;  4A7A A;  4GAP A;  3V3O A;  4CCR A;  4AOS A;  3S61 A;  2W0H A;  5KMQ A;  2GR1 A;  1MXT A;  3DK9 A;  4H4T A;  4ICY A;  2VVL A;  4ZN0 A;  5KRQ A;  1GRT A;  4BJY A;  1LQU A;  1H7W A;  2BS3 A;  2NPX A;  3CNT A;  4DGK A;  1W4X A;  2R4E A;  2C4C A;  1F8W A;  1X31 B;  2YR6 A;  2WP9 A;  3ISH A;  2RGJ A;  1TRB A;  5IQ4 A;  1GET A;  1NG4 A;  1L9E A;  4A99 A;  4PAA A;  3AD7 B;  3LZX A;  4K2X A;  1F8R A;  3NTD A;  1PBB A;  3AED A;  3KKJ A;  2B7R A;  5HY5 A;  3O0H A;  2XYO A;  3CNP A;  3ALL A;  4NEW A;  2JBV A;  4U8O A;  5J60 A;  1RSG A;  1O95 A;  1OJC A;  2BA9 A;  2C75 A;  2GH5 A;  3F8P A;  4G9K A;  4TM0 A;  2DKH A;  4TM3 A;  4Y4N A;  2YG5 A;  1DJQ A;  1RP0 A;  3ATQ A;  3NYE A;  4USQ A;  4A65 A;  1KSS A;  3CGE A;  2GMH A;  1EL8 A;  4J31 A;  2WOI A;  3QSS A;  4H4V A;  1E6E A;  3T2K A;  1CC2 A;  1JRY A;  4BK3 A;  4G73 A;  1GRE A;  2B9W A;  2C3C A;  2XFO A;  3B3R A;  4H4X A;  4OCG A;  3CPJ G;  3UOX A;  2QAE A;  2XLS A;  5L46 A;  1ZOY A;  3P4S A;  4U8N A;  4X4J A;  4ZCD A;  4ECH A;  1ZMD A;  1IUT A;  5U25 A;  3HZL A;  1PXB A;  4G6H A;  5JCK A;  4YTN A;  5BVA A;  3AE3 A;  4A6N A;  1VG0 A;  1PXA A;  4LA1 A;  3BI5 A;  3UTG A;  3UKL A;  2C76 A;  1CBO A;  2H88 A;  4I58 A;  4LII A;  3AE9 A;  3LAD A;  3ZDN A;  5HHF A;  2GQW A;  5U1O A;  4CNK A;  4YTP A;  3EPT A;  1FCD A;  3NN6 X;  4U8K A;  4EM3 A;  3ITJ A;  5KMP A;  2OLO A;  3FMW A;  1YQ3 A;  2BCP A;  4YSX A;  2WPC A;  4A79 A;  2EQ6 A;  1PJ5 A;  1E1K A;  2GQF A;  1H6V A;  2C73 A;  3H4K A;  3NIX A;  3BHK A;  4H4Q A;  4OPC A;  2RAB A;  2VRM A;  1F3P A;  3AE7 A;  3CTY A;  3UCL A;  2CFY A;  4H4Z A;  4GRT A;  4NEV A;  4IV9 A;  4DSG A;  2Q6U A;  3EAN A;  4Z25 A;  2XLP A;  5GRT A;  5BRT A;  3VRA A;  3QFA A;  2B9Y A;  1CF3 A;  1GER A;  3RED A;  3UKQ A;  2XLR A;  1DOD A;  2YR4 A;  4H2R A;  1H82 A;  2X50 A;  4TLZ A;  2WS3 A;  4G6G A;  3RNM A;  1QO8 A;  2PHH A;  4BV6 A;  2JB2 A;  1EL5 A;  1NG3 A;  2OAM A;  3PS9 A;  1Y56 A;  3G5Q A;  4H4S A;  3AD9 B;  4B65 A;  2B7S A;  1D4C A;  1FL2 A;  1N1P A;  1Q1R A;  4K7Z A;  2VQB A;  3QJ4 A;  3CGB A;  3VRD B;  4EIP A;  5JCM A;  1LPF A;  4X9N A;  5FS8 A;  1DOC A;  3GD3 A;  2JKC A;  2DKI A;  1L9C A;  2YM1 A;  3UTH A;  4NTD A;  1GV4 A;  1PBE A;  2E4G A;  4WX1 A;  4GCM A;  1K4Q A;  1V59 A;  2I0Z A;  3NYF A;  1M64 A;  3L1R A;  1DOE A;  2GAH B;  4U8L A;  1RYI A;  4AP3 A;  2FBW A;  2WHD A;  3D1C A;  3GDP A;  2PYX A;  1FEB A;  3HYW A;  3IWA A;  1XDI A;  4AT0 A;  4X9M A;  4IVO B;  3UTF A;  3FIM B;  3IF9 A;  1GPE A;  2YWL A;  3GWD A;  3BNU A;  3GYI A;  2X8G A;  4J2W A;  1YQZ A;  3M0O A;  5JCN A;  1PHH A;  2VQ7 A;  3NYC A;  3R9U A;  2XDO A;  2E5V A;  5KOW A;  2BRY A;  4WCT A;  4BUR A;  3FBS A;  5ER0 A;  3P1W A;  2FJE A;  1H83 A;  2ZBW A;  1CJ3 A;  2JAE A;  1JEH A;  1ELI A;  1JRX A;  2V60 A;  3QVP A;  4C5O A;  1TDE A;  2ZZC A;  1P2H A;  3UOY A;  1D7L A;  1F8S A;  4YKG A;  2VVM A;  2WOV A;  1YKJ A;  1GTH A;  1B5Q A;  1N4W A;  1YQ4 A;  2BS2 A;  4U8P A;  4K22 A;  1DOB A;  3CIR A;  1NEN A;  3H8L A;  1LVL A;  4YT0 A;  4H7U A;  4USR A;  2YVF A;  1BWC A;  3NNE A;  2BC1 A;  1ZOV A;  3RP6 A;  3G5R A;  2GMJ A;  2WET A;  4JY3 A;  4G74 A;  1O94 A;  4YTM A;  1DXL A;  2OAL A;  3CNJ A;  1NHR A;  2WU2 A;  2XFP A;  3VQR A;  1QJD A;  3NLC A;  2YLR A;  3T37 A;  3UP4 A;  3NN0 X;  3LJP A;  3UKA A;  2GB0 A;  2H89 A;  3SGL A;  3NKS A;  4CY8 A;  2R4J A;  2WDR A;  4O5Q A;  3ATR A;  4ZCC A;  1CL0 A;  4U8J A;  2J3N A;  3K7Q X;  2XVF A;  2Z5Y A;  2QA2 A;  4YKF A;  3AB1 A;  2WOW A;  3II4 A;  4IA6 A;  2TPR A;  3CPH G;  4U8M A;  2YLS A;  1KNP A;  3GWF A;  2O9Z A;  3EF6 A;  2QA1 A;  2Q0L A;  4JDR A;  2YVJ A;  4A9W A;  1IJH A;  1S3B A;  4B66 A;  5IQ1 A;  1E1M A;  3SQP A;  1H84 A;  4JNA A;  4P9S A;  2X3N A;  4FDC B;  1KNR A;  2C66 A;  1BGJ A;  3HYX A;  4FK1 A;  3Q9T A;  4UP3 A;  3UKK A;  1H86 A;  5KMR A;  2V61 A;  3KD9 A;  5FS9 A;  3KVE A;  4REK A;  4A5L A;  1BGN A;  3NRN A;  3NT6 A;  4CRT A;  1FEA A;  3P4R A;  1IUW A;  5FMH A;  1GRG A;  2V3B A;  2XVE A;  3AE5 A;  4YSZ A;  4MJW A;  2C70 A;  2A8X A;  3ICT A;  3QFB A;  4RG4 A;  4GR1 A;  1ZX9 A;  2XLU A;  4XWR A;  1GTE A;  3AYJ A;  2C65 A;  3M12 A;  2FJA A;  1GRF A;  3KLJ A;  1KFY A;  3T2Y A;  1NHS A;  4E0V A;  3IHM A;  4J33 A;  2YG6 A;  3AE4 A;  3V76 A;  3UOV A;  4YSH A;  2BK4 A;  5HXI A;  3BHF A;  1LV0 A;  1CC4 A;  5C3J A;  1EL7 A;  1REO A;  4U2S A;  4GAV A;  1NEK A;  4EQX A;  2E1M A;  2F5Z A;  2CDU A;  4JN9 A;  3AXB A;  3V3N A;  1N4V A;  1ZKQ A;  2YG4 A;  2VRL A;  3CGD A;  2X8C A;  4U8I A;  1GRB A;  3OZ2 A;  3AEB A;  4H2P A;  2A87 A;  1PBF A;  1PBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...