3NNKA

Biochemical and structural characterization of a ureidoglycine aminotransferase in the klebsiella pneumoniae uric acid catabolic pathway
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
411
structure length
410
Chain Sequence
MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYDPAMTHYMNEVMALYRGVFRTENRWTMLVDGTSRAGIEAILVSAIRPGDKVLVPVFGRFGHLLCEIARRCRAEVHTIEVPWGEVFTPDQVEDAVKRIRPRLLLTVQGDTSTTMLQPLAELGEICRRYDALFYTDATASLGGNPLETDVWGLDAVSAGMQCLGGPSGTSPITLSARMEEAIRRRKCVEEGIRTDAHRDGDEEMIYSNYFDLGMVMDYWGPERLNHHTEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDLKHKMNNVLGVVIPQGINGDQARKLMLEDFGIEIGTSFGPLHGKVWRIGTMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycine-glyoxylate aminotransferase
publication title Biochemical and Structural Characterization of a Ureidoglycine Aminotransferase in the Klebsiella pneumoniae Uric Acid Catabolic Pathway.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 140
structure length 410
sequence length 411
chains with identical sequence B, C, D, E, F, G, H, J, K, L, M, O, P, R, S
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3nnkA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3nnkA02
1S07A 2ZYJA 3RQ1A 4A00A 2AY7A 1AICA 2VMOA 5G4IA 3VP6A 3NYSA 1H1CA 1AKAA 1DGEA 2VGTA 3TFTA 4WP0A 5EIGB 2W7GA 4GSAA 5G2PA 1B9IA 4OMAA 1V2EA 1OATA 2ZSMA 1CL2A 1AMQA 4Y0DA 1ASFA 3K28A 3EI8A 4WYFA 2AY5A 3DR4A 2Z20A 3HLMA 4ZDLA 4A0RA 4CXRA 4EMYA 3MBBA 1BS0A 3DXVA 3EZSA 4Q31A 5EAAA 2EH6A 3PDXA 3AEMC 2QB3A 4UHMA 4GEBA 2D61A 1MAPA 2HUFA 2ZUKA 3DR7A 3GR9A 1DJUA 4AO9A 3KGXA 1GEWA 4E3RA 2WK8A 1DTYA 2QA3A 4GRXA 4MY5A 4JF1A 3COGA 2PO3A 1D7VA 3PAAA 1ARTA 3KGWA 4K2BA 2JGTA 3PA9A 3HVYA 4MKKA 1ECXA 4Q6RA 1TARA 4ZSWA 4EFFA 2HP1A 2ZSLA 1I43A 2W8TA 1N2TA 3A9YA 1SZSA 1LKCA 1AHFA 4GE7A 2W7IA 1X2AA 1AAWA 3NDNA 3FQAA 4IYOA 4ATQA 1I29A 1AIBA 3NUBA 4A0GA 3BCAA 1KKJA 4A6TA 4N0BA 1GBNA 1I41A 3QBOA 1N31A 2W8WA 5D5SA 2OKKA 1YNUA 2AEVA 4N0WA 1FG3A 2FNIA 4WXFA 1GCKA 1LW5A 3EIBA 5EUEA 2XBNA 3N5MA 4W1VA 4W8IA 5G0AA 1PFFA 3NTJA 3NU7A 1S0AA 4E3QA 1C9CA 4XAUA 1X0MA 4KAMA 4F5HA 2BIEA 5JAYA 2EZ1A 3K40A 3FDBA 5FT6A 2VMQA 4IYOB 4JEZA 1ARIA 1H0CA 1Z3ZA 4MSOA 4AH3A 2XH1A 3GSBA 1CZEA 4JEWA 1BJNA 3TFUA 4IXSA 5AX8A 2FYFA 2X8UA 3RCHA 3A9ZA 1ASLA 2BWOA 4RKDA 5E3KA 1M4NA 3AEJC 2VMZA 2R5EA 1G7WA 3EZ1A 4JF0A 2HOZA 4RITA 3FVUA 3W1IA 5I92A 4EB5A 1ASEA 4BA4A 2BI2A 1GC0A 3GETA 3P1TA 1DGDA 1QISA 2VGSA 2Z1ZA 4IX8A 1S06A 1W3UA 4IW7A 3JWBA 4WLJA 1I48A 1WYVA 3WZFA 3MAUA 5D95A 2BWPA 3BCXA 2YKVA 1X29A 4A0HA 5K8BA 3MADA 4M2KA 3EUCA 1O62A 2W7DA 4WYAA 2C44A 3BWNC 4WBTA 4XQ2A 2OATA 4RIZA 4W1WA 1IX8A 1G4XA 4U1TA 4BMKA 2JJGA 4HVKA 4EU1A 2OGAA 4ADCA 1BW0A 2GSAA 2O0RA 1E5EA 1KL1A 2Z61A 4W1XA 3AV7A 2D66A 2BYLA 4Q75A 1RVYA 1D7UA 2CH2A 3LV2A 2VGUA 3N0LA 3CQ5A 3GZDA 1SF2A 1YAAA 2VGWA 4WXGA 2W8VA 4R5ZA 5E4ZA 4A72A 5HXXA 1U08A 2VMYA 1JS6A 1SPAA 1KMKA 4XEWA 5M46A 1M32A 1WYVB 2VMTA 1BJOA 1D2FA 1BJ4A 2CJGA 2EZ2A 3PGYA 3A8UX 3RI6A 1CJ0A 2JJHA 3BN1A 3NRAA 3CQ4A 1M7YA 4AZJA 2ZY4A 3NX3A 3PIUA 2CTZA 3I5TA 1MDOA 1UU1A 3FZ8A 5EUDA 2V1PA 5IWQA 3R9AA 4BHDA 2JJEA 5C6UA 4A6RA 3ZRRA 4WB0A 3DYDA 3EI7A 3ZRPA 3QM2A 3W1JA 4ADEA 1IVRA 1M0PA 2AY4A 3AENA 2BI3A 1AKCA 3WY7A 2ZY3A 1W7NA 1P3WA 3FZ7A 3OP7A 5TF5A 4R2NA 3RBLA 1ASMA 2GQNA 1BJOB 2AY2A 3FKDA 2D64A 4UQVA 3QPGA 1KKPA 1G7XA 2D65A 1LW4A 2YCTA 1Z7DA 3WGCA 4CVQA 1RV4A 1SZKA 3WLXA 4RLGA 1MGVA 3NU8A 2DGLA 1C0NA 3VAXA 4FL0A 4RM1A 4F5GA 1CQ6A 1SFFA 3B1EA 3NYUA 1XI9A 3AENB 3E2FA 3LY1A 4WD2A 2W7EA 1ZOBA 2FM1A 4I8AA 4K2MA 1VP4A 2E7UA 2VGZA 2W8JA 4P3MA 4F4EA 2ZY2A 1C7NA 1YIZA 1AJRA 3BWOA 2R2NA 3G0TA 5J8QA 3OKSA 2HOXA 2BYJA 4KXKA 1KL2A 3HDOA 4XJLA 5EQCA 2W7HA 5M4DA 1YJSA 1C7OA 1CQ8A 1FC4A 1EJIA 3MAFA 2TPLA 1TOEA 1OHVA 3TCMA 1IUGA 4Y0IA 1LK9A 3MEBA 3FVSA 2X5DA 4GE4A 3MC6C 4BA5A 3JW9A 4LNMA 2AATA 1VJOA 2R5CA 1ASGA 3N75A 3P6KA 4PFFA 2VMSA 4UHNA 1WKGA 1B4XA 8AATA 4W5KA 2ZC0A 1V2DA 2JJFA 2R0TA 3NYTA 3NUIA 2Z9UA 1QJ3A 1O4SA 3E6GA 2VMRA 4TMRA 5DX5A 1X28A 5DB5A 1TATA 3AOWA 4IY7A 1QZ9A 4MKJA 3WCOA 2BHXA 3ASAA 2GMUA 2NMPA 3HQTA 3I4JA 3I16A 1BJWA 1GC3A 4CBRA 3BCBA 3BS8A 3D6KA 3VK3A 3CQ6A 3WX9A 3ELEA 3W1HA 1PMMA 1GEYA 2R5CB 3CAIA 4ADBA 1GC4A 1WYUA 4J8LA 4NOGA 2FQ6A 4ITGA 5G2QA 2YKXA 5FT5A 3E77A 2W7MA 3UAKA 2AY6A 2VI8A 4OBUA 1TOGA 1AIAA 3GBXA 2ZY5A 1VEFA 4ITXA 3MKJA 2GMSA 2YOBA 1M0OA 4ZAHA 3HL2A 1AY5A 3F9TA 2YCPA 1MLYA 3L44A 2VGVA 1OHWA 2EPJA 3EI9A 4Y0HA 4M2MA 2BWNA 3RCHB 3K7YA 3GJUA 4UOYA 1IX6A 3B1CA 3HBXA 2CANA 4LNJA 1JG8A 3USFA 1Y4IA 2AY8A 1XEYA 4GE9A 2DGKA 4FFCA 1GC2A 1ZC9A 1UKJA 2ORDA 3AEJA 1C7GA 4AO4A 4EB7A 2D7YA 1TOIA 1M0NA 2VLHA 4R5FA 1ELQA 2VLFA 3DZZA 3M5UA 4MGRA 2WK9A 4ZASA 1AAMA 1CS1A 4F5FA 1E5FA 3JZLA 3ASBA 1PMOA 4PVFA 5G09A 1ASDA 5M49A 4LNLA 3L8AA 2D63A 1M6SA 1ASAA 1AY8A 2CFBA 3EI6A 2ZJGA 4IXZA 4ZSYA 2CY8A 4B98A 1MAQA 3A9XA 1LC7A 3QGUA 4LC3A 3E2YA 3QHXA 1B5OA 1YJYA 3FFHA 4JEXA 3BWNA 7AATA 1W23A 4RAEA 4IXOA 2E7JA 1AHEA 4O6ZA 2HUIA 3HMUA 5F8VA 4DGTA 1AHGA 3E2ZA 3FDDA 4RJYA 4B9BA 2W7FA 1DJEA 1DKAA 3FCRA 1D7SA 3FFRA 3FSLA 3BB8A 2BKWA 1CQ7A 2D5YA 4QGRA 3ATHA 4OCAA 1LC8A 5LHAA 2HOYA 1GD9A 2X3LA 2VMNA 1CL1A 1UU2A 3EI5A 5EIGA 3VOMA 1IX7A 2QLRA 3LVMA 4ZDOA 3Q8NA 1EQBA 1LS3A 2VMPA 5DJ1A 4F5MA 5F9SA 9AATA 4ZWMA 4MQQA 2YRIA 1ZODA 4W91A 1BT4A 3WGBA 3CBFA 3DXWA 2HORA 4DQ6A 4CXQA 3WKSA 4WB0B 3E2ZB 2VMWA 1GDEA 2YCNA 2C7TA 3JWAA 1FG7A 3AEPA 3IHJA 1UU0A 2DKBA 1YJZA 2F8JA 2CJDA 2VMUA 2O1BA 1IAXA 4JEVA 4J5UA 4XJMA 1EG5A 2QBTA 4ADDA 2JG2A 3DU4A 2JISA 1IAYA 3BV0A 1ELUA 1C4KA 2AY9A 2VMXA 1B9HA 1BKGA 3ACZA 3FD0A 4TN4A 4OTLA 1GEXA 1YOOA 3QI6A 5BJ3A 4BQ0A 2X5FA 1WKHA 4K2IA 4OC9A 3EIAA 1QJ5A 3LVKA 4R8DA 3IF2A 2Z67A 4RKCA 1QITA 1BQDA 2VYCA 4L0OA 4WYGA 1OXOA 2PB0A 1QGNA 3FTBA 4WYEA 5LH9A 4F5IA 3PD6A 4ATPA 2WKAA 3AEMA 2GB3A 2VI9A 1AX4A 3AATA 3LVLB 1PG8A 2DKJA 1AJSA 4U2HA 4JE5A 1QIRA 3B46A 1SZUA 1OXPA 1J32A 3FRKA 3II0A 1N8PA 3TATA 3KKIA 2FNUA 4MQRA 4AOAA 4XJOA 1AY4A 4OBVA 1ASNA 3LVJA 2Z9XA 4E1OA 2C0RA 2QB2A 1AMAA 2W7KA 4JE5D 1MDZA 3RUYA 3LG0A 1O61A 3MAFB 2RFVA 2D7ZA 3FZ6A 1IBJA 3WCNA 3ISLA 1D7RA 2VMVA 1ORDA 3G7QA 3PD6B 4OT8A 1ARGA 1BQAA 1DFOA 1JS3A 2HZPA 4WXBA 3TQXA 4PFNA 1SVVA 1CZCA 3MC6A 2EGYA 1AJSB 4MQPA 5FT8A 5M4BA 4UHOA 2AY1A 4Q76A 4XK1A 1W7LA 5HDMA 4WYDA 1V72A 3DODA 1ARHA 1DJ9A 3FQ7A 3QN6A 3HT4A 4LW2A 4XJPA 4DBCA 3A2BA 2BIAA 2VIBA 2CJHA 3JTXA 2CINA 2CSTA 4TV7A 1RVUA 4A0FA 2DR1A 1AMSA 2HP2A 3E9KA 2W7LA 5BJ4A 2W7JA 2VIAA 5DJ9A 3WKRA 4KYOA 1ASCA 1T3IA 2O7CA 1TOJA 3GZCA 2YRRA 2PB2A 2BIGA 3AOVA 3LWSA 2EO5A 1M0QA 3F0HA 4ZWVA 1W7MA 2FN6A 1LC5A 2W8UA 5EFSA 3H7FA 1WYUB 3PJ0A 1WYTA 4JEYA 3GZDC 3VK4A 2CH1A 3UE8A 2HUUA 3PPLA 2Z9WA 3FQ8A 2E54A 1B5PA 1AHYA 1RV3A 3DRDA 2AEUA 3ECDA 3BC8A 2Z1YA 4CBSA 4F5LA 1J04A 2DGMA 5G4JA 1AHXA 3VK2A 4ZM3A 3JU7A 4RJ0A 4GDYA 3KE3A 1TOKA 2OKJA 5E5IA 3B1DA 4AZKA 1ASBA 3AELA 4H51A 3DC1A 1AMRA 1MDXA 1JF9A 3PDBA 3R4TA 5HHYA 1V2FA 1KMJA 2Z9VA 1WYTB 3RBFA 4WYCA 2BI5A 2Q7WA 3B8XA 3UWCA 1WSTA 2V0YA 4M2JA 4OYTA 4F5KA 3F6TA 3T32A 3ZZJA 2QMAA 1S09A 1OHYA 4ISYA 1S08A 3H14A 4ZLVA 2C81A 1IJIA 1TASA 1O69A 3NNKA 5EAVA 5FT4A 1YIYA 1TPLA 2BI9A 2E7IA 2OGEA 4PIWA 1B8GA 5EUNA 2YKYA 2CB1A 2BI1A 2ZP7A 2WK7A 4ZDPA 1G4VA 3PDBB 2AY3A 3ZZKA 2OQXA 1AKBA 1MLZA 2G6WA 2YKUA 1ARSA 4LW4A 4F5JA 3ELPA 4WLHA 2YHKA 4P7YA 4A6UA 3ZRQA 4E77A 3GWPA 3AEOA 3FVXA 2DOUA 3G8MA 4ZM4A 4HF8A
chains in the Genus database with same CATH superfamily
1S07A 2ZYJA 3RQ1A 4A00A 2AY7A 1AICA 2VMOA 5G4IA 3VP6A 3NYSA 1H1CA 1AKAA 1DGEA 2VGTA 3TFTA 4WP0A 5EIGB 2W7GA 4GSAA 5G2PA 1B9IA 4OMAA 1V2EA 1OATA 2ZSMA 1CL2A 1AMQA 4Y0DA 1ASFA 3K28A 3EI8A 4WYFA 2AY5A 3DR4A 2Z20A 3HLMA 4ZDLA 4A0RA 4CXRA 4EMYA 3MBBA 1BS0A 3DXVA 3EZSA 4Q31A 2KFPA 5EAAA 2EH6A 3PDXA 3AEMC 2QB3A 4UHMA 4GEBA 2D61A 1MAPA 2HUFA 2ZUKA 3DR7A 3GR9A 1DJUA 4AO9A 3KGXA 1GEWA 4E3RA 2WK8A 1DTYA 2QA3A 4GRXA 4MY5A 4JF1A 3COGA 2PO3A 1D7VA 3PAAA 1ARTA 3KGWA 4K2BA 2JGTA 3PA9A 3HVYA 4MKKA 1ECXA 4Q6RA 1TARA 4ZSWA 4EFFA 2HP1A 2ZSLA 1I43A 2W8TA 1N2TA 3A9YA 1SZSA 1LKCA 1AHFA 4GE7A 2W7IA 1X2AA 1AAWA 3NDNA 3FQAA 4IYOA 4ATQA 1I29A 1AIBA 3NUBA 4A0GA 3BCAA 4K05A 1KKJA 4A6TA 4N0BA 1GBNA 1I41A 3QBOA 1N31A 2W8WA 5D5SA 2OKKA 1YNUA 2AEVA 4N0WA 1FG3A 2FNIA 4WXFA 1GCKA 1LW5A 3EIBA 5EUEA 2XBNA 3N5MA 4W1VA 4W8IA 5G0AA 3N7NA 1PFFA 3NTJA 3NU7A 1S0AA 4E3QA 1C9CA 4XAUA 1X0MA 4KAMA 4F5HA 2BIEA 5JAYA 2EZ1A 3K40A 3FDBA 5FT6A 2VMQA 4IYOB 4JEZA 1ARIA 1H0CA 4H63Q 1Z3ZA 4MSOA 4AH3A 3N4RA 2XH1A 3GSBA 1CZEA 4JEWA 1BJNA 3TFUA 4IXSA 5AX8A 2FYFA 2X8UA 3RCHA 3A9ZA 1ASLA 2BWOA 4RKDA 5E3KA 1M4NA 3AEJC 2VMZA 2R5EA 1G7WA 3EZ1A 4JF0A 2HOZA 4RITA 3FVUA 3W1IA 5I92A 4EB5A 1ASEA 4BA4A 2BI2A 1GC0A 3GETA 3P1TA 1DGDA 1QISA 2VGSA 2Z1ZA 4IX8A 1S06A 1W3UA 4IW7A 3JWBA 4WLJA 1I48A 1WYVA 3WZFA 3MAUA 5D95A 2BWPA 3BCXA 2YKVA 1X29A 4A0HA 5K8BA 3MADA 4M2KA 3EUCA 1O62A 2W7DA 4WYAA 2C44A 3BWNC 4WBTA 4XQ2A 2OATA 4RIZA 4W1WA 1IX8A 1G4XA 4U1TA 4BMKA 2JJGA 4HVKA 4EU1A 2OGAA 4ADCA 1BW0A 2GSAA 2O0RA 1E5EA 1KL1A 2Z61A 4W1XA 3AV7A 2D66A 2BYLA 4Q75A 1RVYA 1D7UA 2CH2A 2G7JA 3LV2A 2VGUA 3N0LA 3CQ5A 3GZDA 1SF2A 1YAAA 2VGWA 4WXGA 2W8VA 4R5ZA 5E4ZA 4A72A 5HXXA 1U08A 2VMYA 1JS6A 1SPAA 1KMKA 4XEWA 5M46A 1M32A 1WYVB 2VMTA 1BJOA 1D2FA 1BJ4A 2CJGA 2EZ2A 3PGYA 3A8UX 3RI6A 1CJ0A 2JJHA 3BN1A 3NRAA 3CQ4A 1M7YA 4AZJA 2ZY4A 3NX3A 3PIUA 2CTZA 3I5TA 1MDOA 1UU1A 3FZ8A 5EUDA 2V1PA 5IWQA 3R9AA 4BHDA 2JJEA 5C6UA 4A6RA 3ZRRA 4WB0A 3DYDA 3EI7A 3ZRPA 3QM2A 3W1JA 4ADEA 1IVRA 1M0PA 2AY4A 3AENA 2BI3A 1AKCA 3WY7A 2ZY3A 1W7NA 1P3WA 3FZ7A 3OP7A 5TF5A 4R2NA 3RBLA 1ASMA 2GQNA 1BJOB 2AY2A 3FKDA 2D64A 4UQVA 3QPGA 1KKPA 1G7XA 2D65A 1LW4A 2YCTA 1Z7DA 3WGCA 4CVQA 1RV4A 1SZKA 3WLXA 4RLGA 5KTBA 1MGVA 3NU8A 2DGLA 1C0NA 3VAXA 4FL0A 4RM1A 4F5GA 1CQ6A 1SFFA 3B1EA 3NYUA 1XI9A 3AENB 3E2FA 3LY1A 4WD2A 2W7EA 1ZOBA 2FM1A 4I8AA 4K2MA 1VP4A 2E7UA 2VGZA 2W8JA 4P3MA 4F4EA 2ZY2A 1C7NA 1YIZA 1AJRA 3BWOA 2R2NA 3G0TA 5J8QA 3OKSA 2HOXA 2BYJA 4KXKA 1KL2A 3HDOA 4XJLA 5EQCA 2W7HA 5M4DA 1YJSA 1C7OA 1CQ8A 1FC4A 1EJIA 3MAFA 2TPLA 1TOEA 1OHVA 3TCMA 1IUGA 4Y0IA 1LK9A 3MEBA 3FVSA 2X5DA 4GE4A 3MC6C 4BA5A 3JW9A 4LNMA 2AATA 1VJOA 2R5CA 1ASGA 3N75A 3P6KA 4PFFA 2VMSA 4UHNA 1WKGA 1B4XA 8AATA 4W5KA 2ZC0A 1V2DA 2JJFA 2R0TA 3NYTA 3NUIA 2Z9UA 1QJ3A 1O4SA 3E6GA 2VMRA 4TMRA 5DX5A 1X28A 5DB5A 1TATA 3AOWA 4IY7A 1QZ9A 4MKJA 3WCOA 2BHXA 3ASAA 2GMUA 2NMPA 3HQTA 3I4JA 3I16A 1BJWA 1GC3A 4CBRA 3BCBA 3BS8A 3D6KA 3VK3A 3CQ6A 3WX9A 3ELEA 3W1HA 1PMMA 1GEYA 2R5CB 3CAIA 4ADBA 1GC4A 1WYUA 4J8LA 4NOGA 2FQ6A 4ITGA 5G2QA 2YKXA 5FT5A 3E77A 2W7MA 3UAKA 2AY6A 2VI8A 4OBUA 1TOGA 1AIAA 3GBXA 2ZY5A 1VEFA 4ITXA 3MKJA 2GMSA 2YOBA 1M0OA 4ZAHA 3HL2A 1AY5A 3F9TA 2YCPA 1MLYA 3L44A 2VGVA 1OHWA 2EPJA 3EI9A 3N4XA 4Y0HA 4M2MA 2BWNA 3RCHB 3K7YA 3GJUA 4UOYA 1IX6A 3B1CA 3HBXA 2CANA 4LNJA 1JG8A 3USFA 1Y4IA 2AY8A 1XEYA 4GE9A 2DGKA 4FFCA 1GC2A 1ZC9A 1UKJA 2ORDA 3AEJA 1C7GA 4AO4A 4EB7A 2D7YA 1TOIA 1M0NA 2VLHA 4R5FA 1ELQA 2VLFA 3DZZA 3M5UA 4MGRA 2WK9A 4ZASA 1AAMA 1CS1A 4F5FA 1E5FA 3JZLA 3ASBA 1PMOA 4PVFA 5G09A 1ASDA 5M49A 4LNLA 3L8AA 2D63A 1M6SA 1ASAA 1AY8A 2CFBA 3EI6A 2ZJGA 4IXZA 4ZSYA 2CY8A 4B98A 1MAQA 3A9XA 1LC7A 3QGUA 4LC3A 3E2YA 3QHXA 1B5OA 1YJYA 3FFHA 4JEXA 3BWNA 7AATA 1W23A 3N4SA 4RAEA 4IXOA 2E7JA 1AHEA 4O6ZA 2HUIA 3HMUA 5F8VA 4DGTA 1AHGA 3E2ZA 3FDDA 4RJYA 4B9BA 2W7FA 1DJEA 1DKAA 3FCRA 1D7SA 3FFRA 3FSLA 3BB8A 2BKWA 1CQ7A 2D5YA 4QGRA 3ATHA 4OCAA 1LC8A 5LHAA 2HOYA 1GD9A 2X3LA 2VMNA 1CL1A 1UU2A 3EI5A 5EIGA 3VOMA 1IX7A 2QLRA 3LVMA 4ZDOA 3Q8NA 1EQBA 1LS3A 2VMPA 5DJ1A 4F5MA 5F9SA 9AATA 4ZWMA 4MQQA 2YRIA 1ZODA 4W91A 1BT4A 3WGBA 3CBFA 3DXWA 2HORA 4DQ6A 4CXQA 3WKSA 4WB0B 3E2ZB 2VMWA 1GDEA 2YCNA 2C7TA 3JWAA 1FG7A 3AEPA 3IHJA 1UU0A 2DKBA 1YJZA 2F8JA 2CJDA 2VMUA 2O1BA 1IAXA 4JEVA 4J5UA 4XJMA 2EYQA 1EG5A 2QBTA 4ADDA 2JG2A 3DU4A 2JISA 1IAYA 3BV0A 1ELUA 1C4KA 2AY9A 2VMXA 1B9HA 1BKGA 3ACZA 3FD0A 4TN4A 4OTLA 1GEXA 1YOOA 3QI6A 5BJ3A 4BQ0A 2X5FA 1WKHA 4K2IA 4OC9A 3EIAA 1QJ5A 3LVKA 4R8DA 3IF2A 2Z67A 4RKCA 1QITA 1BQDA 2VYCA 2A1VA 4L0OA 4WYGA 2QSRA 2WB6A 1OXOA 2PB0A 1QGNA 3FTBA 4WYEA 3H9XA 5LH9A 4F5IA 3PD6A 4ATPA 2WKAA 3AEMA 2GB3A 2VI9A 1AX4A 3AATA 3LVLB 1PG8A 2DKJA 1AJSA 4U2HA 4JE5A 1QIRA 3B46A 1SZUA 1OXPA 1J32A 3FRKA 3II0A 1N8PA 3TATA 3KKIA 2FNUA 4MQRA 4AOAA 4XJOA 1AY4A 4OBVA 1ASNA 3LVJA 2Z9XA 4E1OA 2C0RA 2QB2A 1AMAA 2W7KA 4JE5D 1MDZA 3RUYA 3LG0A 1O61A 3MAFB 2RFVA 2D7ZA 3FZ6A 1IBJA 3WCNA 3ISLA 1D7RA 2VMVA 1ORDA 3G7QA 3PD6B 4OT8A 1ARGA 1BQAA 1DFOA 1JS3A 2HZPA 4WXBA 3TQXA 4PFNA 1SVVA 1CZCA 3MC6A 2EGYA 1AJSB 4MQPA 5FT8A 5M4BA 4UHOA 2AY1A 4Q76A 4XK1A 1W7LA 5HDMA 4WYDA 1V72A 3DODA 1ARHA 1DJ9A 3FQ7A 3QN6A 3HT4A 4LW2A 4XJPA 4DBCA 3A2BA 2BIAA 2VIBA 2CJHA 3JTXA 2CINA 2CSTA 4TV7A 1RVUA 4A0FA 2DR1A 1AMSA 2HP2A 3E9KA 2W7LA 5BJ4A 2W7JA 2VIAA 5DJ9A 3WKRA 4KYOA 1ASCA 1T3IA 2O7CA 1TOJA 3GZCA 2YRRA 2PB2A 2BIGA 3AOVA 3LWSA 2EO5A 1M0QA 3F0HA 4ZWVA 1W7MA 2FN6A 1LC5A 2W8UA 5EFSA 3H7FA 1WYUB 3PJ0A 1WYTA 4JEYA 3GZDC 3VK4A 2CH1A 3UE8A 2HUUA 3PPLA 2Z9WA 3FQ8A 2E54A 1B5PA 1AHYA 1RV3A 3DRDA 2AEUA 3ECDA 3BC8A 2Z1YA 4CBSA 4F5LA 1J04A 2DGMA 5G4JA 1AHXA 3VK2A 4ZM3A 3JU7A 4RJ0A 4GDYA 3KE3A 1TOKA 2OKJA 5E5IA 3B1DA 4AZKA 1ASBA 3AELA 4H51A 3DC1A 1AMRA 1MDXA 1JF9A 3PDBA 3R4TA 5HHYA 1V2FA 1KMJA 2Z9VA 1WYTB 3RBFA 4WYCA 2BI5A 2Q7WA 3B8XA 3UWCA 1WSTA 2V0YA 4M2JA 4OYTA 4F5KA 3F6TA 3T32A 3ZZJA 2QMAA 1S09A 1OHYA 4ISYA 1S08A 3H14A 4ZLVA 2C81A 1IJIA 1TASA 1O69A 3NNKA 5EAVA 5FT4A 2FKIA 1YIYA 1TPLA 2BI9A 2E7IA 2OGEA 4PIWA 1B8GA 5EUNA 2YKYA 2CB1A 2BI1A 2ZP7A 2WK7A 4ZDPA 1G4VA 3PDBB 2AY3A 3ZZKA 2OQXA 1KAFA 1AKBA 1MLZA 2G6WA 2YKUA 1ARSA 4LW4A 4F5JA 3ELPA 4WLHA 2YHKA 4P7YA 4A6UA 3ZRQA 4E77A 3GWPA 3AEOA 3FVXA 2DOUA 3G8MA 4ZM4A 4HF8A
chains in the Genus database with same CATH topology
1S07A 2ZYJA 3RQ1A 4A00A 2AY7A 1AICA 2VMOA 5G4IA 3VP6A 3NYSA 1H1CA 1AKAA 1DGEA 2VGTA 3TFTA 4WP0A 5EIGB 2W7GA 4GSAA 5G2PA 1B9IA 4OMAA 1V2EA 1OATA 2ZSMA 1CL2A 1AMQA 4Y0DA 1ASFA 3K28A 3EI8A 4WYFA 2AY5A 3DR4A 2Z20A 3HLMA 4ZDLA 4A0RA 4CXRA 4EMYA 3MBBA 1BS0A 3DXVA 3EZSA 4Q31A 2KFPA 5EAAA 2EH6A 3PDXA 3AEMC 2QB3A 4UHMA 4GEBA 2D61A 1MAPA 2HUFA 2ZUKA 3DR7A 3GR9A 1DJUA 4AO9A 3KGXA 1GEWA 4E3RA 2WK8A 1DTYA 2QA3A 4GRXA 4MY5A 4JF1A 3COGA 2PO3A 1D7VA 3PAAA 1ARTA 3KGWA 4K2BA 2JGTA 3PA9A 3HVYA 4MKKA 1ECXA 4Q6RA 1TARA 4ZSWA 4EFFA 2HP1A 2ZSLA 1I43A 2W8TA 1N2TA 3A9YA 1SZSA 1LKCA 1AHFA 4GE7A 2W7IA 1X2AA 1AAWA 3NDNA 3FQAA 4IYOA 4ATQA 1I29A 1AIBA 3NUBA 4A0GA 3BCAA 4K05A 1KKJA 4A6TA 4N0BA 1GBNA 1I41A 3QBOA 1N31A 2W8WA 5D5SA 2OKKA 1YNUA 2AEVA 4N0WA 1FG3A 2FNIA 4WXFA 1GCKA 1LW5A 3EIBA 5EUEA 2XBNA 3N5MA 4W1VA 4W8IA 5G0AA 3N7NA 1PFFA 3NTJA 3NU7A 1S0AA 4E3QA 1C9CA 4XAUA 1X0MA 4KAMA 4F5HA 2BIEA 5JAYA 2EZ1A 3K40A 3FDBA 5FT6A 2VMQA 4IYOB 4JEZA 1ARIA 1H0CA 4H63Q 1Z3ZA 4MSOA 4AH3A 3N4RA 2XH1A 3GSBA 1CZEA 4JEWA 1BJNA 3TFUA 4IXSA 5AX8A 2FYFA 2X8UA 3RCHA 3A9ZA 1ASLA 2BWOA 4RKDA 5E3KA 1M4NA 3AEJC 2VMZA 2R5EA 1G7WA 3EZ1A 4JF0A 2HOZA 4RITA 3FVUA 3W1IA 5I92A 4EB5A 1ASEA 4BA4A 2BI2A 1GC0A 3GETA 3P1TA 1DGDA 1QISA 2VGSA 2Z1ZA 4IX8A 1S06A 1W3UA 4IW7A 3JWBA 4WLJA 1I48A 1WYVA 3WZFA 3MAUA 5D95A 2BWPA 3BCXA 2YKVA 1X29A 4A0HA 5K8BA 3MADA 4M2KA 3EUCA 1O62A 2W7DA 4WYAA 2C44A 3BWNC 4WBTA 4XQ2A 2OATA 4RIZA 4W1WA 1IX8A 1G4XA 4U1TA 4BMKA 2JJGA 4HVKA 4EU1A 2OGAA 4ADCA 1BW0A 2GSAA 2O0RA 1E5EA 1KL1A 2Z61A 4W1XA 3AV7A 2D66A 2BYLA 4Q75A 1RVYA 1D7UA 2CH2A 2G7JA 3LV2A 2VGUA 3N0LA 3CQ5A 3GZDA 1SF2A 1YAAA 2VGWA 4WXGA 2W8VA 4R5ZA 5E4ZA 4A72A 5HXXA 1U08A 2VMYA 1JS6A 1SPAA 1KMKA 4XEWA 5M46A 1M32A 1WYVB 2VMTA 1BJOA 1D2FA 1BJ4A 2CJGA 2EZ2A 3PGYA 3A8UX 3RI6A 1CJ0A 2JJHA 3BN1A 3NRAA 3CQ4A 1M7YA 4AZJA 2ZY4A 3NX3A 3PIUA 2CTZA 3I5TA 1MDOA 1UU1A 3FZ8A 5EUDA 2V1PA 5IWQA 3R9AA 4BHDA 2JJEA 5C6UA 4A6RA 3ZRRA 4WB0A 3DYDA 3EI7A 3ZRPA 3QM2A 3W1JA 4ADEA 1IVRA 1M0PA 2AY4A 3AENA 2BI3A 1AKCA 3WY7A 2ZY3A 1W7NA 1P3WA 3FZ7A 3OP7A 5TF5A 4R2NA 3RBLA 1ASMA 2GQNA 1BJOB 2AY2A 3FKDA 2D64A 4UQVA 3QPGA 1KKPA 1G7XA 2D65A 1LW4A 2YCTA 1Z7DA 3WGCA 4CVQA 1RV4A 1SZKA 3WLXA 4RLGA 5KTBA 1MGVA 3NU8A 2DGLA 1C0NA 3VAXA 4FL0A 4RM1A 4F5GA 1CQ6A 1SFFA 3B1EA 3NYUA 1XI9A 3AENB 3E2FA 3LY1A 4WD2A 2W7EA 1ZOBA 2FM1A 4I8AA 4K2MA 1VP4A 2E7UA 2VGZA 2W8JA 4P3MA 4F4EA 2ZY2A 1C7NA 1YIZA 1AJRA 3BWOA 2R2NA 3G0TA 5J8QA 3OKSA 2HOXA 2BYJA 4KXKA 1KL2A 3HDOA 4XJLA 5EQCA 2W7HA 5M4DA 1YJSA 1C7OA 1CQ8A 1FC4A 1EJIA 3MAFA 2TPLA 1TOEA 1OHVA 3TCMA 1IUGA 4Y0IA 1LK9A 3MEBA 3FVSA 2X5DA 4GE4A 3MC6C 4BA5A 3JW9A 4LNMA 2AATA 1VJOA 2R5CA 1ASGA 3N75A 3P6KA 4PFFA 2VMSA 4UHNA 1WKGA 1B4XA 8AATA 4W5KA 2ZC0A 1V2DA 2JJFA 2R0TA 3NYTA 3NUIA 2Z9UA 1QJ3A 1O4SA 3E6GA 2VMRA 4TMRA 5DX5A 1X28A 5DB5A 1TATA 3AOWA 4IY7A 1QZ9A 4MKJA 3WCOA 2BHXA 3ASAA 2GMUA 2NMPA 3HQTA 3I4JA 3I16A 1BJWA 1GC3A 4CBRA 3BCBA 3BS8A 3D6KA 3VK3A 3CQ6A 3WX9A 3ELEA 3W1HA 1PMMA 1GEYA 2R5CB 3CAIA 4ADBA 1GC4A 1WYUA 4J8LA 4NOGA 2FQ6A 4ITGA 5G2QA 2YKXA 5FT5A 3E77A 2W7MA 3UAKA 2AY6A 2VI8A 4OBUA 1TOGA 1AIAA 3GBXA 2ZY5A 1VEFA 4ITXA 3MKJA 2GMSA 2YOBA 1M0OA 4ZAHA 3HL2A 1AY5A 3F9TA 2YCPA 1MLYA 3L44A 2VGVA 1OHWA 2EPJA 3EI9A 3N4XA 4Y0HA 4M2MA 2BWNA 3RCHB 3K7YA 3GJUA 4UOYA 1IX6A 3B1CA 3HBXA 2CANA 4LNJA 1JG8A 3USFA 1Y4IA 2AY8A 1XEYA 4GE9A 2DGKA 4FFCA 1GC2A 1ZC9A 1UKJA 2ORDA 3AEJA 1C7GA 4AO4A 4EB7A 2D7YA 1TOIA 1M0NA 2VLHA 4R5FA 1ELQA 2VLFA 3DZZA 3M5UA 4MGRA 2WK9A 4ZASA 1AAMA 1CS1A 4F5FA 1E5FA 3JZLA 3ASBA 1PMOA 4PVFA 5G09A 1ASDA 5M49A 4LNLA 3L8AA 2D63A 1M6SA 1ASAA 1AY8A 2CFBA 3EI6A 2ZJGA 4IXZA 4ZSYA 2CY8A 4B98A 1MAQA 3A9XA 1LC7A 3QGUA 4LC3A 3E2YA 3QHXA 1B5OA 1YJYA 3FFHA 4JEXA 3BWNA 7AATA 1W23A 3N4SA 4RAEA 4IXOA 2E7JA 1AHEA 4O6ZA 2HUIA 3HMUA 5F8VA 4DGTA 1AHGA 3E2ZA 3FDDA 4RJYA 4B9BA 2W7FA 1DJEA 1DKAA 3FCRA 1D7SA 3FFRA 3FSLA 3BB8A 2BKWA 1CQ7A 2D5YA 4QGRA 3ATHA 4OCAA 1LC8A 5LHAA 2HOYA 1GD9A 2X3LA 2VMNA 1CL1A 1UU2A 3EI5A 5EIGA 3VOMA 1IX7A 2QLRA 3LVMA 4ZDOA 3Q8NA 1EQBA 1LS3A 2VMPA 5DJ1A 4F5MA 5F9SA 9AATA 4ZWMA 4MQQA 2YRIA 1ZODA 4W91A 1BT4A 3WGBA 3CBFA 3DXWA 2HORA 4DQ6A 4CXQA 3WKSA 4WB0B 3E2ZB 2VMWA 1GDEA 2YCNA 2C7TA 3JWAA 1FG7A 3AEPA 3IHJA 1UU0A 2DKBA 1YJZA 2F8JA 2CJDA 2VMUA 2O1BA 1IAXA 4JEVA 4J5UA 4XJMA 2EYQA 1EG5A 2QBTA 4ADDA 2JG2A 3DU4A 2JISA 1IAYA 3BV0A 1ELUA 1C4KA 2AY9A 2VMXA 1B9HA 1BKGA 3ACZA 3FD0A 4TN4A 4OTLA 1GEXA 1YOOA 3QI6A 5BJ3A 4BQ0A 2X5FA 1WKHA 4K2IA 4OC9A 3EIAA 1QJ5A 3LVKA 4R8DA 3IF2A 2Z67A 4RKCA 1QITA 1BQDA 2VYCA 2A1VA 4L0OA 4WYGA 2QSRA 2WB6A 1OXOA 2PB0A 1QGNA 3FTBA 4WYEA 3H9XA 5LH9A 4F5IA 3PD6A 4ATPA 2WKAA 3AEMA 2GB3A 2VI9A 1AX4A 3AATA 3LVLB 1PG8A 2DKJA 1AJSA 4U2HA 4JE5A 1QIRA 3B46A 1SZUA 1OXPA 1J32A 3FRKA 3II0A 1N8PA 3TATA 3KKIA 2FNUA 4MQRA 4AOAA 4XJOA 1AY4A 4OBVA 1ASNA 3LVJA 2Z9XA 4E1OA 2C0RA 2QB2A 1AMAA 2W7KA 4JE5D 1MDZA 3RUYA 3LG0A 1O61A 3MAFB 2RFVA 2D7ZA 3FZ6A 1IBJA 3WCNA 3ISLA 1D7RA 2VMVA 1ORDA 3G7QA 3PD6B 4OT8A 1ARGA 1BQAA 1DFOA 1JS3A 2HZPA 4WXBA 3TQXA 4PFNA 1SVVA 1CZCA 3MC6A 2EGYA 1AJSB 4MQPA 5FT8A 5M4BA 4UHOA 2AY1A 4Q76A 4XK1A 1W7LA 5HDMA 4WYDA 1V72A 3DODA 1ARHA 1DJ9A 3FQ7A 3QN6A 3HT4A 4LW2A 4XJPA 4DBCA 3A2BA 2BIAA 2VIBA 2CJHA 3JTXA 2CINA 2CSTA 4TV7A 1RVUA 4A0FA 2DR1A 1AMSA 2HP2A 3E9KA 2W7LA 5BJ4A 2W7JA 2VIAA 5DJ9A 3WKRA 4KYOA 1ASCA 1T3IA 2O7CA 1TOJA 3GZCA 2YRRA 2PB2A 2BIGA 3AOVA 3LWSA 2EO5A 1M0QA 3F0HA 4ZWVA 1W7MA 2FN6A 1LC5A 2W8UA 5EFSA 3H7FA 1WYUB 3PJ0A 1WYTA 4JEYA 3GZDC 3VK4A 2CH1A 3UE8A 2HUUA 3PPLA 2Z9WA 3FQ8A 2E54A 1B5PA 1AHYA 1RV3A 3DRDA 2AEUA 3ECDA 3BC8A 2Z1YA 4CBSA 4F5LA 1J04A 2DGMA 5G4JA 1AHXA 3VK2A 4ZM3A 3JU7A 4RJ0A 4GDYA 3KE3A 1TOKA 2OKJA 5E5IA 3B1DA 4AZKA 1ASBA 3AELA 4H51A 3DC1A 1AMRA 1MDXA 1JF9A 3PDBA 3R4TA 5HHYA 1V2FA 1KMJA 2Z9VA 1WYTB 3RBFA 4WYCA 2BI5A 2Q7WA 3B8XA 3UWCA 1WSTA 2V0YA 4M2JA 4OYTA 4F5KA 3F6TA 3T32A 3ZZJA 2QMAA 1S09A 1OHYA 4ISYA 1S08A 3H14A 4ZLVA 2C81A 1IJIA 1TASA 1O69A 3NNKA 5EAVA 5FT4A 2FKIA 1YIYA 1TPLA 2BI9A 2E7IA 2OGEA 4PIWA 1B8GA 5EUNA 2YKYA 2CB1A 2BI1A 2ZP7A 2WK7A 4ZDPA 1G4VA 3PDBB 2AY3A 3ZZKA 2OQXA 1AKBA 1MLZA 2G6WA 2YKUA 1ARSA 4LW4A 4F5JA 3ELPA 4WLHA 2YHKA 4P7YA 4A6UA 3ZRQA 4E77A 3GWPA 3AEOA 3FVXA 2DOUA 3G8MA 4ZM4A 4HF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S07 A;  2ZYJ A;  3RQ1 A;  4A00 A;  2AY7 A;  1AIC A;  2VMO A;  5G4I A;  3VP6 A;  3NYS A;  1H1C A;  1AKA A;  1DGE A;  2VGT A;  3TFT A;  4WP0 A;  5EIG B;  2W7G A;  4GSA A;  5G2P A;  1B9I A;  4OMA A;  1V2E A;  1OAT A;  2ZSM A;  1CL2 A;  1AMQ A;  4Y0D A;  1ASF A;  3K28 A;  3EI8 A;  4WYF A;  2AY5 A;  3DR4 A;  2Z20 A;  3HLM A;  4ZDL A;  4A0R A;  4CXR A;  4EMY A;  3MBB A;  1BS0 A;  3DXV A;  3EZS A;  4Q31 A;  5EAA A;  2EH6 A;  3PDX A;  3AEM C;  2QB3 A;  4UHM A;  4GEB A;  2D61 A;  1MAP A;  2HUF A;  2ZUK A;  3DR7 A;  3GR9 A;  1DJU A;  4AO9 A;  3KGX A;  1GEW A;  4E3R A;  2WK8 A;  1DTY A;  2QA3 A;  4GRX A;  4MY5 A;  4JF1 A;  3COG A;  2PO3 A;  1D7V A;  3PAA A;  1ART A;  3KGW A;  4K2B A;  2JGT A;  3PA9 A;  3HVY A;  4MKK A;  1ECX A;  4Q6R A;  1TAR A;  4ZSW A;  4EFF A;  2HP1 A;  2ZSL A;  1I43 A;  2W8T A;  1N2T A;  3A9Y A;  1SZS A;  1LKC A;  1AHF A;  4GE7 A;  2W7I A;  1X2A A;  1AAW A;  3NDN A;  3FQA A;  4IYO A;  4ATQ A;  1I29 A;  1AIB A;  3NUB A;  4A0G A;  3BCA A;  1KKJ A;  4A6T A;  4N0B A;  1GBN A;  1I41 A;  3QBO A;  1N31 A;  2W8W A;  5D5S A;  2OKK A;  1YNU A;  2AEV A;  4N0W A;  1FG3 A;  2FNI A;  4WXF A;  1GCK A;  1LW5 A;  3EIB A;  5EUE A;  2XBN A;  3N5M A;  4W1V A;  4W8I A;  5G0A A;  1PFF A;  3NTJ A;  3NU7 A;  1S0A A;  4E3Q A;  1C9C A;  4XAU A;  1X0M A;  4KAM A;  4F5H A;  2BIE A;  5JAY A;  2EZ1 A;  3K40 A;  3FDB A;  5FT6 A;  2VMQ A;  4IYO B;  4JEZ A;  1ARI A;  1H0C A;  1Z3Z A;  4MSO A;  4AH3 A;  2XH1 A;  3GSB A;  1CZE A;  4JEW A;  1BJN A;  3TFU A;  4IXS A;  5AX8 A;  2FYF A;  2X8U A;  3RCH A;  3A9Z A;  1ASL A;  2BWO A;  4RKD A;  5E3K A;  1M4N A;  3AEJ C;  2VMZ A;  2R5E A;  1G7W A;  3EZ1 A;  4JF0 A;  2HOZ A;  4RIT A;  3FVU A;  3W1I A;  5I92 A;  4EB5 A;  1ASE A;  4BA4 A;  2BI2 A;  1GC0 A;  3GET A;  3P1T A;  1DGD A;  1QIS A;  2VGS A;  2Z1Z A;  4IX8 A;  1S06 A;  1W3U A;  4IW7 A;  3JWB A;  4WLJ A;  1I48 A;  1WYV A;  3WZF A;  3MAU A;  5D95 A;  2BWP A;  3BCX A;  2YKV A;  1X29 A;  4A0H A;  5K8B A;  3MAD A;  4M2K A;  3EUC A;  1O62 A;  2W7D A;  4WYA A;  2C44 A;  3BWN C;  4WBT A;  4XQ2 A;  2OAT A;  4RIZ A;  4W1W A;  1IX8 A;  1G4X A;  4U1T A;  4BMK A;  2JJG A;  4HVK A;  4EU1 A;  2OGA A;  4ADC A;  1BW0 A;  2GSA A;  2O0R A;  1E5E A;  1KL1 A;  2Z61 A;  4W1X A;  3AV7 A;  2D66 A;  2BYL A;  4Q75 A;  1RVY A;  1D7U A;  2CH2 A;  3LV2 A;  2VGU A;  3N0L A;  3CQ5 A;  3GZD A;  1SF2 A;  1YAA A;  2VGW A;  4WXG A;  2W8V A;  4R5Z A;  5E4Z A;  4A72 A;  5HXX A;  1U08 A;  2VMY A;  1JS6 A;  1SPA A;  1KMK A;  4XEW A;  5M46 A;  1M32 A;  1WYV B;  2VMT A;  1BJO A;  1D2F A;  1BJ4 A;  2CJG A;  2EZ2 A;  3PGY A;  3A8U X;  3RI6 A;  1CJ0 A;  2JJH A;  3BN1 A;  3NRA A;  3CQ4 A;  1M7Y A;  4AZJ A;  2ZY4 A;  3NX3 A;  3PIU A;  2CTZ A;  3I5T A;  1MDO A;  1UU1 A;  3FZ8 A;  5EUD A;  2V1P A;  5IWQ A;  3R9A A;  4BHD A;  2JJE A;  5C6U A;  4A6R A;  3ZRR A;  4WB0 A;  3DYD A;  3EI7 A;  3ZRP A;  3QM2 A;  3W1J A;  4ADE A;  1IVR A;  1M0P A;  2AY4 A;  3AEN A;  2BI3 A;  1AKC A;  3WY7 A;  2ZY3 A;  1W7N A;  1P3W A;  3FZ7 A;  3OP7 A;  5TF5 A;  4R2N A;  3RBL A;  1ASM A;  2GQN A;  1BJO B;  2AY2 A;  3FKD A;  2D64 A;  4UQV A;  3QPG A;  1KKP A;  1G7X A;  2D65 A;  1LW4 A;  2YCT A;  1Z7D A;  3WGC A;  4CVQ A;  1RV4 A;  1SZK A;  3WLX A;  4RLG A;  1MGV A;  3NU8 A;  2DGL A;  1C0N A;  3VAX A;  4FL0 A;  4RM1 A;  4F5G A;  1CQ6 A;  1SFF A;  3B1E A;  3NYU A;  1XI9 A;  3AEN B;  3E2F A;  3LY1 A;  4WD2 A;  2W7E A;  1ZOB A;  2FM1 A;  4I8A A;  4K2M A;  1VP4 A;  2E7U A;  2VGZ A;  2W8J A;  4P3M A;  4F4E A;  2ZY2 A;  1C7N A;  1YIZ A;  1AJR A;  3BWO A;  2R2N A;  3G0T A;  5J8Q A;  3OKS A;  2HOX A;  2BYJ A;  4KXK A;  1KL2 A;  3HDO A;  4XJL A;  5EQC A;  2W7H A;  5M4D A;  1YJS A;  1C7O A;  1CQ8 A;  1FC4 A;  1EJI A;  3MAF A;  2TPL A;  1TOE A;  1OHV A;  3TCM A;  1IUG A;  4Y0I A;  1LK9 A;  3MEB A;  3FVS A;  2X5D A;  4GE4 A;  3MC6 C;  4BA5 A;  3JW9 A;  4LNM A;  2AAT A;  1VJO A;  2R5C A;  1ASG A;  3N75 A;  3P6K A;  4PFF A;  2VMS A;  4UHN A;  1WKG A;  1B4X A;  8AAT A;  4W5K A;  2ZC0 A;  1V2D A;  2JJF A;  2R0T A;  3NYT A;  3NUI A;  2Z9U A;  1QJ3 A;  1O4S A;  3E6G A;  2VMR A;  4TMR A;  5DX5 A;  1X28 A;  5DB5 A;  1TAT A;  3AOW A;  4IY7 A;  1QZ9 A;  4MKJ A;  3WCO A;  2BHX A;  3ASA A;  2GMU A;  2NMP A;  3HQT A;  3I4J A;  3I16 A;  1BJW A;  1GC3 A;  4CBR A;  3BCB A;  3BS8 A;  3D6K A;  3VK3 A;  3CQ6 A;  3WX9 A;  3ELE A;  3W1H A;  1PMM A;  1GEY A;  2R5C B;  3CAI A;  4ADB A;  1GC4 A;  1WYU A;  4J8L A;  4NOG A;  2FQ6 A;  4ITG A;  5G2Q A;  2YKX A;  5FT5 A;  3E77 A;  2W7M A;  3UAK A;  2AY6 A;  2VI8 A;  4OBU A;  1TOG A;  1AIA A;  3GBX A;  2ZY5 A;  1VEF A;  4ITX A;  3MKJ A;  2GMS A;  2YOB A;  1M0O A;  4ZAH A;  3HL2 A;  1AY5 A;  3F9T A;  2YCP A;  1MLY A;  3L44 A;  2VGV A;  1OHW A;  2EPJ A;  3EI9 A;  4Y0H A;  4M2M A;  2BWN A;  3RCH B;  3K7Y A;  3GJU A;  4UOY A;  1IX6 A;  3B1C A;  3HBX A;  2CAN A;  4LNJ A;  1JG8 A;  3USF A;  1Y4I A;  2AY8 A;  1XEY A;  4GE9 A;  2DGK A;  4FFC A;  1GC2 A;  1ZC9 A;  1UKJ A;  2ORD A;  3AEJ A;  1C7G A;  4AO4 A;  4EB7 A;  2D7Y A;  1TOI A;  1M0N A;  2VLH A;  4R5F A;  1ELQ A;  2VLF A;  3DZZ A;  3M5U A;  4MGR A;  2WK9 A;  4ZAS A;  1AAM A;  1CS1 A;  4F5F A;  1E5F A;  3JZL A;  3ASB A;  1PMO A;  4PVF A;  5G09 A;  1ASD A;  5M49 A;  4LNL A;  3L8A A;  2D63 A;  1M6S A;  1ASA A;  1AY8 A;  2CFB A;  3EI6 A;  2ZJG A;  4IXZ A;  4ZSY A;  2CY8 A;  4B98 A;  1MAQ A;  3A9X A;  1LC7 A;  3QGU A;  4LC3 A;  3E2Y A;  3QHX A;  1B5O A;  1YJY A;  3FFH A;  4JEX A;  3BWN A;  7AAT A;  1W23 A;  4RAE A;  4IXO A;  2E7J A;  1AHE A;  4O6Z A;  2HUI A;  3HMU A;  5F8V A;  4DGT A;  1AHG A;  3E2Z A;  3FDD A;  4RJY A;  4B9B A;  2W7F A;  1DJE A;  1DKA A;  3FCR A;  1D7S A;  3FFR A;  3FSL A;  3BB8 A;  2BKW A;  1CQ7 A;  2D5Y A;  4QGR A;  3ATH A;  4OCA A;  1LC8 A;  5LHA A;  2HOY A;  1GD9 A;  2X3L A;  2VMN A;  1CL1 A;  1UU2 A;  3EI5 A;  5EIG A;  3VOM A;  1IX7 A;  2QLR A;  3LVM A;  4ZDO A;  3Q8N A;  1EQB A;  1LS3 A;  2VMP A;  5DJ1 A;  4F5M A;  5F9S A;  9AAT A;  4ZWM A;  4MQQ A;  2YRI A;  1ZOD A;  4W91 A;  1BT4 A;  3WGB A;  3CBF A;  3DXW A;  2HOR A;  4DQ6 A;  4CXQ A;  3WKS A;  4WB0 B;  3E2Z B;  2VMW A;  1GDE A;  2YCN A;  2C7T A;  3JWA A;  1FG7 A;  3AEP A;  3IHJ A;  1UU0 A;  2DKB A;  1YJZ A;  2F8J A;  2CJD A;  2VMU A;  2O1B A;  1IAX A;  4JEV A;  4J5U A;  4XJM A;  1EG5 A;  2QBT A;  4ADD A;  2JG2 A;  3DU4 A;  2JIS A;  1IAY A;  3BV0 A;  1ELU A;  1C4K A;  2AY9 A;  2VMX A;  1B9H A;  1BKG A;  3ACZ A;  3FD0 A;  4TN4 A;  4OTL A;  1GEX A;  1YOO A;  3QI6 A;  5BJ3 A;  4BQ0 A;  2X5F A;  1WKH A;  4K2I A;  4OC9 A;  3EIA A;  1QJ5 A;  3LVK A;  4R8D A;  3IF2 A;  2Z67 A;  4RKC A;  1QIT A;  1BQD A;  2VYC A;  4L0O A;  4WYG A;  1OXO A;  2PB0 A;  1QGN A;  3FTB A;  4WYE A;  5LH9 A;  4F5I A;  3PD6 A;  4ATP A;  2WKA A;  3AEM A;  2GB3 A;  2VI9 A;  1AX4 A;  3AAT A;  3LVL B;  1PG8 A;  2DKJ A;  1AJS A;  4U2H A;  4JE5 A;  1QIR A;  3B46 A;  1SZU A;  1OXP A;  1J32 A;  3FRK A;  3II0 A;  1N8P A;  3TAT A;  3KKI A;  2FNU A;  4MQR A;  4AOA A;  4XJO A;  1AY4 A;  4OBV A;  1ASN A;  3LVJ A;  2Z9X A;  4E1O A;  2C0R A;  2QB2 A;  1AMA A;  2W7K A;  4JE5 D;  1MDZ A;  3RUY A;  3LG0 A;  1O61 A;  3MAF B;  2RFV A;  2D7Z A;  3FZ6 A;  1IBJ A;  3WCN A;  3ISL A;  1D7R A;  2VMV A;  1ORD A;  3G7Q A;  3PD6 B;  4OT8 A;  1ARG A;  1BQA A;  1DFO A;  1JS3 A;  2HZP A;  4WXB A;  3TQX A;  4PFN A;  1SVV A;  1CZC A;  3MC6 A;  2EGY A;  1AJS B;  4MQP A;  5FT8 A;  5M4B A;  4UHO A;  2AY1 A;  4Q76 A;  4XK1 A;  1W7L A;  5HDM A;  4WYD A;  1V72 A;  3DOD A;  1ARH A;  1DJ9 A;  3FQ7 A;  3QN6 A;  3HT4 A;  4LW2 A;  4XJP A;  4DBC A;  3A2B A;  2BIA A;  2VIB A;  2CJH A;  3JTX A;  2CIN A;  2CST A;  4TV7 A;  1RVU A;  4A0F A;  2DR1 A;  1AMS A;  2HP2 A;  3E9K A;  2W7L A;  5BJ4 A;  2W7J A;  2VIA A;  5DJ9 A;  3WKR A;  4KYO A;  1ASC A;  1T3I A;  2O7C A;  1TOJ A;  3GZC A;  2YRR A;  2PB2 A;  2BIG A;  3AOV A;  3LWS A;  2EO5 A;  1M0Q A;  3F0H A;  4ZWV A;  1W7M A;  2FN6 A;  1LC5 A;  2W8U A;  5EFS A;  3H7F A;  1WYU B;  3PJ0 A;  1WYT A;  4JEY A;  3GZD C;  3VK4 A;  2CH1 A;  3UE8 A;  2HUU A;  3PPL A;  2Z9W A;  3FQ8 A;  2E54 A;  1B5P A;  1AHY A;  1RV3 A;  3DRD A;  2AEU A;  3ECD A;  3BC8 A;  2Z1Y A;  4CBS A;  4F5L A;  1J04 A;  2DGM A;  5G4J A;  1AHX A;  3VK2 A;  4ZM3 A;  3JU7 A;  4RJ0 A;  4GDY A;  3KE3 A;  1TOK A;  2OKJ A;  5E5I A;  3B1D A;  4AZK A;  1ASB A;  3AEL A;  4H51 A;  3DC1 A;  1AMR A;  1MDX A;  1JF9 A;  3PDB A;  3R4T A;  5HHY A;  1V2F A;  1KMJ A;  2Z9V A;  1WYT B;  3RBF A;  4WYC A;  2BI5 A;  2Q7W A;  3B8X A;  3UWC A;  1WST A;  2V0Y A;  4M2J A;  4OYT A;  4F5K A;  3F6T A;  3T32 A;  3ZZJ A;  2QMA A;  1S09 A;  1OHY A;  4ISY A;  1S08 A;  3H14 A;  4ZLV A;  2C81 A;  1IJI A;  1TAS A;  1O69 A;  3NNK A;  5EAV A;  5FT4 A;  1YIY A;  1TPL A;  2BI9 A;  2E7I A;  2OGE A;  4PIW A;  1B8G A;  5EUN A;  2YKY A;  2CB1 A;  2BI1 A;  2ZP7 A;  2WK7 A;  4ZDP A;  1G4V A;  3PDB B;  2AY3 A;  3ZZK A;  2OQX A;  1AKB A;  1MLZ A;  2G6W A;  2YKU A;  1ARS A;  4LW4 A;  4F5J A;  3ELP A;  4WLH A;  2YHK A;  4P7Y A;  4A6U A;  3ZRQ A;  4E77 A;  3GWP A;  3AEO A;  3FVX A;  2DOU A;  3G8M A;  4ZM4 A;  4HF8 A; 
#chains in the Genus database with same CATH topology
 1S07 A;  2ZYJ A;  3RQ1 A;  4A00 A;  2AY7 A;  1AIC A;  2VMO A;  5G4I A;  3VP6 A;  3NYS A;  1H1C A;  1AKA A;  1DGE A;  2VGT A;  3TFT A;  4WP0 A;  5EIG B;  2W7G A;  4GSA A;  5G2P A;  1B9I A;  4OMA A;  1V2E A;  1OAT A;  2ZSM A;  1CL2 A;  1AMQ A;  4Y0D A;  1ASF A;  3K28 A;  3EI8 A;  4WYF A;  2AY5 A;  3DR4 A;  2Z20 A;  3HLM A;  4ZDL A;  4A0R A;  4CXR A;  4EMY A;  3MBB A;  1BS0 A;  3DXV A;  3EZS A;  4Q31 A;  2KFP A;  5EAA A;  2EH6 A;  3PDX A;  3AEM C;  2QB3 A;  4UHM A;  4GEB A;  2D61 A;  1MAP A;  2HUF A;  2ZUK A;  3DR7 A;  3GR9 A;  1DJU A;  4AO9 A;  3KGX A;  1GEW A;  4E3R A;  2WK8 A;  1DTY A;  2QA3 A;  4GRX A;  4MY5 A;  4JF1 A;  3COG A;  2PO3 A;  1D7V A;  3PAA A;  1ART A;  3KGW A;  4K2B A;  2JGT A;  3PA9 A;  3HVY A;  4MKK A;  1ECX A;  4Q6R A;  1TAR A;  4ZSW A;  4EFF A;  2HP1 A;  2ZSL A;  1I43 A;  2W8T A;  1N2T A;  3A9Y A;  1SZS A;  1LKC A;  1AHF A;  4GE7 A;  2W7I A;  1X2A A;  1AAW A;  3NDN A;  3FQA A;  4IYO A;  4ATQ A;  1I29 A;  1AIB A;  3NUB A;  4A0G A;  3BCA A;  4K05 A;  1KKJ A;  4A6T A;  4N0B A;  1GBN A;  1I41 A;  3QBO A;  1N31 A;  2W8W A;  5D5S A;  2OKK A;  1YNU A;  2AEV A;  4N0W A;  1FG3 A;  2FNI A;  4WXF A;  1GCK A;  1LW5 A;  3EIB A;  5EUE A;  2XBN A;  3N5M A;  4W1V A;  4W8I A;  5G0A A;  3N7N A;  1PFF A;  3NTJ A;  3NU7 A;  1S0A A;  4E3Q A;  1C9C A;  4XAU A;  1X0M A;  4KAM A;  4F5H A;  2BIE A;  5JAY A;  2EZ1 A;  3K40 A;  3FDB A;  5FT6 A;  2VMQ A;  4IYO B;  4JEZ A;  1ARI A;  1H0C A;  4H63 Q;  1Z3Z A;  4MSO A;  4AH3 A;  3N4R A;  2XH1 A;  3GSB A;  1CZE A;  4JEW A;  1BJN A;  3TFU A;  4IXS A;  5AX8 A;  2FYF A;  2X8U A;  3RCH A;  3A9Z A;  1ASL A;  2BWO A;  4RKD A;  5E3K A;  1M4N A;  3AEJ C;  2VMZ A;  2R5E A;  1G7W A;  3EZ1 A;  4JF0 A;  2HOZ A;  4RIT A;  3FVU A;  3W1I A;  5I92 A;  4EB5 A;  1ASE A;  4BA4 A;  2BI2 A;  1GC0 A;  3GET A;  3P1T A;  1DGD A;  1QIS A;  2VGS A;  2Z1Z A;  4IX8 A;  1S06 A;  1W3U A;  4IW7 A;  3JWB A;  4WLJ A;  1I48 A;  1WYV A;  3WZF A;  3MAU A;  5D95 A;  2BWP A;  3BCX A;  2YKV A;  1X29 A;  4A0H A;  5K8B A;  3MAD A;  4M2K A;  3EUC A;  1O62 A;  2W7D A;  4WYA A;  2C44 A;  3BWN C;  4WBT A;  4XQ2 A;  2OAT A;  4RIZ A;  4W1W A;  1IX8 A;  1G4X A;  4U1T A;  4BMK A;  2JJG A;  4HVK A;  4EU1 A;  2OGA A;  4ADC A;  1BW0 A;  2GSA A;  2O0R A;  1E5E A;  1KL1 A;  2Z61 A;  4W1X A;  3AV7 A;  2D66 A;  2BYL A;  4Q75 A;  1RVY A;  1D7U A;  2CH2 A;  2G7J A;  3LV2 A;  2VGU A;  3N0L A;  3CQ5 A;  3GZD A;  1SF2 A;  1YAA A;  2VGW A;  4WXG A;  2W8V A;  4R5Z A;  5E4Z A;  4A72 A;  5HXX A;  1U08 A;  2VMY A;  1JS6 A;  1SPA A;  1KMK A;  4XEW A;  5M46 A;  1M32 A;  1WYV B;  2VMT A;  1BJO A;  1D2F A;  1BJ4 A;  2CJG A;  2EZ2 A;  3PGY A;  3A8U X;  3RI6 A;  1CJ0 A;  2JJH A;  3BN1 A;  3NRA A;  3CQ4 A;  1M7Y A;  4AZJ A;  2ZY4 A;  3NX3 A;  3PIU A;  2CTZ A;  3I5T A;  1MDO A;  1UU1 A;  3FZ8 A;  5EUD A;  2V1P A;  5IWQ A;  3R9A A;  4BHD A;  2JJE A;  5C6U A;  4A6R A;  3ZRR A;  4WB0 A;  3DYD A;  3EI7 A;  3ZRP A;  3QM2 A;  3W1J A;  4ADE A;  1IVR A;  1M0P A;  2AY4 A;  3AEN A;  2BI3 A;  1AKC A;  3WY7 A;  2ZY3 A;  1W7N A;  1P3W A;  3FZ7 A;  3OP7 A;  5TF5 A;  4R2N A;  3RBL A;  1ASM A;  2GQN A;  1BJO B;  2AY2 A;  3FKD A;  2D64 A;  4UQV A;  3QPG A;  1KKP A;  1G7X A;  2D65 A;  1LW4 A;  2YCT A;  1Z7D A;  3WGC A;  4CVQ A;  1RV4 A;  1SZK A;  3WLX A;  4RLG A;  5KTB A;  1MGV A;  3NU8 A;  2DGL A;  1C0N A;  3VAX A;  4FL0 A;  4RM1 A;  4F5G A;  1CQ6 A;  1SFF A;  3B1E A;  3NYU A;  1XI9 A;  3AEN B;  3E2F A;  3LY1 A;  4WD2 A;  2W7E A;  1ZOB A;  2FM1 A;  4I8A A;  4K2M A;  1VP4 A;  2E7U A;  2VGZ A;  2W8J A;  4P3M A;  4F4E A;  2ZY2 A;  1C7N A;  1YIZ A;  1AJR A;  3BWO A;  2R2N A;  3G0T A;  5J8Q A;  3OKS A;  2HOX A;  2BYJ A;  4KXK A;  1KL2 A;  3HDO A;  4XJL A;  5EQC A;  2W7H A;  5M4D A;  1YJS A;  1C7O A;  1CQ8 A;  1FC4 A;  1EJI A;  3MAF A;  2TPL A;  1TOE A;  1OHV A;  3TCM A;  1IUG A;  4Y0I A;  1LK9 A;  3MEB A;  3FVS A;  2X5D A;  4GE4 A;  3MC6 C;  4BA5 A;  3JW9 A;  4LNM A;  2AAT A;  1VJO A;  2R5C A;  1ASG A;  3N75 A;  3P6K A;  4PFF A;  2VMS A;  4UHN A;  1WKG A;  1B4X A;  8AAT A;  4W5K A;  2ZC0 A;  1V2D A;  2JJF A;  2R0T A;  3NYT A;  3NUI A;  2Z9U A;  1QJ3 A;  1O4S A;  3E6G A;  2VMR A;  4TMR A;  5DX5 A;  1X28 A;  5DB5 A;  1TAT A;  3AOW A;  4IY7 A;  1QZ9 A;  4MKJ A;  3WCO A;  2BHX A;  3ASA A;  2GMU A;  2NMP A;  3HQT A;  3I4J A;  3I16 A;  1BJW A;  1GC3 A;  4CBR A;  3BCB A;  3BS8 A;  3D6K A;  3VK3 A;  3CQ6 A;  3WX9 A;  3ELE A;  3W1H A;  1PMM A;  1GEY A;  2R5C B;  3CAI A;  4ADB A;  1GC4 A;  1WYU A;  4J8L A;  4NOG A;  2FQ6 A;  4ITG A;  5G2Q A;  2YKX A;  5FT5 A;  3E77 A;  2W7M A;  3UAK A;  2AY6 A;  2VI8 A;  4OBU A;  1TOG A;  1AIA A;  3GBX A;  2ZY5 A;  1VEF A;  4ITX A;  3MKJ A;  2GMS A;  2YOB A;  1M0O A;  4ZAH A;  3HL2 A;  1AY5 A;  3F9T A;  2YCP A;  1MLY A;  3L44 A;  2VGV A;  1OHW A;  2EPJ A;  3EI9 A;  3N4X A;  4Y0H A;  4M2M A;  2BWN A;  3RCH B;  3K7Y A;  3GJU A;  4UOY A;  1IX6 A;  3B1C A;  3HBX A;  2CAN A;  4LNJ A;  1JG8 A;  3USF A;  1Y4I A;  2AY8 A;  1XEY A;  4GE9 A;  2DGK A;  4FFC A;  1GC2 A;  1ZC9 A;  1UKJ A;  2ORD A;  3AEJ A;  1C7G A;  4AO4 A;  4EB7 A;  2D7Y A;  1TOI A;  1M0N A;  2VLH A;  4R5F A;  1ELQ A;  2VLF A;  3DZZ A;  3M5U A;  4MGR A;  2WK9 A;  4ZAS A;  1AAM A;  1CS1 A;  4F5F A;  1E5F A;  3JZL A;  3ASB A;  1PMO A;  4PVF A;  5G09 A;  1ASD A;  5M49 A;  4LNL A;  3L8A A;  2D63 A;  1M6S A;  1ASA A;  1AY8 A;  2CFB A;  3EI6 A;  2ZJG A;  4IXZ A;  4ZSY A;  2CY8 A;  4B98 A;  1MAQ A;  3A9X A;  1LC7 A;  3QGU A;  4LC3 A;  3E2Y A;  3QHX A;  1B5O A;  1YJY A;  3FFH A;  4JEX A;  3BWN A;  7AAT A;  1W23 A;  3N4S A;  4RAE A;  4IXO A;  2E7J A;  1AHE A;  4O6Z A;  2HUI A;  3HMU A;  5F8V A;  4DGT A;  1AHG A;  3E2Z A;  3FDD A;  4RJY A;  4B9B A;  2W7F A;  1DJE A;  1DKA A;  3FCR A;  1D7S A;  3FFR A;  3FSL A;  3BB8 A;  2BKW A;  1CQ7 A;  2D5Y A;  4QGR A;  3ATH A;  4OCA A;  1LC8 A;  5LHA A;  2HOY A;  1GD9 A;  2X3L A;  2VMN A;  1CL1 A;  1UU2 A;  3EI5 A;  5EIG A;  3VOM A;  1IX7 A;  2QLR A;  3LVM A;  4ZDO A;  3Q8N A;  1EQB A;  1LS3 A;  2VMP A;  5DJ1 A;  4F5M A;  5F9S A;  9AAT A;  4ZWM A;  4MQQ A;  2YRI A;  1ZOD A;  4W91 A;  1BT4 A;  3WGB A;  3CBF A;  3DXW A;  2HOR A;  4DQ6 A;  4CXQ A;  3WKS A;  4WB0 B;  3E2Z B;  2VMW A;  1GDE A;  2YCN A;  2C7T A;  3JWA A;  1FG7 A;  3AEP A;  3IHJ A;  1UU0 A;  2DKB A;  1YJZ A;  2F8J A;  2CJD A;  2VMU A;  2O1B A;  1IAX A;  4JEV A;  4J5U A;  4XJM A;  2EYQ A;  1EG5 A;  2QBT A;  4ADD A;  2JG2 A;  3DU4 A;  2JIS A;  1IAY A;  3BV0 A;  1ELU A;  1C4K A;  2AY9 A;  2VMX A;  1B9H A;  1BKG A;  3ACZ A;  3FD0 A;  4TN4 A;  4OTL A;  1GEX A;  1YOO A;  3QI6 A;  5BJ3 A;  4BQ0 A;  2X5F A;  1WKH A;  4K2I A;  4OC9 A;  3EIA A;  1QJ5 A;  3LVK A;  4R8D A;  3IF2 A;  2Z67 A;  4RKC A;  1QIT A;  1BQD A;  2VYC A;  2A1V A;  4L0O A;  4WYG A;  2QSR A;  2WB6 A;  1OXO A;  2PB0 A;  1QGN A;  3FTB A;  4WYE A;  3H9X A;  5LH9 A;  4F5I A;  3PD6 A;  4ATP A;  2WKA A;  3AEM A;  2GB3 A;  2VI9 A;  1AX4 A;  3AAT A;  3LVL B;  1PG8 A;  2DKJ A;  1AJS A;  4U2H A;  4JE5 A;  1QIR A;  3B46 A;  1SZU A;  1OXP A;  1J32 A;  3FRK A;  3II0 A;  1N8P A;  3TAT A;  3KKI A;  2FNU A;  4MQR A;  4AOA A;  4XJO A;  1AY4 A;  4OBV A;  1ASN A;  3LVJ A;  2Z9X A;  4E1O A;  2C0R A;  2QB2 A;  1AMA A;  2W7K A;  4JE5 D;  1MDZ A;  3RUY A;  3LG0 A;  1O61 A;  3MAF B;  2RFV A;  2D7Z A;  3FZ6 A;  1IBJ A;  3WCN A;  3ISL A;  1D7R A;  2VMV A;  1ORD A;  3G7Q A;  3PD6 B;  4OT8 A;  1ARG A;  1BQA A;  1DFO A;  1JS3 A;  2HZP A;  4WXB A;  3TQX A;  4PFN A;  1SVV A;  1CZC A;  3MC6 A;  2EGY A;  1AJS B;  4MQP A;  5FT8 A;  5M4B A;  4UHO A;  2AY1 A;  4Q76 A;  4XK1 A;  1W7L A;  5HDM A;  4WYD A;  1V72 A;  3DOD A;  1ARH A;  1DJ9 A;  3FQ7 A;  3QN6 A;  3HT4 A;  4LW2 A;  4XJP A;  4DBC A;  3A2B A;  2BIA A;  2VIB A;  2CJH A;  3JTX A;  2CIN A;  2CST A;  4TV7 A;  1RVU A;  4A0F A;  2DR1 A;  1AMS A;  2HP2 A;  3E9K A;  2W7L A;  5BJ4 A;  2W7J A;  2VIA A;  5DJ9 A;  3WKR A;  4KYO A;  1ASC A;  1T3I A;  2O7C A;  1TOJ A;  3GZC A;  2YRR A;  2PB2 A;  2BIG A;  3AOV A;  3LWS A;  2EO5 A;  1M0Q A;  3F0H A;  4ZWV A;  1W7M A;  2FN6 A;  1LC5 A;  2W8U A;  5EFS A;  3H7F A;  1WYU B;  3PJ0 A;  1WYT A;  4JEY A;  3GZD C;  3VK4 A;  2CH1 A;  3UE8 A;  2HUU A;  3PPL A;  2Z9W A;  3FQ8 A;  2E54 A;  1B5P A;  1AHY A;  1RV3 A;  3DRD A;  2AEU A;  3ECD A;  3BC8 A;  2Z1Y A;  4CBS A;  4F5L A;  1J04 A;  2DGM A;  5G4J A;  1AHX A;  3VK2 A;  4ZM3 A;  3JU7 A;  4RJ0 A;  4GDY A;  3KE3 A;  1TOK A;  2OKJ A;  5E5I A;  3B1D A;  4AZK A;  1ASB A;  3AEL A;  4H51 A;  3DC1 A;  1AMR A;  1MDX A;  1JF9 A;  3PDB A;  3R4T A;  5HHY A;  1V2F A;  1KMJ A;  2Z9V A;  1WYT B;  3RBF A;  4WYC A;  2BI5 A;  2Q7W A;  3B8X A;  3UWC A;  1WST A;  2V0Y A;  4M2J A;  4OYT A;  4F5K A;  3F6T A;  3T32 A;  3ZZJ A;  2QMA A;  1S09 A;  1OHY A;  4ISY A;  1S08 A;  3H14 A;  4ZLV A;  2C81 A;  1IJI A;  1TAS A;  1O69 A;  3NNK A;  5EAV A;  5FT4 A;  2FKI A;  1YIY A;  1TPL A;  2BI9 A;  2E7I A;  2OGE A;  4PIW A;  1B8G A;  5EUN A;  2YKY A;  2CB1 A;  2BI1 A;  2ZP7 A;  2WK7 A;  4ZDP A;  1G4V A;  3PDB B;  2AY3 A;  3ZZK A;  2OQX A;  1KAF A;  1AKB A;  1MLZ A;  2G6W A;  2YKU A;  1ARS A;  4LW4 A;  4F5J A;  3ELP A;  4WLH A;  2YHK A;  4P7Y A;  4A6U A;  3ZRQ A;  4E77 A;  3GWP A;  3AEO A;  3FVX A;  2DOU A;  3G8M A;  4ZM4 A;  4HF8 A; 
#chains in the Genus database with same CATH homology
 1S07 A;  2ZYJ A;  3RQ1 A;  4A00 A;  2AY7 A;  1AIC A;  2VMO A;  5G4I A;  3VP6 A;  3NYS A;  1H1C A;  1AKA A;  1DGE A;  2VGT A;  3TFT A;  4WP0 A;  5EIG B;  2W7G A;  4GSA A;  5G2P A;  1B9I A;  4OMA A;  1V2E A;  1OAT A;  2ZSM A;  1CL2 A;  1AMQ A;  4Y0D A;  1ASF A;  3K28 A;  3EI8 A;  4WYF A;  2AY5 A;  3DR4 A;  2Z20 A;  3HLM A;  4ZDL A;  4A0R A;  4CXR A;  4EMY A;  3MBB A;  1BS0 A;  3DXV A;  3EZS A;  4Q31 A;  2KFP A;  5EAA A;  2EH6 A;  3PDX A;  3AEM C;  2QB3 A;  4UHM A;  4GEB A;  2D61 A;  1MAP A;  2HUF A;  2ZUK A;  3DR7 A;  3GR9 A;  1DJU A;  4AO9 A;  3KGX A;  1GEW A;  4E3R A;  2WK8 A;  1DTY A;  2QA3 A;  4GRX A;  4MY5 A;  4JF1 A;  3COG A;  2PO3 A;  1D7V A;  3PAA A;  1ART A;  3KGW A;  4K2B A;  2JGT A;  3PA9 A;  3HVY A;  4MKK A;  1ECX A;  4Q6R A;  1TAR A;  4ZSW A;  4EFF A;  2HP1 A;  2ZSL A;  1I43 A;  2W8T A;  1N2T A;  3A9Y A;  1SZS A;  1LKC A;  1AHF A;  4GE7 A;  2W7I A;  1X2A A;  1AAW A;  3NDN A;  3FQA A;  4IYO A;  4ATQ A;  1I29 A;  1AIB A;  3NUB A;  4A0G A;  3BCA A;  4K05 A;  1KKJ A;  4A6T A;  4N0B A;  1GBN A;  1I41 A;  3QBO A;  1N31 A;  2W8W A;  5D5S A;  2OKK A;  1YNU A;  2AEV A;  4N0W A;  1FG3 A;  2FNI A;  4WXF A;  1GCK A;  1LW5 A;  3EIB A;  5EUE A;  2XBN A;  3N5M A;  4W1V A;  4W8I A;  5G0A A;  3N7N A;  1PFF A;  3NTJ A;  3NU7 A;  1S0A A;  4E3Q A;  1C9C A;  4XAU A;  1X0M A;  4KAM A;  4F5H A;  2BIE A;  5JAY A;  2EZ1 A;  3K40 A;  3FDB A;  5FT6 A;  2VMQ A;  4IYO B;  4JEZ A;  1ARI A;  1H0C A;  4H63 Q;  1Z3Z A;  4MSO A;  4AH3 A;  3N4R A;  2XH1 A;  3GSB A;  1CZE A;  4JEW A;  1BJN A;  3TFU A;  4IXS A;  5AX8 A;  2FYF A;  2X8U A;  3RCH A;  3A9Z A;  1ASL A;  2BWO A;  4RKD A;  5E3K A;  1M4N A;  3AEJ C;  2VMZ A;  2R5E A;  1G7W A;  3EZ1 A;  4JF0 A;  2HOZ A;  4RIT A;  3FVU A;  3W1I A;  5I92 A;  4EB5 A;  1ASE A;  4BA4 A;  2BI2 A;  1GC0 A;  3GET A;  3P1T A;  1DGD A;  1QIS A;  2VGS A;  2Z1Z A;  4IX8 A;  1S06 A;  1W3U A;  4IW7 A;  3JWB A;  4WLJ A;  1I48 A;  1WYV A;  3WZF A;  3MAU A;  5D95 A;  2BWP A;  3BCX A;  2YKV A;  1X29 A;  4A0H A;  5K8B A;  3MAD A;  4M2K A;  3EUC A;  1O62 A;  2W7D A;  4WYA A;  2C44 A;  3BWN C;  4WBT A;  4XQ2 A;  2OAT A;  4RIZ A;  4W1W A;  1IX8 A;  1G4X A;  4U1T A;  4BMK A;  2JJG A;  4HVK A;  4EU1 A;  2OGA A;  4ADC A;  1BW0 A;  2GSA A;  2O0R A;  1E5E A;  1KL1 A;  2Z61 A;  4W1X A;  3AV7 A;  2D66 A;  2BYL A;  4Q75 A;  1RVY A;  1D7U A;  2CH2 A;  2G7J A;  3LV2 A;  2VGU A;  3N0L A;  3CQ5 A;  3GZD A;  1SF2 A;  1YAA A;  2VGW A;  4WXG A;  2W8V A;  4R5Z A;  5E4Z A;  4A72 A;  5HXX A;  1U08 A;  2VMY A;  1JS6 A;  1SPA A;  1KMK A;  4XEW A;  5M46 A;  1M32 A;  1WYV B;  2VMT A;  1BJO A;  1D2F A;  1BJ4 A;  2CJG A;  2EZ2 A;  3PGY A;  3A8U X;  3RI6 A;  1CJ0 A;  2JJH A;  3BN1 A;  3NRA A;  3CQ4 A;  1M7Y A;  4AZJ A;  2ZY4 A;  3NX3 A;  3PIU A;  2CTZ A;  3I5T A;  1MDO A;  1UU1 A;  3FZ8 A;  5EUD A;  2V1P A;  5IWQ A;  3R9A A;  4BHD A;  2JJE A;  5C6U A;  4A6R A;  3ZRR A;  4WB0 A;  3DYD A;  3EI7 A;  3ZRP A;  3QM2 A;  3W1J A;  4ADE A;  1IVR A;  1M0P A;  2AY4 A;  3AEN A;  2BI3 A;  1AKC A;  3WY7 A;  2ZY3 A;  1W7N A;  1P3W A;  3FZ7 A;  3OP7 A;  5TF5 A;  4R2N A;  3RBL A;  1ASM A;  2GQN A;  1BJO B;  2AY2 A;  3FKD A;  2D64 A;  4UQV A;  3QPG A;  1KKP A;  1G7X A;  2D65 A;  1LW4 A;  2YCT A;  1Z7D A;  3WGC A;  4CVQ A;  1RV4 A;  1SZK A;  3WLX A;  4RLG A;  5KTB A;  1MGV A;  3NU8 A;  2DGL A;  1C0N A;  3VAX A;  4FL0 A;  4RM1 A;  4F5G A;  1CQ6 A;  1SFF A;  3B1E A;  3NYU A;  1XI9 A;  3AEN B;  3E2F A;  3LY1 A;  4WD2 A;  2W7E A;  1ZOB A;  2FM1 A;  4I8A A;  4K2M A;  1VP4 A;  2E7U A;  2VGZ A;  2W8J A;  4P3M A;  4F4E A;  2ZY2 A;  1C7N A;  1YIZ A;  1AJR A;  3BWO A;  2R2N A;  3G0T A;  5J8Q A;  3OKS A;  2HOX A;  2BYJ A;  4KXK A;  1KL2 A;  3HDO A;  4XJL A;  5EQC A;  2W7H A;  5M4D A;  1YJS A;  1C7O A;  1CQ8 A;  1FC4 A;  1EJI A;  3MAF A;  2TPL A;  1TOE A;  1OHV A;  3TCM A;  1IUG A;  4Y0I A;  1LK9 A;  3MEB A;  3FVS A;  2X5D A;  4GE4 A;  3MC6 C;  4BA5 A;  3JW9 A;  4LNM A;  2AAT A;  1VJO A;  2R5C A;  1ASG A;  3N75 A;  3P6K A;  4PFF A;  2VMS A;  4UHN A;  1WKG A;  1B4X A;  8AAT A;  4W5K A;  2ZC0 A;  1V2D A;  2JJF A;  2R0T A;  3NYT A;  3NUI A;  2Z9U A;  1QJ3 A;  1O4S A;  3E6G A;  2VMR A;  4TMR A;  5DX5 A;  1X28 A;  5DB5 A;  1TAT A;  3AOW A;  4IY7 A;  1QZ9 A;  4MKJ A;  3WCO A;  2BHX A;  3ASA A;  2GMU A;  2NMP A;  3HQT A;  3I4J A;  3I16 A;  1BJW A;  1GC3 A;  4CBR A;  3BCB A;  3BS8 A;  3D6K A;  3VK3 A;  3CQ6 A;  3WX9 A;  3ELE A;  3W1H A;  1PMM A;  1GEY A;  2R5C B;  3CAI A;  4ADB A;  1GC4 A;  1WYU A;  4J8L A;  4NOG A;  2FQ6 A;  4ITG A;  5G2Q A;  2YKX A;  5FT5 A;  3E77 A;  2W7M A;  3UAK A;  2AY6 A;  2VI8 A;  4OBU A;  1TOG A;  1AIA A;  3GBX A;  2ZY5 A;  1VEF A;  4ITX A;  3MKJ A;  2GMS A;  2YOB A;  1M0O A;  4ZAH A;  3HL2 A;  1AY5 A;  3F9T A;  2YCP A;  1MLY A;  3L44 A;  2VGV A;  1OHW A;  2EPJ A;  3EI9 A;  3N4X A;  4Y0H A;  4M2M A;  2BWN A;  3RCH B;  3K7Y A;  3GJU A;  4UOY A;  1IX6 A;  3B1C A;  3HBX A;  2CAN A;  4LNJ A;  1JG8 A;  3USF A;  1Y4I A;  2AY8 A;  1XEY A;  4GE9 A;  2DGK A;  4FFC A;  1GC2 A;  1ZC9 A;  1UKJ A;  2ORD A;  3AEJ A;  1C7G A;  4AO4 A;  4EB7 A;  2D7Y A;  1TOI A;  1M0N A;  2VLH A;  4R5F A;  1ELQ A;  2VLF A;  3DZZ A;  3M5U A;  4MGR A;  2WK9 A;  4ZAS A;  1AAM A;  1CS1 A;  4F5F A;  1E5F A;  3JZL A;  3ASB A;  1PMO A;  4PVF A;  5G09 A;  1ASD A;  5M49 A;  4LNL A;  3L8A A;  2D63 A;  1M6S A;  1ASA A;  1AY8 A;  2CFB A;  3EI6 A;  2ZJG A;  4IXZ A;  4ZSY A;  2CY8 A;  4B98 A;  1MAQ A;  3A9X A;  1LC7 A;  3QGU A;  4LC3 A;  3E2Y A;  3QHX A;  1B5O A;  1YJY A;  3FFH A;  4JEX A;  3BWN A;  7AAT A;  1W23 A;  3N4S A;  4RAE A;  4IXO A;  2E7J A;  1AHE A;  4O6Z A;  2HUI A;  3HMU A;  5F8V A;  4DGT A;  1AHG A;  3E2Z A;  3FDD A;  4RJY A;  4B9B A;  2W7F A;  1DJE A;  1DKA A;  3FCR A;  1D7S A;  3FFR A;  3FSL A;  3BB8 A;  2BKW A;  1CQ7 A;  2D5Y A;  4QGR A;  3ATH A;  4OCA A;  1LC8 A;  5LHA A;  2HOY A;  1GD9 A;  2X3L A;  2VMN A;  1CL1 A;  1UU2 A;  3EI5 A;  5EIG A;  3VOM A;  1IX7 A;  2QLR A;  3LVM A;  4ZDO A;  3Q8N A;  1EQB A;  1LS3 A;  2VMP A;  5DJ1 A;  4F5M A;  5F9S A;  9AAT A;  4ZWM A;  4MQQ A;  2YRI A;  1ZOD A;  4W91 A;  1BT4 A;  3WGB A;  3CBF A;  3DXW A;  2HOR A;  4DQ6 A;  4CXQ A;  3WKS A;  4WB0 B;  3E2Z B;  2VMW A;  1GDE A;  2YCN A;  2C7T A;  3JWA A;  1FG7 A;  3AEP A;  3IHJ A;  1UU0 A;  2DKB A;  1YJZ A;  2F8J A;  2CJD A;  2VMU A;  2O1B A;  1IAX A;  4JEV A;  4J5U A;  4XJM A;  2EYQ A;  1EG5 A;  2QBT A;  4ADD A;  2JG2 A;  3DU4 A;  2JIS A;  1IAY A;  3BV0 A;  1ELU A;  1C4K A;  2AY9 A;  2VMX A;  1B9H A;  1BKG A;  3ACZ A;  3FD0 A;  4TN4 A;  4OTL A;  1GEX A;  1YOO A;  3QI6 A;  5BJ3 A;  4BQ0 A;  2X5F A;  1WKH A;  4K2I A;  4OC9 A;  3EIA A;  1QJ5 A;  3LVK A;  4R8D A;  3IF2 A;  2Z67 A;  4RKC A;  1QIT A;  1BQD A;  2VYC A;  2A1V A;  4L0O A;  4WYG A;  2QSR A;  2WB6 A;  1OXO A;  2PB0 A;  1QGN A;  3FTB A;  4WYE A;  3H9X A;  5LH9 A;  4F5I A;  3PD6 A;  4ATP A;  2WKA A;  3AEM A;  2GB3 A;  2VI9 A;  1AX4 A;  3AAT A;  3LVL B;  1PG8 A;  2DKJ A;  1AJS A;  4U2H A;  4JE5 A;  1QIR A;  3B46 A;  1SZU A;  1OXP A;  1J32 A;  3FRK A;  3II0 A;  1N8P A;  3TAT A;  3KKI A;  2FNU A;  4MQR A;  4AOA A;  4XJO A;  1AY4 A;  4OBV A;  1ASN A;  3LVJ A;  2Z9X A;  4E1O A;  2C0R A;  2QB2 A;  1AMA A;  2W7K A;  4JE5 D;  1MDZ A;  3RUY A;  3LG0 A;  1O61 A;  3MAF B;  2RFV A;  2D7Z A;  3FZ6 A;  1IBJ A;  3WCN A;  3ISL A;  1D7R A;  2VMV A;  1ORD A;  3G7Q A;  3PD6 B;  4OT8 A;  1ARG A;  1BQA A;  1DFO A;  1JS3 A;  2HZP A;  4WXB A;  3TQX A;  4PFN A;  1SVV A;  1CZC A;  3MC6 A;  2EGY A;  1AJS B;  4MQP A;  5FT8 A;  5M4B A;  4UHO A;  2AY1 A;  4Q76 A;  4XK1 A;  1W7L A;  5HDM A;  4WYD A;  1V72 A;  3DOD A;  1ARH A;  1DJ9 A;  3FQ7 A;  3QN6 A;  3HT4 A;  4LW2 A;  4XJP A;  4DBC A;  3A2B A;  2BIA A;  2VIB A;  2CJH A;  3JTX A;  2CIN A;  2CST A;  4TV7 A;  1RVU A;  4A0F A;  2DR1 A;  1AMS A;  2HP2 A;  3E9K A;  2W7L A;  5BJ4 A;  2W7J A;  2VIA A;  5DJ9 A;  3WKR A;  4KYO A;  1ASC A;  1T3I A;  2O7C A;  1TOJ A;  3GZC A;  2YRR A;  2PB2 A;  2BIG A;  3AOV A;  3LWS A;  2EO5 A;  1M0Q A;  3F0H A;  4ZWV A;  1W7M A;  2FN6 A;  1LC5 A;  2W8U A;  5EFS A;  3H7F A;  1WYU B;  3PJ0 A;  1WYT A;  4JEY A;  3GZD C;  3VK4 A;  2CH1 A;  3UE8 A;  2HUU A;  3PPL A;  2Z9W A;  3FQ8 A;  2E54 A;  1B5P A;  1AHY A;  1RV3 A;  3DRD A;  2AEU A;  3ECD A;  3BC8 A;  2Z1Y A;  4CBS A;  4F5L A;  1J04 A;  2DGM A;  5G4J A;  1AHX A;  3VK2 A;  4ZM3 A;  3JU7 A;  4RJ0 A;  4GDY A;  3KE3 A;  1TOK A;  2OKJ A;  5E5I A;  3B1D A;  4AZK A;  1ASB A;  3AEL A;  4H51 A;  3DC1 A;  1AMR A;  1MDX A;  1JF9 A;  3PDB A;  3R4T A;  5HHY A;  1V2F A;  1KMJ A;  2Z9V A;  1WYT B;  3RBF A;  4WYC A;  2BI5 A;  2Q7W A;  3B8X A;  3UWC A;  1WST A;  2V0Y A;  4M2J A;  4OYT A;  4F5K A;  3F6T A;  3T32 A;  3ZZJ A;  2QMA A;  1S09 A;  1OHY A;  4ISY A;  1S08 A;  3H14 A;  4ZLV A;  2C81 A;  1IJI A;  1TAS A;  1O69 A;  3NNK A;  5EAV A;  5FT4 A;  2FKI A;  1YIY A;  1TPL A;  2BI9 A;  2E7I A;  2OGE A;  4PIW A;  1B8G A;  5EUN A;  2YKY A;  2CB1 A;  2BI1 A;  2ZP7 A;  2WK7 A;  4ZDP A;  1G4V A;  3PDB B;  2AY3 A;  3ZZK A;  2OQX A;  1AKB A;  1MLZ A;  2G6W A;  2YKU A;  1ARS A;  4LW4 A;  4F5J A;  3ELP A;  4WLH A;  2YHK A;  4P7Y A;  4A6U A;  3ZRQ A;  4E77 A;  3GWP A;  3AEO A;  3FVX A;  2DOU A;  3G8M A;  4ZM4 A;  4HF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...