3NN0X

Complex of 6-hydroxy-l-nicotine oxidase with nicotinamide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 138
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nn0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nn0X02
3D1CA 2WEUA 4K5SA 1GRBA 3KLJA 1TYPA 3PS9A 2Y6RA 1NHPA 5C3JA 1W4XA 4AP1A 1QLBA 3M13A 4Z2RA 1AOGA 2WS3A 1TRBA 5TR3A 4XXGA 2FBWA 3AEAA 1E1KA 1LJ1A 2BC1A 2OALA 1L9CA 1NHQA 1K0JA 1PJ5A 2GB0A 1JRYA 2WQYA 3BNMA 3DJEA 2ACZA 1K4QA 3ICTA 4PABA 3EF6A 4YTPA 3GDNA 2WDQA 2XFOA 2B9YA 4JDRA 2GVCA 3M12A 3P4QA 3QSSA 2GQWA 3NRNA 4A5LA 5EBKA 3SFDA 2WHDA 1YQ3A 3ALMA 2ARDA 1H81A 3KKJA 1EBDA 4B66A 2BS2A 1BF3A 2FJEA 2OA1A 1NENA 2R0GA 3IHMA 1CL0A 2JB1A 2ZZBA 4OPUA 4C3XA 1REOA 1PXAA 2TMDA 2WBAA 1IUUA 3LADA 3VRBA 1VRQB 4GF7A 1E1LA 3UTGA 1E6EA 2Q0KA 4NTDA 4C5OA 3CGCA 4Z26A 1GRTA 3GMCA 4OVIA 2GF3A 1D7YA 1YY5A 3WE0A 3GRSA 3GRTA 1Q1WA 2Z5XA 3CNJA 3UCLA 5GSNA 3Q9TA 3F8DA 4K5RA 3K7QX 2GAGB 3UKFA 2WU2A 2XFQA 3ISHA 1L0VA 1M6IA 3CN8A 1TDKA 2X8CA 3RHAA 4APNA 5BVAA 3VR9A 2AR8A 4B68A 5KWFA 5M10A 5FS6A 2BS3A 2X50A 3DJJA 3NH3X 2WDRA 1NHSA 4NZHA 2XVHA 2R9ZA 4CY8A 2XVJA 3UKAA 3I6DA 5HY5A 1FEAA 1X31B 2VVLA 1Q9IA 2CVJA 2X8GA 3DJGX 1VDCA 3QVRA 4H2NA 4H4TA 5IPYA 2OLNA 3D8XA 2XVEA 2XFUA 2BCPA 2WESA 2QCUA 3IHGA 2O9ZA 2XLSA 4H2QA 3NK0X 4K8DA 3URHA 4B64A 4H4VA 2C65A 1TDOA 3KU9A 4H4UA 1FOHA 3FG2P 2FJDA 3B6DA 2WP6A 3CTYA 4USQA 4U8MA 4YKGA 4RG4A 4J31A 4U2SA 4YKFA 1D4CA 2EQ6A 2W0HA 1E1NA 4H4RA 4Z2UA 4EIQA 3SQPA 4AOSA 3UOZA 1GALA 4C77A 2GEWA 1PS9A 5GRTA 4OCGA 4JQ9A 2OAMA 3L8KA 5L46A 1GNDA 1NG4A 4EMWA 1BKWA 2WOIA 4HB9A 4YWOA 4DNAA 4CNKA 4EMJA 2WETA 1K0IA 2BYBA 1DOEA 2X3NA 3LXDA 2BK4A 5M0ZA 2APGA 2V60A 3RP6A 3SGLA 2XLPA 1F8RA 1TDEA 1OJCA 3DH9A 4CRTA 3CGDA 4CNJA 2JKCA 1YQ4A 4OPDA 4B65A 3ICRA 1PXBA 3DK8A 3DGZA 1VG0A 3NYEA 3UTFA 3AE9A 4BV6A 2J3NA 4M52A 4E0VA 3NLCA 2NPXA 2WP9A 2YVGA 3AE8A 4A9WA 1SEZA 2BCGG 1ZMDA 4JNQA 4U2TA 4UDQA 3QVPA 4BK2A 1EL7A 3DA1A 2IVDA 4DSGA 2V5ZA 1B5QA 2AQJA 2GR1A 5J7XA 3UOYA 4YSZA 2JK6A 2JB3A 5EB4A 2C73A 2CFYA 3KVEA 4J33A 4H4YA 1OJTA 4D04A 4J2WA 2GR3A 1GSNA 3EAOA 4RSLA 1N4UA 1FCDA 3AYIA 2GRTA 3AE7A 4EQWA 1NDAA 3CPIG 2V3AA 1KSSA 4GR1A 1Y0PA 4A65A 1ELIA 3RP7A 4J57A 5EB5A 4UDRA 1Y56A 3K7TA 2BACA 4BJYA 5JCMA 5BRTA 3AE3A 4J56A 1OJAA 4TLXA 3ZDNA 1F8WA 4WCTA 5CQFA 1H84A 4USRA 4EQXA 2BXSA 3ATRA 1GV4A 3B3RA 1CJ3A 1NHRA 3V3NA 4Y4MA 1XPQA 3ALLA 2Q0LA 3GSIA 3V76A 4DGKA 2YLRA 4H4QA 4RG3A 1P2HA 3RP8A 3GMBA 3NK2X 4A7AA 1GXFA 3R9UA 3CNSA 2YG3A 4NTCA 1OJ9A 3CNPA 2VVLG 1PJ7A 2ZZ0A 1JRZA 2TPRA 3QSMA 4IA6A 3NKSA 3UKQA 4EM3A 1PBFA 2VOUA 1LQTA 4OPLA 2R0CA 4YTNA 2JBVA 1GTEA 4CCRA 2VZ2A 3VQRA 2C3DA 1MOKA 2Y6QA 3BHFA 1MXTA 2GMHA 3FBSA 2YQUA 4U8PA 3PO7A 3DGHA 4YSXA 3AECA 3OC4A 3AYLA 4K22A 3P4PA 4K2XA 4LIIA 2R45A 1H83A 3CIRA 5U63A 3P4RA 4YT0A 2WPEA 4N9XA 1UKVG 2F5ZA 3QFAA 1K0LA 2WP5A 4X9NA 3SFEA 3LJPA 4YTMA 2IVEA 2BABA 1CJ2A 4U8NA 3S5WA 1KDGA 4X9MA 1DJNA 1PBEA 4BURA 1ZK7A 2B9XA 2GH5A 1JNZA 1EL9A 2B7SA 4YSYA 2XYOA 4B69A 1H82A 1N4WA 3BI4A 1GRAA 2XLTA 3ATQA 3NGCX 4HA6A 3ADAB 4DSHA 4A99A 1OJDA 4ECHA 1D5TA 4FX9A 1GT8A 1GETA 2XCGA 1F6MA 3BI2A 3QJ4A 5IQ1A 3S61A 3SM8A 1QJDA 3AE6A 1FECA 1HYUA 1EL8A 1L9EA 2C64A 1GRHA 1DOBA 2C76A 1LQUA 3HZLA 4H2PA 2EQ7A 3AE2A 4AP3A 4TM1A 5BUKA 4OPIA 5HYMA 3REDA 4Z44A 1O95A 1PXCA 3UKLA 4Z25A 2WDVA 3G5QA 2R46A 1DOCA 3UOXA 1O94A 3UP5A 1D4EA 5KOWA 2XFNA 4J36A 4U2LA 2Q6UA 1CHUA 1XDIA 2RGOA 3AEEA 3AXBA 2R4JA 4EQRA 2PHHA 3O0HA 1BWCA 2YR4A 5KVIA 3CGBA 1O5WA 3AEFA 2V6OA 2VQ7A 2WPFA 1ZDLA 2GR2A 2C72A 2WOVA 3CGEA 2HQMA 2CULA 1DXLA 2E4GA 4C74A 1JU2A 1PBBA 2VQBA 3AD7B 1ZY8A 3UTHA 2GMJA 4U8JA 1GEUA 3RNMA 3P1WA 4P9SA 3AEGA 1H6VA 4U8LA 2C70A 4C3YA 3NHOX 3GYJA 4AOXA 2XLUA 1CC2A 3H4KA 4AT2A 2V3BA 1LPFA 3I3LA 2FJAA 2H89A 3KPFA 3QFBA 3NN0X 3AD8B 3M0OA 1S3EA 2WPCA 2ZZCA 1NPXA 4BJZA 2VRLA 4JY3A 2DKHA 3UKKA 2YVJA 3BI5A 2RGHA 1NAAA 1CJ4A 2B76A 2X99A 3P9UA 4GRTA 3VRAA 3ZYXA 3LZWA 2R0PA 2RABA 2VRMA 4JNAA 4NTEA 1TYTA 2YM2A 1LV0A 2B9WA 2Q7VA 4EMIA 1JNRA 3NIXA 2C67A 3F8RA 2YM1A 4ZCDA 3AYJA 4D03A 4OPCA 1CBOA 3DMEA 3IWAA 2Z5YA 4H2RA 1IJHA 3GDPA 1GTHA 5HXIA 1ZP0A 1M64A 1BGJA 1QO8A 2BC0A 1BGNA 3P4SA 1S2QA 2BS4A 3NN6X 4GDPA 1KNRA 2A8XA 1GRGA 4OPTA 4B1BA 3E1TA 1LVLA 4LA1A 1N4VA 2C3CA 4OPGA 4UDPA 3LOVA 2GV8A 2YLTA 2XDOA 3VR8A 3QSEA 4GUVA 4GDEA 4JN9A 3NTDA 2YG5A 3NK1X 3K30A 3G5RA 5HHFA 1F3PA 3ABVA 4X4JA 5JCIA 1CF3A 5JCKA 1ONFA 3CNTA 3CPHG 1RP0A 4O5QA 2BK3A 4FK1A 3DK4A 4U8KA 4YSHA 4MJWA 1H7WA 5LV9A 3KD9A 2JB2A 1XANA 1GPEA 1VQWA 2QA1A 3GWFA 1PHHA 2PYXA 1RYIA 3T37A 2VVMA 2YLZA 4ZN0A 1N1PA 3DJDA 4BK3A 1TDNA 1F8SA 4CY6A 1Q1RA 2V61A 2YLSA 2BA9A 1PBDA 2XVIA 3UKPA 4IVMB 4REKA 5U25A 4Y4LA 1B37A 3OZ2A 3PVCA 1NG3A 3FIMB 4YXDA 2BXRA 3AE4A 1E7PA 1PDHA 3AD9B 3UKHA 2C7GA 5FS9A 1YQZA 3NYFA 1GERA 3C96A 4A79A 2JAEA 3LB8A 5IQ4A 1JRXA 2YLXA 4XWZA 3NT6A 3JSKA 2EQ8A 5JCLA 3VRDB 2RGJA 1YKJA 2A87A 1FEBA 3C4AA 3L1RA 3V3OA 4GCMA 4XWRA 4CCQA 1IUTA 1Z6LA 1KF6A 4KPRA 2B7RA 2H88A 1H86A 4H4XA 4O5UA 5EOWA 4EIPA 4B63A 3COXA 4H4PA 4I59A 4IA5A 5CKUA 3UTEA 1CC6A 1ZKQA 3LZXA 1V59A 1KFYA 2OLOA 2I0ZA 1H7XA 4B67A 1IUVA 4I58A 1S2YA 1D7LA 3EPTA 4EQSA 1MO9A 4TM3A 3NG7X 1RSGA 1FL2A 5U1OA 2R4EA 1PJ6A 1GRFA 4K7ZA 2NVKX 2GR0A 3AE5A 3FPZA 4BK1A 1B4VA 5DBJA 3FMWA 2XFPA 1DNCA 2GAHB 5C2TA 2X8HA 2YG6A 1XHCA 2ZBWA 3F8PA 3GD3A 1S3BA 1TDFA 1IUSA 1ZMCA 4TM4A 3H8LA 4CBQA 5FMHA 4ADWA 3ICSA 4Z24A 3NNEA 4H4WA 2YR6A 2YG7A 4JY2A 2WU5A 4WX1A 1JEHA 4Z43A 3Q6JA 2XLRA 2C66A 1IUWA 2GQFA 2QAEA 3BHKA 1KNPA 5J60A 1PN0A 1E1MA 3GYIA 1ZOVA 1D4DA 5KVHA 4LU6A 1IUXA 4A6NA 2YG4A 3GWDA 3IF9A 3NTAA 3AWIA 3DK9A 1B8SA 4FK1C 4IV9A 2WOWA 1VG9A 2DKIA 1NEKA 2YVFA 1ZX9A 5FS8A 4U8OA 1GOSA 4TLZA 3IC9A 4KX6A 2YWLA 1CJCA 1COYA 1KSUA 2UZZA 1DODA 4EM4A 5BULA 4H50A 4A6NB 4H7UA 1JOAA 1Y56B 3AEDA 5KOXA 2A89A 4IVOB 4NEVA 3CPJG 1GESA 4ZCCA 3G5SA 3H8IA 1PBCA 2IIDA 2YLWA 5FS7A 1EL5A 2QA2A 3GD4A 3AB1A 3KA7A 3ALJA 2AAQA 3AEBA 1P2EA 2C75A 1GREA 1LTXR 3II4A 3ITJA 4NEWA 4PAAA 2YAUA 4ICYA 3C4NA 4Y4NA 1CC4A 2XVFA 3EANA 4FDCB 4H4ZA 1ZOYA 2CDUA 2YR5A 3NYCA 4Z2TA 5JCNA 4J34A 3UP4A 5ER0A 3AE1A 4AT0A 3BNUA 3CNDA 2E5VA 4U8IA 5KRQA 2E1MA 1DJQA 1L9DA 2BK5A 3K7MX 3UOVA 4H4SA 5KXJA 4TM0A 4UP3A 1E39A 1BZLA 2EQ9A 2FJBA
chains in the Genus database with same CATH superfamily
3D1CA 2WEUA 4K5SA 1GRBA 3KLJA 1TYPA 3PS9A 2Y6RA 1NHPA 3T14A 5C3JA 1W4XA 4AP1A 1QLBA 3M13A 5KMQA 4Z2RA 1AOGA 2WS3A 1TRBA 5TR3A 4XXGA 2FBWA 3AEAA 1E1KA 1LJ1A 2BC1A 2OALA 1L9CA 1NHQA 1K0JA 1PJ5A 2GB0A 1JRYA 2WQYA 3BNMA 3DJEA 2ACZA 1K4QA 3ICTA 4PABA 3EF6A 4YTPA 3GDNA 2WDQA 2XFOA 2B9YA 4JDRA 2GVCA 3M12A 3P4QA 3QSSA 2GQWA 3NRNA 4A5LA 5EBKA 3SFDA 2WHDA 1YQ3A 3ALMA 2ARDA 1H81A 3KKJA 1EBDA 4B66A 2BS2A 1BF3A 2FJEA 2OA1A 1NENA 2R0GA 3IHMA 1CL0A 2JB1A 2ZZBA 4II3A 4OPUA 4C3XA 1REOA 1PXAA 2TMDA 2WBAA 1IUUA 3LADA 3VRBA 1VRQB 4GF7A 1E1LA 3UTGA 1E6EA 2Q0KA 4NTDA 4C5OA 3CGCA 4Z26A 1GRTA 3GMCA 4OVIA 2GF3A 1D7YA 1YY5A 3WE0A 3GRSA 3GRTA 1Q1WA 2Z5XA 3CNJA 3UCLA 4GAVA 5GSNA 3Q9TA 3F8DA 4K5RA 3K7QX 2GAGB 3UKFA 2WU2A 2XFQA 3ISHA 1L0VA 1M6IA 3CN8A 1TDKA 2X8CA 3RHAA 4APNA 5BVAA 3VR9A 2AR8A 4B68A 5KWFA 5M10A 5FS6A 2BS3A 2X50A 3DJJA 3NH3X 2WDRA 1NHSA 4NZHA 2XVHA 2R9ZA 4CY8A 2XVJA 3UKAA 3I6DA 5HY5A 1FEAA 1X31B 2VVLA 1Q9IA 2CVJA 2X8GA 3DJGX 1VDCA 3QVRA 4H2NA 4H4TA 4NWZA 2OLNA 3D8XA 2XVEA 2XFUA 2BRAA 2BCPA 2WESA 2QCUA 3IHGA 3T2KA 2O9ZA 2XLSA 4H2QA 3NK0X 4K8DA 3URHA 4II2A 4B64A 5IPYA 4H4VA 2C65A 1TDOA 3KU9A 4H4UA 1FOHA 3FG2P 2FJDA 3B6DA 2WP6A 3CTYA 3CMMA 4USQA 4U8MA 4YKGA 4RG4A 4J31A 4U2SA 4YKFA 1D4CA 2EQ6A 2W0HA 4NNJA 1E1NA 4H4RA 4Z2UA 2BRYA 4EIQA 3SQPA 4AOSA 3UOZA 1GALA 4C77A 2GEWA 1PS9A 5GRTA 4OCGA 4JQ9A 2OAMA 3L8KA 5L46A 1GNDA 1NG4A 4EMWA 4G9KA 1BKWA 2WOIA 4HB9A 3GYXA 4YWOA 4DNAA 4CNKA 4EMJA 2WETA 1K0IA 4G73A 2BYBA 1DOEA 2X3NA 3LXDA 2BK4A 5M0ZA 2APGA 2V60A 3RP6A 3SGLA 2XLPA 1F8RA 1TDEA 1OJCA 3DH9A 4CRTA 3CGDA 4CNJA 2JKCA 1YQ4A 4OPDA 4B65A 3ICRA 1PXBA 3DK8A 3DGZA 1VG0A 3NYEA 3UTFA 3AE9A 4BV6A 2J3NA 4M52A 4E0VA 3NLCA 2NPXA 2WP9A 2YVGA 3AE8A 4A9WA 1SEZA 2BCGG 1ZMDA 4JNQA 4U2TA 4UDQA 3QVPA 4BK2A 1EL7A 3DA1A 2IVDA 4DSGA 2V5ZA 1B5QA 2AQJA 2GR1A 5J7XA 3UOYA 4YSZA 2JK6A 2JB3A 5EB4A 2C73A 2CFYA 3KVEA 4J33A 4H4YA 1OJTA 4D04A 3SZFA 4J2WA 2GR3A 1GSNA 3EAOA 4RSLA 1N4UA 1FCDA 3AYIA 2GRTA 3AE7A 4EQWA 1NDAA 3CPIG 4G74A 2V3AA 1KSSA 4GR1A 1Y0PA 4A65A 1ELIA 3RP7A 4J57A 5EB5A 4UDRA 1Y56A 3K7TA 2BACA 4BJYA 5JCMA 5BRTA 3AE3A 4J56A 1OJAA 4TLXA 3ZDNA 1F8WA 4WCTA 5CQFA 1H84A 4USRA 4EQXA 2BXSA 3ATRA 1GV4A 3B3RA 1CJ3A 1NHRA 3V3NA 4Y4MA 1XPQA 3ALLA 2Q0LA 3GSIA 3V76A 4DGKA 2YLRA 4H4QA 4RG3A 1P2HA 3RP8A 3GMBA 3NK2X 4A7AA 1GXFA 3R9UA 3CNSA 2YG3A 4NTCA 1OJ9A 3CNPA 2VVLG 1PJ7A 2ZZ0A 1JRZA 2TPRA 3QSMA 4IA6A 3NKSA 3UKQA 4EM3A 1PBFA 2VOUA 1LQTA 4OPLA 2R0CA 4YTNA 2JBVA 1GTEA 4CCRA 2VZ2A 3VQRA 2C3DA 1MOKA 2Y6QA 3BHFA 1MXTA 2GMHA 3FBSA 2YQUA 4U8PA 3PO7A 3DGHA 4YSXA 3AECA 3OC4A 3AYLA 4K22A 3P4PA 3SXIA 4K2XA 4LIIA 2R45A 1H83A 3T2ZA 3CIRA 5U63A 3P4RA 4YT0A 2WPEA 4N9XA 1UKVG 2F5ZA 3QFAA 1K0LA 2WP5A 4X9NA 3SFEA 3LJPA 4YTMA 2IVEA 2BABA 1CJ2A 4U8NA 3S5WA 1KDGA 4X9MA 1DJNA 1PBEA 4G6HA 4BURA 1ZK7A 2B9XA 2GH5A 1JNZA 1EL9A 2B7SA 4YSYA 2XYOA 4B69A 1H82A 1N4WA 3BI4A 1GRAA 2XLTA 3ATQA 3NGCX 4HA6A 3ADAB 4DSHA 4A99A 1OJDA 4ECHA 1D5TA 4FX9A 1GT8A 1GETA 2XCGA 1F6MA 3BI2A 3QJ4A 5IQ1A 3S61A 3SM8A 1QJDA 3AE6A 1FECA 1HYUA 1EL8A 1L9EA 2C64A 1GRHA 1DOBA 2C76A 1LQUA 3HZLA 4H2PA 2EQ7A 3AE2A 4AP3A 5KMSA 4TM1A 5BUKA 3SZWA 4OPIA 5HYMA 3REDA 4Z44A 1O95A 1PXCA 3UKLA 4Z25A 2WDVA 3G5QA 2R46A 1DOCA 3UOXA 1O94A 3UP5A 1D4EA 5KOWA 2XFNA 4J36A 4U2LA 2Q6UA 1CHUA 1XDIA 2RGOA 3AEEA 3AXBA 3SX6A 2R4JA 4EQRA 2PHHA 3O0HA 1BWCA 2YR4A 5KVIA 3CGBA 3HYVA 1O5WA 3AEFA 2V6OA 2VQ7A 2WPFA 1ZDLA 2GR2A 2C72A 2WOVA 3CGEA 2HQMA 2CULA 1DXLA 2E4GA 4C74A 1JU2A 1PBBA 2VQBA 3AD7B 1ZY8A 3UTHA 2GMJA 4U8JA 1GEUA 3RNMA 3P1WA 4P9SA 3AEGA 1H6VA 4U8LA 2C70A 4C3YA 3NHOX 3GYJA 4AOXA 2XLUA 1CC2A 3H4KA 4AT2A 2V3BA 1LPFA 3I3LA 2FJAA 2H89A 3HYXA 3KPFA 3NN0X 3QFBA 3AD8B 3M0OA 1S3EA 2WPCA 2ZZCA 1NPXA 4BJZA 2VRLA 4JY3A 2DKHA 3UKKA 2YVJA 3BI5A 2RGHA 1NAAA 1CJ4A 2B76A 2X99A 3P9UA 4GRTA 3VRAA 3ZYXA 2C4CA 3LZWA 2R0PA 2RABA 2VRMA 4JNAA 4NTEA 1TYTA 2YM2A 1LV0A 2B9WA 2Q7VA 4EMIA 1JNRA 3NIXA 2C67A 3F8RA 2YM1A 4ZCDA 3AYJA 4D03A 4OPCA 1CBOA 3DMEA 3IWAA 2Z5YA 4H2RA 1IJHA 3GDPA 1GTHA 5HXIA 1ZP0A 1M64A 1BGJA 1QO8A 2BC0A 1BGNA 3P4SA 1S2QA 2BS4A 3NN6X 4GDPA 1KNRA 2A8XA 1GRGA 4OPTA 4B1BA 4G6GA 3E1TA 1LVLA 4LA1A 1N4VA 2C3CA 4OPGA 4UDPA 3LOVA 2GV8A 2YLTA 2XDOA 3VR8A 3QSEA 4GUVA 4GDEA 4JN9A 3T2YA 3NTDA 2YG5A 3NK1X 3K30A 3T31A 3G5RA 5HHFA 1F3PA 3ABVA 4X4JA 5JCIA 1CF3A 5JCKA 1ONFA 3CNTA 3CPHG 1RP0A 4O5QA 2BK3A 4FK1A 3DK4A 4U8KA 4YSHA 5KMRA 4MJWA 1H7WA 3T0KA 5LV9A 3KD9A 2JB2A 1XANA 1GPEA 1VQWA 2QA1A 3GWFA 1PHHA 2PYXA 1RYIA 3T37A 2VVMA 2YLZA 4ZN0A 1N1PA 3DJDA 4BK3A 1TDNA 1F8SA 4CY6A 1Q1RA 2V61A 2YLSA 2BA9A 1PBDA 2XVIA 3UKPA 4IVMB 4REKA 5U25A 4Y4LA 1B37A 3OZ2A 3PVCA 1NG3A 3FIMB 4YXDA 2BXRA 3AE4A 1E7PA 1PDHA 3AD9B 3UKHA 2C7GA 5FS9A 1YQZA 3NYFA 1GERA 3C96A 4A79A 2JAEA 5KMPA 3LB8A 5IQ4A 1JRXA 2YLXA 5KNLA 4XWZA 3NT6A 3JSKA 2EQ8A 5JCLA 3VRDB 2RGJA 1YKJA 2A87A 3SY4A 1FEBA 3C4AA 3L1RA 3V3OA 4GCMA 4XWRA 4CCQA 1IUTA 1Z6LA 1KF6A 4KPRA 2B7RA 2H88A 1H86A 4H4XA 4O5UA 5EOWA 3SZ0A 4B63A 3COXA 4EIPA 4H4PA 4I59A 4IA5A 5CKUA 3UTEA 3HYWA 1CC6A 1ZKQA 3LZXA 1V59A 1KFYA 2OLOA 2I0ZA 1H7XA 3SYIA 4B67A 1IUVA 4I58A 1S2YA 1D7LA 3EPTA 4EQSA 1MO9A 4TM3A 3NG7X 1RSGA 1FL2A 5U1OA 2R4EA 1PJ6A 1GRFA 4K7ZA 2NVKX 2GR0A 3AE5A 3FPZA 4BK1A 1B4VA 5DBJA 3FMWA 2XFPA 1DNCA 2GAHB 5C2TA 2X8HA 2YG6A 1XHCA 2ZBWA 3F8PA 3GD3A 1S3BA 1TDFA 1IUSA 1ZMCA 4TM4A 3H8LA 4CBQA 5FMHA 4ADWA 4GAPA 3ICSA 4Z24A 3NNEA 4H4WA 2YR6A 2YG7A 4JY2A 2WU5A 4WX1A 1JEHA 4Z43A 3Q6JA 2XLRA 2C66A 1IUWA 2GQFA 2QAEA 3BHKA 1KNPA 5J60A 1PN0A 1E1MA 3GYIA 1ZOVA 1D4DA 5KVHA 4LU6A 1IUXA 4A6NA 2YG4A 3GWDA 3IF9A 3NTAA 3AWIA 3DK9A 1B8SA 4FK1C 4IV9A 2WOWA 1VG9A 2DKIA 1NEKA 2YVFA 1ZX9A 5FS8A 4U8OA 1GOSA 4TLZA 3IC9A 4KX6A 2YWLA 1CJCA 1COYA 1KSUA 2UZZA 1DODA 4EM4A 5BULA 4H50A 4A6NB 4H7UA 1JOAA 1Y56B 3AEDA 5KOXA 2A89A 4IVOB 4NEVA 3CPJG 1GESA 4ZCCA 3G5SA 3H8IA 1PBCA 2IIDA 2YLWA 5FS7A 1EL5A 2QA2A 3GD4A 3KPKA 3AB1A 3KA7A 3ALJA 2AAQA 3AEBA 1P2EA 2C75A 1GREA 1LTXR 3II4A 3ITJA 4NEWA 4PAAA 2YAUA 3SZCA 4ICYA 3C4NA 4Y4NA 1CC4A 2XVFA 3EANA 4FDCB 4H4ZA 1ZOYA 2CDUA 2YR5A 3NYCA 4Z2TA 5JCNA 4J34A 3UP4A 5ER0A 3AE1A 4AT0A 3BNUA 3CNDA 2E5VA 4U8IA 5KRQA 2E1MA 1DJQA 1L9DA 2BK5A 3K7MX 3UOVA 4H4SA 5KXJA 4TM0A 4UP3A 1E39A 1BZLA 2EQ9A 2FJBA
chains in the Genus database with same CATH topology
3D1CA 2WEUA 4K5SA 1GRBA 3KLJA 1TYPA 3PS9A 2Y6RA 1NHPA 3T14A 5C3JA 1W4XA 4AP1A 1QLBA 3M13A 5KMQA 4Z2RA 1AOGA 2WS3A 1TRBA 5TR3A 4XXGA 2FBWA 3AEAA 1E1KA 1LJ1A 2BC1A 2OALA 1L9CA 1NHQA 1K0JA 1PJ5A 2GB0A 1JRYA 2WQYA 3BNMA 3DJEA 2ACZA 1K4QA 3ICTA 4PABA 3EF6A 4YTPA 3GDNA 2WDQA 2XFOA 2B9YA 4JDRA 2GVCA 3M12A 3P4QA 3QSSA 2GQWA 3NRNA 4A5LA 5EBKA 3SFDA 2WHDA 1YQ3A 3ALMA 2ARDA 1H81A 3KKJA 1EBDA 4B66A 2BS2A 1BF3A 2FJEA 2OA1A 1NENA 2R0GA 3IHMA 1CL0A 2JB1A 2ZZBA 4II3A 4OPUA 4C3XA 1REOA 1PXAA 2TMDA 2WBAA 1IUUA 3LADA 3VRBA 1VRQB 4GF7A 1E1LA 3UTGA 1E6EA 2Q0KA 4NTDA 4C5OA 3CGCA 4Z26A 1GRTA 3GMCA 4OVIA 2GF3A 1D7YA 1YY5A 3WE0A 3GRSA 3GRTA 1Q1WA 2Z5XA 3CNJA 3UCLA 4GAVA 5GSNA 3Q9TA 3F8DA 4K5RA 3K7QX 2GAGB 3UKFA 2WU2A 2XFQA 3ISHA 1L0VA 1M6IA 3CN8A 1TDKA 2X8CA 3RHAA 4APNA 5BVAA 3VR9A 2AR8A 4B68A 5KWFA 5M10A 5FS6A 2BS3A 2X50A 3DJJA 3NH3X 2WDRA 1NHSA 4NZHA 2XVHA 2R9ZA 4CY8A 2XVJA 3UKAA 3I6DA 5HY5A 1FEAA 1X31B 2VVLA 1Q9IA 2CVJA 2X8GA 3DJGX 1VDCA 3QVRA 4H2NA 4H4TA 4NWZA 2OLNA 3D8XA 2XVEA 2XFUA 2BRAA 2BCPA 2WESA 2QCUA 3IHGA 3T2KA 2O9ZA 2XLSA 4H2QA 3NK0X 4K8DA 3URHA 4II2A 4B64A 5IPYA 4H4VA 2C65A 1TDOA 3KU9A 4H4UA 1FOHA 3FG2P 2FJDA 3B6DA 2WP6A 3CTYA 3CMMA 4USQA 4U8MA 4YKGA 4RG4A 4J31A 4U2SA 4YKFA 1D4CA 2EQ6A 2W0HA 4NNJA 1E1NA 4H4RA 4Z2UA 2BRYA 4EIQA 3SQPA 4AOSA 3UOZA 1GALA 4C77A 2GEWA 1PS9A 5GRTA 4OCGA 4JQ9A 2OAMA 3L8KA 5L46A 1GNDA 1NG4A 4EMWA 4G9KA 1BKWA 2WOIA 4HB9A 3GYXA 4YWOA 4DNAA 4CNKA 4EMJA 2WETA 1K0IA 4G73A 2BYBA 1DOEA 2X3NA 3LXDA 2BK4A 5M0ZA 2APGA 2V60A 3RP6A 3SGLA 2XLPA 1F8RA 1TDEA 1OJCA 3DH9A 4CRTA 3CGDA 4CNJA 2JKCA 1YQ4A 4OPDA 4B65A 3ICRA 1PXBA 3DK8A 3DGZA 1VG0A 3NYEA 3UTFA 3AE9A 4BV6A 2J3NA 4M52A 4E0VA 3NLCA 2NPXA 2WP9A 2YVGA 3AE8A 4A9WA 1SEZA 2BCGG 1ZMDA 4JNQA 4U2TA 4UDQA 3QVPA 4BK2A 1EL7A 3DA1A 2IVDA 4DSGA 2V5ZA 1B5QA 2AQJA 2GR1A 5J7XA 3UOYA 4YSZA 2JK6A 2JB3A 5EB4A 2C73A 2CFYA 3KVEA 4J33A 4H4YA 1OJTA 4D04A 3SZFA 4J2WA 2GR3A 1GSNA 3EAOA 4RSLA 1N4UA 1FCDA 3AYIA 2GRTA 3AE7A 4EQWA 1NDAA 3CPIG 4G74A 2V3AA 1KSSA 4GR1A 1Y0PA 4A65A 1ELIA 3RP7A 4J57A 5EB5A 4UDRA 1Y56A 3K7TA 2BACA 4BJYA 5JCMA 5BRTA 3AE3A 4J56A 1OJAA 4TLXA 3ZDNA 1F8WA 4WCTA 5CQFA 1H84A 4USRA 4EQXA 2BXSA 3ATRA 1GV4A 3B3RA 1CJ3A 1NHRA 3V3NA 4Y4MA 1XPQA 3ALLA 2Q0LA 3GSIA 3V76A 4DGKA 2YLRA 4H4QA 4RG3A 1P2HA 3RP8A 3GMBA 3NK2X 4A7AA 1GXFA 3R9UA 3CNSA 2YG3A 4NTCA 1OJ9A 3CNPA 2VVLG 1PJ7A 2ZZ0A 1JRZA 2TPRA 3QSMA 4IA6A 3NKSA 3UKQA 4EM3A 1PBFA 2VOUA 1LQTA 4OPLA 2R0CA 4YTNA 2JBVA 1GTEA 4CCRA 2VZ2A 3VQRA 2C3DA 1MOKA 2Y6QA 3BHFA 1MXTA 2GMHA 3FBSA 2YQUA 4U8PA 3PO7A 3DGHA 4YSXA 3AECA 3OC4A 3AYLA 4K22A 3P4PA 3SXIA 4K2XA 4LIIA 2R45A 1H83A 3T2ZA 3CIRA 5U63A 3P4RA 4YT0A 2WPEA 4N9XA 1UKVG 2F5ZA 3QFAA 1K0LA 2WP5A 4X9NA 3SFEA 3LJPA 4YTMA 2IVEA 2BABA 1CJ2A 4U8NA 3S5WA 1KDGA 4X9MA 1DJNA 1PBEA 4G6HA 4BURA 1ZK7A 2B9XA 2GH5A 1JNZA 1EL9A 2B7SA 4YSYA 2XYOA 4B69A 1H82A 1N4WA 3BI4A 1GRAA 2XLTA 3ATQA 3NGCX 4HA6A 3ADAB 4DSHA 4A99A 1OJDA 4ECHA 1D5TA 4FX9A 1GT8A 1GETA 2XCGA 1F6MA 3BI2A 3QJ4A 5IQ1A 3S61A 3SM8A 1QJDA 3AE6A 1FECA 1HYUA 1EL8A 1L9EA 2C64A 1GRHA 1DOBA 2C76A 1LQUA 3HZLA 4H2PA 2EQ7A 3AE2A 4AP3A 5KMSA 4TM1A 5BUKA 3SZWA 4OPIA 5HYMA 3REDA 4Z44A 1O95A 1PXCA 3UKLA 4Z25A 2WDVA 3G5QA 2R46A 1DOCA 3UOXA 1O94A 3UP5A 1D4EA 5KOWA 2XFNA 4J36A 4U2LA 2Q6UA 1CHUA 1XDIA 2RGOA 3AEEA 3AXBA 3SX6A 2R4JA 4EQRA 2PHHA 3O0HA 1BWCA 2YR4A 5KVIA 3CGBA 3HYVA 1O5WA 3AEFA 2V6OA 2VQ7A 2WPFA 1ZDLA 2GR2A 2C72A 2WOVA 3CGEA 2HQMA 2CULA 1DXLA 2E4GA 4C74A 1JU2A 1PBBA 2VQBA 3AD7B 1ZY8A 3UTHA 2GMJA 4U8JA 1GEUA 3RNMA 3P1WA 4P9SA 3AEGA 1H6VA 4U8LA 2C70A 4C3YA 3NHOX 3GYJA 4AOXA 2XLUA 1CC2A 3H4KA 4AT2A 2V3BA 1LPFA 3I3LA 2FJAA 2H89A 3HYXA 3KPFA 3NN0X 3QFBA 3AD8B 3M0OA 1S3EA 2WPCA 2ZZCA 1NPXA 4BJZA 2VRLA 4JY3A 2DKHA 3UKKA 2YVJA 3BI5A 2RGHA 1NAAA 1CJ4A 2B76A 2X99A 3P9UA 4GRTA 3VRAA 3ZYXA 2C4CA 3LZWA 2R0PA 2RABA 2VRMA 4JNAA 4NTEA 1TYTA 2YM2A 1LV0A 2B9WA 2Q7VA 4EMIA 1JNRA 3NIXA 2C67A 3F8RA 2YM1A 4ZCDA 3AYJA 4D03A 4OPCA 1CBOA 3DMEA 3IWAA 2Z5YA 4H2RA 1IJHA 3GDPA 1GTHA 5HXIA 1ZP0A 1M64A 1BGJA 1QO8A 2BC0A 1BGNA 3P4SA 1S2QA 2BS4A 3NN6X 4GDPA 1KNRA 2A8XA 1GRGA 4OPTA 4B1BA 4G6GA 3E1TA 1LVLA 4LA1A 1N4VA 2C3CA 4OPGA 4UDPA 3LOVA 2GV8A 2YLTA 2XDOA 3VR8A 3QSEA 4GUVA 4GDEA 4JN9A 3T2YA 3NTDA 2YG5A 3NK1X 3K30A 3T31A 3G5RA 5HHFA 1F3PA 3ABVA 4X4JA 5JCIA 1CF3A 5JCKA 1ONFA 3CNTA 3CPHG 1RP0A 4O5QA 2BK3A 4FK1A 3DK4A 4U8KA 4YSHA 5KMRA 4MJWA 1H7WA 3T0KA 5LV9A 3KD9A 2JB2A 1XANA 1GPEA 1VQWA 2QA1A 3GWFA 1PHHA 2PYXA 1RYIA 3T37A 2VVMA 2YLZA 4ZN0A 1N1PA 3DJDA 4BK3A 1TDNA 1F8SA 4CY6A 1Q1RA 2V61A 2YLSA 2BA9A 1PBDA 2XVIA 3UKPA 4IVMB 4REKA 5U25A 4Y4LA 1B37A 3OZ2A 3PVCA 1NG3A 3FIMB 4YXDA 2BXRA 3AE4A 1E7PA 1PDHA 3AD9B 3UKHA 2C7GA 5FS9A 1YQZA 3NYFA 1GERA 3C96A 4A79A 2JAEA 5KMPA 3LB8A 5IQ4A 1JRXA 2YLXA 5KNLA 4XWZA 3NT6A 3JSKA 2EQ8A 5JCLA 3VRDB 2RGJA 1YKJA 2A87A 3SY4A 1FEBA 3C4AA 3L1RA 3V3OA 4GCMA 4XWRA 4CCQA 1IUTA 1Z6LA 1KF6A 4KPRA 2B7RA 2H88A 1H86A 4H4XA 4O5UA 5EOWA 3SZ0A 4B63A 3COXA 4EIPA 4H4PA 4I59A 4IA5A 5CKUA 3UTEA 3HYWA 1CC6A 1ZKQA 3LZXA 1V59A 1KFYA 2OLOA 2I0ZA 1H7XA 3SYIA 4B67A 1IUVA 4I58A 1S2YA 1D7LA 3EPTA 4EQSA 1MO9A 4TM3A 3NG7X 1RSGA 1FL2A 5U1OA 2R4EA 1PJ6A 1GRFA 4K7ZA 2NVKX 2GR0A 3AE5A 3FPZA 4BK1A 1B4VA 5DBJA 3FMWA 2XFPA 1DNCA 2GAHB 5C2TA 2X8HA 2YG6A 1XHCA 2ZBWA 3F8PA 3GD3A 1S3BA 1TDFA 1IUSA 1ZMCA 4TM4A 3H8LA 4CBQA 5FMHA 4ADWA 4GAPA 3ICSA 4Z24A 3NNEA 4H4WA 2YR6A 2YG7A 4JY2A 2WU5A 4WX1A 1JEHA 4Z43A 3Q6JA 2XLRA 2C66A 1IUWA 2GQFA 2QAEA 3BHKA 1KNPA 5J60A 1PN0A 1E1MA 3GYIA 1ZOVA 1D4DA 5KVHA 4LU6A 1IUXA 4A6NA 2YG4A 3GWDA 3IF9A 3NTAA 3AWIA 3DK9A 1B8SA 4FK1C 4IV9A 2WOWA 1VG9A 2DKIA 1NEKA 2YVFA 1ZX9A 5FS8A 4U8OA 1GOSA 4TLZA 3IC9A 4KX6A 2YWLA 1CJCA 1COYA 1KSUA 2UZZA 1DODA 4EM4A 5BULA 4H50A 4A6NB 4H7UA 1JOAA 1Y56B 3AEDA 5KOXA 2A89A 4IVOB 4NEVA 3CPJG 1GESA 4ZCCA 3G5SA 3H8IA 1PBCA 2IIDA 2YLWA 5FS7A 1EL5A 2QA2A 3GD4A 3KPKA 3AB1A 3KA7A 3ALJA 2AAQA 3AEBA 1P2EA 2C75A 1GREA 1LTXR 3II4A 3ITJA 4NEWA 4PAAA 2YAUA 3SZCA 4ICYA 3C4NA 4Y4NA 1CC4A 2XVFA 3EANA 4FDCB 4H4ZA 1ZOYA 2CDUA 2YR5A 3NYCA 4Z2TA 5JCNA 4J34A 3UP4A 5ER0A 3AE1A 4AT0A 3BNUA 3CNDA 2E5VA 4U8IA 5KRQA 2E1MA 1DJQA 1L9DA 2BK5A 3K7MX 3UOVA 4H4SA 5KXJA 4TM0A 4UP3A 1E39A 1BZLA 2EQ9A 2FJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1C A;  2WEU A;  4K5S A;  1GRB A;  3KLJ A;  1TYP A;  3PS9 A;  2Y6R A;  1NHP A;  5C3J A;  1W4X A;  4AP1 A;  1QLB A;  3M13 A;  4Z2R A;  1AOG A;  2WS3 A;  1TRB A;  5TR3 A;  4XXG A;  2FBW A;  3AEA A;  1E1K A;  1LJ1 A;  2BC1 A;  2OAL A;  1L9C A;  1NHQ A;  1K0J A;  1PJ5 A;  2GB0 A;  1JRY A;  2WQY A;  3BNM A;  3DJE A;  2ACZ A;  1K4Q A;  3ICT A;  4PAB A;  3EF6 A;  4YTP A;  3GDN A;  2WDQ A;  2XFO A;  2B9Y A;  4JDR A;  2GVC A;  3M12 A;  3P4Q A;  3QSS A;  2GQW A;  3NRN A;  4A5L A;  5EBK A;  3SFD A;  2WHD A;  1YQ3 A;  3ALM A;  2ARD A;  1H81 A;  3KKJ A;  1EBD A;  4B66 A;  2BS2 A;  1BF3 A;  2FJE A;  2OA1 A;  1NEN A;  2R0G A;  3IHM A;  1CL0 A;  2JB1 A;  2ZZB A;  4OPU A;  4C3X A;  1REO A;  1PXA A;  2TMD A;  2WBA A;  1IUU A;  3LAD A;  3VRB A;  1VRQ B;  4GF7 A;  1E1L A;  3UTG A;  1E6E A;  2Q0K A;  4NTD A;  4C5O A;  3CGC A;  4Z26 A;  1GRT A;  3GMC A;  4OVI A;  2GF3 A;  1D7Y A;  1YY5 A;  3WE0 A;  3GRS A;  3GRT A;  1Q1W A;  2Z5X A;  3CNJ A;  3UCL A;  5GSN A;  3Q9T A;  3F8D A;  4K5R A;  3K7Q X;  2GAG B;  3UKF A;  2WU2 A;  2XFQ A;  3ISH A;  1L0V A;  1M6I A;  3CN8 A;  1TDK A;  2X8C A;  3RHA A;  4APN A;  5BVA A;  3VR9 A;  2AR8 A;  4B68 A;  5KWF A;  5M10 A;  5FS6 A;  2BS3 A;  2X50 A;  3DJJ A;  3NH3 X;  2WDR A;  1NHS A;  4NZH A;  2XVH A;  2R9Z A;  4CY8 A;  2XVJ A;  3UKA A;  3I6D A;  5HY5 A;  1FEA A;  1X31 B;  2VVL A;  1Q9I A;  2CVJ A;  2X8G A;  3DJG X;  1VDC A;  3QVR A;  4H2N A;  4H4T A;  5IPY A;  2OLN A;  3D8X A;  2XVE A;  2XFU A;  2BCP A;  2WES A;  2QCU A;  3IHG A;  2O9Z A;  2XLS A;  4H2Q A;  3NK0 X;  4K8D A;  3URH A;  4B64 A;  4H4V A;  2C65 A;  1TDO A;  3KU9 A;  4H4U A;  1FOH A;  3FG2 P;  2FJD A;  3B6D A;  2WP6 A;  3CTY A;  4USQ A;  4U8M A;  4YKG A;  4RG4 A;  4J31 A;  4U2S A;  4YKF A;  1D4C A;  2EQ6 A;  2W0H A;  1E1N A;  4H4R A;  4Z2U A;  4EIQ A;  3SQP A;  4AOS A;  3UOZ A;  1GAL A;  4C77 A;  2GEW A;  1PS9 A;  5GRT A;  4OCG A;  4JQ9 A;  2OAM A;  3L8K A;  5L46 A;  1GND A;  1NG4 A;  4EMW A;  1BKW A;  2WOI A;  4HB9 A;  4YWO A;  4DNA A;  4CNK A;  4EMJ A;  2WET A;  1K0I A;  2BYB A;  1DOE A;  2X3N A;  3LXD A;  2BK4 A;  5M0Z A;  2APG A;  2V60 A;  3RP6 A;  3SGL A;  2XLP A;  1F8R A;  1TDE A;  1OJC A;  3DH9 A;  4CRT A;  3CGD A;  4CNJ A;  2JKC A;  1YQ4 A;  4OPD A;  4B65 A;  3ICR A;  1PXB A;  3DK8 A;  3DGZ A;  1VG0 A;  3NYE A;  3UTF A;  3AE9 A;  4BV6 A;  2J3N A;  4M52 A;  4E0V A;  3NLC A;  2NPX A;  2WP9 A;  2YVG A;  3AE8 A;  4A9W A;  1SEZ A;  2BCG G;  1ZMD A;  4JNQ A;  4U2T A;  4UDQ A;  3QVP A;  4BK2 A;  1EL7 A;  3DA1 A;  2IVD A;  4DSG A;  2V5Z A;  1B5Q A;  2AQJ A;  2GR1 A;  5J7X A;  3UOY A;  4YSZ A;  2JK6 A;  2JB3 A;  5EB4 A;  2C73 A;  2CFY A;  3KVE A;  4J33 A;  4H4Y A;  1OJT A;  4D04 A;  4J2W A;  2GR3 A;  1GSN A;  3EAO A;  4RSL A;  1N4U A;  1FCD A;  3AYI A;  2GRT A;  3AE7 A;  4EQW A;  1NDA A;  3CPI G;  2V3A A;  1KSS A;  4GR1 A;  1Y0P A;  4A65 A;  1ELI A;  3RP7 A;  4J57 A;  5EB5 A;  4UDR A;  1Y56 A;  3K7T A;  2BAC A;  4BJY A;  5JCM A;  5BRT A;  3AE3 A;  4J56 A;  1OJA A;  4TLX A;  3ZDN A;  1F8W A;  4WCT A;  5CQF A;  1H84 A;  4USR A;  4EQX A;  2BXS A;  3ATR A;  1GV4 A;  3B3R A;  1CJ3 A;  1NHR A;  3V3N A;  4Y4M A;  1XPQ A;  3ALL A;  2Q0L A;  3GSI A;  3V76 A;  4DGK A;  2YLR A;  4H4Q A;  4RG3 A;  1P2H A;  3RP8 A;  3GMB A;  3NK2 X;  4A7A A;  1GXF A;  3R9U A;  3CNS A;  2YG3 A;  4NTC A;  1OJ9 A;  3CNP A;  2VVL G;  1PJ7 A;  2ZZ0 A;  1JRZ A;  2TPR A;  3QSM A;  4IA6 A;  3NKS A;  3UKQ A;  4EM3 A;  1PBF A;  2VOU A;  1LQT A;  4OPL A;  2R0C A;  4YTN A;  2JBV A;  1GTE A;  4CCR A;  2VZ2 A;  3VQR A;  2C3D A;  1MOK A;  2Y6Q A;  3BHF A;  1MXT A;  2GMH A;  3FBS A;  2YQU A;  4U8P A;  3PO7 A;  3DGH A;  4YSX A;  3AEC A;  3OC4 A;  3AYL A;  4K22 A;  3P4P A;  4K2X A;  4LII A;  2R45 A;  1H83 A;  3CIR A;  5U63 A;  3P4R A;  4YT0 A;  2WPE A;  4N9X A;  1UKV G;  2F5Z A;  3QFA A;  1K0L A;  2WP5 A;  4X9N A;  3SFE A;  3LJP A;  4YTM A;  2IVE A;  2BAB A;  1CJ2 A;  4U8N A;  3S5W A;  1KDG A;  4X9M A;  1DJN A;  1PBE A;  4BUR A;  1ZK7 A;  2B9X A;  2GH5 A;  1JNZ A;  1EL9 A;  2B7S A;  4YSY A;  2XYO A;  4B69 A;  1H82 A;  1N4W A;  3BI4 A;  1GRA A;  2XLT A;  3ATQ A;  3NGC X;  4HA6 A;  3ADA B;  4DSH A;  4A99 A;  1OJD A;  4ECH A;  1D5T A;  4FX9 A;  1GT8 A;  1GET A;  2XCG A;  1F6M A;  3BI2 A;  3QJ4 A;  5IQ1 A;  3S61 A;  3SM8 A;  1QJD A;  3AE6 A;  1FEC A;  1HYU A;  1EL8 A;  1L9E A;  2C64 A;  1GRH A;  1DOB A;  2C76 A;  1LQU A;  3HZL A;  4H2P A;  2EQ7 A;  3AE2 A;  4AP3 A;  4TM1 A;  5BUK A;  4OPI A;  5HYM A;  3RED A;  4Z44 A;  1O95 A;  1PXC A;  3UKL A;  4Z25 A;  2WDV A;  3G5Q A;  2R46 A;  1DOC A;  3UOX A;  1O94 A;  3UP5 A;  1D4E A;  5KOW A;  2XFN A;  4J36 A;  4U2L A;  2Q6U A;  1CHU A;  1XDI A;  2RGO A;  3AEE A;  3AXB A;  2R4J A;  4EQR A;  2PHH A;  3O0H A;  1BWC A;  2YR4 A;  5KVI A;  3CGB A;  1O5W A;  3AEF A;  2V6O A;  2VQ7 A;  2WPF A;  1ZDL A;  2GR2 A;  2C72 A;  2WOV A;  3CGE A;  2HQM A;  2CUL A;  1DXL A;  2E4G A;  4C74 A;  1JU2 A;  1PBB A;  2VQB A;  3AD7 B;  1ZY8 A;  3UTH A;  2GMJ A;  4U8J A;  1GEU A;  3RNM A;  3P1W A;  4P9S A;  3AEG A;  1H6V A;  4U8L A;  2C70 A;  4C3Y A;  3NHO X;  3GYJ A;  4AOX A;  2XLU A;  1CC2 A;  3H4K A;  4AT2 A;  2V3B A;  1LPF A;  3I3L A;  2FJA A;  2H89 A;  3KPF A;  3QFB A;  3NN0 X;  3AD8 B;  3M0O A;  1S3E A;  2WPC A;  2ZZC A;  1NPX A;  4BJZ A;  2VRL A;  4JY3 A;  2DKH A;  3UKK A;  2YVJ A;  3BI5 A;  2RGH A;  1NAA A;  1CJ4 A;  2B76 A;  2X99 A;  3P9U A;  4GRT A;  3VRA A;  3ZYX A;  3LZW A;  2R0P A;  2RAB A;  2VRM A;  4JNA A;  4NTE A;  1TYT A;  2YM2 A;  1LV0 A;  2B9W A;  2Q7V A;  4EMI A;  1JNR A;  3NIX A;  2C67 A;  3F8R A;  2YM1 A;  4ZCD A;  3AYJ A;  4D03 A;  4OPC A;  1CBO A;  3DME A;  3IWA A;  2Z5Y A;  4H2R A;  1IJH A;  3GDP A;  1GTH A;  5HXI A;  1ZP0 A;  1M64 A;  1BGJ A;  1QO8 A;  2BC0 A;  1BGN A;  3P4S A;  1S2Q A;  2BS4 A;  3NN6 X;  4GDP A;  1KNR A;  2A8X A;  1GRG A;  4OPT A;  4B1B A;  3E1T A;  1LVL A;  4LA1 A;  1N4V A;  2C3C A;  4OPG A;  4UDP A;  3LOV A;  2GV8 A;  2YLT A;  2XDO A;  3VR8 A;  3QSE A;  4GUV A;  4GDE A;  4JN9 A;  3NTD A;  2YG5 A;  3NK1 X;  3K30 A;  3G5R A;  5HHF A;  1F3P A;  3ABV A;  4X4J A;  5JCI A;  1CF3 A;  5JCK A;  1ONF A;  3CNT A;  3CPH G;  1RP0 A;  4O5Q A;  2BK3 A;  4FK1 A;  3DK4 A;  4U8K A;  4YSH A;  4MJW A;  1H7W A;  5LV9 A;  3KD9 A;  2JB2 A;  1XAN A;  1GPE A;  1VQW A;  2QA1 A;  3GWF A;  1PHH A;  2PYX A;  1RYI A;  3T37 A;  2VVM A;  2YLZ A;  4ZN0 A;  1N1P A;  3DJD A;  4BK3 A;  1TDN A;  1F8S A;  4CY6 A;  1Q1R A;  2V61 A;  2YLS A;  2BA9 A;  1PBD A;  2XVI A;  3UKP A;  4IVM B;  4REK A;  5U25 A;  4Y4L A;  1B37 A;  3OZ2 A;  3PVC A;  1NG3 A;  3FIM B;  4YXD A;  2BXR A;  3AE4 A;  1E7P A;  1PDH A;  3AD9 B;  3UKH A;  2C7G A;  5FS9 A;  1YQZ A;  3NYF A;  1GER A;  3C96 A;  4A79 A;  2JAE A;  3LB8 A;  5IQ4 A;  1JRX A;  2YLX A;  4XWZ A;  3NT6 A;  3JSK A;  2EQ8 A;  5JCL A;  3VRD B;  2RGJ A;  1YKJ A;  2A87 A;  1FEB A;  3C4A A;  3L1R A;  3V3O A;  4GCM A;  4XWR A;  4CCQ A;  1IUT A;  1Z6L A;  1KF6 A;  4KPR A;  2B7R A;  2H88 A;  1H86 A;  4H4X A;  4O5U A;  5EOW A;  4EIP A;  4B63 A;  3COX A;  4H4P A;  4I59 A;  4IA5 A;  5CKU A;  3UTE A;  1CC6 A;  1ZKQ A;  3LZX A;  1V59 A;  1KFY A;  2OLO A;  2I0Z A;  1H7X A;  4B67 A;  1IUV A;  4I58 A;  1S2Y A;  1D7L A;  3EPT A;  4EQS A;  1MO9 A;  4TM3 A;  3NG7 X;  1RSG A;  1FL2 A;  5U1O A;  2R4E A;  1PJ6 A;  1GRF A;  4K7Z A;  2NVK X;  2GR0 A;  3AE5 A;  3FPZ A;  4BK1 A;  1B4V A;  5DBJ A;  3FMW A;  2XFP A;  1DNC A;  2GAH B;  5C2T A;  2X8H A;  2YG6 A;  1XHC A;  2ZBW A;  3F8P A;  3GD3 A;  1S3B A;  1TDF A;  1IUS A;  1ZMC A;  4TM4 A;  3H8L A;  4CBQ A;  5FMH A;  4ADW A;  3ICS A;  4Z24 A;  3NNE A;  4H4W A;  2YR6 A;  2YG7 A;  4JY2 A;  2WU5 A;  4WX1 A;  1JEH A;  4Z43 A;  3Q6J A;  2XLR A;  2C66 A;  1IUW A;  2GQF A;  2QAE A;  3BHK A;  1KNP A;  5J60 A;  1PN0 A;  1E1M A;  3GYI A;  1ZOV A;  1D4D A;  5KVH A;  4LU6 A;  1IUX A;  4A6N A;  2YG4 A;  3GWD A;  3IF9 A;  3NTA A;  3AWI A;  3DK9 A;  1B8S A;  4FK1 C;  4IV9 A;  2WOW A;  1VG9 A;  2DKI A;  1NEK A;  2YVF A;  1ZX9 A;  5FS8 A;  4U8O A;  1GOS A;  4TLZ A;  3IC9 A;  4KX6 A;  2YWL A;  1CJC A;  1COY A;  1KSU A;  2UZZ A;  1DOD A;  4EM4 A;  5BUL A;  4H50 A;  4A6N B;  4H7U A;  1JOA A;  1Y56 B;  3AED A;  5KOX A;  2A89 A;  4IVO B;  4NEV A;  3CPJ G;  1GES A;  4ZCC A;  3G5S A;  3H8I A;  1PBC A;  2IID A;  2YLW A;  5FS7 A;  1EL5 A;  2QA2 A;  3GD4 A;  3AB1 A;  3KA7 A;  3ALJ A;  2AAQ A;  3AEB A;  1P2E A;  2C75 A;  1GRE A;  1LTX R;  3II4 A;  3ITJ A;  4NEW A;  4PAA A;  2YAU A;  4ICY A;  3C4N A;  4Y4N A;  1CC4 A;  2XVF A;  3EAN A;  4FDC B;  4H4Z A;  1ZOY A;  2CDU A;  2YR5 A;  3NYC A;  4Z2T A;  5JCN A;  4J34 A;  3UP4 A;  5ER0 A;  3AE1 A;  4AT0 A;  3BNU A;  3CND A;  2E5V A;  4U8I A;  5KRQ A;  2E1M A;  1DJQ A;  1L9D A;  2BK5 A;  3K7M X;  3UOV A;  4H4S A;  5KXJ A;  4TM0 A;  4UP3 A;  1E39 A;  1BZL A;  2EQ9 A;  2FJB A; 
#chains in the Genus database with same CATH topology
 3D1C A;  2WEU A;  4K5S A;  1GRB A;  3KLJ A;  1TYP A;  3PS9 A;  2Y6R A;  1NHP A;  3T14 A;  5C3J A;  1W4X A;  4AP1 A;  1QLB A;  3M13 A;  5KMQ A;  4Z2R A;  1AOG A;  2WS3 A;  1TRB A;  5TR3 A;  4XXG A;  2FBW A;  3AEA A;  1E1K A;  1LJ1 A;  2BC1 A;  2OAL A;  1L9C A;  1NHQ A;  1K0J A;  1PJ5 A;  2GB0 A;  1JRY A;  2WQY A;  3BNM A;  3DJE A;  2ACZ A;  1K4Q A;  3ICT A;  4PAB A;  3EF6 A;  4YTP A;  3GDN A;  2WDQ A;  2XFO A;  2B9Y A;  4JDR A;  2GVC A;  3M12 A;  3P4Q A;  3QSS A;  2GQW A;  3NRN A;  4A5L A;  5EBK A;  3SFD A;  2WHD A;  1YQ3 A;  3ALM A;  2ARD A;  1H81 A;  3KKJ A;  1EBD A;  4B66 A;  2BS2 A;  1BF3 A;  2FJE A;  2OA1 A;  1NEN A;  2R0G A;  3IHM A;  1CL0 A;  2JB1 A;  2ZZB A;  4II3 A;  4OPU A;  4C3X A;  1REO A;  1PXA A;  2TMD A;  2WBA A;  1IUU A;  3LAD A;  3VRB A;  1VRQ B;  4GF7 A;  1E1L A;  3UTG A;  1E6E A;  2Q0K A;  4NTD A;  4C5O A;  3CGC A;  4Z26 A;  1GRT A;  3GMC A;  4OVI A;  2GF3 A;  1D7Y A;  1YY5 A;  3WE0 A;  3GRS A;  3GRT A;  1Q1W A;  2Z5X A;  3CNJ A;  3UCL A;  4GAV A;  5GSN A;  3Q9T A;  3F8D A;  4K5R A;  3K7Q X;  2GAG B;  3UKF A;  2WU2 A;  2XFQ A;  3ISH A;  1L0V A;  1M6I A;  3CN8 A;  1TDK A;  2X8C A;  3RHA A;  4APN A;  5BVA A;  3VR9 A;  2AR8 A;  4B68 A;  5KWF A;  5M10 A;  5FS6 A;  2BS3 A;  2X50 A;  3DJJ A;  3NH3 X;  2WDR A;  1NHS A;  4NZH A;  2XVH A;  2R9Z A;  4CY8 A;  2XVJ A;  3UKA A;  3I6D A;  5HY5 A;  1FEA A;  1X31 B;  2VVL A;  1Q9I A;  2CVJ A;  2X8G A;  3DJG X;  1VDC A;  3QVR A;  4H2N A;  4H4T A;  4NWZ A;  2OLN A;  3D8X A;  2XVE A;  2XFU A;  2BRA A;  2BCP A;  2WES A;  2QCU A;  3IHG A;  3T2K A;  2O9Z A;  2XLS A;  4H2Q A;  3NK0 X;  4K8D A;  3URH A;  4II2 A;  4B64 A;  5IPY A;  4H4V A;  2C65 A;  1TDO A;  3KU9 A;  4H4U A;  1FOH A;  3FG2 P;  2FJD A;  3B6D A;  2WP6 A;  3CTY A;  3CMM A;  4USQ A;  4U8M A;  4YKG A;  4RG4 A;  4J31 A;  4U2S A;  4YKF A;  1D4C A;  2EQ6 A;  2W0H A;  4NNJ A;  1E1N A;  4H4R A;  4Z2U A;  2BRY A;  4EIQ A;  3SQP A;  4AOS A;  3UOZ A;  1GAL A;  4C77 A;  2GEW A;  1PS9 A;  5GRT A;  4OCG A;  4JQ9 A;  2OAM A;  3L8K A;  5L46 A;  1GND A;  1NG4 A;  4EMW A;  4G9K A;  1BKW A;  2WOI A;  4HB9 A;  3GYX A;  4YWO A;  4DNA A;  4CNK A;  4EMJ A;  2WET A;  1K0I A;  4G73 A;  2BYB A;  1DOE A;  2X3N A;  3LXD A;  2BK4 A;  5M0Z A;  2APG A;  2V60 A;  3RP6 A;  3SGL A;  2XLP A;  1F8R A;  1TDE A;  1OJC A;  3DH9 A;  4CRT A;  3CGD A;  4CNJ A;  2JKC A;  1YQ4 A;  4OPD A;  4B65 A;  3ICR A;  1PXB A;  3DK8 A;  3DGZ A;  1VG0 A;  3NYE A;  3UTF A;  3AE9 A;  4BV6 A;  2J3N A;  4M52 A;  4E0V A;  3NLC A;  2NPX A;  2WP9 A;  2YVG A;  3AE8 A;  4A9W A;  1SEZ A;  2BCG G;  1ZMD A;  4JNQ A;  4U2T A;  4UDQ A;  3QVP A;  4BK2 A;  1EL7 A;  3DA1 A;  2IVD A;  4DSG A;  2V5Z A;  1B5Q A;  2AQJ A;  2GR1 A;  5J7X A;  3UOY A;  4YSZ A;  2JK6 A;  2JB3 A;  5EB4 A;  2C73 A;  2CFY A;  3KVE A;  4J33 A;  4H4Y A;  1OJT A;  4D04 A;  3SZF A;  4J2W A;  2GR3 A;  1GSN A;  3EAO A;  4RSL A;  1N4U A;  1FCD A;  3AYI A;  2GRT A;  3AE7 A;  4EQW A;  1NDA A;  3CPI G;  4G74 A;  2V3A A;  1KSS A;  4GR1 A;  1Y0P A;  4A65 A;  1ELI A;  3RP7 A;  4J57 A;  5EB5 A;  4UDR A;  1Y56 A;  3K7T A;  2BAC A;  4BJY A;  5JCM A;  5BRT A;  3AE3 A;  4J56 A;  1OJA A;  4TLX A;  3ZDN A;  1F8W A;  4WCT A;  5CQF A;  1H84 A;  4USR A;  4EQX A;  2BXS A;  3ATR A;  1GV4 A;  3B3R A;  1CJ3 A;  1NHR A;  3V3N A;  4Y4M A;  1XPQ A;  3ALL A;  2Q0L A;  3GSI A;  3V76 A;  4DGK A;  2YLR A;  4H4Q A;  4RG3 A;  1P2H A;  3RP8 A;  3GMB A;  3NK2 X;  4A7A A;  1GXF A;  3R9U A;  3CNS A;  2YG3 A;  4NTC A;  1OJ9 A;  3CNP A;  2VVL G;  1PJ7 A;  2ZZ0 A;  1JRZ A;  2TPR A;  3QSM A;  4IA6 A;  3NKS A;  3UKQ A;  4EM3 A;  1PBF A;  2VOU A;  1LQT A;  4OPL A;  2R0C A;  4YTN A;  2JBV A;  1GTE A;  4CCR A;  2VZ2 A;  3VQR A;  2C3D A;  1MOK A;  2Y6Q A;  3BHF A;  1MXT A;  2GMH A;  3FBS A;  2YQU A;  4U8P A;  3PO7 A;  3DGH A;  4YSX A;  3AEC A;  3OC4 A;  3AYL A;  4K22 A;  3P4P A;  3SXI A;  4K2X A;  4LII A;  2R45 A;  1H83 A;  3T2Z A;  3CIR A;  5U63 A;  3P4R A;  4YT0 A;  2WPE A;  4N9X A;  1UKV G;  2F5Z A;  3QFA A;  1K0L A;  2WP5 A;  4X9N A;  3SFE A;  3LJP A;  4YTM A;  2IVE A;  2BAB A;  1CJ2 A;  4U8N A;  3S5W A;  1KDG A;  4X9M A;  1DJN A;  1PBE A;  4G6H A;  4BUR A;  1ZK7 A;  2B9X A;  2GH5 A;  1JNZ A;  1EL9 A;  2B7S A;  4YSY A;  2XYO A;  4B69 A;  1H82 A;  1N4W A;  3BI4 A;  1GRA A;  2XLT A;  3ATQ A;  3NGC X;  4HA6 A;  3ADA B;  4DSH A;  4A99 A;  1OJD A;  4ECH A;  1D5T A;  4FX9 A;  1GT8 A;  1GET A;  2XCG A;  1F6M A;  3BI2 A;  3QJ4 A;  5IQ1 A;  3S61 A;  3SM8 A;  1QJD A;  3AE6 A;  1FEC A;  1HYU A;  1EL8 A;  1L9E A;  2C64 A;  1GRH A;  1DOB A;  2C76 A;  1LQU A;  3HZL A;  4H2P A;  2EQ7 A;  3AE2 A;  4AP3 A;  5KMS A;  4TM1 A;  5BUK A;  3SZW A;  4OPI A;  5HYM A;  3RED A;  4Z44 A;  1O95 A;  1PXC A;  3UKL A;  4Z25 A;  2WDV A;  3G5Q A;  2R46 A;  1DOC A;  3UOX A;  1O94 A;  3UP5 A;  1D4E A;  5KOW A;  2XFN A;  4J36 A;  4U2L A;  2Q6U A;  1CHU A;  1XDI A;  2RGO A;  3AEE A;  3AXB A;  3SX6 A;  2R4J A;  4EQR A;  2PHH A;  3O0H A;  1BWC A;  2YR4 A;  5KVI A;  3CGB A;  3HYV A;  1O5W A;  3AEF A;  2V6O A;  2VQ7 A;  2WPF A;  1ZDL A;  2GR2 A;  2C72 A;  2WOV A;  3CGE A;  2HQM A;  2CUL A;  1DXL A;  2E4G A;  4C74 A;  1JU2 A;  1PBB A;  2VQB A;  3AD7 B;  1ZY8 A;  3UTH A;  2GMJ A;  4U8J A;  1GEU A;  3RNM A;  3P1W A;  4P9S A;  3AEG A;  1H6V A;  4U8L A;  2C70 A;  4C3Y A;  3NHO X;  3GYJ A;  4AOX A;  2XLU A;  1CC2 A;  3H4K A;  4AT2 A;  2V3B A;  1LPF A;  3I3L A;  2FJA A;  2H89 A;  3HYX A;  3KPF A;  3NN0 X;  3QFB A;  3AD8 B;  3M0O A;  1S3E A;  2WPC A;  2ZZC A;  1NPX A;  4BJZ A;  2VRL A;  4JY3 A;  2DKH A;  3UKK A;  2YVJ A;  3BI5 A;  2RGH A;  1NAA A;  1CJ4 A;  2B76 A;  2X99 A;  3P9U A;  4GRT A;  3VRA A;  3ZYX A;  2C4C A;  3LZW A;  2R0P A;  2RAB A;  2VRM A;  4JNA A;  4NTE A;  1TYT A;  2YM2 A;  1LV0 A;  2B9W A;  2Q7V A;  4EMI A;  1JNR A;  3NIX A;  2C67 A;  3F8R A;  2YM1 A;  4ZCD A;  3AYJ A;  4D03 A;  4OPC A;  1CBO A;  3DME A;  3IWA A;  2Z5Y A;  4H2R A;  1IJH A;  3GDP A;  1GTH A;  5HXI A;  1ZP0 A;  1M64 A;  1BGJ A;  1QO8 A;  2BC0 A;  1BGN A;  3P4S A;  1S2Q A;  2BS4 A;  3NN6 X;  4GDP A;  1KNR A;  2A8X A;  1GRG A;  4OPT A;  4B1B A;  4G6G A;  3E1T A;  1LVL A;  4LA1 A;  1N4V A;  2C3C A;  4OPG A;  4UDP A;  3LOV A;  2GV8 A;  2YLT A;  2XDO A;  3VR8 A;  3QSE A;  4GUV A;  4GDE A;  4JN9 A;  3T2Y A;  3NTD A;  2YG5 A;  3NK1 X;  3K30 A;  3T31 A;  3G5R A;  5HHF A;  1F3P A;  3ABV A;  4X4J A;  5JCI A;  1CF3 A;  5JCK A;  1ONF A;  3CNT A;  3CPH G;  1RP0 A;  4O5Q A;  2BK3 A;  4FK1 A;  3DK4 A;  4U8K A;  4YSH A;  5KMR A;  4MJW A;  1H7W A;  3T0K A;  5LV9 A;  3KD9 A;  2JB2 A;  1XAN A;  1GPE A;  1VQW A;  2QA1 A;  3GWF A;  1PHH A;  2PYX A;  1RYI A;  3T37 A;  2VVM A;  2YLZ A;  4ZN0 A;  1N1P A;  3DJD A;  4BK3 A;  1TDN A;  1F8S A;  4CY6 A;  1Q1R A;  2V61 A;  2YLS A;  2BA9 A;  1PBD A;  2XVI A;  3UKP A;  4IVM B;  4REK A;  5U25 A;  4Y4L A;  1B37 A;  3OZ2 A;  3PVC A;  1NG3 A;  3FIM B;  4YXD A;  2BXR A;  3AE4 A;  1E7P A;  1PDH A;  3AD9 B;  3UKH A;  2C7G A;  5FS9 A;  1YQZ A;  3NYF A;  1GER A;  3C96 A;  4A79 A;  2JAE A;  5KMP A;  3LB8 A;  5IQ4 A;  1JRX A;  2YLX A;  5KNL A;  4XWZ A;  3NT6 A;  3JSK A;  2EQ8 A;  5JCL A;  3VRD B;  2RGJ A;  1YKJ A;  2A87 A;  3SY4 A;  1FEB A;  3C4A A;  3L1R A;  3V3O A;  4GCM A;  4XWR A;  4CCQ A;  1IUT A;  1Z6L A;  1KF6 A;  4KPR A;  2B7R A;  2H88 A;  1H86 A;  4H4X A;  4O5U A;  5EOW A;  3SZ0 A;  4B63 A;  3COX A;  4EIP A;  4H4P A;  4I59 A;  4IA5 A;  5CKU A;  3UTE A;  3HYW A;  1CC6 A;  1ZKQ A;  3LZX A;  1V59 A;  1KFY A;  2OLO A;  2I0Z A;  1H7X A;  3SYI A;  4B67 A;  1IUV A;  4I58 A;  1S2Y A;  1D7L A;  3EPT A;  4EQS A;  1MO9 A;  4TM3 A;  3NG7 X;  1RSG A;  1FL2 A;  5U1O A;  2R4E A;  1PJ6 A;  1GRF A;  4K7Z A;  2NVK X;  2GR0 A;  3AE5 A;  3FPZ A;  4BK1 A;  1B4V A;  5DBJ A;  3FMW A;  2XFP A;  1DNC A;  2GAH B;  5C2T A;  2X8H A;  2YG6 A;  1XHC A;  2ZBW A;  3F8P A;  3GD3 A;  1S3B A;  1TDF A;  1IUS A;  1ZMC A;  4TM4 A;  3H8L A;  4CBQ A;  5FMH A;  4ADW A;  4GAP A;  3ICS A;  4Z24 A;  3NNE A;  4H4W A;  2YR6 A;  2YG7 A;  4JY2 A;  2WU5 A;  4WX1 A;  1JEH A;  4Z43 A;  3Q6J A;  2XLR A;  2C66 A;  1IUW A;  2GQF A;  2QAE A;  3BHK A;  1KNP A;  5J60 A;  1PN0 A;  1E1M A;  3GYI A;  1ZOV A;  1D4D A;  5KVH A;  4LU6 A;  1IUX A;  4A6N A;  2YG4 A;  3GWD A;  3IF9 A;  3NTA A;  3AWI A;  3DK9 A;  1B8S A;  4FK1 C;  4IV9 A;  2WOW A;  1VG9 A;  2DKI A;  1NEK A;  2YVF A;  1ZX9 A;  5FS8 A;  4U8O A;  1GOS A;  4TLZ A;  3IC9 A;  4KX6 A;  2YWL A;  1CJC A;  1COY A;  1KSU A;  2UZZ A;  1DOD A;  4EM4 A;  5BUL A;  4H50 A;  4A6N B;  4H7U A;  1JOA A;  1Y56 B;  3AED A;  5KOX A;  2A89 A;  4IVO B;  4NEV A;  3CPJ G;  1GES A;  4ZCC A;  3G5S A;  3H8I A;  1PBC A;  2IID A;  2YLW A;  5FS7 A;  1EL5 A;  2QA2 A;  3GD4 A;  3KPK A;  3AB1 A;  3KA7 A;  3ALJ A;  2AAQ A;  3AEB A;  1P2E A;  2C75 A;  1GRE A;  1LTX R;  3II4 A;  3ITJ A;  4NEW A;  4PAA A;  2YAU A;  3SZC A;  4ICY A;  3C4N A;  4Y4N A;  1CC4 A;  2XVF A;  3EAN A;  4FDC B;  4H4Z A;  1ZOY A;  2CDU A;  2YR5 A;  3NYC A;  4Z2T A;  5JCN A;  4J34 A;  3UP4 A;  5ER0 A;  3AE1 A;  4AT0 A;  3BNU A;  3CND A;  2E5V A;  4U8I A;  5KRQ A;  2E1M A;  1DJQ A;  1L9D A;  2BK5 A;  3K7M X;  3UOV A;  4H4S A;  5KXJ A;  4TM0 A;  4UP3 A;  1E39 A;  1BZL A;  2EQ9 A;  2FJB A; 
#chains in the Genus database with same CATH homology
 3D1C A;  2WEU A;  4K5S A;  1GRB A;  3KLJ A;  1TYP A;  3PS9 A;  2Y6R A;  1NHP A;  3T14 A;  5C3J A;  1W4X A;  4AP1 A;  1QLB A;  3M13 A;  5KMQ A;  4Z2R A;  1AOG A;  2WS3 A;  1TRB A;  5TR3 A;  4XXG A;  2FBW A;  3AEA A;  1E1K A;  1LJ1 A;  2BC1 A;  2OAL A;  1L9C A;  1NHQ A;  1K0J A;  1PJ5 A;  2GB0 A;  1JRY A;  2WQY A;  3BNM A;  3DJE A;  2ACZ A;  1K4Q A;  3ICT A;  4PAB A;  3EF6 A;  4YTP A;  3GDN A;  2WDQ A;  2XFO A;  2B9Y A;  4JDR A;  2GVC A;  3M12 A;  3P4Q A;  3QSS A;  2GQW A;  3NRN A;  4A5L A;  5EBK A;  3SFD A;  2WHD A;  1YQ3 A;  3ALM A;  2ARD A;  1H81 A;  3KKJ A;  1EBD A;  4B66 A;  2BS2 A;  1BF3 A;  2FJE A;  2OA1 A;  1NEN A;  2R0G A;  3IHM A;  1CL0 A;  2JB1 A;  2ZZB A;  4II3 A;  4OPU A;  4C3X A;  1REO A;  1PXA A;  2TMD A;  2WBA A;  1IUU A;  3LAD A;  3VRB A;  1VRQ B;  4GF7 A;  1E1L A;  3UTG A;  1E6E A;  2Q0K A;  4NTD A;  4C5O A;  3CGC A;  4Z26 A;  1GRT A;  3GMC A;  4OVI A;  2GF3 A;  1D7Y A;  1YY5 A;  3WE0 A;  3GRS A;  3GRT A;  1Q1W A;  2Z5X A;  3CNJ A;  3UCL A;  4GAV A;  5GSN A;  3Q9T A;  3F8D A;  4K5R A;  3K7Q X;  2GAG B;  3UKF A;  2WU2 A;  2XFQ A;  3ISH A;  1L0V A;  1M6I A;  3CN8 A;  1TDK A;  2X8C A;  3RHA A;  4APN A;  5BVA A;  3VR9 A;  2AR8 A;  4B68 A;  5KWF A;  5M10 A;  5FS6 A;  2BS3 A;  2X50 A;  3DJJ A;  3NH3 X;  2WDR A;  1NHS A;  4NZH A;  2XVH A;  2R9Z A;  4CY8 A;  2XVJ A;  3UKA A;  3I6D A;  5HY5 A;  1FEA A;  1X31 B;  2VVL A;  1Q9I A;  2CVJ A;  2X8G A;  3DJG X;  1VDC A;  3QVR A;  4H2N A;  4H4T A;  4NWZ A;  2OLN A;  3D8X A;  2XVE A;  2XFU A;  2BRA A;  2BCP A;  2WES A;  2QCU A;  3IHG A;  3T2K A;  2O9Z A;  2XLS A;  4H2Q A;  3NK0 X;  4K8D A;  3URH A;  4II2 A;  4B64 A;  5IPY A;  4H4V A;  2C65 A;  1TDO A;  3KU9 A;  4H4U A;  1FOH A;  3FG2 P;  2FJD A;  3B6D A;  2WP6 A;  3CTY A;  3CMM A;  4USQ A;  4U8M A;  4YKG A;  4RG4 A;  4J31 A;  4U2S A;  4YKF A;  1D4C A;  2EQ6 A;  2W0H A;  4NNJ A;  1E1N A;  4H4R A;  4Z2U A;  2BRY A;  4EIQ A;  3SQP A;  4AOS A;  3UOZ A;  1GAL A;  4C77 A;  2GEW A;  1PS9 A;  5GRT A;  4OCG A;  4JQ9 A;  2OAM A;  3L8K A;  5L46 A;  1GND A;  1NG4 A;  4EMW A;  4G9K A;  1BKW A;  2WOI A;  4HB9 A;  3GYX A;  4YWO A;  4DNA A;  4CNK A;  4EMJ A;  2WET A;  1K0I A;  4G73 A;  2BYB A;  1DOE A;  2X3N A;  3LXD A;  2BK4 A;  5M0Z A;  2APG A;  2V60 A;  3RP6 A;  3SGL A;  2XLP A;  1F8R A;  1TDE A;  1OJC A;  3DH9 A;  4CRT A;  3CGD A;  4CNJ A;  2JKC A;  1YQ4 A;  4OPD A;  4B65 A;  3ICR A;  1PXB A;  3DK8 A;  3DGZ A;  1VG0 A;  3NYE A;  3UTF A;  3AE9 A;  4BV6 A;  2J3N A;  4M52 A;  4E0V A;  3NLC A;  2NPX A;  2WP9 A;  2YVG A;  3AE8 A;  4A9W A;  1SEZ A;  2BCG G;  1ZMD A;  4JNQ A;  4U2T A;  4UDQ A;  3QVP A;  4BK2 A;  1EL7 A;  3DA1 A;  2IVD A;  4DSG A;  2V5Z A;  1B5Q A;  2AQJ A;  2GR1 A;  5J7X A;  3UOY A;  4YSZ A;  2JK6 A;  2JB3 A;  5EB4 A;  2C73 A;  2CFY A;  3KVE A;  4J33 A;  4H4Y A;  1OJT A;  4D04 A;  3SZF A;  4J2W A;  2GR3 A;  1GSN A;  3EAO A;  4RSL A;  1N4U A;  1FCD A;  3AYI A;  2GRT A;  3AE7 A;  4EQW A;  1NDA A;  3CPI G;  4G74 A;  2V3A A;  1KSS A;  4GR1 A;  1Y0P A;  4A65 A;  1ELI A;  3RP7 A;  4J57 A;  5EB5 A;  4UDR A;  1Y56 A;  3K7T A;  2BAC A;  4BJY A;  5JCM A;  5BRT A;  3AE3 A;  4J56 A;  1OJA A;  4TLX A;  3ZDN A;  1F8W A;  4WCT A;  5CQF A;  1H84 A;  4USR A;  4EQX A;  2BXS A;  3ATR A;  1GV4 A;  3B3R A;  1CJ3 A;  1NHR A;  3V3N A;  4Y4M A;  1XPQ A;  3ALL A;  2Q0L A;  3GSI A;  3V76 A;  4DGK A;  2YLR A;  4H4Q A;  4RG3 A;  1P2H A;  3RP8 A;  3GMB A;  3NK2 X;  4A7A A;  1GXF A;  3R9U A;  3CNS A;  2YG3 A;  4NTC A;  1OJ9 A;  3CNP A;  2VVL G;  1PJ7 A;  2ZZ0 A;  1JRZ A;  2TPR A;  3QSM A;  4IA6 A;  3NKS A;  3UKQ A;  4EM3 A;  1PBF A;  2VOU A;  1LQT A;  4OPL A;  2R0C A;  4YTN A;  2JBV A;  1GTE A;  4CCR A;  2VZ2 A;  3VQR A;  2C3D A;  1MOK A;  2Y6Q A;  3BHF A;  1MXT A;  2GMH A;  3FBS A;  2YQU A;  4U8P A;  3PO7 A;  3DGH A;  4YSX A;  3AEC A;  3OC4 A;  3AYL A;  4K22 A;  3P4P A;  3SXI A;  4K2X A;  4LII A;  2R45 A;  1H83 A;  3T2Z A;  3CIR A;  5U63 A;  3P4R A;  4YT0 A;  2WPE A;  4N9X A;  1UKV G;  2F5Z A;  3QFA A;  1K0L A;  2WP5 A;  4X9N A;  3SFE A;  3LJP A;  4YTM A;  2IVE A;  2BAB A;  1CJ2 A;  4U8N A;  3S5W A;  1KDG A;  4X9M A;  1DJN A;  1PBE A;  4G6H A;  4BUR A;  1ZK7 A;  2B9X A;  2GH5 A;  1JNZ A;  1EL9 A;  2B7S A;  4YSY A;  2XYO A;  4B69 A;  1H82 A;  1N4W A;  3BI4 A;  1GRA A;  2XLT A;  3ATQ A;  3NGC X;  4HA6 A;  3ADA B;  4DSH A;  4A99 A;  1OJD A;  4ECH A;  1D5T A;  4FX9 A;  1GT8 A;  1GET A;  2XCG A;  1F6M A;  3BI2 A;  3QJ4 A;  5IQ1 A;  3S61 A;  3SM8 A;  1QJD A;  3AE6 A;  1FEC A;  1HYU A;  1EL8 A;  1L9E A;  2C64 A;  1GRH A;  1DOB A;  2C76 A;  1LQU A;  3HZL A;  4H2P A;  2EQ7 A;  3AE2 A;  4AP3 A;  5KMS A;  4TM1 A;  5BUK A;  3SZW A;  4OPI A;  5HYM A;  3RED A;  4Z44 A;  1O95 A;  1PXC A;  3UKL A;  4Z25 A;  2WDV A;  3G5Q A;  2R46 A;  1DOC A;  3UOX A;  1O94 A;  3UP5 A;  1D4E A;  5KOW A;  2XFN A;  4J36 A;  4U2L A;  2Q6U A;  1CHU A;  1XDI A;  2RGO A;  3AEE A;  3AXB A;  3SX6 A;  2R4J A;  4EQR A;  2PHH A;  3O0H A;  1BWC A;  2YR4 A;  5KVI A;  3CGB A;  3HYV A;  1O5W A;  3AEF A;  2V6O A;  2VQ7 A;  2WPF A;  1ZDL A;  2GR2 A;  2C72 A;  2WOV A;  3CGE A;  2HQM A;  2CUL A;  1DXL A;  2E4G A;  4C74 A;  1JU2 A;  1PBB A;  2VQB A;  3AD7 B;  1ZY8 A;  3UTH A;  2GMJ A;  4U8J A;  1GEU A;  3RNM A;  3P1W A;  4P9S A;  3AEG A;  1H6V A;  4U8L A;  2C70 A;  4C3Y A;  3NHO X;  3GYJ A;  4AOX A;  2XLU A;  1CC2 A;  3H4K A;  4AT2 A;  2V3B A;  1LPF A;  3I3L A;  2FJA A;  2H89 A;  3HYX A;  3KPF A;  3NN0 X;  3QFB A;  3AD8 B;  3M0O A;  1S3E A;  2WPC A;  2ZZC A;  1NPX A;  4BJZ A;  2VRL A;  4JY3 A;  2DKH A;  3UKK A;  2YVJ A;  3BI5 A;  2RGH A;  1NAA A;  1CJ4 A;  2B76 A;  2X99 A;  3P9U A;  4GRT A;  3VRA A;  3ZYX A;  2C4C A;  3LZW A;  2R0P A;  2RAB A;  2VRM A;  4JNA A;  4NTE A;  1TYT A;  2YM2 A;  1LV0 A;  2B9W A;  2Q7V A;  4EMI A;  1JNR A;  3NIX A;  2C67 A;  3F8R A;  2YM1 A;  4ZCD A;  3AYJ A;  4D03 A;  4OPC A;  1CBO A;  3DME A;  3IWA A;  2Z5Y A;  4H2R A;  1IJH A;  3GDP A;  1GTH A;  5HXI A;  1ZP0 A;  1M64 A;  1BGJ A;  1QO8 A;  2BC0 A;  1BGN A;  3P4S A;  1S2Q A;  2BS4 A;  3NN6 X;  4GDP A;  1KNR A;  2A8X A;  1GRG A;  4OPT A;  4B1B A;  4G6G A;  3E1T A;  1LVL A;  4LA1 A;  1N4V A;  2C3C A;  4OPG A;  4UDP A;  3LOV A;  2GV8 A;  2YLT A;  2XDO A;  3VR8 A;  3QSE A;  4GUV A;  4GDE A;  4JN9 A;  3T2Y A;  3NTD A;  2YG5 A;  3NK1 X;  3K30 A;  3T31 A;  3G5R A;  5HHF A;  1F3P A;  3ABV A;  4X4J A;  5JCI A;  1CF3 A;  5JCK A;  1ONF A;  3CNT A;  3CPH G;  1RP0 A;  4O5Q A;  2BK3 A;  4FK1 A;  3DK4 A;  4U8K A;  4YSH A;  5KMR A;  4MJW A;  1H7W A;  3T0K A;  5LV9 A;  3KD9 A;  2JB2 A;  1XAN A;  1GPE A;  1VQW A;  2QA1 A;  3GWF A;  1PHH A;  2PYX A;  1RYI A;  3T37 A;  2VVM A;  2YLZ A;  4ZN0 A;  1N1P A;  3DJD A;  4BK3 A;  1TDN A;  1F8S A;  4CY6 A;  1Q1R A;  2V61 A;  2YLS A;  2BA9 A;  1PBD A;  2XVI A;  3UKP A;  4IVM B;  4REK A;  5U25 A;  4Y4L A;  1B37 A;  3OZ2 A;  3PVC A;  1NG3 A;  3FIM B;  4YXD A;  2BXR A;  3AE4 A;  1E7P A;  1PDH A;  3AD9 B;  3UKH A;  2C7G A;  5FS9 A;  1YQZ A;  3NYF A;  1GER A;  3C96 A;  4A79 A;  2JAE A;  5KMP A;  3LB8 A;  5IQ4 A;  1JRX A;  2YLX A;  5KNL A;  4XWZ A;  3NT6 A;  3JSK A;  2EQ8 A;  5JCL A;  3VRD B;  2RGJ A;  1YKJ A;  2A87 A;  3SY4 A;  1FEB A;  3C4A A;  3L1R A;  3V3O A;  4GCM A;  4XWR A;  4CCQ A;  1IUT A;  1Z6L A;  1KF6 A;  4KPR A;  2B7R A;  2H88 A;  1H86 A;  4H4X A;  4O5U A;  5EOW A;  3SZ0 A;  4B63 A;  3COX A;  4EIP A;  4H4P A;  4I59 A;  4IA5 A;  5CKU A;  3UTE A;  3HYW A;  1CC6 A;  1ZKQ A;  3LZX A;  1V59 A;  1KFY A;  2OLO A;  2I0Z A;  1H7X A;  3SYI A;  4B67 A;  1IUV A;  4I58 A;  1S2Y A;  1D7L A;  3EPT A;  4EQS A;  1MO9 A;  4TM3 A;  3NG7 X;  1RSG A;  1FL2 A;  5U1O A;  2R4E A;  1PJ6 A;  1GRF A;  4K7Z A;  2NVK X;  2GR0 A;  3AE5 A;  3FPZ A;  4BK1 A;  1B4V A;  5DBJ A;  3FMW A;  2XFP A;  1DNC A;  2GAH B;  5C2T A;  2X8H A;  2YG6 A;  1XHC A;  2ZBW A;  3F8P A;  3GD3 A;  1S3B A;  1TDF A;  1IUS A;  1ZMC A;  4TM4 A;  3H8L A;  4CBQ A;  5FMH A;  4ADW A;  4GAP A;  3ICS A;  4Z24 A;  3NNE A;  4H4W A;  2YR6 A;  2YG7 A;  4JY2 A;  2WU5 A;  4WX1 A;  1JEH A;  4Z43 A;  3Q6J A;  2XLR A;  2C66 A;  1IUW A;  2GQF A;  2QAE A;  3BHK A;  1KNP A;  5J60 A;  1PN0 A;  1E1M A;  3GYI A;  1ZOV A;  1D4D A;  5KVH A;  4LU6 A;  1IUX A;  4A6N A;  2YG4 A;  3GWD A;  3IF9 A;  3NTA A;  3AWI A;  3DK9 A;  1B8S A;  4FK1 C;  4IV9 A;  2WOW A;  1VG9 A;  2DKI A;  1NEK A;  2YVF A;  1ZX9 A;  5FS8 A;  4U8O A;  1GOS A;  4TLZ A;  3IC9 A;  4KX6 A;  2YWL A;  1CJC A;  1COY A;  1KSU A;  2UZZ A;  1DOD A;  4EM4 A;  5BUL A;  4H50 A;  4A6N B;  4H7U A;  1JOA A;  1Y56 B;  3AED A;  5KOX A;  2A89 A;  4IVO B;  4NEV A;  3CPJ G;  1GES A;  4ZCC A;  3G5S A;  3H8I A;  1PBC A;  2IID A;  2YLW A;  5FS7 A;  1EL5 A;  2QA2 A;  3GD4 A;  3KPK A;  3AB1 A;  3KA7 A;  3ALJ A;  2AAQ A;  3AEB A;  1P2E A;  2C75 A;  1GRE A;  1LTX R;  3II4 A;  3ITJ A;  4NEW A;  4PAA A;  2YAU A;  3SZC A;  4ICY A;  3C4N A;  4Y4N A;  1CC4 A;  2XVF A;  3EAN A;  4FDC B;  4H4Z A;  1ZOY A;  2CDU A;  2YR5 A;  3NYC A;  4Z2T A;  5JCN A;  4J34 A;  3UP4 A;  5ER0 A;  3AE1 A;  4AT0 A;  3BNU A;  3CND A;  2E5V A;  4U8I A;  5KRQ A;  2E1M A;  1DJQ A;  1L9D A;  2BK5 A;  3K7M X;  3UOV A;  4H4S A;  5KXJ A;  4TM0 A;  4UP3 A;  1E39 A;  1BZL A;  2EQ9 A;  2FJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...