3NNHA

Crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
b'DAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUGBP Elav-like family member 1
molecule tags Rna binding protein/rna
source organism Homo sapiens
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nnhA00
1RK8A 1WWHA 2KM8B 5LSOA 3MUTP 2CQBA 4RU2A 1FJ7A 2M9KA 3R1HA 4PRFA 5CYJA 1FT8A 2MB0B 2DGSA 2KXNB 2FC8A 2LA6A 1X5TA 2DNHA 2AYBA 5GADU 2MQQA 2I2YA 1VQMS 1SJRA 2CQ1A 5LJ3Y 1VQ8S 2E5JA 2MJNA 2N82B 2AYGA 1JJ4A 4CQ1A 1VQPS 4QU6A 1Q82T 4IO9Q 2OTLS 2CQIA 2K8GA 5IFMA 2CPIA 1VBXA 2HGNA 2V94A 3VAGA 2ZJRQ 5LSLA 2YWKA 1DBDA 3US5A 4CIOA 3DLLQ 2DB1A 4OZ1A 1HD0A 1X5OA 2KH9A 3CC7S 3NNAA 2PEHA 1K73T 2MPUA 1U1RA 2M52A 4CH0S 3JB9k 3G8TA 2ZJQQ 2FPHX 1Q81T 2XSFA 2DNLA 2DGXA 1VQ9S 4QU7A 1KOOA 2DNZA 3S8SA 2DNNA 2RUGA 2RU3A 2MQNA 2MMYA 4PKDB 2F9JA 1R8PA 4BS2A 4TU8A 2DHAA 2MQLA 2DGWA 3FEXB 1OWXA 2XNRA 1U1LA 1X4CA 2CQ4A 3TYTA 1ZH5A 5CA5A 2CPDA 1X4BA 3RW7A 2DNMA 1HA1A 3FEYB 1WF1A 2LCWA 2KXFA 2DHSA 2DGTA 4WFBQ 1VQ5S 3ULHA 3R1LA 3SDEA 2DNQA 2LYVA 2BOPA 2ZJPQ 2MYFA 1VQ4S 1YTYA 2EVZA 2L9WA 4ED5A 2AD9A 1Q7YT 4EGLA 3CCRS 4FXWA 2DGUA 5HL7Q 2XNQA 1VBYA 2DH7A 5JVHQ 3ZZZA 2G4BA 5LJ5Y 4WCEQ 5GVQA 3MUMP 3VF0B 2MGZB 1NO8A 3CCES 3CCSS 1X5PA 2LECA 2M2BA 1VC6A 5EN1A 2DHXA 2DISA 2LXIA 1U6BA 3CCUS 1PO6A 2JVRA 2KXHA 2EK6A 3NS5A 1R8HA 2XS5A 4IOCQ 3Q2SC 1DHMA 4QQBA 2MQPA 2KG0A 3I55S 1QVFR 2J0SD 2QA4S 2LQ5A 5DDRC 3UCGA 5FJ4A 2N3OA 3EGZA 3V4MA 1U1PA 3EX7B 3P6YC 2CQDA 1M5KC 5HO4A 3NMRA 4A8XA 4CH1A 1Q86T 3G96A 1ZZFA 2MSTA 2E5HA 5DDQC 5DM7Q 4IOAQ 3SXLA 3BO3A 2MSSA 2JVOA 1ZZNA 5IM0B 5D78A 2M70A 4ZKAA 2XS2A 2G0CA 2E5GA 5D77A 1WEYA 2HZCA 2U1AA 3MXHP 1YIJS 3IRWP 2DH9A 2AYMA 2DIUA 3CPWR 2L41A 4YOEA 3BO2A 4Y0FA 2VOOA 2MKCA 2KVIA 3D2WA 2X1GA 1UW4A 1U2FA 1FO1A 3B4MA 3CXCR 2CQHA 2M0GB 3DXBA 2VONA 4J5OA 3L3CA 2FC9A 1H2UX 2X1AA 2CPHA 2D9PA 1DZ5A 2MKKA 4W92B 5IM0A 3P49B 2K3KA 3TO8A 1WF2A 4TU9A 3CCLS 5GAHU 3G6ES 1JMTA 2MXYA 5DM6Q 1G2EA 2LMIA 1OO0B 2B0GA 2MGZA 3CCQS 2N3LA 1M5PC 1WHXA 2YH0A 5ITHA 4TU7A 1WTBA 3UD4P 1DRZA 5GAEU 2E5IA 1QM9A 1WHYA 2YH1A 3MUVP 2MZSA 2ADBA 2RRBA 2MZJA 2CQPA 4V19X 4M5DB 1VQOS 2EK1A 2OTJS 2RS2A 1WG4A 4C7QA 5DDPC 4IUFA 4WKRA 4ERDA 2M8HA 3P3DA 2LXUA 4C4WA 5LXYA 1X4AA 2CQ0A 2OSRA 3LPYA 1BY9A 2MZ1A 4OZ0A 5MLCV 1SJ4P 1FJEB 2Q79A 3PIOQ 2MY8A 3VAJA 3R27A 3CD6S 2DGVA 2JX2A 5BJRA 2UP1A 3EGNA 2BZ2A 3P5TL 3N9UC 2KT5A 5GMKa 1JJ2R 2PE8A 1WELA 2J8AA 2M4MA 3S6EA 1VC5A 3CULA 2JWNA 3CUNA 2J0QD 1U1QA 2A3JA 2XB2D 1JJHA 1W2BR 3HHNB 2I38A 4UQTA 2HGLA 1KD1T 2KHCA 2MJUA 3H2VE 3MURP 1SJFA 1N8RT 2CPXA 1VQ7S 1WF0A 1HD1A 1X4DA 2MHNA 1VBZA 1WG1A 4P6QA 2RQCA 3TP2A 3J7ZT 2MKSA 2DH8A 2CPEA 1YJWS 1N54B 2M88A 2ADCA 4LIRA 4PR6A 2HGMA 3CMAS 3H2UB 5GAGU 1VQ6S 3S7RA 2GO9A 2M8DB 3MI7X 1YJNS 2JRSA 1S79A 2D3OR 1YI2S 4W90B 2DIVA 1N88A 3VAMA 3CTRA 2M7SA 1K9MT 1H6KX 1HL6A 2NZ4A 2FY1A 1X4EA 2QEXS 1XN9A 4QPTA 3CC2S 2DNKA 3SMZA 1YJ9S 2DO0A 3CCVS 1IQTA 1S72S 2X1FA 4C0OC 2DNGA 4UY8T 2DK2A 1VC0A 1H2VZ 1WHVA 2DHGA 2DO4A 1D8ZA 2LEBA 2CPFA 2VODA 2RVJA 2CQCA 4LMZA 1FHTA 2OIHA 1U6FA 1X5SA 2LKZA 3S01A 1VQNS 5JVGQ 3U1MA 2MZRA 3K0JA 2KFYA 2D9OA 1FXLA 2HYIB 2DNOA 1U1MA 4Y00A 2MKHA 3VALA 3MOJB 1WEZA 1D9AA 2DGQA 2F3JA 3UWTA 1A7GE 4WF9Q 3IWNC 1SJ3P 1URNA 3NNHA 3THTA 1X4GA 1U1KA 2XS7A 1UAWA 2VOPA 4U67Q 2KYXA 1M5VC 2RS8A 2KU7A 3UCUP 1X0FA 3LQVA 1B7FA 1P1TA 1OPIA 3BEGB 3HI9A 1YITS 5H1SV 4LJMA 2RRAA 2DITA 3B4DA 3THPA 2O3DA 2RT3A 2MQOA 1U1NA 3RW6A 3CF5Q 2MQMA 2J76E 2CQGA 3VAFA 3BO4A 3PIPQ 2LA4A 3VAKA 1WI6A 1NU4A 1FNXH 2KI2A 2NLWA 5LXRA 2L08A 4WFAQ 1AUDA 2KRBA 5DETA 1N52B 1M5OC 2CQ3A 3NS6A 1CVJA 4F25A 2E44A 2U2FA 4WIIA 3U1LA 2KRRA 2HVZA 3NNCA 3UE2A 1WG5A 2CPZA 2GHPA 3UCZP 1L3KA 3J7YU 3ZZYA 1KOHA 1UFWA 2RQ4A 3MDFA 5CXTA 2SXLA 4F26A 3SDEB 1UP1A 2RNEA 1VQLS 1P27B 3VAHA 4Z2XA 1U1OA 3CMES 2CJKA 2MKIA 1H2TZ 4WFNQ 4FXVA 3CCMS 3OW2R 2FHOB 2MZQA 3CCJS 1SJQA 1RKJA 2MY7A 1K8AT 1X4HA 1M90T 1F9FA 2DGOA 2LEAA 1FJCA 2CPYA 1PGZA 1WI8A 3VAIA 2MKJA 1KQSR 1WEXA 2QFJA 2N7CA 4TLQA 3G9CA 1VQKS 3Q2TC 2F9DA 3BS9A 3G8SA 1SXLA 4YB1P 2CQ2A 2OJ3A 2YTCA 2X1BA 2KG1A 3MD3A 2DNRA 3G71S 3MD1A 1WHWA 1QVGR 3G4SS 3UD3P 3I56S 2MZTA 1M1KT 1KC8T 5IQQA 1OIAA 4F02A 1YWXA 1A9NB 2AYEA 1X4FA 2ERRA 1O0PA 2DNPA 2OSQA 4YUDA 2KN4A 2CPJA 2WBRA 2G1DA 2KM8C 5DDOC 3CC4S 1NJIT 2DNYA 1YHQS 2YKAA
chains in the Genus database with same CATH superfamily
1TTHB 2KM8B 1ZM3A 4YB5A 2ZHAA 1M1HA 2B4PA 1FRJA 4DSIA 1NJXA 3JSMA 2OPRB 3PRBA 4HL9A 1VYAA 3R1HA 4PRFA 3PHTA 2YKPA 3UR0A 5U47A 3GJSB 2L9NA 3PJWA 2MB0B 3IS9B 2DGSA 2KXNB 1D9DA 1QE1B 1LV5A 2UZAA 2ZC4A 4TNOA 5D15A 4L72B 5F0WA 4NZ6A 1BHNA 4BWJA 3BKTA 5GADU 2IRXA 2Z2ZA 4EUVA 1S9GA 4U8YA 3MEKA 2HWIA 2WSEC 1XMQF 2HBQB 4UQGA 1U6ZA 3W1YC 3JSBA 3PG9A 5HROA 2VASA 1VQSA 2H65B 5LJ3Y 1VQMS 3AD7C 3WQPA 4BDPA 1UVMA 1UKUA 2GQ2A 1C4CA 4HH0A 2EFPA 5L1JA 1R8BA 3HSDA 2ZZNA 2HHQA 1UA1A 1R7IA 2E5JA 1OQ3A 2DXDA 4HEA9 3T5HA 2AYGA 3MM8A 2G9OA 1X9SA 1VQPS 2L3MA 3HHLB 4TKTA 5KTQA 2UUCF 4QU6A 4IO9Q 4ECUA 3HJFA 1NM2A 2CQIA 2QZ8A 1GQEA 3HVWA 5B0CA 5IFMA 2HBYB 2W9CB 2J6TA 2ZZMA 2VD3A 3M2UA 2F8MA 3VAGA 3KJNB 1DBDA 3BDPA 4A8OA 3IS9A 4OZ1A 4C11B 3JQJA 1QE1A 2NPFA 1RISA 3PX4A 4QW8A 4FXDA 2ALYB 2HLUA 1U1RA 2M52A 4JI7F 4X64F 4CH0S 3G8QA 1FE0A 2Y1RI 3F0NA 1TL1B 4URGA 1X0FA 2VKZG 4F0MA 2GVDA 3WIVA 1IKWB 5KFBA 3GIJA 1KSPA 4PYAA 3R8YA 4HKQA 1K0TA 3CB4A 1V3RA 3I0SA 5E3RA 5KT4A 2IJFA 4KR0B 1FD2A 4IOBA 3VGUA 3S8SA 1F5BA 2RUGA 4K50A 1R6YA 3D4JA 3SFUA 4F36A 4LF4J 1IM4A 1GFWB 3OVAA 2MQNA 4AQYJ 2MMYA 3V81A 3KMSA 1FEHA 1RAJA 3MM8B 4PKDB 4J9SA 2C2EA 4OYXA 1R8PA 4X66J 4LQ3A 1NHUA 4RW9B 4DUZJ 2NS1B 1JLBA 2W4DA 1CJVA 3FEXB 1RXOB 2XNRA 4J9QA 2Y0BB 4D3HA 1UL3A 1RT3A 3QGPA 1OSCA 3TYTA 1HQEB 1ZH5A 1RI7A 4L3KA 1R3NA 3FCVA 4IR9A 2CPDA 4JI2J 2RHSB 2EC0A 1SKWA 1X4BA 3RW7A 2LU1A 3TA1A 1VR6A 1QSYA 1ELOA 2Z2MA 3T9ZA 4DR7F 4RUHA 3BYPA 4OYWA 2E1RA 3IFEA 2DHSA 4USHA 4EK2A 3GILA 1IBKJ 2XZTB 3S1TA 1QTNB 2IRYA 2Z56B 3NRBA 2J0XA 1U0SA 1B0PA 3IG1B 4B9MA 1Y3JA 2LYVA 2BOPA 3MPYA 2O01C 5KFIA 4AXIA 1VQ4S 1S4FA 2HHXA 4DEZA 2L9WA 3FFIA 3SIPB 4CNYA 3AODA 1NK6A 4EGLA 1FESA 5KFMA 1ROFA 5HMWA 3HHDA 1IR1A 3PX6A 1GMVA 4FNHA 4FXWA 4M5MA 5HL7Q 1K47A 3KLFB 3CCRS 2R8KA 4CTAB 3ZZZA 3TEHB 3OTDA 3BSNA 5JVHQ 3TUJC 1B0VA 1EJ7L 4C8YA 3MR2A 3OTCA 4RBVA 3RBDA 3IR7B 3ILJA 4Q7AA 3KLEA 3K5LA 2AQ4A 3CDAA 3OTEA 5KT6A 5L1LA 1S0VA 4WU2A 2L9DA 3OXGA 3OV7A 1NHVA 3N6LA 1I5OB 3NLCA 2DXFA 1XR5A 4XDCA 1R8AA 3M1VA 1I94F 1X5PA 3DRXA 4C8NA 2V8PA 1Y9OA 2DCUB 4N56A 1HBUB 2BKPA 2ZH3A 4KGMA 1VC6A 3KG4A 3B6BA 4O3OA 2AIRB 2V9KA 3NGTA 3I5CA 4Y28C 2R7XA 2DISA 2LXIA 2K1RA 1IUJA 2JEIA 4O4GB 2V4JB 5GMDA 1AW0A 4JI4F 5BR8F 1BXNA 5DG9A 1NB2A 3W3SA 4IOCQ 3Q2SC 1DHMA 2MQPA 3HVTA 4YY3J 1UZHA 4IRCA 3I55S 1YZ6A 1UPMB 4ZPCA 4P10A 1RTHA 3H8YA 4B3OA 1HHSA 4EZ9A 1HQUB 3CDWA 3ZTRA 1FEEA 1NH7A 4JI0F 1C1BA 4G1QA 3GIRA 7AT1B 2WSCC 4JI6J 4LF5F 3OFGA 2NREA 3IP0A 1XMOF 2BABA 3C16B 5K20B 2N3OA 3V4MA 1UPPA 4I67A 1WKJA 1X7VA 3EX7B 1RHRB 3MZIA 1YJUA 2IM3A 3IAS9 2AF6A 1Q86T 1JNRB 2LQBA 3DRPA 1NKCA 1RTJA 1QSSA 2AX1A 1NRKA 2RKIA 1ZA1B 4DL0C 3TA0A 4O4GA 3NGUA 3HT0A 2R8JA 3MMAB 2Y1JA 2OLWA 2XULA 4ZKAA 1UEUA 4C3MA 1U2RA 1LWXA 1EKRA 3CVKA 1Q7LB 2J7UA 2E5GA 3JYTB 1B70B 1WEYA 5HAOA 3KNGA 1WC6A 5A76A 5KFLA 1KVIA 3W7BA 1KEKA 1KLNA 4A8QA 1J2VA 4DR3J 3MXHP 4ZVTB 1SCJB 3KLHA 1DURA 5DGAA 4V19J 4IH5A 3CPWR 3TAPA 1RP5A 2ZNYA 9RUBA 2W2PP 3BO2A 1FWLA 1RB0A 3BSAA 2MKCA 2XWYA 2KVIA 2HNDB 3IBWA 2CJYB 3F44A 4C48A 3AQOA 3D3CJ 4USJC 2B4UA 3FRYA 1UW4A 3EDRB 2QE5A 5IV4A 3H90A 5F8IA 3CD0A 4ZCIA 1HMVA 2B5JA 4MT1A 1LW2B 3H20A 2ABYA 2Z8QA 4B9TA 1FO1A 1S7HA 2M0GB 4NI2B 4NLPA 2UXCJ 3OQ2A 2FC9A 5CZVA 1NJZA 1H2UX 2PSZA 3SQOP 4DS5A 3TANA 1DZ5A 2MKKA 4A8SA 1VCTA 2EG1A 5CD4H 4X2BA 1CSJA 5KFGA 1R0AA 2HQ3A 3P49B 2K3KA 4TU9A 3ILIA 5GAHU 1JMTA 2J8SA 6AT1B 2F4FA 2B0GA 2VA3A 2FLNA 2VH7A 2ZH7A 3ISND 4K4TA 1OQ6A 4OZ5A 3ZTPA 4NLRA 4ELTA 1C0UA 4Y3CA 3DGPB 1V5VA 2CJXB 3RGIA 3UD4P 1DRZA 2W7OA 5I3PA 3GFZA 1RTIB 3TJ9A 2E5IA 2QLWA 5GAEU 5KG6A 3MUVP 2ADBA 4JYAF 2F1FA 4WKYA 1MU2B 1RAIB 3ZZ0A 3QRPA 2A1BA 4ITSA 1VQOS 1Q8KA 5F0UA 2RS2A 4NZ0A 3FBBA 2QLFB 4YP3A 5LMNJ 3MECB 4IUFA 1FRXA 4M63A 2HNYB 1PYOB 3D6TB 2VQFF 5FDLB 2M8HA 1VMBA 1V5IB 2OPSB 3EDQB 3QIPA 1T8EA 2HFNA 4KHRA 4I7FB 3R6LB 2VU5A 4Y2AA 1X4AA 1YG0A 2RDDA 5J2PA 1RT1A 2YNFA 5J2MA 1OS5A 2PD1A 4OZ0A 1SJ4P 1YHQS 3FDSA 4B9VA 1T9UA 2YKMB 2VC1A 4ZVUB 2GS8A 4OX9F 5FD1A 1UWBB 3HZGA 1ACMB 4OLPA 3HHLD 1DARA 3IN5A 3CD6S 4WP8A 3NL0A 5CYQA 4DFPA 1RCXB 1U0HA 3VVUA 1T95A 3I9V9 4C3KA 1IBMJ 2VFTA 2W9CA 2ZD1A 3RTVA 3QWPA 5HJXA 4DV5J 2R9LA 2W9BA 1CJKB 2BKNA 2C2MB 2ZH2A 4O0IA 1IXKA 2J8AA 3FZBA 1A0OB 1TUVA 4DX8H 3CULA 4EBDA 3WDOA 5JUMA 2KT3A 3B78A 4NEYA 2WK4A 2J0QD 2A3JA 1DTTB 1UVLA 1O5JA 1JJHA 2FD2A 2FTRA 1MW7A 4U7UK 2JC0A 3W62A 3KHRA 2CZVC 4K8RA 3HHNB 1G1XA 3QAUA 4P75A 4UQTA 4RW8A 2I9SA 3PXGa 3HZEA 2HGLA 4OX6A 3U02A 3OBIA 3GIMA 2KHCA 3MMCA 4LIWA 2DEJA 3I0RB 3O3LA 4IYQA 4DBQA 1N8RT 3QWUA 2ATLA 1H7XA 3TZZA 1HW8A 3M7VA 2MHNA 4QWDA 4I6AA 1AFJA 4DQSA 4P6QA 1ZPVA 2QJ3A 2YNHB 3JSRA 3KG0A 3OR2B 4FZVA 4CT9A 2H9ZA 3PR5B 3NEKA 2YNGA 2F63A 3J7ZT 3D9BA 1Y00A 2IAJB 3OFFA 4RUAA 4UZBA 1S1XA 4P7TA 4RW9A 1T9VA 4CO1A 4EYHB 2QFIA 1JNZB 3TX0A 1N54B 9ATCB 2GO8A 2HW3A 4LIRA 4A47A 1RUSA 2R42A 2HGMA 3CMAS 1I1GA 2HVEA 2CXEA 1GMWA 2JLFA 5D0EA 3S7RA 1CS4B 5KFOA 4QWCA 2GO9A 2QSWA 3LGNA 3AY0A 1TV6B 2C42A 4ETZA 4GVLA 2WONA 3SV4A 2D3OR 3KJQB 2EFNA 2CUYA 4DV3F 1S1TA 1FKOB 2BJ1A 2E7XA 1K9MT 1SV5B 4HT5A 3MMCB 2NZ4A 3K17A 4WP3A 3A8EA 1YJRA 3MMBA 1HWKA 3NP5A 3PEJA 1AZSB 3RAMA 2FJVA 3LWLA 2Y8WA 3M9MB 4HTIA 2V2QA 1FJGJ 3MFIA 4UT4A 1JLGB 4EYIB 2FHKA 1S72S 4NCAA 2X1FA 1QAYA 4DL2A 1RWMB 3EJMA 3CNQP 2QL7B 1N32F 1VC0A 1H2VZ 3BPDA 2YNGB 4OYPA 1C1CA 2DO4A 3IMQJ 3QBCA 4WIQA 1D8ZA 4B3SF 2VODA 1EX8A 2RVJA 3OPKA 2OMLA 3HF5A 4LMZA 4HHHA 1CEZA 4F0HA 2OPPA 5J2QA 4YEAA 3DYAB 4JV1A 4NXNF 2FVPA 4IDKA 1M1GA 3S01A 4Q45A 5JVGQ 1TFWA 2POKA 1P6TA 1U8WA 5B0FA 3K0JA 3BV8A 3DI6A 2D9OA 3LANA 5K14A 2KFYA 3DDIA 3N4WA 4DMZA 1JWWA 2DNOA 3DLGB 4N47A 3PW7A 4LSNB 3PCOB 5HP1B 3G87A 1U49A 3RU0A 1FFGB 3LP2A 5LL6d 2C2OB 3LPEA 4A4JA 4Z37A 3VALA 1OMSA 1ZS6A 4URQU 3HMJG 5D4NA 3QIDA 4KY3A 1AZSA 3D0HE 5D4OA 1TK8A 4WF9Q 3IWNC 3GJRB 4HLBA 4JUZA 3MPVA 2Y9HA 3E3XA 4ZCLA 3THTA 3FZ2A 1RYRA 1TKTB 1UAWA 3U7JA 3UNGC 2CG8A 3ISNC 4KC5A 2XS7A 4DPYA 1WOSA 3NCQA 3KK2A 3HVTB 4OIXA 1TK0A 4LF8F 4JV5F 2VBXA 2ASDA 1FFSB 1V3SA 1U7LA 2UVRA 5KFSA 1KLMB 1REVA 2A2DA 2BJ3A 3KK3B 1QUPA 2NUHA 2QN6B 2YNIB 2P9GA 5J2NA 2J9DE 1XNQF 5F8JA 3UCUP 1WOPA 2O67A 1NKBA 1B7FA 4I4BA 2XEXA 3QPIA 4PWWA 5H1SV 3TNVA 2JLGA 2K7JA 5KT7A 3T5JA 1NZAA 5L39A 2V8VA 4PG5A 4Z7CA 4IDKB 3BSCA 1T05A 2GHVC 2ROPA 3THPA 3QNWB 5C42B 2ZH8A 1TZ0A 3TZXA 3DC2A 2QMWA 2W4PA 3PJ9A 3DLGA 1HNIA 2MQMA 1YX2A 1N34J 2I5JA 5CAAA 3BO4A 2ZWPA 2KVQE 4OZ2A 3PIPQ 3M05A 4ZIVA 3PKYA 1JLQB 3PX0A 4WWSA 3PKMA 4EO6A 3DMJB 1RE1B 1D1UA 2NUUG 3P5BP 3AT1B 2VPXB 1PAEX 2VFUA 1RHMB 2NLWA 3BH6B 4HI1A 3LP1B 2PGCA 4OLOA 2UVWA 2KFZA 5LXRA 5DGBA 5CD4A 1X60A 3D3BJ 1EHWA 4ES2A 2C3OA 1AUDA 4NCGB 2VBZA 1DTQA 1RT2A 1FI4A 1FNMA 2PC6A 2NXJA 3KK3A 1S76D 3BJYA 1M5OC 2IYIA 3L7OA 4B17A 4FF1A 2CQ3A 4OZJA 5B08A 5F8HA 4ZPWR 1G7CB 4WIIA 1UVKA 4OL8A 5EX0A 2HBZB 3T1HF 3NNCA 3A3NB 1RTZA 1TUWA 3H59A 1IKYA 1S6QB 4LSLB 2UUTA 3FK4A 2F7VA 4LR8A 2FVQA 1VLYA 4X4OA 4GKJJ 1S0NA 4NX9A 2HMIA 3BGOP 4GRSA 2SXLA 4LRBA 5DO2A 4KHPF 4S0MA 4LSZB 4L73A 2FLOA 1QDUB 4DV6F 2C3PA 3GE9A 1HNZJ 3M2RA 1SIWB 1N5YA 4QPXA 4DL4A 1KVKA 3PTWA 1FDAA 4XDDA 3CCMS 1QAXA 4LF1A 2MZQA 1FXDA 3ELHA 4PQAA 4NLTA 4X4RA 4F8RA 2NXUA 5KFXA 2HHHJ 3TOQA 1X8DA 4ZDNA 4W4MA 4DHVA 4O44A 3JAMY 1F9FA 1KTVA 4OJ1A 1O6XA 3JS9A 2YBVA 4UOCA 4Y6IA 2LEAA 1FJCA 2CPYA 2PFDA 1T11A 1Y11A 1XTZA 1WI8A 3GFHA 4QR1A 5HMXA 3DLKA 2VHGA 3VAIA 3C6TA 2GGPB 2QFJA 4PQUA 1RCOB 5KFJA 4TLQA 5IWAJ 1TVRB 4WK1A 3Q2TC 3M32B 1OY6A 3G8SA 1ZOTA 2DCLA 4I7FA 4PUOB 2FDNA 1WSRA 4J9OA 3BF4A 1FWPA 3MCNA 4FYVB 2FVCA 2YPZA 2HFVA 4WYWA 2UXDF 1S57A 2EPIA 4GC6A 1DQAA 4ANDA 1E6YA 3MR5A 4ELUA 1KC8T 3CDUA 4YR0A 1I6JA 1QLNA 1LWEB 1A9NB 4LF9J 3R5AA 3KDOA 1X9WA 1T9TA 4Q43A 5E5NA 4E2FB 4B9LA 3QT5A 4O44B 2BE7D 2DNPA 2M3DA 5FIIA 4ZHRB 1RBLA 1T9XA 4NYPA 1T9WA 2G1DA 4ZOSA 4QBUA 4DX5A 2YQ0A 3KLGB 3FC9A 5CHCB 5SUHA 1GTHA 2DRBA 3PFEA 1DQ9A 2YKAA 4Q2MA 5K8OA 2KJVA 3M6VA 3J80Y 3POTB 3J81Y 1RK8A 2BJDA 3J7YI 1IKXA 2OFGX 3BQ0A 3CJ5A 1OY9A 2JNJA 2R3VA 5LSOA 3MUTP 1K1QA 1FJ7A 2W7PA 2M9KA 1AFIA 2XSJA 4MK7A 2JDJA 5CYJA 2MQ8A 5ETPA 5EWEA 3DDNA 4F4AA 5FLXU 3ONQA 1SQFA 1XMQJ 1CULA 4NYZA 3IBFB 1ZAWA 2IC3A 2OP5A 2FYXA 3D66A 3LUYA 3PZPA 2FLLA 5K8PA 1QTMA 5IOLA 3L9ZA 4OMFG 4ZJQA 1MG7A 3JQMA 3Q8RB 4I64A 4P73A 3GYNA 3QRQA 1SJRA 2CQ1A 3W2WA 1VQ8S 2BRLA 4FBUA 3EWGA 1Q5VA 5KFNA 2IMWP 5KT3A 2ZBCA 1RT7B 5A0YA 2NXNA 1VRUB 3O8WA 5LMNF 3MOZA 1SL1A 2AEJA 5HQMA 3Q23A 2GIRA 4FN5A 2LLZA 1EQ0A 4XO0A 5C25B 1Q82T 2EG2A 3V6JA 1U25A 2OFHX 2K8GA 4L3NA 1S1TB 2CPIA 3H4DA 4Q8FA 2RDJA 1CJTB 2H1YA 3NOGA 4XPEA 5LSLA 3US5A 4CIOA 2K1RB 2ZEJA 5B0BA 2UVUA 2DB1A 3CMQA 2AGOA 2V4JA 3VGSA 3ILLA 1RGVA 2IJRA 3C14A 3DOKA 1K73T 2JZ5A 4DOZA 4F0KA 1MN9A 4DS4A 3CEDA 4I2QA 1RAOA 4NA1A 4R5PB 1PG5B 4ZJOA 1S9FA 3I4PA 4MH8A 2ZJQQ 4J9RA 1RTHB 2GMJA 1Q81T 1XNRJ 4OZLA 2XSFA 1Q79A 2DGXA 4QU7A 4B08A 1IBCB 3VQSA 4B3RF 4QOTA 4CI0B 2DNNA 5KFTA 3IO1A 1E6VA 4DSEA 3EYZA 3UDCA 1HNWF 3PYGA 4LBHA 4ENOA 1N5TA 2B8QA 1VRUA 4UTGA 2YWFA 1T3NA 1LWCB 2F9JA 4G6VB 5LOQA 1EQMA 3IR5B 4ZPTR 4DU7A 1S59A 1FRHA 4R0EA 3KKFA 3I5BA 2WHOA 5B7WA 1IM6A 4RW4B 3J81j 5KOXA 4M5IA 1OWXA 5J1PA 1DJ0A 3CCZA 3LP2B 1YSJA 1BQMB 3HP6A 1ULRA 3R97A 3OJSA 5CA5A 1WJ9A 3H25A 1XNRF 3BN7A 3EZUA 4DPTA 4TY8B 3KJFB 1CQMA 2W8LA 2OO4A 3NBPA 1LWFB 1KQGB 3G6VA 3EICA 2KXFA 3T9NA 3EGWB 4JV0A 4YFUA 2K3IA 3W60A 2DGTA 2V0NA 5ETNA 4PZVA 2RSQA 4BLGA 3GR1A 3VZHA 2WVBA 1NK8A 2YVSA 4UUWA 2RMLA 3SDEA 3TZYA 2DNQA 4R8UA 1MNEA 1GXUA 4KKOB 2ZJPQ 2MYFA 3PRDA 2H4YB 4J9VA 4ZA1A 4E0DA 3N0VA 4NRTA 3N5FA 1IQZA 2EBEA 4IH7A 3R9LA 1YTYA 3FSIA 3HXMA 4PWDA 1GXLA 4X4TA 1IWGA 4QW9A 1RHQB 2AD9A 1CPZA 4JI3J 3O2IA 2DGUA 1VBYA 2IA6A 4HACB 2CDQA 1DQ8A 2G4BA 2NSBA 4KH0B 4CM2A 2DBBA 3NCPA 3MCMA 5GVQA 4ETXA 4WCEQ 3VF0B 2OEKA 1XEZA 1U4BA 1HBOB 2NYHA 2W2NP 3CJ8A 3DLEA 3BGRA 3HHKA 4G65A 1TKZA 5KFAA 5KFQA 3DRRB 5E3PA 1MWQA 3GTYX 4LFBF 5KFWA 2E9ZA 2LECA 3IXQA 4F2RA 2M2BA 4F3OA 1F9HA 3G6YA 1HI0P 2VPWB 5C2GA 3AXKA 3VZIA 3SSSA 3GV8B 2BV3A 2ZUGA 4TQSA 3GCXP 3DGPA 3DRSA 4MIAA 3D1QA 3V6DA 1PO6A 1FF2A 1RTIA 3LF0A 4F50A 4Q0BB 1S12A 1RWVB 3HLUA 3NS5A 2P6SA 4JI3F 3M8QA 4QZVB 2XS5A 3C46A 1LOUA 4IFYB 5J1EB 1NUEA 5KG5A 1S4EA 4EBEA 2B4VA 2V4RA 1V6HA 4JI6F 1EETA 4KPCA 1NLKL 1YJVA 3SCJE 4ALZA 4HACA 1WSVA 4YR3A 1PBAA 5A8WA 3SQGA 3T6JA 2QA4S 3PYEA 3PW4A 2DR9A 3UD5A 2XZDB 5HLFA 3UCGA 3I87A 5L8RC 2AT1B 4B3TF 5FJ4A 3EGZA 2BYCA 4HH1A 3GR0A 4J9KA 4QYZJ 4NYOA 4LFBJ 3GLJA 2E7VA 2EKNA 3I0SB 1ZM9A 1TUGB 3G82A 3W9JA 2PT0A 1SH0A 2VPYB 3MM7B 4A8XA 3K5MA 3U1NA 4H4KC 3G96A 1J27A 2YKMA 5DDQC 3V81B 4DR4F 2OPQA 2QT7A 4IOAQ 2MSSA 3C2PA 2DPJA 5CYQB 1RT4B 1ZPWX 2B4OA 4F4ZA 1U0HB 3BR8A 1JLFB 5D78A 4B3TJ 2XS2A 1MLAA 1JLBB 3RJMB 2ZHOA 2G0CA 1SIZA 3SI8A 3R6GB 5ETRA 1KNZA 2R7SA 1H38A 2HZCA 2PMWA 1R6VA 3UDEA 5L1KA 3G86A 2W9BB 2BJ8A 2FGOA 4FNIA 4PXBA 1EETB 2HRTA 3BZQA 3K7RA 1KVJA 3IRWP 2AGQA 2HPUA 3OL8A 2AYMA 1RADB 4DFMA 3HK2A 3M2VB 3QT7A 3FSYA 4XPCA 1TP7A 1FFWB 4YHHF 1TVRA 4Y0FA 2V68A 5HLFB 2HQFA 4NLGA 1U2CA 2GJFA 2X1GA 1YZ7A 3PY8A 2D7SA 4PUOA 2EKYA 4OYIA 3B54A 4ZVOB 4K59A 3GV5B 1U2FA 4ZVGA 5I42A 1EAYC 2C2KB 3B4MA 1D3WA 2CQHA 3T5LA 1C0TA 3RR8A 5L9XA 3WZ0A 5DRKA 1E6YB 3L3CA 3MEEA 2X1AA 1RWPB 3LP0B 2XO7A 3OR2A 5AE1A 3TVZA 4DR4J 4DPWA 2B56A 3F56A 3TO8A 4F04B 1KRPA 3CCLS 3R2DJ 1S1XB 1FE4A 2ATCB 2OEMA 4HTJA 5THWA 2BE2B 2MXYA 2LMIA 2XM3A 3O1LA 2H5IB 3KLGA 3CCQS 3H5XA 2N3LA 5M2PA 1M5PC 3OFHA 2ZM6F 4B9NA 2G2ZA 5MAOA 4Q8EA 4TU7A 2KT2A 1KBRA 4USWA 5D0GA 1HNXF 3D6FB 3E51A 2Y3YA 4X65F 3CJSA 2HFSA 4DFJA 4PG6A 1QM9A 1WHYA 1JKHB 1LNQA 3BBBA 1WC5A 1RBAA 3JAMU 3DHWC 1S10A 2CQPA 4EI2A 4M5JA 2EK1A 4CH7A 2B7CB 3RAXA 3SSQA 1WG4A 4HI2A 1KWMA 3TQ1A 4C7QA 2C3MA 4ICLB 5F8NA 1S9EA 3GB0A 2Z2LA 5DDPC 1SQEA 3E2EA 4QWAA 1G3OA 4X4QA 2BW2A 5B0AA 4WKRA 2JC1A 2J9DA 4WBFA 2W25A 4J91A 4DUTA 4F4KA 1U24A 1XERA 2IVYA 1S6PA 2FJEB 3NGRA 3P3DA 2LXUA 3P4UB 3Q8UA 5KT5A 3OL6A 4TYBA 4CLTA 2G0IA 3LPYA 4H4KA 5E7OB 2MZ1A 1XJWB 3CDEA 3HD2A 2XYGB 2W24A 2GVZA 5E3QA 5G0RB 5A6WA 4RWWA 4OHZA 5MLCV 1F0XA 2RHQB 2R7RA 2DVIA 4I6WA 2XY6A 4G3IA 1F2HA 1F2GA 3G6XA 2O66A 3PIOQ 3F41A 3HPOA 2LEPA 3VAJA 4LRFA 4NLUA 3G2XA 2DGVA 2CVIA 2RQKA 5KFVA 2IRUA 3RR7A 2RE1A 1RAGB 4NA3A 1ZAXA 4DV0F 4I68A 2BZ2A 2MEWA 3ETMA 3P5TL 5CYMB 4ED1A 4NEZA 4OI4A 2BR0A 1UVIA 5DJBA 2XB2D 4WE1B 4IKAA 2HSEB 1VQYA 4ECYA 1JJ2R 2COLA 5H9EJ 2HFOA 4FYYB 3M8SA 2KJWA 2JWNA 4DG1A 4ZMMA 4LF8J 4LT6A 1U1QA 4JV5J 2VG7B 3OUYA 2HVHA 1N56A 2KFNA 1RWXB 2XWXA 2HFZA 2I38A 1TK5A 2BDPA 4NXMJ 2R7UA 2MDAA 4ED8A 2F4VJ 1TQLA 3MHYA 3KFWX 5L9NA 1FK9A 3QGGA 3PO4A 2GHWA 2IVFB 1GX5A 4MFBA 5LSRA 3MURP 1YBTA 3HFKA 1FX4A 1PIEA 2VDHA 4KYZA 1SJFA 1WF0A 4KV8B 1BC6A 1X4DA 3HFZB 2VF3A 1VBZA 1FX2A 2JHEA 4KJIA 3CCTA 1TL4A 4CT8A 4KGXB 1F5AA 3TP2A 4CWBA 3H5SA 5C24B 3OTOF 3O44A 1S1VB 2DH8A 4H54A 2BKOA 3AXMA 5GADI 3QSYB 2UU9F 5KT2A 1YJWS 4N8NA 2DJWA 2PEBA 1O51A 4ECQA 2R2UA 3W65A 4PR6A 1JXEA 1VIOA 2L48A 3H2UB 2ACYA 2DKOB 2HFUA 1UCNA 4URSA 4DWIA 4FF4A 1FKPA 1RHJB 2GIFA 3V6KA 4P72A 2ZH6A 4DR5F 3I82A 2QO3A 3N01A 3MI7X 1HARA 2JRSA 1YJNS 4JB8B 2DTJA 1Q5YA 3GFYA 1NSQA 1N88A 4DV4J 4OHXA 3QAEA 3CTRA 4L75A 4DX6A 4O23A 4OJGA 3FBFA 2R7WA 2GJIA 3CJ3A 3LH2S 4KO0B 4NCGA 3H5YA 3BB5A 2EFVA 3PHEA 2FY1A 3KNAA 1X4EA 3UN3A 4LF6J 1XN9A 2VG5A 3BGLA 3HFVA 1TFYA 2MLYA 1YJ9S 2PI4A 1KDNA 3LALA 3SCIE 3K8VA 3CCVS 4JP8A 4Q5VA 3R3TA 4ID5A 3MAHA 4C0OC 4K0KF 3QSIA 1TL5A 1UEKA 2OMOA 1S0OA 4UY8T 3NAHA 1SC1B 2Z2YB 1RBOB 3E8OA 2EFQA 1XR6A 4IO1A 4MIWA 2B9EA 2GNKA 3ITHA 2BUNA 2VPZB 4PPDA 3W61A 4ED6A 4FVCA 2LEBA 2R8HA 3KLHB 1H72C 2PFFB 2IDEA 2XMKA 1QJHA 5HVGA 1FRLA 4L74A 2CQCA 2QA2A 3NWRA 3WIUA 2ZHBA 1HHTP 2OIHA 3QIPB 4MK8A 4F4XA 1SQGA 1X5SA 2GMLA 3MAAA 1Z4UA 5EUHA 1HNZF 1VQNS 3GONA 4DV4F 1KFSA 3U1MA 1N48A 3QGIA 1UFLA 2DY9A 1FTCA 3NS7B 2BMBA 2XCPA 1DFDA 1B0TA 3HKWA 3CSKA 3IBCB 3J7AN 2OAUA 4LRCA 2OD4A 3KLIA 3OJUA 4J9PA 1F1BB 2MKHA 4LRAA 1N5QA 1HWJA 2LDIA 2F3JA 1BD6A 1D9AA 4G1PA 3BQ1A 3IR6B 2FLPA 1VOMA 1SJ3P 1MMDA 3M8YA 4XIUA 3NNHA 1ITPA 1PYSB 2W2QP 3Q8YA 4IFYA 1GEHA 1Q4RA 3ILOA 5J1EA 2EW9A 2XLKA 3NMAA 2VFSA 4PG7A 5HATA 1N0VC 1Q8LA 2X3GA 4PXDA 3ITHB 2A18A 2KYXA 4U67Q 1UZDA 2RIJA 1UWAA 2RS8A 3HHLA 3MM9B 1YLXA 1NK5A 5A8WB 4EZ6A 3GSDA 3LQVA 4M5LA 1OPIA 4A8WA 3DLHA 1NJWA 3UFCX 1LW0B 4NA2A 4FS1A 2RRAA 2DITA 2DY1A 4DV7J 4QIEA 3T41A 2VC0A 1VGYA 3QQCD 2J0WA 5CABA 4K4ZA 4ECVA 2C2ZB 3A3OB 1BLUA 2MQOA 1NK9A 1YBAA 4ED4A 4U95A 4EO8A 2VBWA 4DXLA 4RNOA 2K06A 3P8BB 4M5NA 2CQGA 4PWUA 2YX1A 4UOFA 1KQFB 3AQPA 1RJJA 4K5RA 1BQNA 1NBEB 4N77A 3W5YA 2IM1A 1Y5IB 2GVDB 2LA4A 2MLZA 3TZWA 3KLVA 3PACA 2B6AB 1TKXA 1TMMA 3GWCA 3CT9A 3DLJA 3L7UA 1NU4A 3QGHA 3M30A 3R5BA 2V9WA 5F3TA 2AEMA 4YY3F 1SH2A 2RILA 4AT1B 2L08A 4BCAA 2NR0A 4ECZA 1N6QA 1UWBA 3AJ2A 2KRBA 2UUAJ 2MTLA 4AFFA 4N8OA 1RT5A 1PCAA 3MM9A 4RW6B 4X62F 2LP4A 1I94J 4DF4A 3T6BA 1IBLF 2RD5C 1CVJA 2E44A 2WVFA 1HR0J 2XY5A 3TAMB 1HNVB 4ER8A 5EWGA 3QO9B 3L4BC 4F4YA 3UE2A 2JH3A 3MMJA 5ETSA 1N5VA 3A8KA 3O6QA 4KFBB 3AOBA 4U8VA 2A0FB 1UW9A 2GHPA 2YWEA 2ZBIA 3QFWA 3QJLA 1QAIA 3DM2A 1RHUB 2N7YA 1HW9A 5B09A 2LQ9A 4ES3A 4ZCMA 3J7YU 1S99A 1KOHA 1UFWA 5L38A 2W2MP 4JI0J 4CYUB 3IG1A 3GCWP 3B82A 4F26A 2EC2A 1KHWA 2XMWA 3NWGA 4LF7J 2C3UA 1P27B 2CNLB 3Q0AA 4K4YA 4K4XA 3CMES 2UVVA 2LDYA 4CLKA 1XQIA 1H2TZ 4CLZA 2P2CB 4QJVA 4KHPJ 2OHDA 4WFNQ 1SPBP 2GZOA 2QV6A 4FXVA 1N33J 1UMJA 4USTA 3ZZOA 5HMZA 1RT5B 1SJQA 2HK2A 4NE9C 5C25A 2MY7A 5IWAF 3K2YA 3KLFA 1S6UA 2JFDA 1K8AT 2GC8A 4LSNA 4X84A 3D0GE 1JKHA 1M90T 1RACB 3C8YA 2DGOA 1CJTA 3HHLC 5CH7B 3SSRA 5D8HB 3BDEA 7FD1A 2X7IA 1CC8A 1PJ6A 1KQSR 5DZ6A 2CWKA 2V34A 2D1CA 2GAHC 3G9CA 1R0BG 3F73A 2QLJB 1VQKS 3ET6B 1FKOA 3JQKA 1S6PB 2ASYA 1HKAA 2H54B 4AL6A 2N4DA 2QL5B 4DV3J 2RRNA 2H4WB 3M8WA 3MD3A 1WHWA 3M9OB 3GG0A 4NZ7A 4DV6J 4OZNA 4J9UE 4IG0A 5SZTA 4OHWA 2MZTA 3DDKA 3JSMB 2NYIA 1M1KT 1G4CA 5IQQA 5AE2A 2O5DA 4IG3A 2V4QA 1TR0A 4ANEA 3M6WA 4F02A 2BE9B 1YWXA 3TX8A 2AYEA 1TMJA 3VHQA 1N34F 1WOOA 4WPAA 1HQUA 2WRMA 5T7LA 2CNNB 1BQXA 1O0PA 2OSQA 4I2PB 1NDLA 2PA8D 1S1UB 2KN4A 2CPJA 3GSIA 4USMA 2KM8C 1C4AA 3BKFA 2WOMA 4K5SA 3C16A 3HT3A 2OH2A 4JI5J 1R0AB 4HDGA 3H2LA 3QFHA 3DI6B 1WWHA 3MM5B 4RW7B 2W4CA 5K9FA 5CCMA 2RH3A 4CLWA 3V5RA 3GIIA 2EFOA 2W2OP 1XMBA 2CQBA 4OHVA 5HP1A 4RU2A 2UUCJ 4JV2A 1Q16B 1S7IA 2DT9A 2Z30B 2R2SA 1HPZA 4R8UB 4MAKA 5GAEI 3QT8A 2KZZA 2LA6A 4ZVQB 2D3UA 1S5ZA 1B4SA 2DNHA 3CO9A 2AYBA 3H7HB 1B3TA 3LTOA 4UUXA 3I6PA 3BGFA 1WUUA 3UR3C 2ZH4A 1S77D 2MQQA 4MJKA 5F41A 2DXEA 1GXTA 2XYPB 1UJ4A 1F6TA 4KB7A 4RO0A 2VJUA 1VS3A 3Q8SB 3M8PB 1T0TV 2UUWA 4Y2KA 3KDNA 5FDLA 3LOUA 1PKUA 3RB4A 4K0KJ 2I1RA 4HYKA 4CQ1A 5LT5A 2VZ9A 2ZH1A 5J2PB 4MKAA 4CLLA 4A8KA 2KZMA 4OHYA 2OTLS 4ZP7A 2FHJA 4UF4A 5KFHA 1VBXA 4K4UA 2G2YA 2HGNA 2PDAA 2F40A 3EZOA 2V94A 3E01B 3IWXA 2I5JB 2Q6BA 4KO0A 3KJVA 3OXLA 2JFKA 4ELVA 4KQZA 4ES1A 1YRUA 3DLLQ 4WK3A 5ETTA 2D74B 1HD0A 3MWBA 4K7QA 2KH9A 1EZZB 2PEHA 4B3RJ 1RAAB 2Q6CA 1FJGF 2EBGA 2IPOB 4WXWA 3AH6A 2HIYA 1RT3B 2R7VA 5KFPA 2EXUA 1LK7A 1MWYA 2FPHX 4GC7A 2YWWA 4AYBD 3T3FA 4YN3B 2P6TA 3QZ8A 3KOAA 1W7WA 3FMBA 3M8PA 1NK7A 2X3DA 1S0MA 2RU3A 4DUZF 4LQ9A 1Y7PA 2CIMA 2RF2A 5KFKA 1G6BA 3PYFA 3M8RA 1HYSA 2GCFA 1KTQA 1IKYB 2R7QA 1FDDA 2V8DA 4IH6A 2DHAA 3G82B 1OYEA 2MQLA 3W5XA 4CLFA 5CQGA 4DJBA 3KK1A 4B3SJ 3QLHB 5ETVA 1U1LA 2J6SA 2Y0SD 1TELA 2CQ4A 1X4CA 1CJUA 3GIKA 3W8PA 2EWHA 2XI3A 3R7NB 3WC0A 2R4FA 3IM9A 4WXOA 3UPFA 4A8MP 3H4BA 4IR1A 1VI7A 1HA1A 2DNMA 1B7YB 3FEYB 5B0GA 5AE3A 5DS7A 1F60B 2LCWA 2N4CA 2AEFA 1SL0A 2E29A 3I31A 1HWUA 4WFBQ 3SV3A 4HR2A 3T1YF 4C8OA 4RUBA 3ULHA 2UU9J 2HVIA 1Y5NB 1SUQA 4F2SA 1GTEA 3M2VA 1U02A 1UVNA 1NJYA 1GH8A 2PN6A 2J5AA 3EGVA 4IRDA 2EFGA 1CJVB 2EVZA 3AHPA 4B3MJ 2JEJA 1LW0A 1VBKA 4X4NA 4DPUA 4X4SA 4PG8A 3UVJA 1ZBTA 2VICA 1Q7YT 4ED5A 3PO5A 4ZPDA 1Q1KA 3Q8VA 4ZIWA 2QMUB 2RF2B 4DR6F 3N6MA 1YRTA 3DKDA 3DOLA 1H98A 4QR0A 3DXSX 5LJ5Y 5D3GB 4C98A 5HBMB 2K2PA 2Y8YA 3MUMP 2MGZB 1GMWD 3D7SB 1NO8A 3GYXB 3A8IA 2CJQA 1YBUA 3KWMA 1ZAVA 3CCES 4JI8F 4GVBB 3HJVA 3TR5A 3W2WB 2XI2A 4ZPBA 2ZKTA 5EN1A 4YB6A 3UN5A 1CBKA 2DHXA 5BXIA 3TAQA 1KONA 3MPUB 2UV8A 4LF5J 2ZUAA 2NXEA 2OI2A 4PXEA 4FYWB 5A8KB 2V8GA 2PMHA 2DR5A 2IAJA 5CZXA 2JVRA 3OXFA 3VGTA 3EE3A 1VRTA 3AJ1A 4OI2A 2EK6A 2XQCA 2X51A 4OFZA 4LF9F 4WFZA 2LVWA 2VFRA 3OHAA 3AOCA 1R8CA 1U48A 4ATNA 4H4OA 3R5DA 3EPIA 4QQBA 3T1YJ 1HQ2A 2ACMA 2AMCB 2VQEJ 2RKIB 3H98A 2BANA 3IM8A 3KG1A 1U09A 7FDRA 2Z4PA 3DFEA 3BPSP 4OYZA 1PYTA 3DOMB 4N5SA 1NSAA 4DZ6A 4RR5A 2HK3A 2ASJA 2GMHA 5DDRC 4DN0A 1Y10A 2R7OA 4P2SA 2QYCA 2G2OA 3CW2C 4DCOB 1TL3B 3BBFA 4O3NA 2NPIA 1X9MA 1P1LA 3P6YC 1KS2A 1M5KC 3A1YG 1N36F 5AXMA 5E41A 3OSNA 4F3QA 2V50A 1TAQA 2HNDA 1AYEA 3M4XA 4ZLLA 5DQHA 3Q24A 2V2KA 1RT6B 2ZNZA 3DN9A 5DM7Q 1ZZNA 3RYLA 5C42A 5DLFA 2ZOGA 4FS2A 2RU9A 2M70A 2HHHF 2E7WA 4RW4A 4DL6A 4M5GA 4O3QA 1MROB 3PR4A 4EBCA 4M94A 2W8KA 2U1AA 4DN9A 4NLOA 2XBPA 5IQ6A 3THVA 1CQNA 3RUBL 5KFCA 2G0JA 2BJ7A 2KTQA 1JLEA 4UW2A 1YIJS 4USKA 2DH9A 1SKRA 2HZAA 4M5HA 2L41A 2QRRA 4JYAJ 4YOEA 2ZBPA 2HHUA 1GT8A 1V9OA 1XIQA 2GAGC 2NXCA 1YGYA 1NK4A 3A4TA 1LFWA 2WSFC 3D54A 1MMLA 4ID8A 5I3QA 3L95X 1RTJB 1DTQB 4LF7F 4G1IA 5IV3A 2AJQA 5A8RB 1RLCL 3DXBA 1J5EF 1NDKA 1QD1A 2P9CA 1MSWD 1FVSA 4J5OA 4IG0B 2R2TA 2HG4A 2E66A 2XMAA 3EZ5A 1YJ7A 2A6OA 2HEKA 4LFAF 2D9PA 4ZCKA 3SEOA 4R5PA 3T1HJ 2FZGB 3IRXA 4ECSA 3QATA 4BC7A 4RBTA 2F8EX 1DLOA 1BWEA 4LRDA 2IBOA 3ENAA 3FCWA 2P8IA 2HNYA 4TLRA 2CJAA 1OO0B 4DX7A 1S1UA 3B8HA 5KG1A 4RLEA 2V5HG 3TI0A 4JI1J 2HMIB 2WOMB 1Z1ZA 2ZWOA 3C15B 1NNDA 1JLEB 5KOWA 2AJ2A 1WTBA 1Q53A 1UTAA 2OEJA 1J5EJ 4FF3A 1RWKB 2RUSA 3IGVA 5D4PA 3W8GA 4K4WA 2MZSA 2YH1A 3UDLA 4V19X 2FJAB 4M5DB 3BSOA 1HNXJ 1S6OA 2ROEA 3M6UA 8AT1B 3SYZA 2BQ3A 2DR6A 3MR7A 1MMNA 5F3ZA 2ZM6J 5A8RA 1YDLA 4C8KA 4DV1F 2J7WA 2QA1A 2VA2A 4ECTA 2J7KA 3ENWA 4ERDA 3H5UA 5KG0A 2CJ9A 4ZJLA 2ZDOA 3T1AA 2Y1IA 1OY8A 1Q78A 1CJKA 2VL1A 2ZOMA 3AD8C 3IRXB 5G4DA 4C4WA 2CQ0A 4PXCA 4DV2F 2E5LJ 4P74A 1BY9A 1HBMA 1PC4A 4DUYF 2CA9A 2DEIA 1NCLA 2BVZA 3FKBA 2V2ZA 4PWDB 4L6V3 2Q79A 4C2MA 4TY9A 4ZVRB 3TJ8A 4ZK7M 1PJ7A 1IR2A 2MY8A 5HVHA 1KFDA 3C15A 5HI7A 2C3YA 3R27A 4C11A 2JX2A 4MKYA 5BJRA 2UP1A 1BMQB 4U96A 4DV2J 2E5LF 5T41A 4P2FA 4RL1A 4IRKA 4Q2LA 2Q43A 3UW1A 4DCPB 2KT5A 4CRJA 2YX4A 1RAHB 2OPQB 5IXUA 1UEVA 1WELA 3GPAA 1TKZB 2M4MA 3ZC4A 3S6EA 4DI6A 4EFAC 1VC5A 4GO5X 5KFZA 3CUNA 2AKWB 3D0IE 3OVBA 3R7BB 2YNFB 3T5KA 1GX6A 2Q66A 4R25A 3OR1B 4U9RA 4C8LA 3FQLA 4DUYJ 2H48B 1KD1T 1WTFA 2ZE2A 3H2VE 4FYDA 2CPXA 3PM9A 1VQ7S 1KKHA 4EMDA 3Q8PB 2LQJA 3CJKB 3SBMA 1AT1B 3OLBA 1XR7A 4DZDA 4CM0A 3RRHA 1WG1A 5KG4A 1WC1A 4PYDA 1N32J 3Q89A 1VK8A 2MKSA 1U47A 5I42B 2CZ9A 1Q95G 1L3UA 1DTTA 1W25A 1JLGA 3SFGA 3NOCA 2M88A 3PNIA 4HDHA 4JI8J 4HVZA 1H73A 5B0EA 5F8MA 1PC5A 4RW8B 5GAGU 1VQ6S 5EX3A 4LF4F 1SKUB 4ZS6A 3W64A 4B3OB 3GJTB 2DRAA 1VIXA 3QT6A 5ETMA 2W1BA 2M8DB 3BM7A 4JI1F 4W90B 2P9EA 1YI2S 1ZM4A 3K5PA 1JLCB 3MM7A 1TL7B 5K8MA 3Q8QB 4DQQA 1D9FA 4KIAA 1SC6A 4DDFA 4NXNJ 1HL6A 1U8SA 4OZ3A 3IA0A 2YWGA 4DPOA 5I3UB 1LWEA 1J5OA 1NSKL 1Q8IA 3I32A 2VIHA 1T3OA 1DAXA 1RT4A 2QEXS 4QPTA 2CNOB 3W2VA 3N79A 2AW0A 2DNKA 4CTAA 4JI7J 4K4VA 4ZHRA 5C5JA 1RABB 2H3EB 2KB2A 3DHXA 4KT0C 3UVJB 4DV1J 3KYLA 2BW7A 4DV0J 4AL5A 2DHGA 1IVZA 2NQPA 3NG8A 2XGPA 1SKSA 1P8GA 4QYZK 2CKWA 1TU0B 5D3GA 4X66F 4I2QB 1FKAF 1TKTA 2C2NA 2LFVA 4M95A 1FHTA 4NCBA 3BH7B 1U6FA 2B51A 2WB1D 3MEDB 2HQGA 1GMUA 2BM1A 1L3TA 2ZBRA 1FXLA 1FERA 3HSZA 1NH8A 2FJBB 3AB2B 5K5MA 3VGVA 2HYIB 2XMTA 2GVZB 1JLCA 2YQ3A 3BN4A 2F4VF 1F3FA 3CD5A 3OL9A 3MEEB 3W63A 1IQTA 2AHOB 3LP0A 1QY7A 4FBTA 1RKIA 2OD6A 4Y00A 4AXJA 5BYSA 4H4MB 1OJ4A 1WEZA 4OQJA 4RKUC 4DV7F 1T05B 1QSLA 1HBNB 3SZ2A 1GNKA 2KO1A 3MFHA 2QMXA 1VRTB 4IFVA 4MIBA 3NGDA 3DNCA 1S97A 2WVDA 1LK5A 1VLOA 1W2IA 2FY8A 1I51B 5M2RA 1ZTWA 2YQ1A 4KH1B 3MTJA 4H4OB 2OPPB 4TYAA 2HNZA 2W01A 5A0YB 4QWEA 3CJ0A 3RB3A 1PJ5A 1H3DA 4KGVB 1D09B 2BACA 2KU7A 3FJ2A 3PFOA 3FBCA 1P1TA 3BEGB 5AXKA 2B8PA 2ZBQA 4EWTA 1YITS 4LJMA 1JX4A 3OFEA 2NCKL 3CGIA 4FPIA 1RSCA 2KDOA 5HANA 3B4DA 4EU0A 4DR5J 1Y5LB 2UV8G 4DL3A 4OYAA 1HWIA 3WHIA 2QGFB 1NMEB 2VQEF 3MEGA 1RWWB 3Q22A 4I6YA 1U1NA 2PIIA 3RW6A 3AD9C 3CF5Q 5L1IA 5C2CA 1RT6A 1VDHA 3VAFA 4ILLA 2WCXA 2XYHB 3GQCA 1S1WA 1IN0A 2IMOA 2XMUA 2A6MA 3OTBA 1JB0C 1K1SA 1HBNA 3RBXA 1REVB 1ICEB 1AUSL 5DLGA 3MECA 3ZZRA 1FNXH 5ETOA 3QJJA 2VBYA 3ENQA 3VVTA 3FQKA 4NLSA 5A6PA 4RNMA 3D6MB 4Z7YA 2OPRA 1SH3A 3UDVA 2XGQA 2JEGA 4WFAQ 2CFXA 1FDNA 2FB0A 4DSFA 4KRWA 1HMVB 2B5JB 5DETA 1LWCA 2CDRB 1N52B 1RT1B 1UJ6A 2QC3A 2V63A 4DLEA 2UXCF 1HNIB 2XMVA 4WTOB 2U2FA 3M2RB 2UXBF 2HVDA 3U1LA 1T02A 1R0CB 2KRRA 5KFYA 4CLPA 5DQGA 5C7PA 1UVJA 1NK0A 1JLQA 2IM0A 2YXLA 4RJVA 4TY8A 4O3RA 2FHJD 3L09A 3NBPB 2YKQA 2R7TA 1CG2A 1JXVA 4Q44A 4XK8C 5DZ7A 5AXNA 5CXTA 2RQ4A 3PV8A 2E1AA 1BUXA 2ZDPA 3SDEB 4FKXA 1UP1A 2FZKB 2V69A 1ZM2A 2ZKUA 3UI3A 5DG8A 3SQGB 1OYDA 1IR0A 4FP9A 6FD1A 1M0SA 2V8HA 3M32A 2B9XA 4IQMA 4A46A 2MKIA 3IGNA 3M2UB 2IDLA 4TVAB 1RA6A 4Y2CA 1RTDB 4B02A 3OW2R 2QLBB 2FHOB 3I0RA 1JQGA 4F67A 2HQIA 1S48A 3CCJS 1FRMA 1UJ5A 3PJXA 1RKJA 1X4HA 3T19A 3JTNA 4LBPA 3C6UB 4LSLA 3I96A 4MKBA 4M1KA 5GMEA 4DR2J 3FFIB 3WC2A 4I1TA 3TUZC 4A8FA 1TL1A 1HI8A 4FYXB 5KFFA 3J81U 3K59A 2HRYA 2Z0GA 2YKNA 1FTRA 1OSDA 4Y2IA 2MKJA 2BBEA 3LGHA 1JLFA 1WEXA 5BYQA 1P9YA 4ZP6A 1JLAB 4J9LA 1Z2LA 2R8IA 2F9DA 3BS9A 3W66A 4CLYA 1RWUA 1SXLA 3GMGA 3KLEB 3OL7A 2CQ2A 2OJ3A 1HLWA 2YTCA 2X1BA 4WZMA 2PO4A 4ZVSB 2HHVA 1WKLA 1CS4A 2DNRA 4CDIA 2P5VA 3MD1A 1TV6A 3V2UC 1HFEL 1XBWA 3G4SS 3UD3P 2C28A 1APSA 2CZ4A 2KKHA 2VV5A 3HM9A 2B9YA 2O1PA 1YRXA 1OIAA 2IVMA 3HVRA 4HHJA 4KAIA 3RBEA 1ZA2B 1H74A 2WTFA 1OPZA 2IC3B 4PQUB 3C6UA 2ERRA 3RZAA 4DL7A 1VHIA 3HHEA 4RPFA 4CO2A 2OUGA 3KUEA 3LO3A 5DDOC 3QJPA 1IKVB 3ZTSA 2YKNB 4O3PA 1C1CB 3R2CJ 3H42A 1WACA 2OGUA 1NXIA 4YB7A 3FVYA 1H0HB 4LREA 1X31C 1RQ0A 4FPRA 1C1BB 4G1QB 2HWHA 4UZCA 1MWZA 3OR1A 3TRGA 3IC1A 5KG2A 1IJEB 4ZP9A 5GAGI 5EHHA 2HHWA 2IA0A 2IHR1 1FT8A 2W9AA 1SUQB 2W7AA 2WW4A 3D1OA 3MF5A 2FC8A 4NMXA 2VUGA 5K14B 1JIHA 4ZPVR 2JEFA 1X5TA 3CCWA 2HQCA 3ZZPA 4DPXA 3NAIA 3ZNJ1 3TJAA 4QCLA 2KYZA 3BBCA 5ADZA 4ECWA 4PCQA 2HIQA 1XK8A 3ZXWA 2I2YA 3HSGA 3DOLB 1S9EB 4LVOP 1WDTA 2I0XA 4E98A 3M1VB 3Q86A 2ROGA 1RHKB 4X64J 1SVDA 2HS3A 4WYLA 4C3LA 4ZVFA 1YJTA 4P2MA 3K89A 1O8BA 4JBCA 3M8ZA 2WVCA 2MJNA 3MPDA 2N82B 1DY3A 1B64A 1M5SA 2YX7A 2IFXA 2ZC3A 3MMBB 3W5ZA 1JJ4A 4BWMA 2H5JB 2YNIA 5J2NB 1C0TB 2PI5A 4OI0A 2FQQB 1FD8A 4ZN1A 5IT4A 2YY3A 1AA1B 1MN7A 4WP9A 2ZJRQ 2YWKA 1BQNB 4FVMA 4NMLA 3CWJA 2IYGA 1T94A 3SCLE 1RTDA 4NPOA 3H0PA 1NAQA 1X5OA 2AP6A 3EMTA 3LW5C 3CC7S 3NNAA 1Y0HA 2MPUA 3CD7A 1WC0A 3CJ4A 3D68A 3M30B 2FVRA 3JB9k 5E3CA 3M6XA 1VISA 1FDBA 3OT9A 3P45B 4AQYF 5H9EK 3NKYA 1BQMA 3G8TA 2GJ2A 3GFXA 4CO3A 4PABA 1K0VA 5EWFA 2R2RA 1AROP 1FWKA 3DMJA 3UN2A 4TQRA 5IZHA 3R5CA 1PBUA 3TUPA 2DNLA 1LWFA 5DQIA 1VQ9S 1KOOA 2DNZA 2IM2A 4U6PA 4QIFA 5KFRA 3TAMA 4AE5A 4ED2A 1UA0A 4WZQA 1CLFA 3MM6A 5EGYA 4B3MF 5F9LA 2HHPA 2KL8A 1TL3A 4LFCF 4CO0A 1T03B 4KFBA 3UO0A 1A6LA 3CIMA 5D0RA 4TU8A 3CIZA 4BS2A 5KG7A 2E1MC 2DGWA 2AX0A 4DSJA 1MU2A 1BGXT 3BQ2A 3LAKA 5M2UA 3KK2B 5C24A 4H4MA 4MK9A 2D3O1 4M8LA 1KLMA 1RAFB 2QLXA 2HZVA 3FRZA 1L3SA 4DSKA 1YVFA 4IFVB 5AJ3F 3L7PA 1WF1A 4OV1A 3C19A 4NLVA 4PG4A 1MROA 1NPRA 1GK8A 3KXDA 3GZ7A 4AD6A 5DG7A 1HBOA 2HAFA 1VQ5S 4UOGA 3EUNA 1I3OB 1R27B 2AZ1A 3EVWA 4NRUA 5J1NA 4RUCA 3I5AA 1RWNB 3R1LA 2FVSA 2BA9A 4DR6J 5J2QB 3OLAA 4Y34A 2AU0A 3EVOA 2VB6A 2F65A 3FMWA 3ZNUA 3FGVA 3K57A 3MM6B 2JL9A 3OHBA 3QRRA 3TUIC 2BX6A 2GFFA 1N0UA 1F9EB 2V6AA 2XZWA 2XNQA 3MEGB 2DH7A 4JOUA 4KGZB 2VG5B 4XTTA 5HVFA 3TWZA 5HROB 3RRGA 2CADA 2CYYA 5D4LA 2FIUA 4HHUA 1VRQC 3M8QB 1H7WA 1NKEA 3PYDA 2J9EA 1XNQJ 3GJQB 4LUBA 3PVXA 2IJNA 1S1WB 3CE8A 3TEGA 1K44A 1FK9B 4I0WA 1DLOB 4O0NA 2UUAF 1JJCB 2VG6B 4WFXA 4C97A 1VJWA 4XAKA 2GGPA 4YMEA 2XO6A 3LWMA 5IC6B 3CCSS 4DLGA 2GX8A 3ENVA 4AUKA 3FUYA 3MTKA 3EXYA 4TXSA 2IY5B 4BHQA 2FGCA 3CO0P 4LR9A 4A8YA 3MGJA 3HO1A 2UXBJ 1CC7A 1U6BA 5HMYA 3CCUS 1S1VA 5D6GA 1SB6A 1S6QA 3LAMA 1WNEA 2DYAA 2KXHA 4J37A 1LFPA 3FBEA 5T14A 1N36J 2F8HA 4F7VA 4I2PA 4K2JA 1R8HA 4RNFA 3KUHA 3KLIB 1URRA 4YR2A 2JLEA 3BR9A 4D3GA 4NOHA 3CDBA 1RA7A 2KG0A 4F3MA 2D41A 4J90A 1IKWA 1FKPB 3K8WA 4RX6A 4USVA 2NZCA 4W98A 2DHHA 3AOAA 3RBZA 1QVFR 2J0SD 3MM5A 4RW7A 4DSLA 1VK3A 1HR0F 3DLBA 3FEZA 4U7UD 2LQ5A 1WC4A 1SC4B 2WB4A 4YDXA 4X62J 1IBLJ 3Q83A 2C22A 2DRDA 3JXOA 4HT7A 4Y65A 5KFDA 4QWBA 2HWTA 1R43A 4NLDA 4B9UA 2VG6A 2NSCA 2BRKA 3BYRA 1HBMB 4K2XA 4RWXA 2CQDA 5KFEA 1U1PA 5HO4A 4KGKA 3EXCX 3NMRA 3BGUA 3D67A 2E1CA 2QG9B 4DCJB 4QR2A 4CH1A 2ZD1B 1ZZFA 2MSTA 1SV5A 2E5HA 3A12A 3VTIA 1NPKA 3J7Z5 2WAQD 3SXLA 5FLXY 3BO3A 2JVOA 5IM0B 2ILZA 3D28A 3R5GA 2ZZTA 3DLKB 5AXLA 3A13A 3V6HA 5HN0A 3C6TB 1EB0A 1FRKA 1HHQA 1Z2ZA 2QIFA 2ZOFA 2FZCB 2RDIA 4L76A 4LR7A 4PEOA 4ZVHA 3UNYA 1AB8A 5D77A 4UY85 1REGX 4UOHA 4YS2A 2GIQA 4RBUA 4WFYA 2BJ9A 1GAOA 3R7SB 4P9SA 2ZITA 3KHHA 1RDRA 4C8MA 2JJ4D 4GO7X 2WW8A 2DIUA 1NZ8A 2C2DA 4RNNA 1JLAA 3A8JA 3LGMA 4DL5A 2UUBF 3RB0A 5ETQA 2VOOA 1V3ZA 2RQMA 3GU0A 3D2WA 3NGSA 2GQCA 2H5EA 2YNHA 3ZFVA 1XC9A 1RT7A 3KUGA 3C3LA 3NXZA 3BKUA 2ZE2B 1PILA 2B7BB 3FNNA 4OJHA 5A2QY 2FJXA 4C9DA 3MR3A 3PDNA 3CXCR 1LQ9A 2VONA 3J7A1 5HK4A 4DR1J 4CLUA 2XLIA 4GKJF 3VWSA 2I8EA 2K7KA 1FNOA 2CPHA 2WVEA 1XMOJ 3ZZUA 3HCXA 4W92B 2B3TB 1T7PA 3HX9A 3HULA 3PW0A 2WBMA 3QYYA 5IM0A 3KHLA 3CJ2A 1NDCA 1WF2A 3C14B 1B99A 3DOKB 3POTA 3G6ES 1KN6A 1IKXB 5DM6Q 2WONB 4ED0A 4TN2A 3TVKA 4JI5F 5HBMA 1G2EA 3P96A 1KHVA 4ZVEA 2MGZA 5IS2A 2H51B 1IKVA 1WHXA 2YH0A 4PPZA 2XSJB 5ETKA 1KR4A 8RUCA 3I9ZA 5RUBA 5ITHA 2VKRA 2B9WA 3CJRA 4ECRA 4GVBA 4LVNP 3GG1A 2GQQA 4U7CA 4KSEB 1IBMF 2HS4A 5I4MA 3R5JB 1N33F 3DU5A 3W9IA 3QLHA 2RRBA 2VDIA 2MZJA 2XHCA 4OJ3A 2OTJS 1Q8BA 1VHFA 1TKXB 2B6AA 3JSYA 4YHHJ 3WX8A 2HRUA 4MKVA 2BE2A 1L5UA 3D6HB 4N76A 3DYAA 4NLXA 5JJBA 5IC4B 2J6UA 2E9TA 4C8ZA 4R0JA 3VCDA 5LXYA 1N6QB 2OSRA 4QIGA 5H9FJ 5CCLA 3RAQA 4OV6A 2VQFJ 4NLWA 4KPYA 3MR6A 2AV5A 2Y1LB 5E3AA 2HS0A 4NLYA 1FJEB 1RYSA 4OYMA 2BEFA 3DRPB 4J9MA 3ADAC 1VJQA 3HSJA 1RT2B 4IQXA 4KE5A 3DU6A 3RB6A 4KKOA 4ICLA 3EGNA 3MMAA 5HSPA 3EM1A 4ILMA 1EARA 2YPYA 3N9UC 5LM7E 2DPIA 1WKKA 1IWAA 5GMKa 1IJFB 2AJ4A 2BOAA 2PE8A 4QIVA 5IT9U 1IBKF 1FCAA 1WD6A 3JTOA 3CJQA 4P52A 3ZTOA 4AL7A 1U45A 5K8NA 4PAAA 5GAHI 5L46A 3GYGA 3ZO7A 5G0RA 1W2BR 2CJBA 4LBIA 1E6VB 2A2CA 4MYTA 1NDPA 2HNZB 4RNHA 5LMUF 4GKKJ 3BGRB 2XC9A 1LEOA 2MJUA 3DRRA 4N7TA 1LW2A 1WORA 2Q3PA 3AJDA 4OI6A 5HJYA 5IT0A 2HURA 2ALZA 5F9NA 2V67A 1HD1A 5D0HA 4ZLPA 3RRKA 4CLSA 4WE1A 3EPGA 2DR8A 2I6WA 4M5KA 2RQCA 2AZ3A 2GV1A 1NB7A 2Q1LA 4O3SA 5LMUJ 2FHMA 4ZLNA 4DR2F 4GKKF 2AWZA 3U27A 2CPEA 1HIYA 2XHWA 2BQRA 3DOMA 2OELA 3VQTA 4Q0BA 3BREA 2ADCA 2MHEA 1R31A 3PRVA 3AA9A 4ID5B 2XY7A 2FJWA 1M5HA 1WDDA 2AJ0A 4P7VA 4ILRA 1TKDA 1C0UB 4P2XA 4B9SA 4ZP8A 2EEYA 3ETOA 1S79A 1UFKA 2DIVA 3FCHA 4KV8A 3WX4A 3H40A 3VAMA 2ASLA 1NSPA 4J7CA 2M7SA 1H6KX 1FRIA 3ZZTA 1JXLA 2F5GA 4IG3B 1FXRA 3IWLA 2QTWA 3X1LB 3ISZA 2XMJA 2GW8A 2YWHA 3CC2S 3SMZA 4MYUA 3W9HA 2DO0A 2C2RA 1N4LA 4NL5A 5KG3A 2APOA 3KMQA 4M5DA 2DNGA 2OPSA 2DK2A 4BBYA 3KJVB 3PEHA 2HBRB 3TVYA 2ZH9A 1WHVA 4Y2MA 4FDFA 3VV2B 4K4SA 1EP4A 5EDWA 5F8LA 2CPFA 1SI9A 3KHGA 3I4HX 2DD8S 5J2MB 1XWLA 2MKYA 1RU1A 1ZETA 3ICLA 1N5YB 2ZH5A 2GA7A 1EKSA 2B43A 4OYBA 5E0OA 4LFCJ 2LKZA 4NLQA 4RU9A 2BXJA 2CG4A 1HPZB 2CRLA 2MZRA 2ZFHA 1BE4A 1Q0NA 2MLXA 3DRSB 3V6DB 3OSPA 1PAUB 3N6NA 1ZYQA 4LF6F 5BR8J 2XCAA 2Z57B 1U1MA 2CWXA 1SC3B 1X0PA 4ZLJA 2RAQA 3AAWB 4YDDB 3TA2A 3KTQA 1HNWJ 3MOJB 1HQEA 2DGQA 1HWLA 2BJEA 5JXSA 3UWTA 1A7GE 1HYSB 3A3PB 3MAQA 1UETA 2RB7A 3D1HA 3KK1B 1URNA 4DR7J 4OI1A 1PSDA 2E1PA 1AXQA 1X4GA 4I69A 4C0BA 4OX8A 1U1KA 1D8YA 1U26A 1NEEA 4X4PA 2FJDB 3MAAB 2FUG9 1FA0A 3FSXA 4QIWD 3K5NA 2OKQA 4JI2F 2XTJP 3PW5A 2VOPA 2G13A 1M5VC 4ZITA 1EP4B 2IIHA 2HQDA 2Z58B 2PA3A 3HI9A 5E33A 4BC9A 1QUVA 4CNZA 4ECXA 4X4UA 4C6AA 3E01A 3GP9A 2M5YA 4QYRA 3O5TB 2HAIA 3TW0A 4V1Ak 4EEYA 1R89A 4MTPA 2O3DA 1RZMA 2RT3A 2A10A 4RW6A 2AGPA 4LF2A 4P71A 2HHSA 3D5MA 1F5CA 3NGKA 5JMNA 2LU2A 4J9NA 2J76E 3K5OA 1P9QC 3X3UA 3ZTQA 1RLDA 2VJVA 1L3VA 4OYOA 4YQWA 3VAKA 3N28A 4CCHA 1YK9A 2QSFA 1LKZA 1WI6A 1QAJA 3NCRA 4O4RA 1T9YA 4NWBA 4USUA 2KI2A 1SBRA 3DM2B 1HBUA 2V2VA 4WU3A 2YKOA 4FF2A 1S49A 4DU8A 3V4IB 5F8GA 2AJ1A 2PMZD 4WJBA 1FVQA 2AJFE 3MPWA 1N5SA 4DF8A 3N5BA 4ZPAA 3HKZD 1CULB 2C1EB 3K58A 2QX0A 3HD1A 3NS6A 4DR1F 4F25A 2HLTA 5AT1B 1TL7A 2JSXA 3DGVA 2XLJA 1ZTTA 4GMKA 4NASA 2RJZA 1YQHA 3AB4B 1CJUB 2HVZA 5KAKA 5I3UA 1J5OB 1WG5A 1NPPA 1JK9B 1Y4ZB 2XG8A 4DQIA 4DV5F 2CPZA 2LXFA 4DQRA 3TQEA 4OX7A 3UCZP 1L3KA 3RG6A 8ATCB 2QYGA 4DQPA 2QA4G 3ZZYA 4KBIA 2BM0A 3CJTA 3MDFA 4WTYA 1W26A 5AJ3J 4KHMA 1WC3A 3HDSA 4ZN3A 3OD2A 4N41A 2HHTA 1LXNA 2CAJA 2RNEA 2EI5A 1VQLS 3MCSA 1F3VA 4CO5A 5A2QU 3AFGA 3M9NB 2VG7A 3OUYB 3CJKA 4LFAJ 4Z2XA 3VAHA 3PW2A 1U1OA 2VFVA 3IAM9 3GV7B 2CJKA 3V4IA 1HNVA 3MEDA 3QO9A 2ILYA 2CNKB 2ZVSA 4KTQA 4MFBB 4CO4A 2G1HA 4DR3F 4X65J 1RAEB 1RWOB 2UXDJ 5E2QA 1Y3KA 4CP5A 1TAUA 1HI1A 3UQSA 1RU2A 2J9CA 3QZ7A 3JYTA 2D69A 4X4VA 3LA0A 4OI3A 1PGZA 4JI4J 2LQ8A 4CYUA 5ETLA 4C0HA 2DR7A 4E8UA 2HKEA 5T7LB 2N7CA 5HQ8A 3MCOA 4I56A 5KFUA 3HVAA 1SL2A 3VR1A 1YKWA 4YB1P 2KHDA 2XMMA 3DLEB 1EIYB 2KG1A 2UUBJ 5A8KA 3G71S 3OTOJ 3NY0A 1QVGR 4USIA 1D0EA 3W2VB 4FKYA 3AA8A 4NI2A 5CYMA 4RZRA 4ED3A 1KQKA 5HQLA 3I56S 2WZ1A 5H9FK 2R8GA 2BQUA 1S9GB 4OX9J 1T03A 4CZCA 1SJ1A 2E9RX 1C2PA 2CVEA 2BANB 3DRYA 4MMOA 1X4FA 4ZVPB 5BYRA 3DCAA 5B0DA 4DFKA 4DG1B 1NHKL 3C66A 2D3ZA 3J80U 5IT9Y 4A48A 3SCKE 1LXJA 3LP1A 4YUDA 3OVSA 3ET6A 2IBKA 2WBRA 4NXMF 2ZVIA 3JTPA 2JOQA 2QL9B 4ANCA 3WBZA 1KP6A 3EVMA 1NJIT 3CC4S 2DNYA 6FDRA 4F4WA 3TARA 4ED7A 1VFJA 3QMQA 1BWVA
chains in the Genus database with same CATH topology
2KM8B 1ZM3A 4YB5A 2ZHAA 2B4PA 1FRJA 4DSIA 1NJXA 3JSMA 2OPRB 3PRBA 4HL9A 3R1HA 4PRFA 2YKPA 3UR0A 5U47A 2L9NA 3PJWA 2MB0B 3IS9B 2DGSA 2KXNB 1D9DA 1QE1B 1LV5A 2UZAA 2ZC4A 4TNOA 4L72B 5F0WA 4NZ6A 4BWJA 5GADU 2IRXA 4EUVA 1S9GA 3MEKA 2HWIA 2WSEC 1XMQF 4UQGA 1U6ZA 3JSBA 5HROA 2VASA 1VQSA 1VQMS 5LJ3Y 4BDPA 1UVMA 1UKUA 2GQ2A 1C4CA 4HH0A 2EFPA 5L1JA 1R8BA 2HHQA 2ZZNA 1UA1A 1R7IA 2E5JA 1OQ3A 4HEA9 3T5HA 2AYGA 3MM8A 2G9OA 1X9SA 1VQPS 2L3MA 3HHLB 4TKTA 5KTQA 2UUCF 4QU6A 4IO9Q 4ECUA 3HJFA 2CQIA 3HVWA 2QZ8A 1GQEA 5B0CA 5IFMA 2J6TA 2W9CB 2ZZMA 2VD3A 3M2UA 2F8MA 3VAGA 1DBDA 3BDPA 4A8OA 3IS9A 4OZ1A 4C11B 2NPFA 1QE1A 3PX4A 1RISA 4FXDA 4QW8A 1U1RA 2HLUA 2M52A 4JI7F 4X64F 4CH0S 3G8QA 1FE0A 2Y1RI 4URGA 1TL1B 2VKZG 1IKWB 5KFBA 3GIJA 1KSPA 4HKQA 1K0TA 3CB4A 1V3RA 3I0SA 5E3RA 5KT4A 2IJFA 4KR0B 1FD2A 4IOBA 3S8SA 1F5BA 2RUGA 4K50A 1R6YA 3SFUA 1IM4A 3OVAA 2MQNA 2MMYA 3V81A 3KMSA 1FEHA 1RAJA 3MM8B 4PKDB 4J9SA 2C2EA 1R8PA 4LQ3A 1NHUA 4RW9B 2NS1B 1JLBA 2W4DA 3FEXB 2XNRA 4J9QA 4D3HA 1UL3A 1RT3A 3QGPA 1OSCA 3TYTA 1HQEB 1ZH5A 1RI7A 2EC0A 1R3NA 4IR9A 2CPDA 1SKWA 1X4BA 3RW7A 2LU1A 3TA1A 1QSYA 1ELOA 2Z2MA 3T9ZA 4DR7F 4RUHA 2E1RA 3IFEA 2DHSA 4USHA 3GILA 3S1TA 2IRYA 3NRBA 2J0XA 1B0PA 3IG1B 4B9MA 1Y3JA 2LYVA 2BOPA 3MPYA 2O01C 5KFIA 4AXIA 1VQ4S 1S4FA 2HHXA 4DEZA 2L9WA 3FFIA 4CNYA 1NK6A 4EGLA 1FESA 5KFMA 1ROFA 5HMWA 3HHDA 3PX6A 3CCRS 4FNHA 4FXWA 5HL7Q 2R8KA 3KLFB 4CTAB 3ZZZA 3BSNA 3OTDA 5JVHQ 3TUJC 1B0VA 4C8YA 3OTCA 4RBVA 3RBDA 3IR7B 4Q7AA 3KLEA 3K5LA 2AQ4A 3CDAA 3OTEA 5KT6A 5L1LA 1S0VA 4WU2A 2L9DA 3OXGA 3OV7A 1NHVA 3N6LA 3NLCA 4XDCA 1XR5A 1R8AA 3M1VA 1I94F 1X5PA 3DRXA 4C8NA 4N56A 1Y9OA 2DCUB 2ZH3A 1HBUB 4KGMA 1VC6A 3KG4A 4O3OA 2V9KA 2R7XA 3I5CA 4Y28C 2DISA 2LXIA 2K1RA 1IUJA 2JEIA 4O4GB 2V4JB 1AW0A 4JI4F 5BR8F 5DG9A 3W3SA 4IOCQ 3Q2SC 1DHMA 2MQPA 3HVTA 4IRCA 3I55S 4ZPCA 1RTHA 3H8YA 4B3OA 1HHSA 4EZ9A 1HQUB 3CDWA 1FEEA 1NH7A 4JI0F 1C1BA 4G1QA 2WSCC 4LF5F 3OFGA 2NREA 1XMOF 2BABA 2N3OA 3V4MA 4I67A 1X7VA 3EX7B 3MZIA 1YJUA 2IM3A 3IAS9 2AF6A 1Q86T 1JNRB 2LQBA 3DRPA 1NKCA 1RTJA 2AX1A 1NRKA 2RKIA 4DL0C 3TA0A 4O4GA 2R8JA 3MMAB 2Y1JA 2OLWA 2XULA 4ZKAA 1UEUA 4C3MA 1U2RA 3CVKA 1Q7LB 2J7UA 2E5GA 3JYTB 1WEYA 3KNGA 5KFLA 1KVIA 3W7BA 1KEKA 1KLNA 4A8QA 1J2VA 3MXHP 1DURA 5DGAA 4V19J 4IH5A 3CPWR 3TAPA 1RP5A 2ZNYA 3BO2A 3BSAA 2MKCA 2XWYA 2KVIA 2HNDB 3IBWA 3F44A 3AQOA 4USJC 2B4UA 3FRYA 1UW4A 5F8IA 2QE5A 3CD0A 4ZCIA 1HMVA 2B5JA 1LW2B 3H20A 2ABYA 2Z8QA 4B9TA 1FO1A 1S7HA 2M0GB 4NLPA 3OQ2A 2FC9A 5CZVA 1NJZA 1H2UX 2PSZA 4DS5A 3TANA 1DZ5A 2MKKA 4A8SA 4X2BA 2EG1A 5CD4H 1CSJA 3P49B 1R0AA 2HQ3A 2K3KA 4TU9A 5GAHU 1JMTA 2B0GA 2VA3A 2FLNA 2VH7A 2ZH7A 3ISND 4K4TA 1OQ6A 4OZ5A 4NLRA 4ELTA 1C0UA 4Y3CA 3UD4P 1DRZA 2W7OA 5I3PA 3GFZA 1RTIB 5GAEU 2E5IA 2QLWA 4JYAF 5KG6A 3MUVP 2ADBA 2F1FA 4WKYA 1MU2B 3ZZ0A 2A1BA 4ITSA 1VQOS 5F0UA 2RS2A 4NZ0A 4YP3A 3MECB 4IUFA 1FRXA 4M63A 2HNYB 2VQFF 5FDLB 2M8HA 1VMBA 2OPSB 3QIPA 1T8EA 2HFNA 4KHRA 4I7FB 4Y2AA 1X4AA 1YG0A 5J2PA 1RT1A 2YNFA 5J2MA 1OS5A 2PD1A 4OZ0A 1SJ4P 1YHQS 3FDSA 4B9VA 2YKMB 2VC1A 4OX9F 5FD1A 1UWBB 3HZGA 4OLPA 3IN5A 3HHLD 1DARA 3CD6S 3NL0A 5CYQA 4DFPA 1T95A 3I9V9 4C3KA 2VFTA 2W9CA 2ZD1A 3RTVA 3QWPA 2R9LA 2W9BA 2ZH2A 4O0IA 1IXKA 2J8AA 3FZBA 4DX8H 1TUVA 3CULA 4EBDA 3WDOA 5JUMA 2KT3A 3B78A 2J0QD 2WK4A 1UVLA 2A3JA 1DTTB 2XB2D 1O5JA 1JJHA 2FD2A 2FTRA 1MW7A 4U7UK 2JC0A 3KHRA 3HHNB 2CZVC 1G1XA 3QAUA 4UQTA 4RW8A 2I9SA 3PXGa 3HZEA 2HGLA 4OX6A 3U02A 3OBIA 3GIMA 2KHCA 3MMCA 4LIWA 3I0RB 3O3LA 4DBQA 4IYQA 1N8RT 3QWUA 2ATLA 1H7XA 1HW8A 2MHNA 4QWDA 4I6AA 1AFJA 4DQSA 4P6QA 1ZPVA 2YNHB 3KG0A 3JSRA 4FZVA 3OR2B 4CT9A 2H9ZA 3PR5B 2YNGA 3J7ZT 1Y00A 2IAJB 3OFFA 4RUAA 1S1XA 4P7TA 4RW9A 4CO1A 4EYHB 1JNZB 2HW3A 1N54B 2GO8A 4LIRA 4A47A 2HGMA 3CMAS 1I1GA 2JLFA 3S7RA 4QWCA 5KFOA 4FS1A 2GO9A 2QSWA 3LGNA 3AY0A 1TV6B 2C42A 4ETZA 2WONA 3SV4A 2D3OR 2EFNA 4DV3F 1S1TA 1FKOB 2E7XA 1K9MT 1SV5B 4HT5A 3MMCB 2NZ4A 3A8EA 1YJRA 3MMBA 1HWKA 3NP5A 3PEJA 3RAMA 2FJVA 3LWLA 3M9MB 4HTIA 3MFIA 4EYIB 1JLGB 2FHKA 1S72S 4NCAA 2X1FA 1QAYA 4DL2A 1N32F 1VC0A 1H2VZ 2YNGB 1C1CA 2DO4A 1D8ZA 4B3SF 2VODA 3OPKA 2RVJA 2OMLA 3HF5A 4LMZA 1CEZA 2OPPA 4YEAA 3DYAB 4JV1A 4NXNF 2FVPA 4IDKA 3S01A 4Q45A 5JVGQ 1TFWA 2POKA 1P6TA 5B0FA 3K0JA 3DI6A 2KFYA 2D9OA 3LANA 5K14A 3N4WA 4DMZA 1JWWA 2DNOA 3DLGB 4N47A 3PW7A 4LSNB 5HP1B 1U49A 3RU0A 3LP2A 5LL6d 4A4JA 4Z37A 3VALA 4URQU 3HMJG 5D4NA 3QIDA 3D0HE 1TK8A 5D4OA 4WF9Q 3IWNC 4HLBA 4JUZA 3MPVA 3E3XA 4ZCLA 3THTA 3FZ2A 1RYRA 1TKTB 1UAWA 3U7JA 3UNGC 3ISNC 4KC5A 2XS7A 1TK0A 3NCQA 3KK2A 3HVTB 4OIXA 4LF8F 4JV5F 2VBXA 2ASDA 1V3SA 2UVRA 1U7LA 5KFSA 1KLMB 1REVA 2A2DA 3KK3B 1QUPA 2NUHA 2YNIB 5J2NA 2P9GA 1XNQF 2J9DE 5F8JA 3UCUP