3NNHA

Crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
DAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUGBP Elav-like family member 1
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nnhA00
2FY1A 5JVGQ 2U1AA 5LJ5Y 2Q79A 1RK8A 1DHMA 4OZ1A 2XSFA 2DHAA 3S01A 1YHQS 1WWHA 2WBRA 1O0PA 2DNPA 1U1PA 4J5OA 4C0OC 3MXHP 5IM0B 2YH1A 5MLCV 1VQOS 1WF2A 1W2BR 2AD9A 2CQ4A 3HHNB 1VQ5S 3I56S 1JJ2R 2M9KA 3CC7S 3UE2A 2AYBA 3CPWR 3CCJS 4C7QA 3G71S 1YTYA 1K73T 1WI8A 3G96A 3Q2TC 1SJ3P 4W90B 2CPDA 2CPZA 2G4BA 5H1SV 5LSOA 1U2FA 2RRAA 2YH0A 2CPXA 1BY9A 3G8SA 2MZTA 2CQ0A 2J0SD 1QVGR 1X5PA 3JB9k 2DNZA 4CH0S 3P49B 3MUTP 1VQ6S 3SDEA 3TP2A 2JRSA 1YI2S 1F9FA 5DM6Q 4TU9A 2MGZA 2KXFA 5GAEU 1YITS 5GMKa 3EX7B 3CCVS 2D9PA 3S8SA 1R8PA 1WG5A 2X1BA 2F9DA 2PE8A 2E5HA 4P6QA 1X4BA 5DM7Q 2D9OA 1S72S 3UD4P 1P1TA 3UCGA 2N3OA 3LQVA 3NNCA 2PEHA 4CQ1A 2FHOB 1VQ4S 1WEZA 2EVZA 1HL6A 2ERRA 2ADBA 2KM8B 1R8HA 3I55S 4U67Q 5IM0A 1YJWS 2BZ2A 4Z2XA 2RS8A 1WG1A 2L41A 1KD1T 3BS9A 3CUNA 1OPIA 2KXHA 1JJ4A 2BOPA 3DXBA 5FJ4A 2MKJA 4PRFA 1NO8A 3VAKA 2XNRA 5D78A 1H2TZ 2N3LA 1X4DA 3UWTA 3R1LA 1P27B 2MKCA 2YKAA 4C4WA 2MKKA 1Q81T 1WHWA 3J7ZT 1FJCA 2AYGA 1WF1A 2MSSA 5LJ3Y 2KG1A 2MZSA 1X4FA 1AUDA 2CQPA 2RQ4A 2A3JA 5ITHA 3CCSS 4V19X 1X5TA 2RNEA 2ADCA 3SMZA 2DNRA 1K9MT 1OO0B 2MMYA 3H2VE 2LYVA 1X5SA 2DHGA 2KI2A 3PIPQ 1VQ7S 2G0CA 2DNKA 5CA5A 2M2BA 1U1RA 1X0FA 1SXLA 1WI6A 1H2UX 1NU4A 1SJRA 2MQNA 3BO3A 3CMES 3G9CA 1X4GA 2XNQA 2LXUA 1M90T 3MDFA 5EN1A 3NS5A 4WKRA 1KOHA 1DBDA 2MQLA 3S7RA 1VQ8S 1WEXA 3H2UB 1YWXA 1X4HA 2MQOA 2NLWA 4EGLA 1FJ7A 2ZJQQ 3RW7A 2KHCA 2CQBA 2KVIA 2RVJA 2MJUA 4QPTA 3CULA 2G1DA 3R27A 3NS6A 1VQMS 2M52A 2RQCA 4WIIA 2KFYA 5JVHQ 3CF5Q 1RKJA 2GHPA 2DH9A 3VAHA 2DISA 5IQQA 3R1HA 3MD1A 2L08A 2V94A 3CMAS 4FXVA 2B0GA 3ZZZA 2MZJA 4ZKAA 3IWNC 1IQTA 2DNMA 2DB1A 2DH7A 2EK1A 2KT5A 2E5IA 1SJ4P 2VOPA 4QU7A 2MJNA 2JX2A 4TLQA 2I2YA 2DNHA 1VC0A 1FXLA 3CCUS 1N54B 2DNOA 3MI7X 3CCLS 2CQHA 2RS2A 3V4MA 3TYTA 3S6EA 2MY7A 3MURP 3MD3A 5CYJA 2DGQA 3VAGA 2JWNA 2VODA 2HGNA 3G8TA 1U1MA 3MOJB 4F26A 1U1LA 4IUFA 1U1KA 3P5TL 2MKIA 2MQQA 2LEBA 4Y0FA 4CIOA 2KRRA 2M4MA 4LJMA 2XB2D 2CPIA 2F9JA 2MZQA 2MZRA 1G2EA 2LCWA 4M5DB 2M88A 2MYFA 3FEYB 4PR6A 2DH8A 5HL7Q 2LA4A 2OJ3A 4IOAQ 3ZZYA 4F02A 2J76E 1PGZA 1L3KA 2CQ1A 2X1GA 3CXCR 2E5GA 2CPFA 3IRWP 2CQ2A 1YJNS 2MXYA 3U1MA 5GAHU 3B4MA 1VBXA 3CD6S 1HD1A 3NNHA 4F25A 2DGSA 2CPEA 4TU8A 3VF0B 1OIAA 3MUVP 2SXLA 3RW6A 2FC8A 1PO6A 1FT8A 2LQ5A 3K0JA 4QQBA 1M5VC 3P3DA 2HVZA 4CH1A 1WEYA 4UQTA 1FO1A 2DHSA 2MSTA 4BS2A 1A7GE 1FNXH 2DITA 3CC2S 2RUGA 1SJFA 3FEXB 5DDRC 3J7YU 1FHTA 2XS2A 3VAFA 1B7FA 1QM9A 1X4EA 2N82B 1VC5A 2GO9A 4IO9Q 2CQIA 2DGWA 1A9NB 3B4DA 1UFWA 5LXYA 4YUDA 2DGOA 1ZH5A 1D8ZA 4RU2A 4WFBQ 2MHNA 1H2VZ 2MPUA 2CPHA 3CCQS 1KOOA 2J0QD 3THTA 4WF9Q 2MQPA 1U1OA 2ZJRQ 2X1FA 5HO4A 2DGXA 1K8AT 4WCEQ 3PIOQ 5IFMA 3D2WA 3LPYA 1WELA 3ULHA 2HGMA 2KN4A 5LXRA 2AYEA 2DO0A 2LA6A 1DRZA 1D9AA 4UY8T 2CQ3A 1OWXA 1WG4A 2DNNA 1VBYA 2CPJA 2M8HA 2NZ4A 1S79A 5GADU 2DIVA 3EGZA 2HYIB 3P6YC 1FJEB 2K3KA 2CJKA 1HA1A 4PKDB 2O3DA 3HI9A 3SXLA 1WF0A 2KH9A 4ERDA 4YOEA 3U1LA 2N7CA 2E44A 2VOOA 2YWKA 3G6ES 2DK2A 2DNQA 4W92B 3US5A 5BJRA 1H6KX 1VQLS 5LSLA 3L3CA 3MUMP 2DGTA 1CVJA 2QEXS 4TU7A 3CC4S 2CQGA 5GVQA 1Q7YT 2KXNB 1M5KC 3Q2SC 4A8XA 2I38A 1JMTA 3BO4A 5GAGU 1JJHA 2DO4A 2XS7A 5DDPC 3VAIA 2LKZA 2RRBA 3CCRS 1XN9A 2L9WA 1KQSR 2KRBA 1DZ5A 1N8RT 3N9UC 5DDOC 1M5OC 2M7SA 1N52B 1VQKS 2ZJPQ 2OIHA 1VQPS 1Q82T 1HD0A 1VBZA 1Q86T 2J8AA 1N88A 1URNA 3UCUP 2FPHX 2AYMA 2M0GB 1KC8T 2OSQA 2XS5A 3BO2A 3OW2R 3TO8A 3VAMA 2HZCA 2DNGA 3G4SS 3NNAA 1QVFR 1U1NA 2MY8A 2KYXA 1X5OA 4Y00A 1UW4A 3EGNA 4LMZA 2CQCA 2LEAA 1X4CA 2VONA 2EK6A 1WHXA 2DHXA 2JVOA 2X1AA 2DGUA 1UP1A 1WHVA 1WTBA 2FC9A 2QA4S 2MB0B 2CQDA 1U1QA 3VALA 2LMIA 3BEGB 2KU7A 2OSRA 4YB1P 2KM8C 2MKHA 2KG0A 2OTLS 4LIRA 2DGVA 5CXTA 2D3OR 1SJQA 2DNYA 1YJ9S 2F3JA 2RU3A 1U6BA 1YIJS 5D77A 1VQ9S 4IOCQ 1VC6A 1WHYA 2K8GA 2CPYA 3NMRA 1ZZNA 2JVRA 1X4AA 4WFAQ 2E5JA 2MQMA 2RT3A 5DETA 4WFNQ 2UP1A 2YTCA 2OTJS 1NJIT 1ZZFA 2U2FA 3CTRA 3UD3P 4OZ0A 4ED5A 2DNLA 4FXWA 3CCES 3DLLQ 3SDEB 1UAWA 5DDQC 1M1KT 3THPA 2LECA 1VQNS 3CCMS 1U6FA 2MGZB 3VAJA 1M5PC 2LXIA 2MKSA 2DIUA 2QFJA 2HGLA 2M8DB 2M70A 2MZ1A 4QU6A 3UCZP
chains in the Genus database with same CATH superfamily
1DTQA 3MGJA 4PCQA 5ETOA 3ZTSA 4XDDA 2AW0A 1U09A 4CLKA 4MYUA 1V5VA 1H7WA 4ED2A 1J5OB 3LW5C 3EVOA 2IJNA 3PW7A 3MXHP 4NMLA 4NA2A 1FRLA 2VC0A 4J9UE 4HDHA 3UE2A 1NK8A 2AMCB 3HD2A 2N4CA 4FYWB 1UPMB 4O3RA 2R2TA 3GFYA 1IBMJ 1KLMA 4ED6A 1RAEB 4JI0F 2MGZA 3OL6A 4IG3B 3LGHA 3CCVS 5T41A 1SI9A 3HK2A 4M5IA 4LBPA 2UXDF 2Z2LA 4TY8A 3ENQA 1V6HA 4OYOA 1WEZA 2IPOB 4RW4B 2MHEA 1JLFA 3GB0A 3GV5B 5AJ3J 4OZNA 4URGA 3CUNA 3HF5A 4O3PA 2BVZA 4LR7A 4K4SA 1X4DA 2GIQA 3V4IA 1MN9A 1T94A 3KG1A 4KGKA 4LBIA 2Q6BA 3I0SA 2V4JA 5F0WA 1TFWA 1FERA 2G0CA 4X4SA 3QIDA 3OFGA 2V68A 3M9NB 2D3UA 1IKXB 3RW7A 1JLCB 2I1RA 3R27A 1VQMS 3B78A 1OYDA 4WIIA 1NKBA 3M6WA 3SCKE 2C1EB 1W7WA 4OZ5A 3R1HA 2L08A 4ZP6A 4MMOA 5IXUA 1NSAA 3ZZZA 3V81B 1HMVB 4OX9J 3C3LA 2BJDA 5DGBA 4U6PA 1T9XA 2QMXA 5LMNF 2XGQA 3UFCX 2B4UA 2AEFA 4B9NA 2Y9HA 1GTHA 2ZHOA 3S6EA 2VODA 3EZ5A 2CG4A 3R2CJ 4YDDB 4DN9A 3OSPA 4A4JA 1Q5VA 2B6AA 2ASYA 2LFVA 4WPAA 4DX8H 4PR6A 3H98A 2H65B 2A2DA 2DCLA 4X66F 2CQ2A 4X62F 3T6JA 2CPEA 5J2QB 2C2DA 2W25A 3K0JA 3GU0A 3SI8A 4CLWA 2X3GA 1C4AA 3OR1B 2MSTA 1CULB 4DR1J 2DITA 2JZ5A 1BMQB 5DDRC 3VAFA 4PWDB 2C22A 3KXDA 5EX3A 4L76A 2R3VA 3SQGB 1ICEB 2A6MA 4HTJA 4GO5X 2ZNYA 2ZM6F 3HKWA 2MHNA 1KVJA 1N32J 1R8BA 2BJ8A 1DTTA 4USIA 3OFFA 1IKYB 4LFBF 2UVUA 2MTLA 1WG4A 4KGZB 1S6QB 2BRKA 2NZ4A 1RT1A 4FNIA 4PKDB 4RNHA 4DPOA 2B4OA 3M2RA 2NR0A 2FGOA 1VQLS 2V50A 2DEIA 4LFCJ 1RT5B 3CC4S 2CQGA 2HBQB 4ETZA 3DU5A 1LWXA 4P9SA 2WONB 3TNVA 2BJEA 3Q8PB 3Q8YA 2M7SA 3M8WA 2OIHA 1NK6A 4OHWA 1N48A 2ACMA 3MR3A 3I4HX 3HPOA 3LAKA 2RU9A 5KFLA 3OJUA 1X4CA 1UEKA 3TI0A 4DR7F 3HSGA 3AD8C 2OMOA 3WX8A 3CJKB 3PDNA 5CXTA 4EI2A 1SJQA 2DNYA 3IBWA 3NLCA 4DS5A 4F3MA 2C3PA 3OPKA 3GG0A 1SQEA 2RT3A 1IVZA 4PXEA 1JLQA 4LBHA 3PNIA 2DRBA 1ZTTA 1PCAA 3WIVA 5E2QA 1TAUA 1M5PC 3J7YI 3GR1A 1NK4A 1N6QA 3IN5A 4B3TF 1FWPA 1EP4A 2ZH5A 4RZRA 4L75A 2ZBCA 4USWA 4ECRA 4LQ3A 3G96A 3Q2TC 1S1WA 2UV8G 2RILA 2IDEA 1RWNB 4USMA 3M8PA 5T7LA 1VBKA 4DV7F 4G1IA 3IP0A 2CZ9A 3ADAC 5GAEU 2MLZA 1HR0J 4RW7A 2X1BA 5D6GA 1YG0A 2HHHJ 4H4MA 4NLTA 1S1VA 4DZDA 4LF5J 2PEHA 5G0RB 1VDHA 3NGSA 3VHQA 1ZAXA 4DQSA 2VD3A 3DGPA 1S1TB 5L1KA 2YQ0A 6AT1B 1KHWA 4HTIA 3KUGA 3DXBA 3W65A 5B0DA 3MECA 4JP8A 4JUZA 5A8KA 1UVIA 1Q81T 1FK9A 4XDCA 2W8LA 1WC3A 2BJ9A 2EFGA 2R7RA 3K57A 4CZCA 3CCSS 4K0KJ 2YWGA 6FD1A 1U7LA 3H2VE 3U27A 4EUVA 1SKSA 1X0FA 2CADA 3G9CA 4UOCA 1FA0A 2YNGA 4LF4J 1IXKA 3GJTB 2OPSB 4RNFA 3I96A 2K7JA 4ED8A 2YNHA 4XPCA 3MZIA 2M52A 4LFAJ 5JVHQ 2W4CA 5DZ7A 1RKJA 5LT5A 3VAHA 2HQFA 3T5KA 1NBEB 2B0GA 2MZJA 2DY1A 4DUYF 4HACA 3ILLA 2QSFA 2PIIA 1Q5YA 2CQHA 4ES2A 2ZH7A 3V6DA 4LIWA 3GILA 4ID5B 2JWNA 2EC0A 3DOLA 4M5KA 3PW4A 4NZ6A 4OYPA 4P7VA 4KHPF 2Y8WA 1GQEA 3GFHA 1FD8A 4C11B 3RBDA 4F02A 1UVKA 1VK8A 3M30A 1NB2A 2CQ1A 1XIQA 5KFHA 4WYLA 3U1MA 4YR0A 5B08A 1NK5A 1IUJA 2GCFA 5L9NA 3IBFB 1C1BB 3PKMA 2HIYA 4QWEA 3SEOA 3FQLA 4YHHJ 5KFAA 4J9LA 2WK4A 2V8VA 3MAAA 3SQOP 2XS2A 3L7PA 2DGWA 3SYZA 4L3NA 5KFNA 2HZVA 4LSNB 1TP7A 3GFZA 1NRKA 2J0QD 1QLNA 3M2VB 2NREA 5J2PA 3D2WA 4N41A 3A13A 1EKRA 3QGIA 3RBZA 4IG0A 4UY8T 2CQ3A 3OT9A 4A8MP 1CS4A 2DNNA 2AJ4A 1CJVA 5D4PA 3GTYX 1QD1A 3QFWA 2O3DA 5E7OB 2Z56B 3GSIA 4PXCA 4EBDA 2LVWA 5DO2A 3PW2A 3HHEA 1MMDA 3J81Y 3OTOJ 4MKYA 2EWHA 4B9TA 4JI2J 1PBUA 3UDCA 2GQ2A 3KLFB 3T9NA 2VPYB 2A2CA 4C48A 1Q7YT 1FI4A 3KDNA 5KFZA 3RB3A 5KT6A 1JMTA 2GV1A 1B7YB 1YK9A 2UXBF 1FD2A 4B9LA 1ZM9A 3SSQA 5LOQA 1FTRA 3BN4A 1NHKL 1LXNA 4ELUA 3UCUP 1RHQB 2M0GB 1YDLA 4LF8J 3MCOA 2ATLA 1RI7A 4K5SA 4ZPAA 1TVRA 2H4WB 3D3BJ 1S1XA 1PBAA 2FC9A 5K14B 1ZYQA 2OTLS 4JI3J 4TVAB 2HHWA 3LP1A 4ATNA 1NDCA 4PG8A 5D77A 4EWTA 4ES1A 1WHYA 3W2VA 4MJKA 1EB0A 4CYUA 3MM8A 5F41A 3UN5A 5D4NA 2RE1A 4K4WA 2WSEC 2GJFA 1QE1B 3CCES 1RT6B 4P7TA 4CM0A 2QFJA 3C16A 4K4VA 1F5CA 5E5NA 2W2QP 1KFSA 1CJTB 1CJUA 5KFCA 3ELHA 1AZSB 1OSCA 2GMLA 4XIUA 1O0PA 5SZTA 2HVEA 2WRMA 4LF7J 5AT1B 4KH1B 4PG6A 4O23A 5F8LA 3CCJS 4K4XA 1D9FA 3ITHA 2WAQD 2Y1LB 2BW7A 2BE9B 7FD1A 2V8GA 3D0GE 1KQFB 1VQ6S 4EZ6A 4AXIA 1NAQA 4J90A 4DL7A 1H72C 3NY0A 1WG5A 4HHHA 3UD5A 4B02A 3GONA 4C8YA 5L46A 5DM7Q 2NYHA 1RHRB 2ERRA 3WIUA 2ADBA 1J5OA 3BBCA 2YPYA 1YJWS 1W26A 3HSJA 4F7VA 1RWPB 2V8PA 3A8IA 4PRFA 2HFZA 3KJVB 1FXRA 2BDPA 3R1LA 4W98A 3BH6B 3QZ7A 1NJXA 2VHGA 2MSSA 4ECVA 2B9WA 4O4RA 4LF1A 2C3MA 1U2RA 4IG3A 1TV6B 4C0HA 3EJMA 2JHEA 1YKWA 1H2UX 2IYIA 2XNQA 3DYAB 3ET6B 3NS5A 4WKRA 1KOHA 3CJ3A 4RW4A 1SIZA 3A3OB 4QCLA 5A8WB 2H5EA 5D0EA 2CFXA 1LWEB 2KVIA 5K9FA 1OMSA 1HWKA 3NS6A 1MNEA 2OH2A 3CT9A 5D0HA 1S48A 1XERA 2XQCA 2HFVA 3PHTA 4WP3A 4OHYA 2DH7A 1Q7LB 2MJNA 5ETTA 7AT1B 1UPPA 3ZFVA 1B4SA 4RBUA 2OP5A 3MAHA 2PD1A 3VVTA 2HGNA 4A47A 1SL0A 1IKXA 2JH3A 2ZBPA 3QWUA 1JLCA 2J7KA 2HQ3A 4PWWA 2XYHB 4MKVA 4K8RA 3PJXA 2CPFA 3C14B 3R7NB 2A18A 3V81A 1HMVA 1F1BB 2XMJA 2AP6A 1FT8A 2LQ5A 4DSKA 4C8ZA 4PYDA 1N5SA 4UQTA 4DX5A 2QV6A 5AJ3F 3DDKA 5KG2A 2RUGA 2G0JA 2XBPA 3UDVA 1QM9A 2LEPA 2H54B 2ZH1A 4RBTA 4C8KA 1T7PA 2ZWPA 3TVKA 2Q3PA 4CCHA 1CG2A 3DLEB 3CW2C 2WW8A 3M6XA 2CZ4A 4CLFA 1KTVA 2LA6A 1RTIB 3QMQA 5DG7A 1XR7A 4NOHA 5J2QA 5GADU 1YJRA 1L5UA 3C19A 3OR1A 1HNXJ 4FF1A 1CULA 5BJRA 2IJRA 2D3ZA 2OUGA 4PWDA 2J5AA 1XC9A 2XO7A 3SQGA 2IVFB 4ZPTR 2FJDB 3L3CA 4DCJB 3IFEA 1Y5IB 2VPZB 2FGCA 2DKOB 4OX9F 2QG9B 1N5TA 2XS7A 2FLOA 2HFSA 1NHVA 4GRSA 3ZTPA 1F60B 1IKYA 1N52B 4I69A 1VQKS 5DGAA 1UL3A 3PRDA 2QL7B 1S6QA 2GS8A 4TLRA 4X4QA 1TQLA 3DRYA 2CG8A 2NXEA 3R6GB 1HPZB 4O0NA 2XWYA 4B08A 4CO1A 3M1VB 4V1Ak 3FNNA 1U0HB 2BJ7A 1LQ9A 1GXLA 3BEGB 2KU7A 4DFKA 2DGVA 2FLLA 1RT5A 1T05B 2LQ8A 4QWDA 1VMBA 1F3VA 2CVEA 3DLJA 4OYAA 5HATA 3FEZA 2WONA 2ZHBA 2GAGC 2YTCA 2KB2A 3UD3P 3EGWB 1HIYA 5KG3A 3CE8A 2H9ZA 1LFPA 3TX0A 1G3OA 3THPA 4QR0A 4DR1F 4OLOA 3PACA 4N56A 2WB1D 2LDIA 4CDIA 4F0HA 3T1YJ 4URSA 1K47A 4FF2A 3QWPA 4M8LA 1N32F 4DV4J 4YS2A 3CJKA 2X7IA 2BACA 3HM9A 2R2UA 3N28A 3JQJA 3PFEA 2AV5A 1SJ3P 4RNNA 2RRAA 1CC7A 4NZ0A 1FNMA 3TJ8A 4F4WA 2ZH4A 1HWIA 1JLBB 3P49B 2ZKUA 4DV2J 2P9EA 1PIEA 1YJUA 2ZBIA 2KFZA 2AIRB 2V34A 1VRUB 2JSXA 3WC2A 4LFCF 1RAJA 1O8BA 2RF2B 3J7AN 2DRAA 4QPXA 4NYZA 5CQGA 3I55S 3CDBA 4QWCA 4X4UA 1H73A 2C2KB 5F8MA 2KXHA 5C42B 3K8WA 2MKJA 1YRXA 1R89A 3VAKA 1T0TV 2CJ9A 1NDKA 1YZ6A 3J7Z5 1P27B 2QMUB 5J2MB 2PI5A 3HX9A 1LOUA 4F04B 4IR9A 1V9OA 3EXCX 4HDGA 4DLEA 1K1QA 1J5EJ 2XWXA 2IFXA 2ADCA 3TA2A 2DNRA 1F0XA 4DR3J 2V9KA 1IKWB 2OEJA 4M95A 3M8ZA 1RISA 5FD1A 2KVQE 5G0RA 4OYXA 1VISA 1ZAWA 1JKHB 4EGLA 3TR5A 1S1TA 1FKAF 3LOUA 4DL3A 2IJFA 4K59A 1H74A 3POTB 3QO9B 3OHBA 3L09A 3NOGA 2YKNB 1M5HA 4OYMA 2ZH2A 4DLGA 3MI7X 1PILA 5A8RB 4K4YA 5M2RA 3SCJE 3A3NB 3MCNA 2QIFA 1PAEX 5L1IA 3EPIA 4F50A 3GCXP 1U1KA 1RWUA 2MQQA 1FRHA 1X31C 1G2EA 2OPSA 4HI2A 1QSYA 1B0VA 1VOMA 2O67A 4B9UA 2QE5A 2ZHAA 3HVTB 3KNGA 3ZZYA 1HR0F 4N76A 3KLGB 2HHHF 2G13A 3TX8A 2ZITA 4LF5F 1TKZB 3NEKA 3VV2B 3ZNUA 4ER8A 4ID5A 1N0UA 1X4EA 3DU6A 4WBFA 1ZH5A 4Q44A 1VS3A 4DR4F 3FQKA 1R6VA 4NLWA 2ASJA 4OYIA 2UVRA 2CPHA 4USHA 4K0KF 4C11A 1U1OA 5HN0A 1HHQA 3TA1A 4QYRA 5D4OA 4O0IA 2CNNB 3F44A 2ZBQA 3MPDA 3V6JA 5MAOA 3Q8SB 4X64J 1N5YB 3EVMA 1HBMB 5CD4A 3R8YA 3VR1A 2CA9A 5C2GA 3M2UB 3RZAA 2AZ3A 1C1BA 3ILJA 2CJKA 1V3ZA 2E44A 1I1GA 3D6FB 3NGKA 3C15B 3E2EA 3HZEA 4E0DA 3FBBA 2VU5A 3KWMA 4LFAF 2R8JA 4UOGA 4DUZJ 3AA8A 3RRGA 4LSNA 4DV1J 3N5BA 2FB0A 3M2VA 5KFFA 2V8DA 1TL4A 3PR4A 1Q8KA 3NCQA 1LNQA 1EAYC 2AEJA 1N88A 3P96A 3AOAA 3VAMA 1SC1B 1DURA 4K4UA 1FRIA 1RWXB 1REGX 2RDJA 2DHXA 2AHOB 1REVB 3NBPB 1U8WA 2W2MP 4ZVOB 2W2OP 2JNJA 3CGIA 3ENWA 3GPAA 3UVJB 3CIZA 1UA1A 3VALA 4C8LA 2OSRA 3KLFA 1GAOA 2RU3A 3IM8A 2VQFJ 1XWLA 3GLJA 2MQMA 3AXKA 3TUJC 4OZ0A 4B3MF 1NM2A 1FX4A 4YHHF 3WC0A 1U6FA 4ZVEA 2LXIA 2JC0A 4MT1A 2D69A 2Q79A 4CO0A 5ETSA 3EDQB 1FRMA 3NS7B 4X2BA 1NNDA 2NUUG 1U25A 5K14A 3D1OA 1U1PA 4J5OA 4C0OC 4CO5A 3SV4A 2PFDA 4FKXA 4WK1A 1VQOS 1W2BR 3MM5B 4S0MA 3TEGA 4CRJA 4Q8EA 5L9XA 2WHOA 3I0RB 4A8YA 1WACA 3LUYA 3H8YA 1U2FA 5I3UB 2EC2A 4PQAA 5L8RC 1QVGR 1X5PA 1QE1A 4RWWA 3MUTP 1RT6A 3H2LA 3OTOF 3AJ1A 4L73A 4JI2F 2KZZA 3PKYA 4RX6A 1CJTA 4OZ3A 2JJ4D 3D0IE 3BR8A 1AZSA 1AFJA 2PFFB 1DARA 1N4LA 3AB4B 2ZVSA 2IY5B 2C2OB 3I31A 2OI2A 2JEIA 1U02A 1NO8A 1RTDB 2F4VJ 1Y00A 1S7IA 1H2TZ 2N3LA 1BD6A 4LF8F 1FVSA 3HXMA 1G1XA 1S77D 4A8QA 2PGCA 5HLFB 3AXMA 2R8IA 3IAS9 5ETKA 2PMWA 2JFDA 4BWMA 2L3MA 1HNZJ 4JI3F 5A2QY 2IDLA 1JLAB 2E7XA 4OYBA 5KFVA 1DBDA 4V19J 3CJ0A 5KG7A 1YBTA 2QJ3A 1YWXA 3MEEB 1HWLA 1TUVA 2ZJQQ 2MJUA 4LF2A 3KJVA 1T3OA 3OHAA 4MIWA 4OV6A 4USKA 1RAGB 4WU3A 1IQZA 1HQ2A 2DNMA 4Q2LA 1M0SA 4ECYA 4ENOA 1TV6A 2HAIA 3AQPA 3GG1A 4LF7F 4DQPA 5E3QA 4GC6A 1C0UB 4MH8A 3DYAA 1YQHA 3ET6A 2C28A 1ZETA 1FDAA 5A8WA 2CNOB 1IN0A 1SC4B 1LWEA 4KPCA 1S9EB 4Y2IA 4IQXA 5ETVA 1QJHA 3KLIB 2AZ1A 3OL8A 4OI6A 2YNIB 2VFUA 3MUVP 2SXLA 4QQBA 2C42A 4MKBA 1NJZA 3HP6A 4YR3A 2OLWA 2RIJA 4GKJJ 4J9KA 1NSPA 1S4EA 2PC6A 2JOQA 1FHTA 1ZA1B 5ETMA 3IGVA 1N0VC 1SJ1A 5ETPA 4WTOB 1MWZA 2PO4A 4CLYA 1RADB 1JNRB 3D67A 3MWBA 5A6WA 3LP0B 1JXLA 2AJFE 3C14A 1VYAA 4DHVA 3I9V9 3A4TA 2HHTA 1OWXA 4JV2A 1UVMA 2IRYA 3MPVA 1WF0A 1ZPWX 2VV5A 1KBRA 2BMBA 3CJ4A 3CJSA 1T95A 3RUBL 5LSLA 1HWJA 3I5AA 4A8KA 5J1NA 5A6PA 2BV3A 1SPBP 5FLXY 4E98A 1M1HA 3DLEA 4WFYA 3GFXA 2QC3A 2FIUA 3E51A 5HQ8A 4M63A 1RTIA 4ANDA 4YB5A 2KT2A 2AYMA 3DLKB 5CZVA 3TO8A 1JIHA 4FKYA 2QT7A 4Y00A 1JJCB 2FY8A 3MEGB 2CQCA 3KDOA 4C97A 1S10A 4DN0A 3D1HA 4KO0B 2D3O1 2P8IA 2RQKA 3M6VA 4ILMA 3MFIA 3JTOA 1U1QA 4TYAA 5M2PA 3N6MA 2KG0A 3MPYA 4LIRA 2FZCB 4H4KA 2F3JA 2CJYB 1XR6A 2B4PA 4DX7A 3H5XA 2K8GA 8RUCA 4QYZK 2E5JA 2PSZA 3ETMA 1L3TA 3W3SA 3SDEB 1UAWA 3CCMS 4C2MA 3R7SB 2MKSA 1ZM4A 1HPZA 1HNVB 1RCXB 2LU2A 2IM3A 3M1VA 1TMJA 2RKIB 1U0HA 2W01A 4USUA 2GVDB 2EBEA 5B0EA 3LF0A 4RUBA 2O66A 1T05A 3TAMB 2AYBA 5ETLA 1K73T 3J7A1 2VL1A 3CJ5A 5CYQB 4J9NA 4B9VA 1FE4A 2ROGA 1KVKA 3KLHB 2R7SA 3G8SA 3PJ9A 2DNZA 4BBYA 5B0AA 3FC9A 1HNXF 4DQQA 4NPOA 3AD7C 2Q1LA 1EJ7L 2WVFA 1R8PA 2C3UA 4DSEA 4H54A 3BPSP 1RTHB 2W8KA 5M2UA 2FD2A 4ZJLA 3CCTA 3UD4P 5BYRA 4KBIA 3UCGA 3MPWA 3NNCA 2LDYA 1HL6A 4X4OA 3H4DA 4F2RA 2E9TA 3K5MA 4JI5J 1WSVA 2KZMA 2XHWA 1HARA 3TQ1A 2IM2A 4DV5J 3ZZOA 2R9LA 3V6KA 2W4DA 2YKAA 3OXFA 1KHVA 3PYDA 2FHJA 2B7CB 1JLBA 2CQPA 4YFUA 1RU1A 4JI6J 3D3CJ 1VRUA 1FDBA 5KT2A 3ENVA 5EGYA 4JV5J 1NSQA 2D74B 2EEYA 4IR1A 4C3MA 1HHTP 2F7VA 1U49A 3D6TB 2RF2A 1Y7PA 4ICLB 1WDDA 4KSEB 2GC8A 1I5OB 3I6PA 3NRBA 3HDSA 3C2PA 2KDOA 3AJ2A 5C42A 4NLDA 2ZH6A 4DG1B 5J2MA 1OJ4A 3MEDB 2B9EA 5DS7A 4OI0A 3T1YF 4PWUA 1Y4ZB 2V2ZA 2QGFB 3A3PB 3CCUS 1FX2A 2GGPB 4DV4F 2O1PA 3D1QA 1IKWA 4OZLA 3BDPA 2AQ4A 2ZDPA 5AE1A 4DPTA 3KG0A 4Y0FA 1JKHA 1UJ4A 3FEYB 3ZTQA 2KT3A 2XZDB 2VKRA 3UQSA 2J7UA 1R0BG 4DV2F 1RWKB 2J6SA 3ZXWA 3IWLA 2E5GA 3IRWP 4NRUA 2EG2A 3POTA 4ED0A 1B70B 3QO9A 4F25A 3VVUA 1HW8A 2QLFB 2YKNA 1IR2A 4CNYA 3EE3A 5A8RA 1E6VB 3SFGA 3PY8A 2CZVC 2AJ2A 1MU2B 3CVKA 3B4DA 1NH7A 3OL9A 3D9BA 2UU9J 5U47A 4WFBQ 3HVTA 1J5EF 1T9WA 2ZJRQ 3FFIB 2E9RX 5G4DA 4DR3F 2IIHA 2OKQA 2AYEA 2YQ1A 3KLGA 1KTQA 1D9AA 4KJIA 4DFJA 1VBYA 1RTZA 4PZVA 2QL5B 1TKZA 1XR5A 2W2NP 3WX4A 1LW2B 3KMQA 3DXSX 2XMVA 2NPIA 2KTQA 2HS3A 3CD7A 4ID8A 4L74A 2FLPA 3HKZD 2DPJA 1XNQJ 2R8KA 1F2HA 1RWWB 1WKJA 2VFVA 4E2FB 2KKHA 2KXNB 3D54A 3T41A 5JJBA 2L9WA 2VPXB 2VG5B 2B5JB 2ZJPQ 1N5YA 4ITSA 4NCGB 1NDPA 1HBMA 4DXLA 2CJBA 4FYYB 2XS5A 2DR6A 3FZBA 3M2UA 2E7VA 1J2VA 1A6LA 1HNWJ 3C15A 1BQNB 4B9SA 2FVQA 2NQPA 4IRCA 4UZCA 4DV0J 1IBKJ 3UO0A 2MKHA 2BKOA 4NI2B 2HMIB 2AGPA 4PUOB 1QUVA 4IOBA 2DVIA 2YWHA 1KRPA 2UZAA 1G7CB 1QDUB 3UN3A 3GR0A 2DNLA 2P6SA 2J0WA 2XZWA 1RBOB 3Q8QB 5DDQC 3IBCB 2LECA 2ZNZA 3VAJA 2UUAF 1NXIA 1X9SA 1RA6A 4F4XA 4X65J 2I0XA 1RYRA 3MHYA 1REVA 3PFOA 1YJ7A 3NBPA 3RB4A 1YHQS 3UVJA 5IM0B 3NGUA 3OFHA 3ZNJ1 1GMWA 2BUNA 2F40A 4X64F 1VQSA 2B3TB 3GJRB 5DQIA 3MR2A 1FF2A 2XI2A 2N7YA 2P9CA 2FJBB 2PEBA 1LXJA 1VIOA 3I87A 5GMKa 2E1CA 3KK3B 3AY0A 1RP5A 1JLGB 1KP6A 4ETXA 3SCIE 2ZWOA 1S99A 2PE8A 2E5HA 1IBLJ 4UZBA 4P73A 4ZP8A 4DV1F 3HJVA 1R27B 3MM5A 3AQOA 3BS9A 3I0RA 4PYAA 5FJ4A 2F1FA 3IR5B 2P6TA 4TQRA 3BQ1A 1D09B 4IRKA 3QATA 5I3UA 3D0HE 2MEWA 5F9LA 4LR8A 1SH2A 2V2QA 2E66A 5ITHA 1BXNA 2CAJA 2DR7A 2MMYA 2KJVA 2CYYA 4F0MA 3HHKA 2DNKA 4ZVHA 5LM7E 4RO0A 2EI5A 4RW9B 2VG6B 2VQFF 4NE9C 4DPXA 4LREA 2FTRA 4ZS6A 1TAQA 4NWBA 2XMKA 4I6YA 1S6UA 1L3UA 1BE4A 2IYGA 1RTDA 2WVDA 2VG7B 4JV0A 3C6TB 2ALZA 2DISA 2BQUA 2HHXA 3CMAS 4FXVA 1VFJA 3B54A 5KTQA 2GO8A 5HLFA 2FUG9 2KT5A 3AFGA 3E01B 2P9GA 1FXLA 3CJ2A 4FPRA 2V6AA 3IM9A 1TKTB 3W63A 3MD3A 2IA0A 1JLAA 3VAGA 4BHQA 2GJ2A 5B0GA 3GJSB 4JYAJ 2M4MA 2FHJD 2F9JA 3MEEA 2B7BB 5F8IA 2ASDA 5HJYA 3DOMB 3V2UC 4GKKF 5KFBA 1NK0A 2WCXA 1YJNS 2KL8A 1KKHA 2A1BA 4B3OB 1Q79A 1H7XA 1HD1A 2DGSA 4TU8A 1OIAA 4M5HA 4KIAA 3RW6A 1PO6A 3PJWA 4F4YA 5HROB 4ED1A 1U26A 2YXLA 5CYMB 1C0UA 4R5PB 1B7FA 2F4VF 1HNIB 2RH3A 1SUQB 1HHSA 1RHKB 1VRQC 2NXUA 4KGMA 3P8BB 2G0IA 4PQUB 4XO0A 1KSPA 2H3EB 1S9EA 3DRPB 2W4PA 3T5JA 4OI2A 4ES3A 1KOOA 2EKNA 4ZPWR 3KLIA 1D8YA 2X1FA 2OEKA 1ZS6A 3PIOQ 1HWUA 4DCOB 2ZD1B 3PHEA 2F8EX 3RTVA 2UVWA 3CJ8A 2YNIA 1HNZF 1DFDA 1HI0P 2CPJA 5HMXA 1IBCB 2UXCJ 3QRQA 1HA1A 3IRXB 1MROB 4WXWA 2J9EA 3G6ES 4ZLLA 2XC9A 1TMMA 1FDNA 2XYPB 5HP1B 4ZLPA 4DJBA 2DGTA 1R0CB 4KY3A 4TU7A 4ZVTB 1RJJA 4A8XA 5KFXA 3VGSA 3BO4A 2XY6A 2C3OA 2JLEA 3SSRA 4RW8B 2QA1A 3BF4A 3LP0A 3N9UC 4OZJA 1QUPA 1UFKA 1VQPS 2BR0A 4YB6A 1NEEA 1CBKA 2HLTA 2XHCA 1KQKA 1S5ZA 4QIGA 2VBZA 2HQGA 2A6OA 3IAM9 3KLEB 1WNEA 2DY9A 1IJFB 4YEAA 5IT9Y 2NCKL 4Y2AA 1YBUA 3MR6A 4HR2A 1FFWB 3HULA 4DL6A 3QAUA 2DT9A 4NMXA 1HBUB 1JX4A 3N6LA 4EEYA 4RL1A 2FVCA 2HSEB 3D6MB 2JVRA 2YWFA 3SZ2A 2JFKA 4MK9A 2WVBA 3CTRA 1L3VA 4CO2A 1TL7B 1SIWB 4WJBA 4GKJF 3DLKA 2DR8A 2VZ9A 1GK8A 3CEDA 2CJQA 2Y8YA 2IBOA 4C3LA 3TAPA 2C2RA 1FEHA 1RB0A 3MEGA 3MMAB 5IC4B 1CEZA 2YWEA 4KO0A 4CTAB 2NS1B 3EWGA 4X4RA 3W61A 5KFMA 3RYLA 1QSLA 2FHKA 3K5NA 3L7UA 5L39A 5J1EB 4OJHA 3RR8A 1SQFA 2KFNA 3MR5A 2LQBA 2P5VA 1WOPA 4I67A 2R4FA 2RD5C 1TFYA 3AT1B 3GWCA 3F41A 4H4OB 2XEXA 3HVWA 1Q8IA 3SDEA 4I2PB 1OYEA 2IHR1 5F8GA 2V2VA 1KLNA 4RNMA 2KXFA 3EX7B 1S57A 4OYWA 1RT4B 1HNVA 1U47A 3T5HA 3KUHA 3RAMA 2QTWA 4P6QA 1QAXA 2RKIA 5FDLB 3H25A 3ICLA 1Y10A 5B7WA 2GVDA 3CDAA 3Q83A 2HBYB 3ZZRA 3BKFA 4OL8A 2RS8A 1VIXA 1FWLA 3TAMA 3Q8VA 3HVRA 2QMWA 1S9GB 4MIBA 2EG1A 2LU1A 5CYQA 3O44A 3KLHA 2Z2MA 4C4WA 1IWAA 4EBEA 4Y65A 4M5JA 2GVZB 4FYVB 2B56A 3TUIC 1Z2ZA 4V19X 4PAAA 1OO0B 3BBBA 3KJQB 5KG6A 4IDKB 3BPDA 1GMWD 2KI2A 2DD8S 1RTHA 1NU4A 4CNZA 3MDFA 3AAWB 5EN1A 3PG9A 3CJTA 2W9BB 1APSA 2OPRB 1S59A 4DFPA 1FJ7A 5KFEA 1RGVA 3LA0A 1GH8A 2HK2A 1T11A 2CUYA 3HLUA 3F73A 1RBAA 2B8QA 1UW9A 2GHPA 4DQRA 4AQYJ 2H4YB 2PI4A 5C24B 3MMCB 1KNZA 2WSCC 2EK1A 3R6LB 3CD0A 5KFIA 2I2YA 2DNHA 1VC0A 2Z58B 2G9OA 3FSXA 3VGUA 5A76A 3TYTA 1XMQJ 2K7KA 2KHDA 4XTTA 4X4TA 2VA2A 3R3TA 3P5TL 4ICLA 2LEBA 3HD1A 2KRRA 2I5JB 1K0VA 4QYZJ 2WTFA 2MYFA 4M5GA 2DRDA 5K5MA 4QW9A 4Q8FA 5HAOA 1V3RA 3QPIA 4DG1A 2ZE2B 2BKNA 4G1QB 3E3XA 2OPPB 3MEDA 3QJLA 4U8VA 3B4MA 1JWWA 2ZM6J 2EPIA 2GGPA 4QWBA 2H51B 3DNCA 4CH1A 3QAEA 5ETNA 2XULA 1ZPVA 2X3DA 4JI5F 3CC2S 2EXUA 3J80Y 3HO1A 4DV5F 2GO9A 1RUSA 1V5IB 2DGOA 4KYZA 2ZH3A 4P74A 1XMOJ 2XMWA 3GJQB 2Z4PA 1E6YB 4RU9A 4WF9Q 1RE1B 2DGXA 1K8AT 4P2MA 4JI6F 3FJ2A 2GMJA 1SL2A 4UY85 4N5SA 3CDWA 5F0UA 4JV5F 4GMKA 1HW9A 3AD9C 1NK9A 3FCVA 4BDPA 1PYTA 1CQMA 1E6VA 3KTQA 4U96A 3U1LA 2N7CA 1UZDA 3LO3A 1Y0HA 3NKYA 3Q86A 1MW7A 2V8HA 2HHQA 1XQIA 3DHWC 1MU2A 1FVQA 2ZOFA 3KK1B 4JOUA 4HKQA 3MTJA 5GAGU 4WE1B 3VAIA 5F3TA 3FFIA 1RWOB 3CCRS 3M8QB 5A0YB 1RDRA 2AF6A 2JEGA 2HQDA 2NUHA 3QT5A 1LW2A 2Q43A 2QLXA 2F8MA 2ZUGA 1PAUB 3R5AA 2JVOA 4WTYA 2DGUA 4NLVA 2MB0B 2XLIA 1QY7A 2CQDA 2LMIA 4QWAA 4QBUA 3C6UB 3HJFA 2EFPA 3QJPA 1YIJS 3PW0A 1RHMB 4IH6A 3TA0A 4IOCQ 2QZ8A 1ZZNA 3QT7A 1K1SA 3EXYA 4IKAA 2C2NA 2VG5A 2B5JA 4WP8A 4HT7A 4NCGA 3DLGB 5CZXA 5IZHA 4NLQA 2XZTB 4M5MA 2DIUA 4B9MA 4KH0B 3I4PA 5K8NA 2WVCA 3NAHA 3MMBB 3BSOA 1BQNA 2DHAA 2F63A 2ZH8A 5L1LA 3F56A 1RCOB 2OD6A 3BSNA 4KGXB 4ZVSB 4NI2A 1VRTB 4Z7CA 3AHPA 2HMIA 1VCTA 4PUOA 1RAAB 5ETQA 2N4DA 3R5GA 3K5OA 2JRSA 1F9FA 2JLFA 5ETRA 3KJNB 5KFOA 5H9FK 1XNQF 3M05A 4RW6B 2I6WA 5HI7A 1TK8A 1TL1B 1S4FA 4B3SJ 2IMWP 1HBNB 2D9OA 4DBQA 2FHOB 3TAQA 5KFKA 4H4KC 4U67Q 4F8RA 4OX7A 5IM0A 1SV5B 4FS2A 4Z2XA 4C9DA 2ZZNA 1ZTWA 3W5YA 3A8KA 5T14A 5J1PA 3K59A 1AB8A 4P2SA 2BOPA 3QT6A 3T1AA 2H5IB 2ROPA 4LSZB 1AW0A 3K89A 5LJ3Y 3B82A 3W66A 1AUDA 2C2EA 1HNWF 1YBAA 2ZC4A 3EDRB 3JS9A 1Y5LB 3KK3A 4D3GA 1RAHB 4AL6A 1JLGA 4DV0F 1IBKF 2J6TA 3CMES 3NMAA 1X4GA 4BCAA 3K2YA 3M4XA 3ISZA 1XK8A 1GEHA 4USTA 2HNDB 2MQLA 1EHWA 3S7RA 2E29A 1EARA 1X4HA 3N0VA 5B0BA 5K8PA 1TTHB 1HYSB 4R0EA 3UN2A 2K3IA 3BGLA 3ETOA 5IQQA 3DMJB 4BWJA 2V94A 2DHHA 2KO1A 4X65F 4ZKAA 1IQTA 1O5JA 5CABA 5K8MA 2VFTA 4C3KA 5JXSA 2RS2A 2G1HA 4RW9A 3HVAA 2VG6A 3C8YA 3UNGC 1ELOA 4IUFA 1U2CA 4EBCA 4ALZA 1RT2B 2B4VA 5EHHA 2YQ3A 3T19A 3JSYA 3MPUB 1VQYA 1JNZB 1FRJA 1GNKA 2VG7A 5BYQA 5IS2A 3C6TA 3QZ8A 5GAGI 2J76E 5A2QU 1PGZA 3LTOA 3FKBA 2AEMA 1SKRA 1NPRA 2MXYA 3G8QA 4C8MA 5GAEI 4WK3A 1RT3B 5HVHA 3NNHA 2FVPA 4EK2A 2VKZG 3AODA 3E01A 3OTDA 1IBLF 2BQ3A 2IMOA 1QAIA 4O3NA 3T1HF 2D41A 4P75A 1LWFB 1TKTA 3HT3A 2BBEA 3QRRA 3BN7A 1Q8LA 1AFIA 2QLWA 4OI1A 1LWCB 1VC5A 3O5TB 4LF9J 1Z2LA 1MG7A 5LXYA 5CCLA 4UUXA 3DLHA 3DOMA 2MPUA 2JC1A 2BOAA 4UF4A 3GV8B 3UI3A 3IGNA 2O5DA 2HGMA 2KN4A 4B3OA 1I94J 1U24A 3Q22A 1NDLA 1FDDA 4G6VB 2M8HA 5HROA 1FJEB 4F4ZA 2GFFA 3NCRA 5CYMA 1TKXB 1YVFA 2A10A 3KYLA 2RMLA 4CO3A 4R5PA 4LF6J 5LMUJ 1HNIA 4DOZA 5DQHA 1SUQA 1GXUA 1VK3A 4PQUA 4NLGA 4ZPBA 3DRPA 5L38A 5HK4A 2I38A 2IM0A 1C0TB 1KVIA 2XMAA 4M1KA 1S97A 2ZD1A 1N8RT 1AUSL 2BANB 1AXQA 3VGVA 3PCOB 4NLRA 1Q82T 1YJTA 2POKA 1UMJA 2UUCJ 4NYOA 3NNAA 2BM1A 3IRXA 1MROA 4JYAF 3W5ZA 1GTEA 2YPZA 3L7OA 1BLUA 2NXNA 4L72B 2E1PA 1Q0NA 5HP1A 2Z30B 3K5PA 1PC4A 2NXCA 3CNQP 2F5GA 4CLSA 2ILZA 4ZVPB 4J9OA 3JQKA 4FYXB 4OJGA 2AJQA 1N34J 3NMRA 2R7TA 2AX1A 4RW8A 4J9RA 2VBWA 3TEHB 4FXWA 1SL1A 2IRXA 1YLXA 3LAMA 2M8DB 2ZOMA 2MZ1A 4DX6A 3KLEA 3IR7B 5FLXU 2FY1A 3QNWB 1RK8A 1F9EB 5KG5A 3UW1A 2EBGA 3QLHB 4NCBA 4OI3A 1WF2A 1RWVB 2CQ4A 3R5BA 1SKWA 4IFVB 1HBUA 3KMSA 4C7QA 3VQTA 3G71S 4Q0BB 2QLJB 4MIAA 4JBCA 4O3QA 4QIFA 3JYTB 3R97A 1TL7A 2BE2B 4K4ZA 1S6PB 5HVGA 1H38A 2PT0A 2R7QA 4TU9A 6FDRA 1WTFA 4PEOA 3H5UA 2XYGB 1SQGA 5F9NA 1Y3KA 2BXJA 1R6YA 2F9DA 3MMAA 1S72S 4CTAA 2UUBJ 1IBMF 4G65A 3H40A 4Z37A 1DLOB 2FZKB 3RRHA 2CIMA 5J1EA 2VFSA 3ONQA 1IM6A 2BE7D 1YJVA 2HQIA 4HH0A 2RQMA 2GMHA 4I6WA 2M3DA 2A0FB 3AH6A 4J7CA 4OJ3A 1S0VA 1B3TA 2W7AA 5K8OA 2FJVA 3MCMA 4I2PA 3K58A 3G82B 3H90A 2DTJA 3H7HB 5ADZA 1MSWD 2HW3A 1X5SA 1RT4A 3DHXA 1WI6A 4JI8J 1CPZA 5FDLA 4YP3A 2OHDA 3BSAA 1ULRA 1WEXA 3NCPA 4P72A 4J9PA 2G1DA 2RB7A 4ZMMA 4DU8A 2WVEA 2X51A 1S9GA 1CQNA 5GMDA 4RR5A 3FZ2A 3I82A 3OXGA 3MD1A 4I64A 2GVZA 4M5LA 4NZ7A 4BC7A 4IDKA 3TARA 3CCLS 5KFJA 5CYJA 2DGQA 4F3OA 4YDXA 1R7IA 3MOJB 4O44B 3IWXA 2VC1A 2W9BA 2OPRA 9ATCB 2MZQA 4DCPB 1B0TA 4RUHA 3W60A 3HFVA 1S76D 2CKWA 2ACYA 5HL7Q 1PJ7A 2LA4A 5C2CA 2GJIA 2W1BA 2BRLA 4NASA 2X1GA 5C24A 5B0FA 3MMCA 1RBLA 1XTZA 3BKUA 5LSRA 3VF0B 3O1LA 2FC8A 4PG4A 2LQ9A 2GIFA 3JAMY 4F2SA 3V6HA 1FNXH 1NLKL 2K06A 4TKTA 3J7YU 4HHUA 1DQAA 2E1AA 1HKAA 1QAJA 2I5JA 5E0OA 1UFWA 5IT4A 1T8EA 1RWMB 2ZE2A 4Y2KA 3QSYB 4G1QA 5DG8A 4ECUA 3M8SA 3O8WA 2OPPA 5HQLA 2DO0A 4G1PA 1HBOB 4K2JA 3H42A 3ZTRA 1OPZA 1NK7A 4NA3A 1NUEA 4KB7A 2M5YA 3AA9A 3HI9A 5HMZA 1UTAA 3QQCD 1TK0A 2CNLB 2XGPA 1H6KX 1XEZA 3NAIA 4IH5A 8ATCB 4Y6IA 1QSSA 2QEXS 4AQYF 3BQ0A 3FK4A 5DJBA 1FFGB 3OVSA 5HBMB 1E6YA 1PYOB 1X9WA 1JB0C 5CH7B 3DRRB 1DZ5A 1HQEB 1RXOB 1M5OC 1TZ0A 3PX4A 3DI6B 5D0GA 5KFWA 4X4VA 1V3SA 3GCWP 1XMQF 2HNZB 4XPEA 1IKVB 1H3DA 4LRAA 2HZCA 2DNGA 4ED4A 3FBFA 2G2YA 3QGPA 1X5OA 3N01A 3D28A 3MR7A 1H98A 4LMZA 3ZO7A 4IYQA 2BX6A 4ECTA 1T3NA 2X1AA 1WHVA 1RAFB 4J9VA 3DDIA 4WFZA 2KM8C 3BQ2A 2RHQB 3Q8UA 4HHJA 5CD4H 3KK1A 4YN3B 2AGOA 1RSCA 3FUYA 4WE1A 4QIVA 5F8NA 1WC5A 1P9YA 4KR0B 1S12A 3PO5A 1VLYA 1SC3B 4HLBA 4MK7A 1N56A 5AXNA 5D0RA 1JLEB 3QFHA 1L3SA 3OQ2A 3D6HB 3M8QA 4K4TA 5A0YA 1VHIA 2FZGB 1VJQA 4K5RA 2JDJA 3PEJA 4AL5A 1IR0A 1UWBB 1NZ8A 3ZZUA 2EFQA 3VQSA 1XMOF 4DSIA 3DCAA 5MLCV 3K7RA 4UQGA 3C6UA 1VLOA 1JJ2R 1VHFA 4KHRA 3CC7S 1PJ6A 5IT0A 1WI8A 5HSPA 2ZC3A 1EETB 2YKPA 4ELVA 3P5BP 2WSFC 1BY9A 4C8NA 1FRKA 2ZVIA 2J0SD 3LP2B 2JL9A 3W2WB 5GADI 3JB9k 5KT7A 4DPUA 3DLGA 3TP2A 1TL5A 2IM1A 3QRPA 3T3FA 4HEA9 1K0TA 1FKPB 1F2GA 2HEKA 3MMBA 1P1TA 2PN6A 5DRKA 2BEFA 3BKTA 3MM7B 3GZ7A 4RPFA 1VRTA 3OLAA 4AD6A 5C25B 2E7WA 4CI0B 1KDNA 3I9ZA 1T9YA 3ILOA 2Y1IA 3FCWA 2OPQB 2OMLA 1C4CA 1FJCA 2PMZD 2PMHA 3LH2S 2W9CB 3GYGA 3H0PA 4U9RA 4RW6A 3QIPB 5CA5A 2M2BA 2HVHA 1TL1A 4LT6A 2YWWA 1HBNA 2LXUA 2J7WA 4CLZA 1SV5A 3GIKA 2W24A 2MQOA 2AX0A 3HHLB 2APOA 3L95X 2RVJA 5THWA 3THVA 3OVAA 4I6AA 1JXEA 4GO7X 4TY9A 2AJ0A 4CT8A 1UEUA 3CCZA 2XMTA 3X3UA 1O51A 1T9UA 4KRWA 4A48A 4LF4F 3TUZC 3IWNC 2HURA 1SVDA 4EO6A 1WUUA 1T03B 2HVIA 4EMDA 3V4MA 3W9JA 4HVZA 4DMZA 1FKOB 2GW8A 3MURP 5BR8J 3ZC4A 2QN6B 2ZZMA 2HNDA 1KFDA 5KFSA 4FDFA 4CIOA 5AXLA 3K5LA 3DLBA 2MZRA 4NCAA 2YX1A 2XY7A 1OY8A 1HYSA 3M32B 3NWGA 1ZM2A 1DAXA 2NSCA 1L3KA 3OJSA 4AT1B 3H5SA 3DMJA 3PYEA 1PSDA 4DL0C 2GAHC 2GHVC 3CD6S 3MTKA 2HQCA 2J9CA 4B3SF 5EWFA 4DR4J 4NXNJ 4RUCA 2UVVA 4E8UA 1HFEL 1FO1A 2IBKA 2IVYA 2XM3A 1SJFA 4RKUC 2QYGA 3SSSA 4LRFA 3CD5A 4IO9Q 1N33J 2XSJB 2NXJA 1RT2A 4MKAA 1D8ZA 1UETA 2AT1B 4I0WA 1F3FA 2L9NA 4HH1A 2VQEJ 4J9MA 4BLGA 4DR2J 5H9FJ 3GP9A 1U48A 2VA3A 1RT3A 4J9SA 1Y9OA 1FTCA 2AGQA 5AE3A 1EZZB 3DM2B 3EGZA 2HYIB 1KQGB 1MMNA 1LWFA 2RDDA 1NKEA 2YWKA 2Z0GA 4LVNP 1QTMA 1MMLA 5HJXA 4P71A 1WKKA 3PTWA 2GNKA 1LWCA 4IFYB 3D68A 3N79A 4ZOSA 5IQ6A 3W64A 3LGNA 3O2IA 3OTBA 2XO6A 1SC6A 4FXDA 5F3ZA 1W2IA 3W8GA 2DO4A 1EIYB 1XN9A 5IOLA 2OELA 2ZOGA 4N8OA 3PEHA 1YSJA 1HD0A 4NX9A 5E3AA 1Q86T 8AT1B 2D1CA 2OSQA 1RTJB 4MFBB 4UOFA 4ZVFA 2RRNA 2GA7A 3WHIA 1EKSA 1TKXA 2C2ZB 3FSYA 3R5DA 4B3MJ 2OFGX 1UJ5A 1QAYA 1BUXA 4I68A 3GIRA 3PXGa 4DSLA 2HZAA 1LFWA 2NZCA 3BGUA 2HVDA 2HFOA 1C0TA 4X84A 2YBVA 4C8OA 2UP1A 1Q8BA 3MF5A 2BANA 3A8JA 1WC4A 4U8YA 4KV8B 4LVOP 5I3PA 4LF9F 2CRLA 3V5RA 2U1AA 5F8HA 1DHMA 4OZ1A 2Z2YB 1SH0A 5BXIA 2VICA 3GYXB 1VQ5S 3I56S 4FS1A 2FJXA 2M9KA 3NGTA 1I94F 2BQRA 4FZVA 5E3CA 5IT9U 1CLFA 1TL3B 4PG5A 3F0NA 2XCPA 2HIQA 1LEOA 1Q78A 4QIEA 2MZTA 2ALYB 5EWGA 3I32A 2UV8A 2Z8QA 4ILRA 3T9ZA 4LF6F 1YITS 5LMUF 3SFUA 3RB6A 3W9HA 3UR0A 3QSIA 1Q16B 4ECZA 2N3OA 3QLHA 2EVZA 2KM8B 3GSDA 1BC6A 2BZ2A 4IFVA 1KD1T 2R7UA 4N77A 1OPIA 4UW2A 4Q0BA 3KFWX 3FCHA 4CT9A 2UUCF 4DF4A 3JYTA 2ZZTA 2CWXA 3KHLA 2BE2A 5KT5A 1S6PA 2RQ4A 3SMZA 4YB7A 2MLXA 1URRA 5KFTA 2HRYA 1X8DA 2MQNA 3IC1A 1CJKB 2FYXA 1N34F 1VQ8S 4CLUA 3ZTOA 2NYIA 3KHRA 1WJ9A 4KPYA 1DLOA 4R8UB 4F36A 1NMEB 1RQ0A 4GC7A 3E8OA 2H5JB 2HRUA 3DOKB 3AB2B 2R7WA 3O3LA 2W7PA 3G82A 3CWJA 1ITPA 4OJ1A 1S7HA 2E5IA 4QU7A 4ZJQA 2HAFA 1F9HA 1U45A 5K20B 4R25A 4MK8A 5H9EK 1B0PA 1U0SA 1GX5A 2DPIA 5AXMA 1GMUA 3HT0A 3VZHA 3QGGA 4WXOA 1WC0A 1WORA 4DR6J 2QSWA 1UVNA 5EUHA 5EX0A 1IR1A 2V0NA 1P6TA 2LCWA 2ZBRA 2M88A 2YX4A 4YY3J 4JI1J 1Q4RA 1M1GA 5HMWA 4IRDA 3CXCR 4KQZA 1Z1ZA 1DY3A 1GMVA 2LP4A 1MWYA 2BA9A 2UUBF 5C5JA 3RAQA 3T6BA 2HHUA 1T9TA 1DJ0A 3D7SB 4F3QA 4EO8A 2HNYB 4FN5A 4BS2A 2IVMA 3BGFA 2Q66A 4O44A 3RU0A 4NXMJ 5HVFA 4ZIWA 2J9DE 3FMBA 3IR6B 2Z57B 1R0AB 1D1UA 1H2VZ 1S1UB 2ROEA 3RRKA 5HO4A 4DUTA 4WCEQ 5IFMA 1TK5A 2XI3A 2K2PA 1DRZA 2ZEJA 4JI8F 3L9ZA 4IQMA 2F4FA 2HS4A 3H4BA 4OX8A 4ECQA 3FDSA 3SXLA 5LL6d 2W2PP 3KHGA 2DNQA 4CLTA 2J9DA 2HWIA 4KKOB 2Q6CA 3S1TA 3FRZA 3MUMP 2E5LJ 1I3OB 4UUWA 2C2MB 4I7FB 3G6VA 4QW8A 4KFBB 1GFWB 3PRBA 2CXEA 4O4GB 1JJHA 2HFUA 2LKZA 2Y1JA 5RUBA 4USJC 1KQSR 3TWZA 4ZITA 5DDOC 3J80U 4NLUA 2OFHX 1NPPA 1VBZA 1URNA 3BGRB 4WKYA 5DZ6A 1HBOA 3OUYB 1OQ6A 3BO2A 3OW2R 1S49A 3CO0P 1U1NA 5GMEA 1C2PA 2VH7A 1UW4A 1C1CB 1UVLA 3SV3A 1T9VA 2Y3YA 4M94A 2QA4S 1I6JA 1YJ9S 3U02A 3AOCA 3WBZA 1VQ9S 5HBMA 4WFAQ 2JEJA 4TQSA 3DRRA 1HQEA 1IJEB 2D7SA 4ZN1A 1RZMA 3DI6A 3TQEA 2XG8A 1HI8A 2HNZA 2EKYA 1IKVA 4C6AA 1WKLA 1R3NA 3W9IA 3BB5A 4USVA 3A1YG 1SB6A 2HGLA 1SH3A 1NHUA 2XSFA 3TOQA 4ZHRB 1FRXA 3JSRA 3CB4A 1DQ8A 3HHNB 3OR2B 4DPYA 3H20A 5HMYA 4OMFG 2Y0BB 5IV3A 4FVMA 4ZPDA 5H1SV 2HK3A 4ZCLA 2O01C 1JLEA 4KE5A 2LLZA 2RUSA 2E1RA 4CH0S 3LGMA 4DL4A 1D3WA 2JLGA 2FHMA 4F67A 5J2NB 1UWBA 5CHCB 3QJJA 1G6BA 4DR5J 2AJ1A 4JV1A 1WD6A 3RGIA 4CQ1A 2AKWB 3IXQA 1X7VA 3OLBA 3ISND 5IV4A 4ZPCA 4EYHB 2B51A 1ZA2B 1X9MA 2R42A 1A0OB 4TN2A 2HRTA 1GT8A 2I9SA 1EETA 1LV5A 3BGOP 2UUWA 2ZH9A 3LP2A 4TXSA 3W2WA 2DXDA 3FBEA 3TUPA 3J81j 2K1RB 3DGVA 1RKIA 1CSJA 1FKPA 4ZN3A 3AJDA 3GIJA 1VR6A 5KFRA 3UPFA 4ZK7M 3G6XA 4LRDA 3MM7A 3ENAA 4CH7A 5B09A 3CULA 5C25A 1UEVA 3M7VA 1WOOA 3MM6B 2NSBA 4JI7J 3M6UA 2L9DA 3CF5Q 5E3PA 2OPQA 3NWRA 4NLYA 2B43A 2BM0A 2CVIA 3W8PA 2QLBB 2DB1A 2GIRA 2W9CA 4TLQA 3CSKA 1N54B 2DNOA 5KFDA 3QIPA 3CCWA 3RJMB 3EICA 3WZ0A 3KLVA 2OAUA 4NLPA 2LXFA 2QRRA 2RSQA 3GIIA 2MKIA 5IC6B 4LJMA 2XB2D 4Z7YA 3HHLA 4M5DB 2DXFA 3NL0A 3K8VA 4NA1A 3OFEA 3C66A 4A8SA 2DH8A 4NL5A 9RUBA 4ED7A 2B9YA 3BREA 1KR4A 3RBXA 1NPKA 2HS0A 4ZVUB 1UVJA 1ZM3A 3PR5B 1G4CA 2V63A 3OSNA 1YRUA 2FDNA 1N5QA 1J27A 1T03A 1PC5A 3P3DA 5D15A 2HVZA 3BZQA 1LW0B 1FKOA 1MLAA 4OYZA 4QJVA 1SBRA 3Q89A 4YUDA 5KG1A 1XJWB 3EUNA 3PX6A 3PVXA 4P10A 3M32A 3J81U 4TYBA 1UFLA 1FCAA 1PJ5A 1S6OA 2YNFB 2OGUA 2FQQB 1XNRJ 4OLPA 1Q53A 1VI7A 2DYAA 2EFNA 2EW9A 4RBVA 5I42B 4W4MA 1S0NA 2XCAA 3JQMA 5CCMA 4Y2CA 1HQUB 2KH9A 1PYSB 4ERDA 4YOEA 3DN9A 1BGXT 2VPWB 1GX6A 4K7QA 1ZOTA 3HZGA 2XSJA 2GX8A 1NJWA 2I8EA 1NSKL 1PG5B 5GVQA 1M5KC 3IO1A 2RAQA 3D4JA 4F4AA 4HYKA 4GVBB 1R8CA 2R7VA 1BHNA 1MWQA 3EM1A 4EU0A 2QFIA 5BR8F 3DM2A 4MAKA 3IG1B 3Q24A 4DUZF 3IMQJ 1IWGA 2V5HG 3BSCA 3A8EA 3G4SS 3FBCA 3OXLA 3EMTA 3G87A 2DR9A 2HLUA 2VONA 3NGDA 1BWVA 3P4UB 2QX0A 3KG4A 4IFYA 1N36J 4ZPVR 4ECWA 2MDAA 2XY5A 1XMBA 3CJRA 4ZP7A 2UUAJ 3O6QA 5DQGA 5KFUA 5D3GB 4NXNF 3JTNA 1QTNB 3D66A 2OTJS 2GQQA 4N8NA 1D0EA 1Y3JA 1VQNS 3DDNA 1RTJA 3DRSB 1F5BA 4MFBA 1OQ3A 3PZPA 1N33F 1RT7B 4DWIA 4Q2MA 3SBMA 4QR1A 2WBRA 2IAJB 3TZWA 2VFRA 2VQEF 1Y5NB 2YH1A 3EZUA 1GXTA 2AD9A 2E9ZA 4DR2F 1YTYA 2ILYA 4F4KA 2G4BA 1B64A 1RHUB 1YRTA 2CPXA 2CQ0A 2R8GA 4KV8A 3OD2A 4ZVRB 4QOTA 3CJQA 1R8AA 1ZAVA 2R2RA 4HT5A 2VJVA 3M9MB 1CC8A 4EZ9A 1JK9B 4ZVGA 4B3RJ 4Q43A 3GV7B 4ZCMA 1X4BA 3LQVA 2ZFHA 4UOHA 1SKUB 1R8HA 2HWTA 2EFVA 1SCJB 2HWHA 3Q23A 5D78A 1TL3A 3Q0AA 3UWTA 4K50A 1NH8A 3J7ZT 3NOCA 4O3SA 5EDWA 4LRCA 1WF1A 2KG1A 2MZSA 3R9LA 4O3OA 4LQ9A 1K9MT 2LYVA 4AXJA 2F65A 1U1RA 4FBTA 4NLXA 1SXLA 4URQU 1OY9A 1UWAA 3AOBA 2COLA 3ZZPA 4OX6A 3CDEA 3KNAA 2OD4A 2V69A 3H2UB 3UDLA 4DSJA 1VJWA 4QPTA 4KGVB 4EYIB 3RR7A 4ZIVA 4DL5A 2ASLA 4Y34A 4FF3A 1DQ9A 1AA1B 3KHHA 3HMJG 2GZOA 2VUGA 3PV8A 3JXOA 4YQWA 4DV6J 3H59A 3DKDA 2YKMB 1LK5A 4WZQA 4GKKJ 3G8TA 4J37A 3G6YA 2W7OA 1CJKA 2VDHA 2CPIA 3FRYA 3HCXA 5AXKA 4CO4A 5IWAJ 3BM7A 4L6V3 4U7UK 4R8UA 3PRVA 4LSLB 1TU0B 1U4BA 3OL7A 4DV3J 5KFQA 4PPZA 4JI4J 3DOKA 2DEJA 2V4RA 4CWBA 4FVCA 3EYZA 2V9WA 1FJGJ 3JSMB 4HL9A 1BQMB 4PXDA 3PM9A 2IC3B 4Q7AA 3G2XA 4XAKA 3HFKA 4I2QB 4U7CA 3IS9B 3KUEA 1YX2A 3KK2B 2VBXA 5KAKA 1T02A 2JEFA 5E33A 4U7UD 4ZJOA 1HLWA 1F5AA 3N5FA 4RU2A 2FVSA 3TRGA 1TR0A 3VGTA 3ULHA 2CJAA 2WBMA 4Y2MA 4N47A 4PPDA 4G3IA 1S79A 3ZZTA 2DIVA 2FJAB 4KC5A 1WDTA 3NXZA 3BR9A 3HHLD 1WOSA 2HNYA 2DK2A 4JI0J 4PG7A 2WOMB 3PYGA 4DF8A 1CVJA 2UXDJ 1R0AA 4C98A 3Q2SC 1S1UA 3JAMU 2RRBA 4ZDNA 1Z4UA 3TVYA 4YMEA 2ATCB 2H48B 3R5JB 3VZIA 4MTPA 5HANA 4NEZA 1RAOA 2FLNA 2J8AA 2CDQA 3MM9B 3NG8A 4WZMA 2LQJA 4DR6F 3ZZ0A 3UR3C 5E41A 2KYXA 1LK7A 1DTQB 1W25A 2LEAA 2GQCA 1OSDA 4HI1A 4WIQA 1UCNA 1UP1A 2YY3A 4KKOA 4YY3F 1KN6A 4JI1F 3X1LB 3G86A 3W5XA 3BDEA 2R7OA 4I7FA 4CLPA 1O6XA 1BWEA 3WDOA 2QA4G 3R5CA 4KFBA 4O4GA 2CPYA 1FESA 1X4AA 4NLOA 1NJIT 1ZZFA 4FBUA 1KLMB 1WC1A 4DZ6A 2Y0SD 2R8HA 4R0JA 5H9EJ 1M1KT 3BGRA 3LALA 2HHVA 3OUYA 1KEKA 2MGZB 4NXMF 2BABA 4NLSA 2M70A 4QU6A 2ZKTA 5JVGQ 3TW0A 4OV1A 1C1CA 1ACMB 3M9OB 1BQXA 4TY8B 3TZXA 2DR5A 3S01A 5LMNJ 4OZ2A 2DNPA 1JLFB 5D8HB 3CDUA 4QIWD 5KG0A 3GQCA 3CPWR 4PXBA 4QZVB 4WP9A 1B99A 4W90B 3V4IB 5LSOA 3OBIA 3PYFA 1JQGA 4AFFA 2G2OA 1NJYA 2QA2A 1RLDA 5AE2A 4X66J 1P8GA 1Q95G 3BYRA 5DM6Q 3I0SB 3QT8A 2V4JB 5FIIA 3S8SA 2BJ3A 4X62J 1TKDA 2E5LF 4WU2A 3OV7A 3C46A 3QGHA 4ZHRA 1VQ4S 2RDIA 1OS5A 5KT4A 4ZCIA 1WG1A 2L41A 3OR2A 2XNRA 4WFXA 3BH7B 5JUMA 1UJ6A 4FYDA 4OFZA 3ISNC 4OI4A 4ELTA 1RU2A 1WHWA 4LR9A 4RLEA 4EFAC 4RUAA 2AYGA 2W9AA 3KOAA 2R2SA 2A3JA 1X5TA 2RNEA 3JSBA 2F8HA 3ILIA 2VBYA 5J2NA 3PIPQ 3MCSA 3HSZA 4LFBJ 2RHSB 3BV8A 4MYTA 3BO3A 1SJRA 3MMJA 2B9XA 4ZVQB 1Q1KA 2B6AB 2KHCA 1WSRA 4F0KA 2OEMA 4ZLJA 2RQCA 5KFGA 2YKOA 4BC9A 4X4NA 2DBBA 4IO1A 4CLLA 1NZAA 1EQMA 3CO9A 3TJAA 2VF3A 2VOPA 2JX2A 3B6BA 3FMWA 2K1RA 2VB6A 5SUHA 3VWSA 2MY7A 4Q45A 1U1MA 2WW4A 2G2ZA 1AYEA 4U95A 4OHZA 3LWMA 4DR7J 3P45B 4Q5VA 1S0MA 3MM6A 4DFMA 2OJ3A 2QL9B 4Y28C 4JB8B 5DLGA 1DTTB 4P2FA 5GAHU 1VBXA 4DR5F 3MEKA 4P2XA 1RT1B 1UA0A 2BKPA 1WEYA 2BW2A 2DHSA 4PABA 4Y3CA 3RG6A 4FF4A 2KJWA 1A7GE 3EGVA 3M2RB 2N82B 1U6ZA 3DC2A 3HSDA 3GE9A 1YGYA 1EX8A 4M5DA 1X60A 5EWEA 4B3TJ 3WQPA 2GHWA 4GVLA 2MKYA 3CCQS 4ZCKA 2MQPA 2FJEB 3GIMA 3M8RA 5I3QA 3PW5A 1FE0A 1TUGB 4J91A 4OQJA 2UU9F 1TELA 1LW0A 3SCLE 2R7XA 4DV7J 3QBCA 2J8SA 3N4WA 4WYWA 2XLKA 3US5A 5DG9A 5KFYA 4DU7A 4JI7F 4UTGA 3M8YA 3FGVA 1RABB 1D9DA 4AE5A 2FVRA 2V2KA 2DCUB 3R7BB 4A46A 4ANEA 2HHSA 1JLQB 2KRBA 2YNFA 4QR2A 1HI1A 4DEZA 2FPHX 5I42A 4KHMA 1QVFR 3B8HA 2MY8A 3I5CA 1HQUA 4ANCA 4CM2A 2UUTA 3NGRA 2EK6A 1N6QB 1WHXA 4ZP9A 4AUKA 3K17A 4AL7A 1U8SA 1KWMA 1WTBA 3BYPA 2QYCA 1EP4B 4YB1P 1RACB 2D3OR 4DS4A 3DRXA 1RYSA 1TUWA 1U6BA 2RJZA 3EZOA 5F8JA 1S1WB 1VC6A 3Q8RB 3CMQA 5KFPA 4K2XA 3M8PB 4GVBA 3H5YA 4AYBD 1Y11A 5T7LB 4ED5A 4DSFA 4B17A 4J9QA 3IG1A 4DI6A 3PX0A 4CP5A 4X4PA 4RW7B 5LJ5Y 4DUYJ 4H4MB 1S1VB 3JTPA 4XK8C 1WWHA 3EVWA 4ECSA 1YZ7A 2E1MC 3T5LA 1RAIB 3R2DJ 3HFZB 1XNRF 3DGPB 3MAQA 1UZHA 3MECB 2CPDA 2CPZA 5D3GA 5A8KB 2PA3A 2YH0A 3TZZA 5D4LA 4KHPJ 1FK9B 4OHXA 3W1YC 1YI2S 3DRSA 3PO4A 1P9QC 2D9PA 1RT7A 2FJWA 2CNKB 3KJFB 5JMNA 2Z2ZA 1FEEA 7FDRA 3OTCA 1FXDA 3W7BA 3LPEA 2YVSA 4ED3A 4FP9A 2IAJA 2YNGB 3QYYA 4L3KA 2NPFA 2YNHB 3LWLA 1JJ4A 2AU0A 5CAAA 4M5NA 1JXVA 1S9FA 2MKCA 2MKKA 5GAHI 5C7PA 1K44A 1X4FA 4HACB 3FSIA 4ZA1A 2DHGA 2HG4A 1VQ7S 1PKUA 3OTEA 3V6DB 1FWKA 1IM4A 1N36F 2ZUAA 3RAXA 1M90T 3I5BA 2V4QA 3DOLB 4ILLA 4I4BA 2J6UA 2XMUA 2NLWA 2CQBA 3N6NA 2J0XA 5DLFA 1XBWA 2HPUA 5KG4A 1WC6A 2BYCA 1NCLA 3A12A 4LRBA 5B0CA 2KFYA 3M30B 2DH9A 2HBRB 4A8OA 4KT0C 1SJ4P 5I4MA 1VGYA 2UXBJ 2DXEA 2IRUA 4P52A 1MN7A 1NKCA 2CDRB 3MOZA 2EFOA 3MAAB 1KS2A 4F26A 1P1LA 1RHJB 5KT3A 1U1LA 1H0HB 3BJYA 2XLJA 4ZLNA 3FVYA 5BYSA 1OY6A 2OO4A 2IA6A 3T1HJ 4IOAQ 2CJXB 3VTIA 5J2PB 3U7JA 4TNOA 1EQ0A 1FNOA 3GMGA 1LKZA 4IG0B 3VCDA 4B3RF 1CS4B 2B8PA 3IA0A 1R43A 2VIHA 2XMMA 1KONA 2YKQA 4I56A 1CJVB 1M5VC 2QO3A 4DQIA 2P2CB 1RLCL 3CIMA 4D3HA 2YKMA 2VDIA 3FEXB 5E3RA 2MQ8A 3TJ9A 4NRTA 2KYZA 2CQIA 5KOXA 1N5VA 1A9NB 2DJWA 2HFNA 4LSLA 3MFHA 1M5SA 2XTJP 4FPIA 2H1YA 1R31A 3THTA 3GYNA 4IH7A 3LPYA 1WELA 5LXRA 4DPWA 3TVZA 3JSMA 4UT4A 2VJUA 1BQMA 3P6YC 2Y1RI 2IC3A 1AROP 2K3KA 3BBFA 2BJ1A 4I2QA 1UKUA 2C3YA 2HHPA 4RWXA 3IS9A 2VOOA 4DL2A 1TVRB 4W92B 3KK2A 4OIXA 1S1XB 4YR2A 4RJVA 3HHLC 1AT1B 2HBZB 2WB4A 3U1NA 2ABYA 2UXCF 3LP1B 2PA8D 3RB0A 1ZBTA 4LUBA 3TANA 3TZYA 3KKFA 3W2VB 5DDPC 1F6TA 3DFEA 2AWZA 4WWSA 4KAIA 4CYUB 1RA7A 3MM8B 1S0OA 3D5MA 2PDAA 2ZDOA 3SIPB 4DV6F 4N7TA 4KTQA 1X0PA 1KC8T 5L1JA 3C16B 2YX7A 4DDFA 2CWKA 3EGNA 5KOWA 3RBEA 3EPGA 5IWAF 3LANA 1CJUB 3UDEA 4A8WA 2V67A 2HKEA 4ECXA 4OHVA 2WOMA 3HHDA 4DV3F 1I51B 2L48A 4JI4F 3ITHB 4H4OA 4NEYA 1ROFA 4NYPA 1FJGF 4RNOA 4A8FA 5DETA 4WFNQ 2U2FA 4I1TA 3UNYA 2MLYA 3DLLQ 3OVBA 2WZ1A 3MM9A 2VASA 3W62A 4FNHA 4C0BA 1FFSB 5HQMA 1NB7A 3L4BC 3NP5A 3UCZP
chains in the Genus database with same CATH topology
1DTQA 5K8NA 3MGJA 1SH3A 3NAHA 2Q79A 1NHUA 4PCQA 3MMBB 4CO0A 3BSOA 4XDDA 1BQNA 2AW0A 1U09A 1FRMA 2DHAA 2XSFA 4MYUA 3TOQA 4ZHRB 1H7WA 4ED2A 4X2BA 1FRXA 1N4LA 1J5OB 1NNDA 2NUUG 3LW5C 2ZH8A 1U25A 5L1LA 2IJNA 5K14A 3JSRA 3D1OA 1U1PA 4J5OA 3F56A 4C0OC 3CB4A 4CO5A 4NMLA 1DQ8A 3SV4A 3PW7A 3MXHP 4NA2A 4WK1A 1VQOS 2OD6A 1FRLA 3MM5B 1W2BR 3HHNB 3BSNA 2VC0A 3OR2B 1VRTB 4HDHA 4Q8EA 3UE2A 5L9XA 3AHPA 2WHOA 3H20A 3I0RB 1NK8A 2HMIA 4A8YA 5HMYA 1WACA 4PUOA 2N4CA 3LUYA 4OMFG 4O3RA 3H8YA 4FVMA 4ZPDA 2N4DA 5H1SV 2R2TA 4ZCLA 1U2FA 3GFYA 2O01C 5I3UB 4PQAA 1JLEA 1KLMA 4KE5A 5L8RC 2LLZA 1QVGR 1X5PA 4ED6A 2E1RA 4CH0S 3LGMA 1QE1A 4RWWA 3MUTP 3K5OA 2JRSA 4DL4A 4JI0F 1F9FA 2JLFA 2MGZA 1D3WA 1RT6A 5KFOA 2JLGA 3OL6A 4IG3B 2FHMA 4F67A 1XNQF 3CCVS 5T41A 1SI9A 5J2NB 3H2LA 3HK2A 3M05A 1UWBA 4RW6B 3AJ1A 3OTOF 5CHCB 4JI2F 3QJJA 1G6BA 5HI7A 2KZZA 3PKYA 1TK8A 1TL1B 4RX6A 2UXDF 1S4FA 2IMWP 2JJ4D 2Z2LA 4TY8A 3D0IE 1HBNB 2D9OA 2AJ1A 3BR8A 4DBQA 4JV1A 3ENQA 1V6HA 1AFJA 1WD6A 4CQ1A 2FHOB 1WEZA 2PFFB 4RW4B 2MHEA 1DARA 3TAQA 1JLFA 5KFKA 4H4KC 4U67Q 3AB4B 3GB0A 3IXQA 2ZVSA 4OX7A 5IM0A 4F8RA 1SV5B 1X7VA 3I31A 3OLBA 4FS2A 3GV5B 4Z2XA 4OZNA 3ISND 4URGA 2ZZNA 4C9DA 4ZPCA 1ZTWA 4EYHB 5T14A 5J1PA 2B51A 3CUNA 2JEIA 3HF5A 3K59A 4O3PA 4P2SA 1X9MA 2BOPA 4TN2A 2BVZA 1RTDB 1NO8A 1Y00A 1GT8A 4K4SA 2I9SA 1EETA 1H2TZ 2N3LA 1X4DA 1LV5A 2GIQA 3V4IA 1BD6A 2UUWA 3T1AA 1T94A 4LF8F 2ZH9A 1FVSA 3HXMA 1G1XA 3LP2A 1S77D 2ROPA 4TXSA 3W2WA 3KG1A 1AW0A 4A8QA 5LJ3Y 3B82A 4KGKA 2PGCA 5HLFB 1AUDA 2C2EA 2Q6BA 2R8IA 3IAS9 1HNWF 1YBAA 3I0SA 2ZC4A 2JFDA 2V4JA 1Y5LB 5F0WA 3KK3A 4D3GA 1FERA 1TFWA 2K1RB 2G0CA 4AL6A 4BWMA 2L3MA 1JLGA 1CSJA 1FKPA 1RKIA 4X4SA 4DV0F 1IBKF 3QIDA 3GIJA 2J6TA 3CMES 4JI3F 3OFGA 5A2QY 1X4GA 4BCAA 1JLAB 3K2YA 5KFRA 3NMAA 3M4XA 3UPFA 3ISZA 2E7XA 4ZK7M 1XK8A 3G6XA 3M9NB 5KFVA 1DBDA 4V19J 3CJ0A 2HNDB 2MQLA 2D3UA 3S7RA 2E29A 5KG7A 1IKXB 1YWXA 3MEEB 3MM7A 1HWLA 1X4HA 3N0VA 4CH7A 1TUVA 2ZJQQ 3RW7A 5B0BA 1JLCB 5K8PA 2MJUA 5B09A 3CULA 2I1RA 1UEVA 3R27A 5C25A 1HYSB 1VQMS 3B78A 3KJVA 1T3OA 3MM6B 2NSBA 4R0EA 4WIIA 1NKBA 3M6WA 3SCKE 3M6UA 2L9DA 2K3IA 3CF5Q 4OZ5A 5E3PA 3BGLA 3ETOA 2OPQA 5IQQA 3R1HA 3DMJB 3OHAA 2L08A 4MIWA 4BWJA 4WU3A 4ZP6A 2V94A 1IQZA 4MMOA 4NLYA 5IXUA 2KO1A 3ZZZA 3V81B 2B43A 1HMVB 2BM0A 4X65F 4ZKAA 3C3LA 2BJDA 1IQTA 1O5JA 2CVIA 2DNMA 5DGBA 2DB1A 2GIRA 2W9CA 4Q2LA 1M0SA 4U6PA 4ECYA 2QMXA 4TLQA 5LMNF 2XGQA 3UFCX 3CSKA 1N54B 1TV6A 2DNOA 5KFDA 2B4UA 5K8MA 4B9NA 2HAIA 3AQPA 2VFTA 3GG1A 3QIPA 5JXSA 4C3KA 2RS2A 4LF7F 1GTHA 2ZHOA 4DQPA 5E3QA 3S6EA 4GC6A 3CCWA 1C0UB 2VODA 4RW9A 3WZ0A 4MH8A 3HVAA 3KLVA 3EZ5A 2CG4A 2OAUA 3DYAA 2VG6A 1YQHA 4NLPA 2LXFA 3C8YA 2QRRA 2RSQA 1ELOA 3UNGC 4DN9A 4YDDB 3GIIA 3OSPA 2C28A 4IUFA 2MKIA 4A4JA 1ZETA 1FDAA 5A8WA 4EBCA 4LJMA 4ALZA 2XB2D 1RT2B 2B4VA 2B6AA 2ASYA 1IN0A 5EHHA 2YQ3A 3HHLA 1LWEA 4M5DB 3T19A 4DX8H 3NL0A 3K8VA 3JSYA 4PR6A 3H98A 3OFEA 1S9EB 3C66A 4NA1A 4A8SA 1VQYA 2DH8A 4NL5A 4Y2IA 4ED7A 4IQXA 1JNZB 2B9YA 1FRJA 1GNKA 2VG7A 1QJHA 2A2DA 3BREA 5BYQA 5IS2A 3C6TA 3QZ8A 2DCLA 4X66F 5GAGI 3KLIB 1KR4A 2J76E 1PGZA 2HS0A 2CQ2A 1SKRA 2MXYA 3OL8A 3G8QA 4C8MA 4OI6A 5GAEI 4X62F 4WK3A 1RT3B 2VFUA 2YNIB 3T6JA 1ZM3A 3PR5B 1UVJA 3NNHA 2FVPA 2CPEA 3OSNA 1YRUA 3MUVP 2SXLA 2VKZG 5J2QB 2FDNA 3E01A 1N5QA 3OTDA 2W25A 2C2DA 2BQ3A 2IMOA 1IBLF 4QQBA 3K0JA 2C42A 1QAIA 4O3NA 4MKBA 3SI8A 1NJZA 1T03A 1PC5A 3P3DA 3T1HF 3HP6A 2D41A 2HVZA 4YR3A 3BZQA 2X3GA 1LW0B 1C4AA 1LWFB 1TKTA 1FKOA 2OLWA 3OR1B 3HT3A 2RIJA 2BBEA 2MSTA 3BN7A 1Q8LA 1AFIA 4J9KA 2DITA 2QLWA 2JZ5A 5DDRC 2PC6A 2JOQA 1FHTA 3VAFA 4OI1A 4PWDB 1LWCB 1VC5A 3O5TB 2C22A 5EX3A 3SQGB 4QJVA 1SBRA 1Z2LA 5LXYA 4HTJA 4YUDA 4GO5X 5CCLA 5KG1A 2ZNYA 3IGVA 4UUXA 2ZM6F 3EUNA 3PX6A 3DLHA 1N0VC 3HKWA 3PVXA 2MHNA 1KVJA 3M32A 3DOMA 1SJ1A 2MPUA 1MWZA 2PO4A 2JC1A 1R8BA 3GV8B 1DTTA 4TYBA 1UFLA 1JNRB 1FCAA 3UI3A 3MWBA 3IGNA 5A6WA 1S6OA 3LP0B 2YNFB 4USIA 2AJFE 1JXLA 3OFFA 2O5DA 1IKYB 4DHVA 2HGMA 4LFBF 2KN4A 2UVUA 4B3OA 3I9V9 2HHTA 1U24A 4OLPA 1Q53A 3Q22A 1OWXA 1WG4A 1VI7A 1S6QB 1FDDA 4G6VB 2BRKA 2M8HA 2EW9A 2EFNA 4RBVA 5I42B 4JV2A 5HROA 2NZ4A 1RT1A 1UVMA 2IRYA 4FNIA 1S0NA 2XCAA 4F4ZA 1FJEB 2GFFA 3NCRA 5CYMA 4PKDB 5CCMA 4Y2CA 3MPVA 1TKXB 1HQUB 2KH9A 1WF0A 1ZPWX 2VV5A 4RNHA 3DN9A 1BGXT 1YVFA 4ERDA 4YOEA 4DPOA 2A10A 3KYLA 2B4OA 2RMLA 2VPWB 3M2RA 1GX6A 3CJ4A 4CO3A 4R5PA 2NR0A 2FGOA 1T95A 1HNIA 4DOZA 5DQHA 1SUQA 1ZOTA 1VQLS 1GXUA 5LSLA 3HZGA 1HWJA 2XSJA 3I5AA 1VK3A 4A8KA 2GX8A 4PQUA 1NJWA 4NLGA 4ZPBA 1RT5B 2I8EA 5J1NA 5A6PA 3CC4S 2BV3A 2CQGA 5GVQA 3DRPA 5L38A 1M5KC 3IO1A 4ETZA 5FLXY 3DU5A 2I38A 4E98A 2IM0A 1C0TB 4HYKA 3DLEA 2WONB 3TNVA 4WFYA 2BJEA 3GFXA 3Q8PB 1KVIA 4M1KA 1S97A