3NNKA

Biochemical and structural characterization of a ureidoglycine aminotransferase in the klebsiella pneumoniae uric acid catabolic pathway
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
411
structure length
410
Chain Sequence
MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYDPAMTHYMNEVMALYRGVFRTENRWTMLVDGTSRAGIEAILVSAIRPGDKVLVPVFGRFGHLLCEIARRCRAEVHTIEVPWGEVFTPDQVEDAVKRIRPRLLLTVQGDTSTTMLQPLAELGEICRRYDALFYTDATASLGGNPLETDVWGLDAVSAGMQCLGGPSGTSPITLSARMEEAIRRRKCVEEGIRTDAHRDGDEEMIYSNYFDLGMVMDYWGPERLNHHTEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDLKHKMNNVLGVVIPQGINGDQARKLMLEDFGIEIGTSFGPLHGKVWRIGTMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycine-glyoxylate aminotransferase
publication title Biochemical and Structural Characterization of a Ureidoglycine Aminotransferase in the Klebsiella pneumoniae Uric Acid Catabolic Pathway.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 140
structure length 410
sequence length 411
chains with identical sequence B, C, D, E, F, G, H, J, K, L, M, O, P, R, S
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3nnkA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3nnkA02
3CBFA 2ZC0A 3HVYA 4ADDA 3W1JA 1TOKA 1YAAA 4AO9A 4JEVA 4XQ2A 3GETA 2HP1A 3MAFA 1Y4IA 2OQXA 1TASA 3EZSA 3G0TA 9AATA 4ZM3A 4M2JA 1H1CA 2JJHA 1BJ4A 4LNMA 3RBLA 3QBOA 3NYSA 5LHAA 2VGTA 3DYDA 1C9CA 3PPLA 1GBNA 1X29A 1QGNA 3AEMC 2W8WA 1AAWA 2O1BA 1BS0A 1I43A 1UU2A 2ZSMA 1AJSB 3EZ1A 3HMUA 4MKKA 4XJMA 3UAKA 1B9HA 4F5MA 1GC4A 5LH9A 1AMSA 5D5SA 3ELEA 2BYLA 2BI9A 1LC5A 1MDZA 3DXWA 2VYCA 3QPGA 4RJYA 5DX5A 2VMNA 3DR7A 4XEWA 4RLGA 3JTXA 3VK4A 2JJFA 3NUIA 2VMUA 3FZ8A 1M6SA 3E2ZA 2X5DA 1YOOA 2VMRA 4Y0DA 3CQ5A 3QN6A 5EIGA 1B9IA 1KMJA 1UU0A 1SZUA 3MADA 4JF0A 4E1OA 4ZDPA 3BCBA 5EAVA 3E6GA 2VLFA 2FNUA 2ZY4A 1C7OA 1CQ8A 3GWPA 3K40A 2BWPA 2CJDA 4DBCA 4HF8A 4ZASA 2VI8A 2WK9A 2Z9UA 3AENA 1BJWA 1S07A 1MGVA 2D65A 4ADEA 2BKWA 5E5IA 1CS1A 1Z7DA 2PO3A 1YIZA 3ELPA 4K2MA 3P6KA 4DQ6A 2ZY2A 1XI9A 2RFVA 2BI1A 2CTZA 3IF2A 1WYUB 1AMAA 1AIBA 3FKDA 3MAFB 5HXXA 3AEMA 1ASMA 3RUYA 1MLZA 2V0YA 2W7GA 1O61A 2CINA 2EPJA 3ASAA 4CXQA 1QITA 2VIAA 4I8AA 2DGKA 2R5CA 1LS3A 3B8XA 1AY5A 3FQ7A 3LVLB 1G4XA 1XEYA 1J04A 2R2NA 4OCAA 1ORDA 1WYTB 2E54A 1TARA 2YKYA 1DKAA 3G8MA 4Q75A 4U2HA 1ARSA 2X5FA 5AX8A 1D2FA 1KL2A 3NU7A 1AIAA 3B46A 3WGCA 1JS3A 2GQNA 1S0AA 1SVVA 4B98A 2X8UA 4IXSA 2FYFA 4A00A 2W7FA 3QHXA 4OBVA 2NMPA 3GR9A 4IY7A 5G09A 1WKHA 5TF5A 1ASNA 3K28A 1G7XA 1AHEA 3MKJA 3E2YA 2W8VA 1AHYA 1Z3ZA 4IX8A 4MQQA 3AATA 1BW0A 1AJSA 3TQXA 3H14A 3WKRA 4KYOA 1G7WA 5M4BA 1ZOBA 4IW7A 1GEYA 2FQ6A 4ZLVA 4IXOA 4ZDLA 4A0GA 4ZDOA 1MAQA 4J5UA 4OC9A 3KE3A 5DJ1A 3DR4A 1DFOA 5M4DA 3ATHA 2BHXA 1ASGA 4E3QA 2VMVA 4CBSA 3FDDA 4RM1A 4Y0HA 2W7JA 2QB3A 2VI9A 2VGUA 2YKVA 4WB0B 2BIAA 2CJGA 2ZJGA 2XH1A 2ZSLA 4GRXA 3FFHA 3ZRQA 3I4JA 2VGVA 5E4ZA 2JJGA 3COGA 3OP7A 4JE5D 5G0AA 4E3RA 3EI7A 2R5CB 4QGRA 4WXFA 4AZJA 3FSLA 4JEYA 4UHMA 3KKIA 4F5FA 3GZDC 1KMKA 4WD2A 5E3KA 4F5JA 1ARGA 3A9YA 1OXOA 1LW5A 1WSTA 2EZ1A 3LV2A 3FD0A 3VK2A 2D5YA 1RVUA 2BI3A 2R0TA 3RQ1A 2Z1ZA 3EI5A 3HQTA 2XBNA 3UE8A 1CJ0A 1JF9A 2DGLA 4F5LA 1WYUA 3GJUA 3B1EA 3JW9A 4Y0IA 4A6TA 3QM2A 4A0FA 1GCKA 2HORA 2OATA 1LKCA 1AKCA 4LNLA 4AOAA 3A9XA 4XJLA 1ZC9A 1TOGA 1SF2A 2VMTA 3NYUA 2ZY3A 4NOGA 3NTJA 2Z61A 3PD6B 3E2FA 2HOZA 3VP6A 4WXGA 3II0A 1AY8A 1WYTA 1YJYA 2W8TA 2HP2A 2FM1A 2D7ZA 3LVJA 3RI6A 2Z9XA 2W7IA 2YCNA 4MKJA 2CB1A 3FFRA 3WCNA 1V2FA 1KKJA 4A0HA 3TFUA 1C7NA 3ZZKA 2YHKA 2EGYA 4W5KA 4J8LA 2QBTA 3ISLA 3WZFA 4RJ0A 2O0RA 1GEXA 4Q76A 1O4SA 5C6UA 2JISA 1TOJA 4F5KA 1WYVB 2WKAA 1GEWA 1KL1A 4AZKA 3GZDA 4MSOA 4O6ZA 2HUFA 4W1WA 2VLHA 1CQ7A 4UOYA 2AATA 1FC4A 3CAIA 1DJEA 3N5MA 2C44A 1J32A 2R5EA 5DJ9A 3WX9A 5G4IA 2VIBA 3KGWA 1VP4A 3EI9A 1I41A 3P1TA 4KXKA 4P3MA 1DTYA 2VMQA 3Q8NA 2QA3A 3AV7A 4ZM4A 4ISYA 4WBTA 3QI6A 3AEJC 1ASAA 1CL2A 3GBXA 3LWSA 5EUDA 3BB8A 5K8BA 1AKAA 1IAXA 1YNUA 1N2TA 2DKBA 3LG0A 4RKDA 1SZKA 2Z67A 5EUNA 1N31A 2ZY5A 1JG8A 1IVRA 3AELA 3F9TA 4EB7A 4TMRA 4WB0A 4M2KA 1BT4A 3F0HA 4WYGA 4RKCA 4EFFA 4MY5A 1IUGA 1C4KA 1OXPA 3G7QA 3A8UX 4LC3A 4N0WA 3WGBA 2VMPA 5FT4A 1S09A 5M49A 1VEFA 3HL2A 4GSAA 2HUIA 2X3LA 2CH1A 3AOVA 1ARIA 3RCHA 1JS6A 1MDOA 2W7EA 3A9ZA 4H51A 2ORDA 4WYAA 3PAAA 4BA5A 2VMZA 4U1TA 3EIBA 4ZSWA 3NYTA 3PIUA 1M0NA 2BIGA 1M0QA 1X2AA 1QIRA 3WLXA 2HZPA 1GC3A 1X0MA 1GD9A 2YRIA 4MGRA 4A6UA 4ADCA 2ZYJA 3WY7A 3VK3A 2JGTA 1PG8A 3FVUA 3LY1A 1LC8A 2W8JA 2W7LA 3N75A 3VOMA 4BQ0A 4GDYA 4PFFA 1GC2A 3HDOA 2VGZA 1GC0A 3DXVA 2BYJA 3PD6A 1ZODA 3QGUA 3B1CA 4CXRA 1AY4A 3EUCA 3FVSA 1IAYA 5HDMA 2D66A 3N0LA 3AEJA 1D7VA 1YJZA 4GE4A 5FT6A 3ZRPA 1BKGA 1IX8A 2JG2A 4AH3A 1BJOB 2HOYA 2BI2A 1ASDA 2AY5A 2DGMA 1V2EA 3FQ8A 3E77A 3T32A 4HVKA 3CQ6A 3PJ0A 5G2PA 5BJ4A 5EFSA 1B5PA 3PDBB 5G2QA 1S08A 1W7NA 2BI5A 3K7YA 1DGDA 3R9AA 5JAYA 1AICA 3BCAA 4F4EA 3DU4A 3R4TA 5J8QA 3USFA 1WYVA 2AY3A 5BJ3A 2W8UA 2FN6A 4ZWVA 1V72A 1X28A 3MAUA 4ZWMA 1M7YA 3HT4A 1W23A 4L0OA 2CY8A 1W3UA 1SZSA 1OHWA 4Q31A 3RCHB 1TPLA 3EIAA 4ITGA 1TOIA 4ZAHA 1WKGA 3UWCA 3JWAA 4E77A 5F8VA 1MLYA 1FG3A 3MC6C 4GEBA 1S06A 2CSTA 3DC1A 3AEPA 2D61A 1AX4A 1IJIA 2D7YA 2YKUA 3HBXA 4M2MA 4OTLA 3TFTA 3BN1A 3VAXA 1AHGA 1P3WA 2JJEA 4WYEA 1AMRA 1W7MA 3L8AA 4W1VA 2W7MA 4RITA 2C7TA 1EQBA 5EAAA 2VGSA 2ZP7A 1M4NA 1LK9A 1PMOA 3CQ4A 1EJIA 3ECDA 2BWNA 1OHYA 3EI8A 2FNIA 4N0BA 4WXBA 1I48A 4FL0A 1M0OA 3FCRA 4W8IA 1PMMA 2Q7WA 3NRAA 1AJRA 5FT5A 4WYCA 2YOBA 4W1XA 1UKJA 1SPAA 3KGXA 4F5GA 2YRRA 3BS8A 3JZLA 4JE5A 3RBFA 1T3IA 1ASLA 1D7SA 4KAMA 1CQ6A 4K2IA 4PFNA 1B8GA 1VJOA 3BCXA 4BMKA 4EMYA 1C7GA 2GMUA 3BC8A 4JEXA 2Z9VA 4CBRA 1LC7A 1LW4A 4R2NA 3W1IA 2E7JA 3F6TA 4R5ZA 1ASFA 3FQAA 4F5HA 2YKXA 4RAEA 4LNJA 1RVYA 5EUEA 2C0RA 1RV4A 3NX3A 1BQAA 3MC6A 1OATA 1CL1A 4JEZA 3MEBA 3ASBA 1BJOA 4WLJA 1DGEA 2WK7A 1AAMA 2PB0A 1TOEA 1B5OA 2BIEA 2CJHA 1H0CA 3PDBA 4EU1A 3FZ7A 3AEOA 4IYOB 3E9KA 2OKJA 3DODA 3LVKA 3M5UA 3A2BA 1MDXA 3FZ6A 1QJ5A 4TN4A 3BV0A 1BQDA 1DJ9A 1UU1A 4ATPA 4ZSYA 2CANA 1SFFA 2OGEA 4K2BA 2HOXA 4EB5A 1ARTA 3FDBA 3NUBA 1I29A 4XJPA 4MQPA 3ACZA 4B9BA 3BWOA 4CVQA 2AY2A 1KKPA 2F8JA 3HLMA 1RV3A 2AY8A 1O62A 4W91A 4Q6RA 4UHNA 1M32A 1MAPA 4A0RA 1YJSA 2DOUA 3BWNC 4R5FA 1ASBA 2Z1YA 3NDNA 4XK1A 5EQCA 5HHYA 5I92A 1OHVA 4AO4A 2VMWA 4PIWA 1D7RA 4BA4A 4JEWA 3PDXA 2EO5A 2GMSA 3WCOA 1ASEA 1E5FA 2V1PA 2TPLA 2GB3A 4UQVA 1ARHA 3NNKA 2OKKA 4XAUA 2BWOA 1IX6A 2YCTA 1YIYA 4JF1A 2G6WA 4OYTA 2C81A 2W7DA 3DRDA 3AOWA 1ELUA 4WYDA 2YCPA 5G4JA 4BHDA 4TV7A 2Z9WA 2AY1A 4LW2A 1EG5A 2QLRA 1FG7A 5FT8A 2OGAA 4UHOA 4ADBA 1O69A 4LW4A 1D7UA 3JU7A 3NU8A 3GSBA 1AHXA 1ECXA 2VMOA 3FRKA 4OBUA 1ASCA 2GSAA 1IBJA 1N8PA 3E2ZB 5EIGB 3D6KA 3IHJA 3ZRRA 2E7IA 4FFCA 2W7HA 4XJOA 4P7YA 2E7UA 2VMYA 3I5TA 3MBBA 4A72A 2AY6A 5D95A 4A6RA 5M46A 2AEUA 1G4VA 4WLHA 1IX7A 4GE9A 2PB2A 2ZUKA 2AEVA 2CH2A 3BWNA 2QB2A 3FTBA 1E5EA 1U08A 2DKJA 1TATA 3FVXA 4RIZA 3AENB 7AATA 3TCMA 3GZCA 3WKSA 3B1DA 3L44A 5DB5A 5IWQA 1M0PA 2EZ2A 5F9SA 1QZ9A 1AMQA 3TATA 2CFBA 2AY9A 1AHFA 1V2DA 2D64A 4IYOA 2HUUA 4WYFA 4PVFA 3LVMA 2VMSA 1CZCA 2W7KA 2QMAA 2D63A 8AATA 2O7CA 2DR1A 3PGYA 4MQRA 2VMXA 4ITXA 1CZEA 1QJ3A 3W1HA 3EI6A 4ATQA 1AKBA 4OMAA 4R8DA 3DZZA 1QISA 4OT8A 4F5IA 2VGWA 4WP0A 3ZZJA 2AY4A 3OKSA 2AY7A 3H7FA 3I16A 2EH6A 1DJUA 1ELQA 1GDEA 1PFFA 2WK8A 4IXZA 1B4XA 4DGTA 1BJNA 1W7LA 1C0NA 3PA9A 3JWBA 4GE7A 2Z20A
chains in the Genus database with same CATH superfamily
3CBFA 2ZC0A 3HVYA 4ADDA 3W1JA 1TOKA 1YAAA 4AO9A 4JEVA 4XQ2A 3GETA 2HP1A 3MAFA 1Y4IA 2OQXA 1TASA 3EZSA 3G0TA 9AATA 4ZM3A 4M2JA 1H1CA 2JJHA 1BJ4A 4LNMA 3RBLA 3QBOA 3NYSA 5LHAA 2G7JA 2VGTA 3DYDA 1C9CA 3PPLA 1GBNA 1X29A 1QGNA 3AEMC 2W8WA 1AAWA 2O1BA 1BS0A 1I43A 1UU2A 2ZSMA 1AJSB 3EZ1A 3HMUA 4MKKA 4XJMA 3UAKA 1B9HA 4F5MA 1GC4A 5LH9A 1AMSA 5D5SA 3ELEA 2BYLA 2BI9A 1LC5A 1MDZA 3DXWA 2VYCA 3QPGA 4RJYA 5DX5A 2VMNA 3DR7A 4XEWA 4RLGA 3JTXA 3VK4A 2JJFA 3NUIA 2VMUA 3FZ8A 1M6SA 3E2ZA 2X5DA 1YOOA 2VMRA 4Y0DA 3CQ5A 3QN6A 5EIGA 1B9IA 1KMJA 1UU0A 1SZUA 3MADA 4JF0A 4E1OA 4ZDPA 3BCBA 5EAVA 3E6GA 2VLFA 2FNUA 2ZY4A 1C7OA 1CQ8A 3GWPA 3K40A 2BWPA 2CJDA 4DBCA 4HF8A 4ZASA 2VI8A 2WK9A 2Z9UA 3AENA 1BJWA 1S07A 1MGVA 2D65A 4ADEA 2BKWA 5E5IA 1CS1A 1Z7DA 2PO3A 1YIZA 3ELPA 4K2MA 3P6KA 4DQ6A 2ZY2A 1XI9A 2RFVA 2BI1A 2CTZA 3IF2A 1WYUB 1AMAA 1AIBA 3FKDA 3MAFB 5HXXA 3AEMA 1ASMA 3RUYA 1MLZA 2V0YA 2W7GA 1O61A 2CINA 2EPJA 3ASAA 4CXQA 1QITA 2VIAA 4I8AA 2DGKA 2R5CA 1LS3A 3B8XA 1AY5A 3FQ7A 3LVLB 1G4XA 1XEYA 1J04A 2R2NA 4OCAA 1ORDA 1WYTB 2E54A 1TARA 2YKYA 1DKAA 3G8MA 4Q75A 4U2HA 1ARSA 2X5FA 5AX8A 1D2FA 1KL2A 3NU7A 1AIAA 3B46A 3WGCA 1JS3A 2GQNA 1S0AA 1SVVA 4B98A 2X8UA 4IXSA 2FYFA 4A00A 2W7FA 3QHXA 4OBVA 2NMPA 3GR9A 4IY7A 5G09A 1WKHA 5TF5A 1ASNA 3K28A 1G7XA 1AHEA 3MKJA 3E2YA 2W8VA 1AHYA 1Z3ZA 4IX8A 4MQQA 3AATA 1BW0A 1AJSA 3TQXA 3H14A 3WKRA 4KYOA 1G7WA 5M4BA 1ZOBA 4IW7A 1GEYA 2FQ6A 4ZLVA 4IXOA 4ZDLA 4A0GA 4ZDOA 1MAQA 4J5UA 4OC9A 3KE3A 5DJ1A 3DR4A 1DFOA 5M4DA 3ATHA 2BHXA 1ASGA 4E3QA 2VMVA 4CBSA 3FDDA 4RM1A 4Y0HA 2W7JA 2QB3A 2VI9A 2VGUA 2YKVA 4WB0B 2BIAA 2CJGA 2ZJGA 2XH1A 2ZSLA 4GRXA 3FFHA 3ZRQA 3I4JA 2VGVA 5E4ZA 2JJGA 3COGA 3OP7A 4JE5D 5G0AA 4E3RA 3EI7A 2R5CB 4QGRA 4WXFA 4AZJA 3FSLA 4JEYA 4UHMA 3KKIA 4F5FA 3GZDC 1KMKA 4WD2A 5E3KA 4F5JA 1ARGA 3A9YA 1OXOA 1LW5A 1WSTA 2EZ1A 3LV2A 3FD0A 3VK2A 2D5YA 1RVUA 2BI3A 2R0TA 3RQ1A 2Z1ZA 3EI5A 3HQTA 2XBNA 3UE8A 1CJ0A 1JF9A 2DGLA 4F5LA 1WYUA 3GJUA 3B1EA 3JW9A 4Y0IA 4A6TA 3QM2A 4A0FA 1GCKA 2HORA 2OATA 1LKCA 1AKCA 4LNLA 4AOAA 3A9XA 4XJLA 1ZC9A 1TOGA 1SF2A 2VMTA 3NYUA 2ZY3A 4NOGA 3NTJA 2Z61A 3PD6B 3E2FA 2HOZA 3VP6A 4WXGA 3II0A 1AY8A 1WYTA 1YJYA 1KAFA 2W8TA 2HP2A 2FM1A 2D7ZA 3LVJA 3RI6A 2Z9XA 2W7IA 2YCNA 4MKJA 2CB1A 3FFRA 3WCNA 1V2FA 1KKJA 4A0HA 3TFUA 1C7NA 3ZZKA 2YHKA 2EGYA 4W5KA 4J8LA 2QBTA 3ISLA 3WZFA 4RJ0A 2O0RA 1GEXA 4Q76A 1O4SA 5C6UA 2JISA 1TOJA 4F5KA 1WYVB 2WKAA 1GEWA 1KL1A 4AZKA 3GZDA 4MSOA 4O6ZA 2HUFA 4W1WA 2VLHA 1CQ7A 4UOYA 2AATA 1FC4A 3CAIA 1DJEA 3N5MA 2C44A 1J32A 2R5EA 5DJ9A 3WX9A 5G4IA 2VIBA 3KGWA 1VP4A 3EI9A 1I41A 3P1TA 4KXKA 4P3MA 1DTYA 2VMQA 3Q8NA 2QA3A 3AV7A 4ZM4A 3N7NA 4ISYA 4WBTA 3QI6A 3AEJC 1ASAA 1CL2A 3GBXA 3LWSA 5EUDA 3BB8A 5K8BA 1AKAA 1IAXA 1YNUA 1N2TA 2DKBA 3LG0A 4RKDA 1SZKA 2Z67A 5EUNA 1N31A 2ZY5A 1JG8A 1IVRA 3AELA 3F9TA 4EB7A 4TMRA 4WB0A 4M2KA 1BT4A 3F0HA 4WYGA 4RKCA 2EYQA 2QSRA 4EFFA 4MY5A 1IUGA 1C4KA 1OXPA 3G7QA 3A8UX 4LC3A 4N0WA 3WGBA 2VMPA 5FT4A 1S09A 5M49A 1VEFA 3HL2A 4GSAA 2HUIA 2X3LA 2CH1A 3AOVA 1ARIA 3RCHA 1JS6A 1MDOA 2W7EA 3A9ZA 4H51A 2ORDA 4WYAA 3PAAA 4BA5A 2VMZA 4U1TA 3EIBA 4ZSWA 3NYTA 3PIUA 1M0NA 2BIGA 1M0QA 1X2AA 1QIRA 3WLXA 2HZPA 1GC3A 1X0MA 1GD9A 2YRIA 4MGRA 4A6UA 4ADCA 2ZYJA 3WY7A 2FKIA 3VK3A 2JGTA 1PG8A 3FVUA 3LY1A 1LC8A 2W8JA 2W7LA 3N75A 3VOMA 4BQ0A 4GDYA 4PFFA 1GC2A 3HDOA 2VGZA 1GC0A 3DXVA 2BYJA 3PD6A 1ZODA 3QGUA 3B1CA 4CXRA 1AY4A 4H63Q 3EUCA 3FVSA 1IAYA 5HDMA 2D66A 3N0LA 3AEJA 1D7VA 1YJZA 4GE4A 5FT6A 2WB6A 3ZRPA 1BKGA 1IX8A 2JG2A 4AH3A 1BJOB 2HOYA 2BI2A 1ASDA 2AY5A 2DGMA 1V2EA 3FQ8A 3E77A 3T32A 4HVKA 3CQ6A 3PJ0A 5G2PA 5BJ4A 5EFSA 1B5PA 3PDBB 5G2QA 1S08A 1W7NA 2BI5A 3K7YA 1DGDA 3R9AA 5JAYA 1AICA 3BCAA 4F4EA 3DU4A 3R4TA 5J8QA 3USFA 1WYVA 2AY3A 5BJ3A 2W8UA 2FN6A 4ZWVA 1V72A 2KFPA 1X28A 3MAUA 4ZWMA 3N4RA 1M7YA 3HT4A 1W23A 4L0OA 2CY8A 1W3UA 1SZSA 1OHWA 4Q31A 3RCHB 1TPLA 3EIAA 4ITGA 1TOIA 4ZAHA 1WKGA 3UWCA 3JWAA 4E77A 5F8VA 1MLYA 1FG3A 3MC6C 4GEBA 1S06A 2CSTA 3DC1A 3AEPA 2D61A 1AX4A 1IJIA 2D7YA 2YKUA 3HBXA 4M2MA 4OTLA 3TFTA 3BN1A 3VAXA 1AHGA 1P3WA 2JJEA 4WYEA 1AMRA 1W7MA 3L8AA 4W1VA 2W7MA 4RITA 2C7TA 1EQBA 5EAAA 2VGSA 2ZP7A 1M4NA 1LK9A 1PMOA 3CQ4A 1EJIA 3ECDA 2BWNA 1OHYA 3EI8A 2FNIA 4N0BA 4WXBA 1I48A 4FL0A 1M0OA 3FCRA 4W8IA 1PMMA 2Q7WA 3NRAA 1AJRA 5FT5A 4WYCA 2YOBA 4W1XA 1UKJA 1SPAA 3KGXA 4F5GA 2YRRA 3BS8A 3JZLA 4JE5A 3RBFA 1T3IA 1ASLA 1D7SA 4KAMA 1CQ6A 4K2IA 4PFNA 1B8GA 1VJOA 3BCXA 4BMKA 4EMYA 1C7GA 2GMUA 3BC8A 4JEXA 2Z9VA 4CBRA 1LC7A 1LW4A 4R2NA 3W1IA 2E7JA 3F6TA 4R5ZA 1ASFA 3FQAA 4F5HA 2YKXA 4RAEA 4LNJA 1RVYA 5EUEA 2C0RA 1RV4A 3NX3A 1BQAA 3MC6A 1OATA 1CL1A 4JEZA 3MEBA 3ASBA 1BJOA 4WLJA 5KTBA 1DGEA 2WK7A 1AAMA 2PB0A 4K05A 1TOEA 1B5OA 2BIEA 2CJHA 1H0CA 3PDBA 4EU1A 3FZ7A 3AEOA 4IYOB 3E9KA 2OKJA 3DODA 3LVKA 3M5UA 3A2BA 1MDXA 3FZ6A 1QJ5A 4TN4A 3BV0A 1BQDA 1DJ9A 1UU1A 4ATPA 4ZSYA 2CANA 1SFFA 2OGEA 4K2BA 2HOXA 4EB5A 1ARTA 3FDBA 3NUBA 1I29A 4XJPA 4MQPA 3ACZA 4B9BA 3BWOA 4CVQA 2AY2A 1KKPA 2F8JA 3HLMA 1RV3A 2AY8A 1O62A 4W91A 4Q6RA 4UHNA 3N4XA 1M32A 1MAPA 4A0RA 1YJSA 2DOUA 3BWNC 4R5FA 3H9XA 1ASBA 2Z1YA 3NDNA 4XK1A 5EQCA 5HHYA 5I92A 1OHVA 4AO4A 2VMWA 4PIWA 1D7RA 4BA4A 3N4SA 4JEWA 3PDXA 2EO5A 2GMSA 3WCOA 1ASEA 1E5FA 2V1PA 2TPLA 2GB3A 4UQVA 1ARHA 3NNKA 2OKKA 4XAUA 2BWOA 1IX6A 2YCTA 1YIYA 4JF1A 2G6WA 4OYTA 2C81A 2W7DA 3DRDA 3AOWA 1ELUA 4WYDA 2YCPA 5G4JA 4BHDA 4TV7A 2Z9WA 2AY1A 4LW2A 1EG5A 2A1VA 2QLRA 1FG7A 5FT8A 2OGAA 4UHOA 4ADBA 1O69A 4LW4A 1D7UA 3JU7A 3NU8A 3GSBA 1AHXA 1ECXA 2VMOA 3FRKA 4OBUA 1ASCA 2GSAA 1IBJA 1N8PA 3E2ZB 5EIGB 3D6KA 3IHJA 3ZRRA 2E7IA 4FFCA 2W7HA 4XJOA 4P7YA 2E7UA 2VMYA 3I5TA 3MBBA 4A72A 2AY6A 5D95A 4A6RA 5M46A 2AEUA 1G4VA 4WLHA 1IX7A 4GE9A 2PB2A 2ZUKA 2AEVA 2CH2A 3BWNA 2QB2A 3FTBA 1E5EA 1U08A 2DKJA 1TATA 3FVXA 4RIZA 3AENB 7AATA 3TCMA 3GZCA 3WKSA 3B1DA 3L44A 5DB5A 5IWQA 1M0PA 2EZ2A 5F9SA 1QZ9A 1AMQA 3TATA 2CFBA 2AY9A 1AHFA 1V2DA 2D64A 4IYOA 2HUUA 4WYFA 4PVFA 3LVMA 2VMSA 1CZCA 2W7KA 2QMAA 2D63A 8AATA 2O7CA 2DR1A 3PGYA 4MQRA 2VMXA 4ITXA 1CZEA 1QJ3A 3W1HA 3EI6A 4ATQA 1AKBA 4OMAA 4R8DA 3DZZA 1QISA 4OT8A 4F5IA 2VGWA 4WP0A 3ZZJA 2AY4A 3OKSA 2AY7A 3H7FA 3I16A 2EH6A 1DJUA 1ELQA 1GDEA 1PFFA 2WK8A 4IXZA 1B4XA 4DGTA 1BJNA 1W7LA 1C0NA 3PA9A 3JWBA 4GE7A 2Z20A
chains in the Genus database with same CATH topology
3CBFA 2ZC0A 3HVYA 4ADDA 3W1JA 1TOKA 1YAAA 4AO9A 4JEVA 4XQ2A 3GETA 2HP1A 3MAFA 1Y4IA 2OQXA 1TASA 3EZSA 3G0TA 9AATA 4ZM3A 4M2JA 1H1CA 2JJHA 1BJ4A 4LNMA 3RBLA 3QBOA 3NYSA 5LHAA 2G7JA 2VGTA 3DYDA 1C9CA 3PPLA 1GBNA 1X29A 1QGNA 3AEMC 2W8WA 1AAWA 2O1BA 1BS0A 1I43A 1UU2A 2ZSMA 1AJSB 3EZ1A 3HMUA 4MKKA 4XJMA 3UAKA 1B9HA 4F5MA 1GC4A 5LH9A 1AMSA 5D5SA 3ELEA 2BYLA 2BI9A 1LC5A 1MDZA 3DXWA 2VYCA 3QPGA 4RJYA 5DX5A 2VMNA 3DR7A 4XEWA 4RLGA 3JTXA 3VK4A 2JJFA 3NUIA 2VMUA 3FZ8A 1M6SA 3E2ZA 2X5DA 1YOOA 2VMRA 4Y0DA 3CQ5A 3QN6A 5EIGA 1B9IA 1KMJA 1UU0A 1SZUA 3MADA 4JF0A 4E1OA 4ZDPA 3BCBA 5EAVA 3E6GA 2VLFA 2FNUA 2ZY4A 1C7OA 1CQ8A 3GWPA 3K40A 2BWPA 2CJDA 4DBCA 4HF8A 4ZASA 2VI8A 2WK9A 2Z9UA 3AENA 1BJWA 1S07A 1MGVA 2D65A 4ADEA 2BKWA 5E5IA 1CS1A 1Z7DA 2PO3A 1YIZA 3ELPA 4K2MA 3P6KA 4DQ6A 2ZY2A 1XI9A 2RFVA 2BI1A 2CTZA 3IF2A 1WYUB 1AMAA 1AIBA 3FKDA 3MAFB 5HXXA 3AEMA 1ASMA 3RUYA 1MLZA 2V0YA 2W7GA 1O61A 2CINA 2EPJA 3ASAA 4CXQA 1QITA 2VIAA 4I8AA 2DGKA 2R5CA 1LS3A 3B8XA 1AY5A 3FQ7A 3LVLB 1G4XA 1XEYA 1J04A 2R2NA 4OCAA 1ORDA 1WYTB 2E54A 1TARA 2YKYA 1DKAA 3G8MA 4Q75A 4U2HA 1ARSA 2X5FA 5AX8A 1D2FA 1KL2A 3NU7A 1AIAA 3B46A 3WGCA 1JS3A 2GQNA 1S0AA 1SVVA 4B98A 2X8UA 4IXSA 2FYFA 4A00A 2W7FA 3QHXA 4OBVA 2NMPA 3GR9A 4IY7A 5G09A 1WKHA 5TF5A 1ASNA 3K28A 1G7XA 1AHEA 3MKJA 3E2YA 2W8VA 1AHYA 1Z3ZA 4IX8A 4MQQA 3AATA 1BW0A 1AJSA 3TQXA 3H14A 3WKRA 4KYOA 1G7WA 5M4BA 1ZOBA 4IW7A 1GEYA 2FQ6A 4ZLVA 4IXOA 4ZDLA 4A0GA 4ZDOA 1MAQA 4J5UA 4OC9A 3KE3A 5DJ1A 3DR4A 1DFOA 5M4DA 3ATHA 2BHXA 1ASGA 4E3QA 2VMVA 4CBSA 3FDDA 4RM1A 4Y0HA 2W7JA 2QB3A 2VI9A 2VGUA 2YKVA 4WB0B 2BIAA 2CJGA 2ZJGA 2XH1A 2ZSLA 4GRXA 3FFHA 3ZRQA 3I4JA 2VGVA 5E4ZA 2JJGA 3COGA 3OP7A 4JE5D 5G0AA 4E3RA 3EI7A 2R5CB 4QGRA 4WXFA 4AZJA 3FSLA 4JEYA 4UHMA 3KKIA 4F5FA 3GZDC 1KMKA 4WD2A 5E3KA 4F5JA 1ARGA 3A9YA 1OXOA 1LW5A 1WSTA 2EZ1A 3LV2A 3FD0A 3VK2A 2D5YA 1RVUA 2BI3A 2R0TA 3RQ1A 2Z1ZA 3EI5A 3HQTA 2XBNA 3UE8A 1CJ0A 1JF9A 2DGLA 4F5LA 1WYUA 3GJUA 3B1EA 3JW9A 4Y0IA 4A6TA 3QM2A 4A0FA 1GCKA 2HORA 2OATA 1LKCA 1AKCA 4LNLA 4AOAA 3A9XA 4XJLA 1ZC9A 1TOGA 1SF2A 2VMTA 3NYUA 2ZY3A 4NOGA 3NTJA 2Z61A 3PD6B 3E2FA 2HOZA 3VP6A 4WXGA 3II0A 1AY8A 1WYTA 1YJYA 2W8TA 2HP2A 2FM1A 2D7ZA 3LVJA 3RI6A 2Z9XA 2W7IA 2YCNA 4MKJA 2CB1A 3FFRA 3WCNA 1V2FA 1KKJA 4A0HA 3TFUA 1C7NA 3ZZKA 2YHKA 2EGYA 4W5KA 4J8LA 2QBTA 3ISLA 3WZFA 4RJ0A 2O0RA 1GEXA 4Q76A 1O4SA 5C6UA 2JISA 1TOJA 4F5KA 1WYVB 2WKAA 1GEWA 1KL1A 4AZKA 3GZDA 4MSOA 4O6ZA 2HUFA 4W1WA 2VLHA 1CQ7A 4UOYA 2AATA 1FC4A 3CAIA 1DJEA 3N5MA 2C44A 1J32A 2R5EA 5DJ9A 3WX9A 5G4IA 2VIBA 3KGWA 1VP4A 3EI9A 1I41A 3P1TA 4KXKA 4P3MA 1DTYA 2VMQA 3Q8NA 2QA3A 3AV7A 4ZM4A 3N7NA 4ISYA 4WBTA 3QI6A 3AEJC 1ASAA 1CL2A 3GBXA 3LWSA 5EUDA 3BB8A 5K8BA 1AKAA 1IAXA 1YNUA 1N2TA 2DKBA 3LG0A 4RKDA 1SZKA 2Z67A 5EUNA 1N31A 2ZY5A 1JG8A 1IVRA 3AELA 3F9TA 4EB7A 4TMRA 4WB0A 4M2KA 1BT4A 3F0HA 4WYGA 4RKCA 2EYQA 2QSRA 4EFFA 4MY5A 1IUGA 1C4KA 1OXPA 3G7QA 3A8UX 4LC3A 4N0WA 3WGBA 2VMPA 5FT4A 1S09A 5M49A 1VEFA 3HL2A 4GSAA 2HUIA 2X3LA 2CH1A 3AOVA 1ARIA 3RCHA 1JS6A 1MDOA 2W7EA 3A9ZA 4H51A 2ORDA 4WYAA 3PAAA 4BA5A 2VMZA 4U1TA 3EIBA 4ZSWA 3NYTA 3PIUA 1M0NA 2BIGA 1M0QA 1X2AA 1QIRA 3WLXA 2HZPA 1GC3A 1X0MA 1GD9A 2YRIA 4MGRA 4A6UA 4ADCA 2ZYJA 3WY7A 2FKIA 3VK3A 2JGTA 1PG8A 3FVUA 3LY1A 1LC8A 2W8JA 2W7LA 3N75A 3VOMA 4BQ0A 4GDYA 4PFFA 1GC2A 3HDOA 2VGZA 1GC0A 3DXVA 2BYJA 3PD6A 1ZODA 3QGUA 3B1CA 4CXRA 1AY4A 4H63Q 3EUCA 3FVSA 1IAYA 5HDMA 2D66A 3N0LA 3AEJA 1D7VA 1YJZA 4GE4A 5FT6A 2WB6A 3ZRPA 1BKGA 1IX8A 2JG2A 4AH3A 1BJOB 2HOYA 2BI2A 1ASDA 2AY5A 2DGMA 1V2EA 3FQ8A 3E77A 3T32A 4HVKA 3CQ6A 3PJ0A 5G2PA 5BJ4A 5EFSA 1B5PA 3PDBB 5G2QA 1S08A 1W7NA 2BI5A 3K7YA 1DGDA 3R9AA 5JAYA 1AICA 3BCAA 4F4EA 3DU4A 3R4TA 5J8QA 3USFA 1WYVA 2AY3A 5BJ3A 2W8UA 2FN6A 4ZWVA 1V72A 2KFPA 1X28A 3MAUA 4ZWMA 3N4RA 1M7YA 3HT4A 1W23A 4L0OA 2CY8A 1W3UA 1SZSA 1OHWA 4Q31A 3RCHB 1TPLA 3EIAA 4ITGA 1TOIA 4ZAHA 1WKGA 3UWCA 3JWAA 4E77A 5F8VA 1MLYA 1FG3A 3MC6C 4GEBA 1S06A 2CSTA 3DC1A 3AEPA 2D61A 1AX4A 1IJIA 2D7YA 2YKUA 3HBXA 4M2MA 4OTLA 3TFTA 3BN1A 3VAXA 1AHGA 1P3WA 2JJEA 4WYEA 1AMRA 1W7MA 3L8AA 4W1VA 2W7MA 4RITA 2C7TA 1EQBA 5EAAA 2VGSA 2ZP7A 1M4NA 1LK9A 1PMOA 3CQ4A 1EJIA 3ECDA 2BWNA 1OHYA 3EI8A 2FNIA 4N0BA 4WXBA 1I48A 4FL0A 1M0OA 3FCRA 4W8IA 1PMMA 2Q7WA 3NRAA 1AJRA 5FT5A 4WYCA 2YOBA 4W1XA 1UKJA 1SPAA 3KGXA 4F5GA 2YRRA 3BS8A 3JZLA 4JE5A 3RBFA 1T3IA 1ASLA 1D7SA 4KAMA 1CQ6A 4K2IA 4PFNA 1B8GA 1VJOA 3BCXA 4BMKA 4EMYA 1C7GA 2GMUA 3BC8A 4JEXA 2Z9VA 4CBRA 1LC7A 1LW4A 4R2NA 3W1IA 2E7JA 3F6TA 4R5ZA 1ASFA 3FQAA 4F5HA 2YKXA 4RAEA 4LNJA 1RVYA 5EUEA 2C0RA 1RV4A 3NX3A 1BQAA 3MC6A 1OATA 1CL1A 4JEZA 3MEBA 3ASBA 1BJOA 4WLJA 5KTBA 1DGEA 2WK7A 1AAMA 2PB0A 4K05A 1TOEA 1B5OA 2BIEA 2CJHA 1H0CA 3PDBA 4EU1A 3FZ7A 3AEOA 4IYOB 3E9KA 2OKJA 3DODA 3LVKA 3M5UA 3A2BA 1MDXA 3FZ6A 1QJ5A 4TN4A 3BV0A 1BQDA 1DJ9A 1UU1A 4ATPA 4ZSYA 2CANA 1SFFA 2OGEA 4K2BA 2HOXA 4EB5A 1ARTA 3FDBA 3NUBA 1I29A 4XJPA 4MQPA 3ACZA 4B9BA 3BWOA 4CVQA 2AY2A 1KKPA 2F8JA 3HLMA 1RV3A 2AY8A 1O62A 4W91A 4Q6RA 4UHNA 3N4XA 1M32A 1MAPA 4A0RA 1YJSA 2DOUA 3BWNC 4R5FA 3H9XA 1ASBA 2Z1YA 3NDNA 4XK1A 5EQCA 5HHYA 5I92A 1OHVA 4AO4A 2VMWA 4PIWA 1D7RA 4BA4A 3N4SA 4JEWA 3PDXA 2EO5A 2GMSA 3WCOA 1ASEA 1E5FA 2V1PA 2TPLA 2GB3A 4UQVA 1ARHA 3NNKA 2OKKA 4XAUA 2BWOA 1IX6A 2YCTA 1YIYA 4JF1A 2G6WA 4OYTA 2C81A 2W7DA 3DRDA 3AOWA 1ELUA 4WYDA 2YCPA 5G4JA 4BHDA 4TV7A 2Z9WA 2AY1A 4LW2A 1EG5A 2A1VA 2QLRA 1FG7A 5FT8A 2OGAA 4UHOA 4ADBA 1O69A 4LW4A 1D7UA 3JU7A 3NU8A 3GSBA 1AHXA 1ECXA 2VMOA 3FRKA 4OBUA 1ASCA 2GSAA 1IBJA 1N8PA 3E2ZB 5EIGB 3D6KA 3IHJA 3ZRRA 2E7IA 4FFCA 2W7HA 4XJOA 4P7YA 2E7UA 2VMYA 3I5TA 3MBBA 4A72A 2AY6A 5D95A 4A6RA 5M46A 2AEUA 1G4VA 4WLHA 1IX7A 4GE9A 2PB2A 2ZUKA 2AEVA 2CH2A 3BWNA 2QB2A 3FTBA 1E5EA 1U08A 2DKJA 1TATA 3FVXA 4RIZA 3AENB 7AATA 3TCMA 3GZCA 3WKSA 3B1DA 3L44A 5DB5A 5IWQA 1M0PA 2EZ2A 5F9SA 1QZ9A 1AMQA 3TATA 2CFBA 2AY9A 1AHFA 1V2DA 2D64A 4IYOA 2HUUA 4WYFA 4PVFA 3LVMA 2VMSA 1CZCA 2W7KA 2QMAA 2D63A 8AATA 2O7CA 2DR1A 3PGYA 4MQRA 2VMXA 4ITXA 1CZEA 1QJ3A 3W1HA 3EI6A 4ATQA 1AKBA 4OMAA 4R8DA 3DZZA 1QISA 4OT8A 4F5IA 2VGWA 4WP0A 3ZZJA 2AY4A 3OKSA 2AY7A 3H7FA 3I16A 2EH6A 1DJUA 1ELQA 1GDEA 1PFFA 2WK8A 4IXZA 1B4XA 4DGTA 1BJNA 1W7LA 1C0NA 3PA9A 3JWBA 4GE7A 2Z20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBF A;  2ZC0 A;  3HVY A;  4ADD A;  3W1J A;  1TOK A;  1YAA A;  4AO9 A;  4JEV A;  4XQ2 A;  3GET A;  2HP1 A;  3MAF A;  1Y4I A;  2OQX A;  1TAS A;  3EZS A;  3G0T A;  9AAT A;  4ZM3 A;  4M2J A;  1H1C A;  2JJH A;  1BJ4 A;  4LNM A;  3RBL A;  3QBO A;  3NYS A;  5LHA A;  2VGT A;  3DYD A;  1C9C A;  3PPL A;  1GBN A;  1X29 A;  1QGN A;  3AEM C;  2W8W A;  1AAW A;  2O1B A;  1BS0 A;  1I43 A;  1UU2 A;  2ZSM A;  1AJS B;  3EZ1 A;  3HMU A;  4MKK A;  4XJM A;  3UAK A;  1B9H A;  4F5M A;  1GC4 A;  5LH9 A;  1AMS A;  5D5S A;  3ELE A;  2BYL A;  2BI9 A;  1LC5 A;  1MDZ A;  3DXW A;  2VYC A;  3QPG A;  4RJY A;  5DX5 A;  2VMN A;  3DR7 A;  4XEW A;  4RLG A;  3JTX A;  3VK4 A;  2JJF A;  3NUI A;  2VMU A;  3FZ8 A;  1M6S A;  3E2Z A;  2X5D A;  1YOO A;  2VMR A;  4Y0D A;  3CQ5 A;  3QN6 A;  5EIG A;  1B9I A;  1KMJ A;  1UU0 A;  1SZU A;  3MAD A;  4JF0 A;  4E1O A;  4ZDP A;  3BCB A;  5EAV A;  3E6G A;  2VLF A;  2FNU A;  2ZY4 A;  1C7O A;  1CQ8 A;  3GWP A;  3K40 A;  2BWP A;  2CJD A;  4DBC A;  4HF8 A;  4ZAS A;  2VI8 A;  2WK9 A;  2Z9U A;  3AEN A;  1BJW A;  1S07 A;  1MGV A;  2D65 A;  4ADE A;  2BKW A;  5E5I A;  1CS1 A;  1Z7D A;  2PO3 A;  1YIZ A;  3ELP A;  4K2M A;  3P6K A;  4DQ6 A;  2ZY2 A;  1XI9 A;  2RFV A;  2BI1 A;  2CTZ A;  3IF2 A;  1WYU B;  1AMA A;  1AIB A;  3FKD A;  3MAF B;  5HXX A;  3AEM A;  1ASM A;  3RUY A;  1MLZ A;  2V0Y A;  2W7G A;  1O61 A;  2CIN A;  2EPJ A;  3ASA A;  4CXQ A;  1QIT A;  2VIA A;  4I8A A;  2DGK A;  2R5C A;  1LS3 A;  3B8X A;  1AY5 A;  3FQ7 A;  3LVL B;  1G4X A;  1XEY A;  1J04 A;  2R2N A;  4OCA A;  1ORD A;  1WYT B;  2E54 A;  1TAR A;  2YKY A;  1DKA A;  3G8M A;  4Q75 A;  4U2H A;  1ARS A;  2X5F A;  5AX8 A;  1D2F A;  1KL2 A;  3NU7 A;  1AIA A;  3B46 A;  3WGC A;  1JS3 A;  2GQN A;  1S0A A;  1SVV A;  4B98 A;  2X8U A;  4IXS A;  2FYF A;  4A00 A;  2W7F A;  3QHX A;  4OBV A;  2NMP A;  3GR9 A;  4IY7 A;  5G09 A;  1WKH A;  5TF5 A;  1ASN A;  3K28 A;  1G7X A;  1AHE A;  3MKJ A;  3E2Y A;  2W8V A;  1AHY A;  1Z3Z A;  4IX8 A;  4MQQ A;  3AAT A;  1BW0 A;  1AJS A;  3TQX A;  3H14 A;  3WKR A;  4KYO A;  1G7W A;  5M4B A;  1ZOB A;  4IW7 A;  1GEY A;  2FQ6 A;  4ZLV A;  4IXO A;  4ZDL A;  4A0G A;  4ZDO A;  1MAQ A;  4J5U A;  4OC9 A;  3KE3 A;  5DJ1 A;  3DR4 A;  1DFO A;  5M4D A;  3ATH A;  2BHX A;  1ASG A;  4E3Q A;  2VMV A;  4CBS A;  3FDD A;  4RM1 A;  4Y0H A;  2W7J A;  2QB3 A;  2VI9 A;  2VGU A;  2YKV A;  4WB0 B;  2BIA A;  2CJG A;  2ZJG A;  2XH1 A;  2ZSL A;  4GRX A;  3FFH A;  3ZRQ A;  3I4J A;  2VGV A;  5E4Z A;  2JJG A;  3COG A;  3OP7 A;  4JE5 D;  5G0A A;  4E3R A;  3EI7 A;  2R5C B;  4QGR A;  4WXF A;  4AZJ A;  3FSL A;  4JEY A;  4UHM A;  3KKI A;  4F5F A;  3GZD C;  1KMK A;  4WD2 A;  5E3K A;  4F5J A;  1ARG A;  3A9Y A;  1OXO A;  1LW5 A;  1WST A;  2EZ1 A;  3LV2 A;  3FD0 A;  3VK2 A;  2D5Y A;  1RVU A;  2BI3 A;  2R0T A;  3RQ1 A;  2Z1Z A;  3EI5 A;  3HQT A;  2XBN A;  3UE8 A;  1CJ0 A;  1JF9 A;  2DGL A;  4F5L A;  1WYU A;  3GJU A;  3B1E A;  3JW9 A;  4Y0I A;  4A6T A;  3QM2 A;  4A0F A;  1GCK A;  2HOR A;  2OAT A;  1LKC A;  1AKC A;  4LNL A;  4AOA A;  3A9X A;  4XJL A;  1ZC9 A;  1TOG A;  1SF2 A;  2VMT A;  3NYU A;  2ZY3 A;  4NOG A;  3NTJ A;  2Z61 A;  3PD6 B;  3E2F A;  2HOZ A;  3VP6 A;  4WXG A;  3II0 A;  1AY8 A;  1WYT A;  1YJY A;  2W8T A;  2HP2 A;  2FM1 A;  2D7Z A;  3LVJ A;  3RI6 A;  2Z9X A;  2W7I A;  2YCN A;  4MKJ A;  2CB1 A;  3FFR A;  3WCN A;  1V2F A;  1KKJ A;  4A0H A;  3TFU A;  1C7N A;  3ZZK A;  2YHK A;  2EGY A;  4W5K A;  4J8L A;  2QBT A;  3ISL A;  3WZF A;  4RJ0 A;  2O0R A;  1GEX A;  4Q76 A;  1O4S A;  5C6U A;  2JIS A;  1TOJ A;  4F5K A;  1WYV B;  2WKA A;  1GEW A;  1KL1 A;  4AZK A;  3GZD A;  4MSO A;  4O6Z A;  2HUF A;  4W1W A;  2VLH A;  1CQ7 A;  4UOY A;  2AAT A;  1FC4 A;  3CAI A;  1DJE A;  3N5M A;  2C44 A;  1J32 A;  2R5E A;  5DJ9 A;  3WX9 A;  5G4I A;  2VIB A;  3KGW A;  1VP4 A;  3EI9 A;  1I41 A;  3P1T A;  4KXK A;  4P3M A;  1DTY A;  2VMQ A;  3Q8N A;  2QA3 A;  3AV7 A;  4ZM4 A;  4ISY A;  4WBT A;  3QI6 A;  3AEJ C;  1ASA A;  1CL2 A;  3GBX A;  3LWS A;  5EUD A;  3BB8 A;  5K8B A;  1AKA A;  1IAX A;  1YNU A;  1N2T A;  2DKB A;  3LG0 A;  4RKD A;  1SZK A;  2Z67 A;  5EUN A;  1N31 A;  2ZY5 A;  1JG8 A;  1IVR A;  3AEL A;  3F9T A;  4EB7 A;  4TMR A;  4WB0 A;  4M2K A;  1BT4 A;  3F0H A;  4WYG A;  4RKC A;  4EFF A;  4MY5 A;  1IUG A;  1C4K A;  1OXP A;  3G7Q A;  3A8U X;  4LC3 A;  4N0W A;  3WGB A;  2VMP A;  5FT4 A;  1S09 A;  5M49 A;  1VEF A;  3HL2 A;  4GSA A;  2HUI A;  2X3L A;  2CH1 A;  3AOV A;  1ARI A;  3RCH A;  1JS6 A;  1MDO A;  2W7E A;  3A9Z A;  4H51 A;  2ORD A;  4WYA A;  3PAA A;  4BA5 A;  2VMZ A;  4U1T A;  3EIB A;  4ZSW A;  3NYT A;  3PIU A;  1M0N A;  2BIG A;  1M0Q A;  1X2A A;  1QIR A;  3WLX A;  2HZP A;  1GC3 A;  1X0M A;  1GD9 A;  2YRI A;  4MGR A;  4A6U A;  4ADC A;  2ZYJ A;  3WY7 A;  3VK3 A;  2JGT A;  1PG8 A;  3FVU A;  3LY1 A;  1LC8 A;  2W8J A;  2W7L A;  3N75 A;  3VOM A;  4BQ0 A;  4GDY A;  4PFF A;  1GC2 A;  3HDO A;  2VGZ A;  1GC0 A;  3DXV A;  2BYJ A;  3PD6 A;  1ZOD A;  3QGU A;  3B1C A;  4CXR A;  1AY4 A;  3EUC A;  3FVS A;  1IAY A;  5HDM A;  2D66 A;  3N0L A;  3AEJ A;  1D7V A;  1YJZ A;  4GE4 A;  5FT6 A;  3ZRP A;  1BKG A;  1IX8 A;  2JG2 A;  4AH3 A;  1BJO B;  2HOY A;  2BI2 A;  1ASD A;  2AY5 A;  2DGM A;  1V2E A;  3FQ8 A;  3E77 A;  3T32 A;  4HVK A;  3CQ6 A;  3PJ0 A;  5G2P A;  5BJ4 A;  5EFS A;  1B5P A;  3PDB B;  5G2Q A;  1S08 A;  1W7N A;  2BI5 A;  3K7Y A;  1DGD A;  3R9A A;  5JAY A;  1AIC A;  3BCA A;  4F4E A;  3DU4 A;  3R4T A;  5J8Q A;  3USF A;  1WYV A;  2AY3 A;  5BJ3 A;  2W8U A;  2FN6 A;  4ZWV A;  1V72 A;  1X28 A;  3MAU A;  4ZWM A;  1M7Y A;  3HT4 A;  1W23 A;  4L0O A;  2CY8 A;  1W3U A;  1SZS A;  1OHW A;  4Q31 A;  3RCH B;  1TPL A;  3EIA A;  4ITG A;  1TOI A;  4ZAH A;  1WKG A;  3UWC A;  3JWA A;  4E77 A;  5F8V A;  1MLY A;  1FG3 A;  3MC6 C;  4GEB A;  1S06 A;  2CST A;  3DC1 A;  3AEP A;  2D61 A;  1AX4 A;  1IJI A;  2D7Y A;  2YKU A;  3HBX A;  4M2M A;  4OTL A;  3TFT A;  3BN1 A;  3VAX A;  1AHG A;  1P3W A;  2JJE A;  4WYE A;  1AMR A;  1W7M A;  3L8A A;  4W1V A;  2W7M A;  4RIT A;  2C7T A;  1EQB A;  5EAA A;  2VGS A;  2ZP7 A;  1M4N A;  1LK9 A;  1PMO A;  3CQ4 A;  1EJI A;  3ECD A;  2BWN A;  1OHY A;  3EI8 A;  2FNI A;  4N0B A;  4WXB A;  1I48 A;  4FL0 A;  1M0O A;  3FCR A;  4W8I A;  1PMM A;  2Q7W A;  3NRA A;  1AJR A;  5FT5 A;  4WYC A;  2YOB A;  4W1X A;  1UKJ A;  1SPA A;  3KGX A;  4F5G A;  2YRR A;  3BS8 A;  3JZL A;  4JE5 A;  3RBF A;  1T3I A;  1ASL A;  1D7S A;  4KAM A;  1CQ6 A;  4K2I A;  4PFN A;  1B8G A;  1VJO A;  3BCX A;  4BMK A;  4EMY A;  1C7G A;  2GMU A;  3BC8 A;  4JEX A;  2Z9V A;  4CBR A;  1LC7 A;  1LW4 A;  4R2N A;  3W1I A;  2E7J A;  3F6T A;  4R5Z A;  1ASF A;  3FQA A;  4F5H A;  2YKX A;  4RAE A;  4LNJ A;  1RVY A;  5EUE A;  2C0R A;  1RV4 A;  3NX3 A;  1BQA A;  3MC6 A;  1OAT A;  1CL1 A;  4JEZ A;  3MEB A;  3ASB A;  1BJO A;  4WLJ A;  1DGE A;  2WK7 A;  1AAM A;  2PB0 A;  1TOE A;  1B5O A;  2BIE A;  2CJH A;  1H0C A;  3PDB A;  4EU1 A;  3FZ7 A;  3AEO A;  4IYO B;  3E9K A;  2OKJ A;  3DOD A;  3LVK A;  3M5U A;  3A2B A;  1MDX A;  3FZ6 A;  1QJ5 A;  4TN4 A;  3BV0 A;  1BQD A;  1DJ9 A;  1UU1 A;  4ATP A;  4ZSY A;  2CAN A;  1SFF A;  2OGE A;  4K2B A;  2HOX A;  4EB5 A;  1ART A;  3FDB A;  3NUB A;  1I29 A;  4XJP A;  4MQP A;  3ACZ A;  4B9B A;  3BWO A;  4CVQ A;  2AY2 A;  1KKP A;  2F8J A;  3HLM A;  1RV3 A;  2AY8 A;  1O62 A;  4W91 A;  4Q6R A;  4UHN A;  1M32 A;  1MAP A;  4A0R A;  1YJS A;  2DOU A;  3BWN C;  4R5F A;  1ASB A;  2Z1Y A;  3NDN A;  4XK1 A;  5EQC A;  5HHY A;  5I92 A;  1OHV A;  4AO4 A;  2VMW A;  4PIW A;  1D7R A;  4BA4 A;  4JEW A;  3PDX A;  2EO5 A;  2GMS A;  3WCO A;  1ASE A;  1E5F A;  2V1P A;  2TPL A;  2GB3 A;  4UQV A;  1ARH A;  3NNK A;  2OKK A;  4XAU A;  2BWO A;  1IX6 A;  2YCT A;  1YIY A;  4JF1 A;  2G6W A;  4OYT A;  2C81 A;  2W7D A;  3DRD A;  3AOW A;  1ELU A;  4WYD A;  2YCP A;  5G4J A;  4BHD A;  4TV7 A;  2Z9W A;  2AY1 A;  4LW2 A;  1EG5 A;  2QLR A;  1FG7 A;  5FT8 A;  2OGA A;  4UHO A;  4ADB A;  1O69 A;  4LW4 A;  1D7U A;  3JU7 A;  3NU8 A;  3GSB A;  1AHX A;  1ECX A;  2VMO A;  3FRK A;  4OBU A;  1ASC A;  2GSA A;  1IBJ A;  1N8P A;  3E2Z B;  5EIG B;  3D6K A;  3IHJ A;  3ZRR A;  2E7I A;  4FFC A;  2W7H A;  4XJO A;  4P7Y A;  2E7U A;  2VMY A;  3I5T A;  3MBB A;  4A72 A;  2AY6 A;  5D95 A;  4A6R A;  5M46 A;  2AEU A;  1G4V A;  4WLH A;  1IX7 A;  4GE9 A;  2PB2 A;  2ZUK A;  2AEV A;  2CH2 A;  3BWN A;  2QB2 A;  3FTB A;  1E5E A;  1U08 A;  2DKJ A;  1TAT A;  3FVX A;  4RIZ A;  3AEN B;  7AAT A;  3TCM A;  3GZC A;  3WKS A;  3B1D A;  3L44 A;  5DB5 A;  5IWQ A;  1M0P A;  2EZ2 A;  5F9S A;  1QZ9 A;  1AMQ A;  3TAT A;  2CFB A;  2AY9 A;  1AHF A;  1V2D A;  2D64 A;  4IYO A;  2HUU A;  4WYF A;  4PVF A;  3LVM A;  2VMS A;  1CZC A;  2W7K A;  2QMA A;  2D63 A;  8AAT A;  2O7C A;  2DR1 A;  3PGY A;  4MQR A;  2VMX A;  4ITX A;  1CZE A;  1QJ3 A;  3W1H A;  3EI6 A;  4ATQ A;  1AKB A;  4OMA A;  4R8D A;  3DZZ A;  1QIS A;  4OT8 A;  4F5I A;  2VGW A;  4WP0 A;  3ZZJ A;  2AY4 A;  3OKS A;  2AY7 A;  3H7F A;  3I16 A;  2EH6 A;  1DJU A;  1ELQ A;  1GDE A;  1PFF A;  2WK8 A;  4IXZ A;  1B4X A;  4DGT A;  1BJN A;  1W7L A;  1C0N A;  3PA9 A;  3JWB A;  4GE7 A;  2Z20 A; 
#chains in the Genus database with same CATH topology
 3CBF A;  2ZC0 A;  3HVY A;  4ADD A;  3W1J A;  1TOK A;  1YAA A;  4AO9 A;  4JEV A;  4XQ2 A;  3GET A;  2HP1 A;  3MAF A;  1Y4I A;  2OQX A;  1TAS A;  3EZS A;  3G0T A;  9AAT A;  4ZM3 A;  4M2J A;  1H1C A;  2JJH A;  1BJ4 A;  4LNM A;  3RBL A;  3QBO A;  3NYS A;  5LHA A;  2G7J A;  2VGT A;  3DYD A;  1C9C A;  3PPL A;  1GBN A;  1X29 A;  1QGN A;  3AEM C;  2W8W A;  1AAW A;  2O1B A;  1BS0 A;  1I43 A;  1UU2 A;  2ZSM A;  1AJS B;  3EZ1 A;  3HMU A;  4MKK A;  4XJM A;  3UAK A;  1B9H A;  4F5M A;  1GC4 A;  5LH9 A;  1AMS A;  5D5S A;  3ELE A;  2BYL A;  2BI9 A;  1LC5 A;  1MDZ A;  3DXW A;  2VYC A;  3QPG A;  4RJY A;  5DX5 A;  2VMN A;  3DR7 A;  4XEW A;  4RLG A;  3JTX A;  3VK4 A;  2JJF A;  3NUI A;  2VMU A;  3FZ8 A;  1M6S A;  3E2Z A;  2X5D A;  1YOO A;  2VMR A;  4Y0D A;  3CQ5 A;  3QN6 A;  5EIG A;  1B9I A;  1KMJ A;  1UU0 A;  1SZU A;  3MAD A;  4JF0 A;  4E1O A;  4ZDP A;  3BCB A;  5EAV A;  3E6G A;  2VLF A;  2FNU A;  2ZY4 A;  1C7O A;  1CQ8 A;  3GWP A;  3K40 A;  2BWP A;  2CJD A;  4DBC A;  4HF8 A;  4ZAS A;  2VI8 A;  2WK9 A;  2Z9U A;  3AEN A;  1BJW A;  1S07 A;  1MGV A;  2D65 A;  4ADE A;  2BKW A;  5E5I A;  1CS1 A;  1Z7D A;  2PO3 A;  1YIZ A;  3ELP A;  4K2M A;  3P6K A;  4DQ6 A;  2ZY2 A;  1XI9 A;  2RFV A;  2BI1 A;  2CTZ A;  3IF2 A;  1WYU B;  1AMA A;  1AIB A;  3FKD A;  3MAF B;  5HXX A;  3AEM A;  1ASM A;  3RUY A;  1MLZ A;  2V0Y A;  2W7G A;  1O61 A;  2CIN A;  2EPJ A;  3ASA A;  4CXQ A;  1QIT A;  2VIA A;  4I8A A;  2DGK A;  2R5C A;  1LS3 A;  3B8X A;  1AY5 A;  3FQ7 A;  3LVL B;  1G4X A;  1XEY A;  1J04 A;  2R2N A;  4OCA A;  1ORD A;  1WYT B;  2E54 A;  1TAR A;  2YKY A;  1DKA A;  3G8M A;  4Q75 A;  4U2H A;  1ARS A;  2X5F A;  5AX8 A;  1D2F A;  1KL2 A;  3NU7 A;  1AIA A;  3B46 A;  3WGC A;  1JS3 A;  2GQN A;  1S0A A;  1SVV A;  4B98 A;  2X8U A;  4IXS A;  2FYF A;  4A00 A;  2W7F A;  3QHX A;  4OBV A;  2NMP A;  3GR9 A;  4IY7 A;  5G09 A;  1WKH A;  5TF5 A;  1ASN A;  3K28 A;  1G7X A;  1AHE A;  3MKJ A;  3E2Y A;  2W8V A;  1AHY A;  1Z3Z A;  4IX8 A;  4MQQ A;  3AAT A;  1BW0 A;  1AJS A;  3TQX A;  3H14 A;  3WKR A;  4KYO A;  1G7W A;  5M4B A;  1ZOB A;  4IW7 A;  1GEY A;  2FQ6 A;  4ZLV A;  4IXO A;  4ZDL A;  4A0G A;  4ZDO A;  1MAQ A;  4J5U A;  4OC9 A;  3KE3 A;  5DJ1 A;  3DR4 A;  1DFO A;  5M4D A;  3ATH A;  2BHX A;  1ASG A;  4E3Q A;  2VMV A;  4CBS A;  3FDD A;  4RM1 A;  4Y0H A;  2W7J A;  2QB3 A;  2VI9 A;  2VGU A;  2YKV A;  4WB0 B;  2BIA A;  2CJG A;  2ZJG A;  2XH1 A;  2ZSL A;  4GRX A;  3FFH A;  3ZRQ A;  3I4J A;  2VGV A;  5E4Z A;  2JJG A;  3COG A;  3OP7 A;  4JE5 D;  5G0A A;  4E3R A;  3EI7 A;  2R5C B;  4QGR A;  4WXF A;  4AZJ A;  3FSL A;  4JEY A;  4UHM A;  3KKI A;  4F5F A;  3GZD C;  1KMK A;  4WD2 A;  5E3K A;  4F5J A;  1ARG A;  3A9Y A;  1OXO A;  1LW5 A;  1WST A;  2EZ1 A;  3LV2 A;  3FD0 A;  3VK2 A;  2D5Y A;  1RVU A;  2BI3 A;  2R0T A;  3RQ1 A;  2Z1Z A;  3EI5 A;  3HQT A;  2XBN A;  3UE8 A;  1CJ0 A;  1JF9 A;  2DGL A;  4F5L A;  1WYU A;  3GJU A;  3B1E A;  3JW9 A;  4Y0I A;  4A6T A;  3QM2 A;  4A0F A;  1GCK A;  2HOR A;  2OAT A;  1LKC A;  1AKC A;  4LNL A;  4AOA A;  3A9X A;  4XJL A;  1ZC9 A;  1TOG A;  1SF2 A;  2VMT A;  3NYU A;  2ZY3 A;  4NOG A;  3NTJ A;  2Z61 A;  3PD6 B;  3E2F A;  2HOZ A;  3VP6 A;  4WXG A;  3II0 A;  1AY8 A;  1WYT A;  1YJY A;  1KAF A;  2W8T A;  2HP2 A;  2FM1 A;  2D7Z A;  3LVJ A;  3RI6 A;  2Z9X A;  2W7I A;  2YCN A;  4MKJ A;  2CB1 A;  3FFR A;  3WCN A;  1V2F A;  1KKJ A;  4A0H A;  3TFU A;  1C7N A;  3ZZK A;  2YHK A;  2EGY A;  4W5K A;  4J8L A;  2QBT A;  3ISL A;  3WZF A;  4RJ0 A;  2O0R A;  1GEX A;  4Q76 A;  1O4S A;  5C6U A;  2JIS A;  1TOJ A;  4F5K A;  1WYV B;  2WKA A;  1GEW A;  1KL1 A;  4AZK A;  3GZD A;  4MSO A;  4O6Z A;  2HUF A;  4W1W A;  2VLH A;  1CQ7 A;  4UOY A;  2AAT A;  1FC4 A;  3CAI A;  1DJE A;  3N5M A;  2C44 A;  1J32 A;  2R5E A;  5DJ9 A;  3WX9 A;  5G4I A;  2VIB A;  3KGW A;  1VP4 A;  3EI9 A;  1I41 A;  3P1T A;  4KXK A;  4P3M A;  1DTY A;  2VMQ A;  3Q8N A;  2QA3 A;  3AV7 A;  4ZM4 A;  3N7N A;  4ISY A;  4WBT A;  3QI6 A;  3AEJ C;  1ASA A;  1CL2 A;  3GBX A;  3LWS A;  5EUD A;  3BB8 A;  5K8B A;  1AKA A;  1IAX A;  1YNU A;  1N2T A;  2DKB A;  3LG0 A;  4RKD A;  1SZK A;  2Z67 A;  5EUN A;  1N31 A;  2ZY5 A;  1JG8 A;  1IVR A;  3AEL A;  3F9T A;  4EB7 A;  4TMR A;  4WB0 A;  4M2K A;  1BT4 A;  3F0H A;  4WYG A;  4RKC A;  2EYQ A;  2QSR A;  4EFF A;  4MY5 A;  1IUG A;  1C4K A;  1OXP A;  3G7Q A;  3A8U X;  4LC3 A;  4N0W A;  3WGB A;  2VMP A;  5FT4 A;  1S09 A;  5M49 A;  1VEF A;  3HL2 A;  4GSA A;  2HUI A;  2X3L A;  2CH1 A;  3AOV A;  1ARI A;  3RCH A;  1JS6 A;  1MDO A;  2W7E A;  3A9Z A;  4H51 A;  2ORD A;  4WYA A;  3PAA A;  4BA5 A;  2VMZ A;  4U1T A;  3EIB A;  4ZSW A;  3NYT A;  3PIU A;  1M0N A;  2BIG A;  1M0Q A;  1X2A A;  1QIR A;  3WLX A;  2HZP A;  1GC3 A;  1X0M A;  1GD9 A;  2YRI A;  4MGR A;  4A6U A;  4ADC A;  2ZYJ A;  3WY7 A;  2FKI A;  3VK3 A;  2JGT A;  1PG8 A;  3FVU A;  3LY1 A;  1LC8 A;  2W8J A;  2W7L A;  3N75 A;  3VOM A;  4BQ0 A;  4GDY A;  4PFF A;  1GC2 A;  3HDO A;  2VGZ A;  1GC0 A;  3DXV A;  2BYJ A;  3PD6 A;  1ZOD A;  3QGU A;  3B1C A;  4CXR A;  1AY4 A;  4H63 Q;  3EUC A;  3FVS A;  1IAY A;  5HDM A;  2D66 A;  3N0L A;  3AEJ A;  1D7V A;  1YJZ A;  4GE4 A;  5FT6 A;  2WB6 A;  3ZRP A;  1BKG A;  1IX8 A;  2JG2 A;  4AH3 A;  1BJO B;  2HOY A;  2BI2 A;  1ASD A;  2AY5 A;  2DGM A;  1V2E A;  3FQ8 A;  3E77 A;  3T32 A;  4HVK A;  3CQ6 A;  3PJ0 A;  5G2P A;  5BJ4 A;  5EFS A;  1B5P A;  3PDB B;  5G2Q A;  1S08 A;  1W7N A;  2BI5 A;  3K7Y A;  1DGD A;  3R9A A;  5JAY A;  1AIC A;  3BCA A;  4F4E A;  3DU4 A;  3R4T A;  5J8Q A;  3USF A;  1WYV A;  2AY3 A;  5BJ3 A;  2W8U A;  2FN6 A;  4ZWV A;  1V72 A;  2KFP A;  1X28 A;  3MAU A;  4ZWM A;  3N4R A;  1M7Y A;  3HT4 A;  1W23 A;  4L0O A;  2CY8 A;  1W3U A;  1SZS A;  1OHW A;  4Q31 A;  3RCH B;  1TPL A;  3EIA A;  4ITG A;  1TOI A;  4ZAH A;  1WKG A;  3UWC A;  3JWA A;  4E77 A;  5F8V A;  1MLY A;  1FG3 A;  3MC6 C;  4GEB A;  1S06 A;  2CST A;  3DC1 A;  3AEP A;  2D61 A;  1AX4 A;  1IJI A;  2D7Y A;  2YKU A;  3HBX A;  4M2M A;  4OTL A;  3TFT A;  3BN1 A;  3VAX A;  1AHG A;  1P3W A;  2JJE A;  4WYE A;  1AMR A;  1W7M A;  3L8A A;  4W1V A;  2W7M A;  4RIT A;  2C7T A;  1EQB A;  5EAA A;  2VGS A;  2ZP7 A;  1M4N A;  1LK9 A;  1PMO A;  3CQ4 A;  1EJI A;  3ECD A;  2BWN A;  1OHY A;  3EI8 A;  2FNI A;  4N0B A;  4WXB A;  1I48 A;  4FL0 A;  1M0O A;  3FCR A;  4W8I A;  1PMM A;  2Q7W A;  3NRA A;  1AJR A;  5FT5 A;  4WYC A;  2YOB A;  4W1X A;  1UKJ A;  1SPA A;  3KGX A;  4F5G A;  2YRR A;  3BS8 A;  3JZL A;  4JE5 A;  3RBF A;  1T3I A;  1ASL A;  1D7S A;  4KAM A;  1CQ6 A;  4K2I A;  4PFN A;  1B8G A;  1VJO A;  3BCX A;  4BMK A;  4EMY A;  1C7G A;  2GMU A;  3BC8 A;  4JEX A;  2Z9V A;  4CBR A;  1LC7 A;  1LW4 A;  4R2N A;  3W1I A;  2E7J A;  3F6T A;  4R5Z A;  1ASF A;  3FQA A;  4F5H A;  2YKX A;  4RAE A;  4LNJ A;  1RVY A;  5EUE A;  2C0R A;  1RV4 A;  3NX3 A;  1BQA A;  3MC6 A;  1OAT A;  1CL1 A;  4JEZ A;  3MEB A;  3ASB A;  1BJO A;  4WLJ A;  5KTB A;  1DGE A;  2WK7 A;  1AAM A;  2PB0 A;  4K05 A;  1TOE A;  1B5O A;  2BIE A;  2CJH A;  1H0C A;  3PDB A;  4EU1 A;  3FZ7 A;  3AEO A;  4IYO B;  3E9K A;  2OKJ A;  3DOD A;  3LVK A;  3M5U A;  3A2B A;  1MDX A;  3FZ6 A;  1QJ5 A;  4TN4 A;  3BV0 A;  1BQD A;  1DJ9 A;  1UU1 A;  4ATP A;  4ZSY A;  2CAN A;  1SFF A;  2OGE A;  4K2B A;  2HOX A;  4EB5 A;  1ART A;  3FDB A;  3NUB A;  1I29 A;  4XJP A;  4MQP A;  3ACZ A;  4B9B A;  3BWO A;  4CVQ A;  2AY2 A;  1KKP A;  2F8J A;  3HLM A;  1RV3 A;  2AY8 A;  1O62 A;  4W91 A;  4Q6R A;  4UHN A;  3N4X A;  1M32 A;  1MAP A;  4A0R A;  1YJS A;  2DOU A;  3BWN C;  4R5F A;  3H9X A;  1ASB A;  2Z1Y A;  3NDN A;  4XK1 A;  5EQC A;  5HHY A;  5I92 A;  1OHV A;  4AO4 A;  2VMW A;  4PIW A;  1D7R A;  4BA4 A;  3N4S A;  4JEW A;  3PDX A;  2EO5 A;  2GMS A;  3WCO A;  1ASE A;  1E5F A;  2V1P A;  2TPL A;  2GB3 A;  4UQV A;  1ARH A;  3NNK A;  2OKK A;  4XAU A;  2BWO A;  1IX6 A;  2YCT A;  1YIY A;  4JF1 A;  2G6W A;  4OYT A;  2C81 A;  2W7D A;  3DRD A;  3AOW A;  1ELU A;  4WYD A;  2YCP A;  5G4J A;  4BHD A;  4TV7 A;  2Z9W A;  2AY1 A;  4LW2 A;  1EG5 A;  2A1V A;  2QLR A;  1FG7 A;  5FT8 A;  2OGA A;  4UHO A;  4ADB A;  1O69 A;  4LW4 A;  1D7U A;  3JU7 A;  3NU8 A;  3GSB A;  1AHX A;  1ECX A;  2VMO A;  3FRK A;  4OBU A;  1ASC A;  2GSA A;  1IBJ A;  1N8P A;  3E2Z B;  5EIG B;  3D6K A;  3IHJ A;  3ZRR A;  2E7I A;  4FFC A;  2W7H A;  4XJO A;  4P7Y A;  2E7U A;  2VMY A;  3I5T A;  3MBB A;  4A72 A;  2AY6 A;  5D95 A;  4A6R A;  5M46 A;  2AEU A;  1G4V A;  4WLH A;  1IX7 A;  4GE9 A;  2PB2 A;  2ZUK A;  2AEV A;  2CH2 A;  3BWN A;  2QB2 A;  3FTB A;  1E5E A;  1U08 A;  2DKJ A;  1TAT A;  3FVX A;  4RIZ A;  3AEN B;  7AAT A;  3TCM A;  3GZC A;  3WKS A;  3B1D A;  3L44 A;  5DB5 A;  5IWQ A;  1M0P A;  2EZ2 A;  5F9S A;  1QZ9 A;  1AMQ A;  3TAT A;  2CFB A;  2AY9 A;  1AHF A;  1V2D A;  2D64 A;  4IYO A;  2HUU A;  4WYF A;  4PVF A;  3LVM A;  2VMS A;  1CZC A;  2W7K A;  2QMA A;  2D63 A;  8AAT A;  2O7C A;  2DR1 A;  3PGY A;  4MQR A;  2VMX A;  4ITX A;  1CZE A;  1QJ3 A;  3W1H A;  3EI6 A;  4ATQ A;  1AKB A;  4OMA A;  4R8D A;  3DZZ A;  1QIS A;  4OT8 A;  4F5I A;  2VGW A;  4WP0 A;  3ZZJ A;  2AY4 A;  3OKS A;  2AY7 A;  3H7F A;  3I16 A;  2EH6 A;  1DJU A;  1ELQ A;  1GDE A;  1PFF A;  2WK8 A;  4IXZ A;  1B4X A;  4DGT A;  1BJN A;  1W7L A;  1C0N A;  3PA9 A;  3JWB A;  4GE7 A;  2Z20 A; 
#chains in the Genus database with same CATH homology
 3CBF A;  2ZC0 A;  3HVY A;  4ADD A;  3W1J A;  1TOK A;  1YAA A;  4AO9 A;  4JEV A;  4XQ2 A;  3GET A;  2HP1 A;  3MAF A;  1Y4I A;  2OQX A;  1TAS A;  3EZS A;  3G0T A;  9AAT A;  4ZM3 A;  4M2J A;  1H1C A;  2JJH A;  1BJ4 A;  4LNM A;  3RBL A;  3QBO A;  3NYS A;  5LHA A;  2G7J A;  2VGT A;  3DYD A;  1C9C A;  3PPL A;  1GBN A;  1X29 A;  1QGN A;  3AEM C;  2W8W A;  1AAW A;  2O1B A;  1BS0 A;  1I43 A;  1UU2 A;  2ZSM A;  1AJS B;  3EZ1 A;  3HMU A;  4MKK A;  4XJM A;  3UAK A;  1B9H A;  4F5M A;  1GC4 A;  5LH9 A;  1AMS A;  5D5S A;  3ELE A;  2BYL A;  2BI9 A;  1LC5 A;  1MDZ A;  3DXW A;  2VYC A;  3QPG A;  4RJY A;  5DX5 A;  2VMN A;  3DR7 A;  4XEW A;  4RLG A;  3JTX A;  3VK4 A;  2JJF A;  3NUI A;  2VMU A;  3FZ8 A;  1M6S A;  3E2Z A;  2X5D A;  1YOO A;  2VMR A;  4Y0D A;  3CQ5 A;  3QN6 A;  5EIG A;  1B9I A;  1KMJ A;  1UU0 A;  1SZU A;  3MAD A;  4JF0 A;  4E1O A;  4ZDP A;  3BCB A;  5EAV A;  3E6G A;  2VLF A;  2FNU A;  2ZY4 A;  1C7O A;  1CQ8 A;  3GWP A;  3K40 A;  2BWP A;  2CJD A;  4DBC A;  4HF8 A;  4ZAS A;  2VI8 A;  2WK9 A;  2Z9U A;  3AEN A;  1BJW A;  1S07 A;  1MGV A;  2D65 A;  4ADE A;  2BKW A;  5E5I A;  1CS1 A;  1Z7D A;  2PO3 A;  1YIZ A;  3ELP A;  4K2M A;  3P6K A;  4DQ6 A;  2ZY2 A;  1XI9 A;  2RFV A;  2BI1 A;  2CTZ A;  3IF2 A;  1WYU B;  1AMA A;  1AIB A;  3FKD A;  3MAF B;  5HXX A;  3AEM A;  1ASM A;  3RUY A;  1MLZ A;  2V0Y A;  2W7G A;  1O61 A;  2CIN A;  2EPJ A;  3ASA A;  4CXQ A;  1QIT A;  2VIA A;  4I8A A;  2DGK A;  2R5C A;  1LS3 A;  3B8X A;  1AY5 A;  3FQ7 A;  3LVL B;  1G4X A;  1XEY A;  1J04 A;  2R2N A;  4OCA A;  1ORD A;  1WYT B;  2E54 A;  1TAR A;  2YKY A;  1DKA A;  3G8M A;  4Q75 A;  4U2H A;  1ARS A;  2X5F A;  5AX8 A;  1D2F A;  1KL2 A;  3NU7 A;  1AIA A;  3B46 A;  3WGC A;  1JS3 A;  2GQN A;  1S0A A;  1SVV A;  4B98 A;  2X8U A;  4IXS A;  2FYF A;  4A00 A;  2W7F A;  3QHX A;  4OBV A;  2NMP A;  3GR9 A;  4IY7 A;  5G09 A;  1WKH A;  5TF5 A;  1ASN A;  3K28 A;  1G7X A;  1AHE A;  3MKJ A;  3E2Y A;  2W8V A;  1AHY A;  1Z3Z A;  4IX8 A;  4MQQ A;  3AAT A;  1BW0 A;  1AJS A;  3TQX A;  3H14 A;  3WKR A;  4KYO A;  1G7W A;  5M4B A;  1ZOB A;  4IW7 A;  1GEY A;  2FQ6 A;  4ZLV A;  4IXO A;  4ZDL A;  4A0G A;  4ZDO A;  1MAQ A;  4J5U A;  4OC9 A;  3KE3 A;  5DJ1 A;  3DR4 A;  1DFO A;  5M4D A;  3ATH A;  2BHX A;  1ASG A;  4E3Q A;  2VMV A;  4CBS A;  3FDD A;  4RM1 A;  4Y0H A;  2W7J A;  2QB3 A;  2VI9 A;  2VGU A;  2YKV A;  4WB0 B;  2BIA A;  2CJG A;  2ZJG A;  2XH1 A;  2ZSL A;  4GRX A;  3FFH A;  3ZRQ A;  3I4J A;  2VGV A;  5E4Z A;  2JJG A;  3COG A;  3OP7 A;  4JE5 D;  5G0A A;  4E3R A;  3EI7 A;  2R5C B;  4QGR A;  4WXF A;  4AZJ A;  3FSL A;  4JEY A;  4UHM A;  3KKI A;  4F5F A;  3GZD C;  1KMK A;  4WD2 A;  5E3K A;  4F5J A;  1ARG A;  3A9Y A;  1OXO A;  1LW5 A;  1WST A;  2EZ1 A;  3LV2 A;  3FD0 A;  3VK2 A;  2D5Y A;  1RVU A;  2BI3 A;  2R0T A;  3RQ1 A;  2Z1Z A;  3EI5 A;  3HQT A;  2XBN A;  3UE8 A;  1CJ0 A;  1JF9 A;  2DGL A;  4F5L A;  1WYU A;  3GJU A;  3B1E A;  3JW9 A;  4Y0I A;  4A6T A;  3QM2 A;  4A0F A;  1GCK A;  2HOR A;  2OAT A;  1LKC A;  1AKC A;  4LNL A;  4AOA A;  3A9X A;  4XJL A;  1ZC9 A;  1TOG A;  1SF2 A;  2VMT A;  3NYU A;  2ZY3 A;  4NOG A;  3NTJ A;  2Z61 A;  3PD6 B;  3E2F A;  2HOZ A;  3VP6 A;  4WXG A;  3II0 A;  1AY8 A;  1WYT A;  1YJY A;  2W8T A;  2HP2 A;  2FM1 A;  2D7Z A;  3LVJ A;  3RI6 A;  2Z9X A;  2W7I A;  2YCN A;  4MKJ A;  2CB1 A;  3FFR A;  3WCN A;  1V2F A;  1KKJ A;  4A0H A;  3TFU A;  1C7N A;  3ZZK A;  2YHK A;  2EGY A;  4W5K A;  4J8L A;  2QBT A;  3ISL A;  3WZF A;  4RJ0 A;  2O0R A;  1GEX A;  4Q76 A;  1O4S A;  5C6U A;  2JIS A;  1TOJ A;  4F5K A;  1WYV B;  2WKA A;  1GEW A;  1KL1 A;  4AZK A;  3GZD A;  4MSO A;  4O6Z A;  2HUF A;  4W1W A;  2VLH A;  1CQ7 A;  4UOY A;  2AAT A;  1FC4 A;  3CAI A;  1DJE A;  3N5M A;  2C44 A;  1J32 A;  2R5E A;  5DJ9 A;  3WX9 A;  5G4I A;  2VIB A;  3KGW A;  1VP4 A;  3EI9 A;  1I41 A;  3P1T A;  4KXK A;  4P3M A;  1DTY A;  2VMQ A;  3Q8N A;  2QA3 A;  3AV7 A;  4ZM4 A;  3N7N A;  4ISY A;  4WBT A;  3QI6 A;  3AEJ C;  1ASA A;  1CL2 A;  3GBX A;  3LWS A;  5EUD A;  3BB8 A;  5K8B A;  1AKA A;  1IAX A;  1YNU A;  1N2T A;  2DKB A;  3LG0 A;  4RKD A;  1SZK A;  2Z67 A;  5EUN A;  1N31 A;  2ZY5 A;  1JG8 A;  1IVR A;  3AEL A;  3F9T A;  4EB7 A;  4TMR A;  4WB0 A;  4M2K A;  1BT4 A;  3F0H A;  4WYG A;  4RKC A;  2EYQ A;  2QSR A;  4EFF A;  4MY5 A;  1IUG A;  1C4K A;  1OXP A;  3G7Q A;  3A8U X;  4LC3 A;  4N0W A;  3WGB A;  2VMP A;  5FT4 A;  1S09 A;  5M49 A;  1VEF A;  3HL2 A;  4GSA A;  2HUI A;  2X3L A;  2CH1 A;  3AOV A;  1ARI A;  3RCH A;  1JS6 A;  1MDO A;  2W7E A;  3A9Z A;  4H51 A;  2ORD A;  4WYA A;  3PAA A;  4BA5 A;  2VMZ A;  4U1T A;  3EIB A;  4ZSW A;  3NYT A;  3PIU A;  1M0N A;  2BIG A;  1M0Q A;  1X2A A;  1QIR A;  3WLX A;  2HZP A;  1GC3 A;  1X0M A;  1GD9 A;  2YRI A;  4MGR A;  4A6U A;  4ADC A;  2ZYJ A;  3WY7 A;  2FKI A;  3VK3 A;  2JGT A;  1PG8 A;  3FVU A;  3LY1 A;  1LC8 A;  2W8J A;  2W7L A;  3N75 A;  3VOM A;  4BQ0 A;  4GDY A;  4PFF A;  1GC2 A;  3HDO A;  2VGZ A;  1GC0 A;  3DXV A;  2BYJ A;  3PD6 A;  1ZOD A;  3QGU A;  3B1C A;  4CXR A;  1AY4 A;  4H63 Q;  3EUC A;  3FVS A;  1IAY A;  5HDM A;  2D66 A;  3N0L A;  3AEJ A;  1D7V A;  1YJZ A;  4GE4 A;  5FT6 A;  2WB6 A;  3ZRP A;  1BKG A;  1IX8 A;  2JG2 A;  4AH3 A;  1BJO B;  2HOY A;  2BI2 A;  1ASD A;  2AY5 A;  2DGM A;  1V2E A;  3FQ8 A;  3E77 A;  3T32 A;  4HVK A;  3CQ6 A;  3PJ0 A;  5G2P A;  5BJ4 A;  5EFS A;  1B5P A;  3PDB B;  5G2Q A;  1S08 A;  1W7N A;  2BI5 A;  3K7Y A;  1DGD A;  3R9A A;  5JAY A;  1AIC A;  3BCA A;  4F4E A;  3DU4 A;  3R4T A;  5J8Q A;  3USF A;  1WYV A;  2AY3 A;  5BJ3 A;  2W8U A;  2FN6 A;  4ZWV A;  1V72 A;  2KFP A;  1X28 A;  3MAU A;  4ZWM A;  3N4R A;  1M7Y A;  3HT4 A;  1W23 A;  4L0O A;  2CY8 A;  1W3U A;  1SZS A;  1OHW A;  4Q31 A;  3RCH B;  1TPL A;  3EIA A;  4ITG A;  1TOI A;  4ZAH A;  1WKG A;  3UWC A;  3JWA A;  4E77 A;  5F8V A;  1MLY A;  1FG3 A;  3MC6 C;  4GEB A;  1S06 A;  2CST A;  3DC1 A;  3AEP A;  2D61 A;  1AX4 A;  1IJI A;  2D7Y A;  2YKU A;  3HBX A;  4M2M A;  4OTL A;  3TFT A;  3BN1 A;  3VAX A;  1AHG A;  1P3W A;  2JJE A;  4WYE A;  1AMR A;  1W7M A;  3L8A A;  4W1V A;  2W7M A;  4RIT A;  2C7T A;  1EQB A;  5EAA A;  2VGS A;  2ZP7 A;  1M4N A;  1LK9 A;  1PMO A;  3CQ4 A;  1EJI A;  3ECD A;  2BWN A;  1OHY A;  3EI8 A;  2FNI A;  4N0B A;  4WXB A;  1I48 A;  4FL0 A;  1M0O A;  3FCR A;  4W8I A;  1PMM A;  2Q7W A;  3NRA A;  1AJR A;  5FT5 A;  4WYC A;  2YOB A;  4W1X A;  1UKJ A;  1SPA A;  3KGX A;  4F5G A;  2YRR A;  3BS8 A;  3JZL A;  4JE5 A;  3RBF A;  1T3I A;  1ASL A;  1D7S A;  4KAM A;  1CQ6 A;  4K2I A;  4PFN A;  1B8G A;  1VJO A;  3BCX A;  4BMK A;  4EMY A;  1C7G A;  2GMU A;  3BC8 A;  4JEX A;  2Z9V A;  4CBR A;  1LC7 A;  1LW4 A;  4R2N A;  3W1I A;  2E7J A;  3F6T A;  4R5Z A;  1ASF A;  3FQA A;  4F5H A;  2YKX A;  4RAE A;  4LNJ A;  1RVY A;  5EUE A;  2C0R A;  1RV4 A;  3NX3 A;  1BQA A;  3MC6 A;  1OAT A;  1CL1 A;  4JEZ A;  3MEB A;  3ASB A;  1BJO A;  4WLJ A;  5KTB A;  1DGE A;  2WK7 A;  1AAM A;  2PB0 A;  4K05 A;  1TOE A;  1B5O A;  2BIE A;  2CJH A;  1H0C A;  3PDB A;  4EU1 A;  3FZ7 A;  3AEO A;  4IYO B;  3E9K A;  2OKJ A;  3DOD A;  3LVK A;  3M5U A;  3A2B A;  1MDX A;  3FZ6 A;  1QJ5 A;  4TN4 A;  3BV0 A;  1BQD A;  1DJ9 A;  1UU1 A;  4ATP A;  4ZSY A;  2CAN A;  1SFF A;  2OGE A;  4K2B A;  2HOX A;  4EB5 A;  1ART A;  3FDB A;  3NUB A;  1I29 A;  4XJP A;  4MQP A;  3ACZ A;  4B9B A;  3BWO A;  4CVQ A;  2AY2 A;  1KKP A;  2F8J A;  3HLM A;  1RV3 A;  2AY8 A;  1O62 A;  4W91 A;  4Q6R A;  4UHN A;  3N4X A;  1M32 A;  1MAP A;  4A0R A;  1YJS A;  2DOU A;  3BWN C;  4R5F A;  3H9X A;  1ASB A;  2Z1Y A;  3NDN A;  4XK1 A;  5EQC A;  5HHY A;  5I92 A;  1OHV A;  4AO4 A;  2VMW A;  4PIW A;  1D7R A;  4BA4 A;  3N4S A;  4JEW A;  3PDX A;  2EO5 A;  2GMS A;  3WCO A;  1ASE A;  1E5F A;  2V1P A;  2TPL A;  2GB3 A;  4UQV A;  1ARH A;  3NNK A;  2OKK A;  4XAU A;  2BWO A;  1IX6 A;  2YCT A;  1YIY A;  4JF1 A;  2G6W A;  4OYT A;  2C81 A;  2W7D A;  3DRD A;  3AOW A;  1ELU A;  4WYD A;  2YCP A;  5G4J A;  4BHD A;  4TV7 A;  2Z9W A;  2AY1 A;  4LW2 A;  1EG5 A;  2A1V A;  2QLR A;  1FG7 A;  5FT8 A;  2OGA A;  4UHO A;  4ADB A;  1O69 A;  4LW4 A;  1D7U A;  3JU7 A;  3NU8 A;  3GSB A;  1AHX A;  1ECX A;  2VMO A;  3FRK A;  4OBU A;  1ASC A;  2GSA A;  1IBJ A;  1N8P A;  3E2Z B;  5EIG B;  3D6K A;  3IHJ A;  3ZRR A;  2E7I A;  4FFC A;  2W7H A;  4XJO A;  4P7Y A;  2E7U A;  2VMY A;  3I5T A;  3MBB A;  4A72 A;  2AY6 A;  5D95 A;  4A6R A;  5M46 A;  2AEU A;  1G4V A;  4WLH A;  1IX7 A;  4GE9 A;  2PB2 A;  2ZUK A;  2AEV A;  2CH2 A;  3BWN A;  2QB2 A;  3FTB A;  1E5E A;  1U08 A;  2DKJ A;  1TAT A;  3FVX A;  4RIZ A;  3AEN B;  7AAT A;  3TCM A;  3GZC A;  3WKS A;  3B1D A;  3L44 A;  5DB5 A;  5IWQ A;  1M0P A;  2EZ2 A;  5F9S A;  1QZ9 A;  1AMQ A;  3TAT A;  2CFB A;  2AY9 A;  1AHF A;  1V2D A;  2D64 A;  4IYO A;  2HUU A;  4WYF A;  4PVF A;  3LVM A;  2VMS A;  1CZC A;  2W7K A;  2QMA A;  2D63 A;  8AAT A;  2O7C A;  2DR1 A;  3PGY A;  4MQR A;  2VMX A;  4ITX A;  1CZE A;  1QJ3 A;  3W1H A;  3EI6 A;  4ATQ A;  1AKB A;  4OMA A;  4R8D A;  3DZZ A;  1QIS A;  4OT8 A;  4F5I A;  2VGW A;  4WP0 A;  3ZZJ A;  2AY4 A;  3OKS A;  2AY7 A;  3H7F A;  3I16 A;  2EH6 A;  1DJU A;  1ELQ A;  1GDE A;  1PFF A;  2WK8 A;  4IXZ A;  1B4X A;  4DGT A;  1BJN A;  1W7L A;  1C0N A;  3PA9 A;  3JWB A;  4GE7 A;  2Z20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...