3NNTA

Crystal structure of k170m mutant of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in non-covalent complex with dehydroquinate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
YFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nntA00
1QMLA 4J9JA 3M5XA 4DO5A 4GUFA 1LZOA 1XBZA 1SQ7A 2BTMA 1NEYA 4HN4A 4RJEA 2FB3A 1Q45A 2NX1A 4IUOA 3TCEA 5HUPA 1GG1A 1MXSA 2LLEA 3QJAA 2VEPA 3L9CA 1VQTA 1YDOA 3W7GA 3SZ8A 3BLEA 3ZFHA 2A0NA 2VEIA 4LV9A 2E77A 3LLFA 4LUJA 3W7NA 3PUEA 3M41A 1BEUA 3C52A 4JY8A 3NL3A 3EX1A 3FIGA 3PS7A 5AB3A 4O53A 2QDHA 1TPDA 1CI1A 3QQ1A 2ISVA 3KOFA 3B06A 2CLIA 4E2BA 2JK2A 4ADSA 3HPZA 3ZWTA 3KVMA 2V0TA 4O1BA 4MLJA 4CNPA 4UIOA 2ATMA 3W1XA 1OJXA 4WOZA 2WQPA 3BO9A 3O1NA 5HJLA 4AEOA 1TPWA 2VOMA 3CIWA 3W84A 3NEVA 2PCQA 4KFNA 3DAQA 1IGSA 4B5NA 3H53A 4XBKA 1JCMP 4MJMA 1X1ZA 5CG7A 5LNVA 2A7PA 4EOUA 1R2SA 2ZZ7A 3RLVA 3EXSA 3WK1A 5EMUA 1KM2A 3GXPA 5F1VA 5EY5A 3HJZA 1OFAA 5H91A 1QPNA 4M5PA 1DOSA 2G96A 3UZ5A 3CQ0A 3LHYA 2QJHA 1YYAA 4JIQA 1TRDA 4O19A 3PSVA 5K9XA 3TQ0A 3S8HA 1TJPA 2A6NA 4FB7A 1XBXA 3U6WA 5FF4A 3EEGA 2NZLA 1KLYA 1OF6A 2CFFA 4OT7A 5KZDA 4E2DA 3G0XA 3W22A 3L0KA 2VFDA 4O15A 3W7IA 3F4WA 2YYUA 4ALDA 4IMGA 3KXQA 1ZENA 4NZFA 4NQ1A 3RFAA 3E49A 2HMCA 1OG0A 3CTLA 3V1PA 3HGSA 4A2SA 2C6QA 1Z41A 1PS9A 1G69A 3QPZA 4IMDA 5BMXA 4JTJA 3N14A 4RZ6A 1TV7A 3EWBX 3YPIA 3SI9A 2CZEA 3NPVA 2ABAA 3OBKA 4JD4A 1DJQA 1GVSA 5KTLA 4TMCA 2B7NA 4DPQA 1MSSA 2BZNA 4MLRA 1A53A 4HPXA 2A2IA 4UTMA 1FXQA 1U83A 3L2IA 3P5YA 1B4EA 3G3DA 3KFTA 4Z1AA 2AGKA 3GKAA 2J88A 2ISSA 5LSMA 2EHHA 3HGRA 4H4IA 1JUBA 3IIVA 3ANYA 1EP1A 4ZQCA 1B9BA 2QCDB 2DZXA 3TC7A 4LOCA 1WV2A 3F03K 3I7SA 3WJXA 4UTUA 3P82A 4ORIA 4LU0A 1SFJA 5AN7A 2G97A 3N9RA 3GDTA 1QR7A 4IX2A 3M16A 1RQBA 4RKAA 1K7FA 1W5PA 1PHQA 2X2GA 5AYYA 1VZWA 4BI5A 4GJ1A 1JQVA 5I3GA 5BRBA 2FLIA 3BW4A 1LORA 3ABOA 3VNDA 1EWEA 3LHWA 1G7UA 3HGOA 4TX9A 1KTNA 2Q8ZA 4WUIA 5BNKA 4Y9AA 1OYCA 1JQXA 4GRSA 1F74A 2RDUA 2ZZ6A 2FQIA 1GVQA 1MZHA 1XCFA 3DGRA 3LLDA 4M6PA 1AG1O 1D3GA 3WJSA 1KBJA 1TO3A 1OK6A 3IIXA 3STFA 2RFGA 1P0NA 5F2GA 2QCDA 1C8VA 4Y6GA 5D05A 1QPQA 2Z6JA 5G2HA 4IJBA 4UTWC 2QCNA 1OX5A 3PB0A 5AOUA 2ZA3A 5I3HA 3W86A 3O16A 4N4QA 1G4SA 5IBXC 2CWNA 3CM4A 3SECA 1Q6QA 3LI0A 3MP4A 6TIMA 3DH7A 3A5FA 1DBTA 3L21A 4JTFA 3SJ3A 4A21A 3L0NA 5I3IA 1AW5A 2RKXA 2ZTJA 3L67A 4N9CA 5IBXA 2BX7A 5E0KA 1HO1A 3P5ZA 3GXNA 4QNWA 2Y7FA 3KHJA 4LVAA 4K8HA 3UWUA 1FY6A 2ZCGA 1DHPA 2X1UA 3DFNA 4NNBA 3C6CA 1H61A 5FI8A 3MI2A 1SU5A 4I7UA 3NQEA 5D09A 5C54A 2ZTKA 2BXVA 4AMAA 3W73A 3I65A 1SZFA 1WA3A 3PF3A 2PRMA 4DO6A 3O63A 4O0ZA 4U4MA 3NM3A 2DZUA 3C2RA 1UB3A 3LRKA 2WSQA 2X1TA 1I8JA 5DCBA 4FX7A 3VI2A 4YCPA 4UMAA 3TNOA 5AC6A 4QNEA 2EKCA 4NXSA 5HNRA 2DZTA 4N02A 3N19B 3F1QA 5D33A 1JR1A 1JCJA 1TSIA 3B0VC 5D38A 3ZWSA 3TDFA 3W2KA 4DF2A 5EPDA 4FNPA 3BLFA 2QUUA 2QJIA 3RLUA 1B57A 3G8RA 4QISA 1EB3A 3HG4A 4AB4A 5D37A 3RK8A 3ATZA 3QH2A 1YDNA 4PL1A 3ABSA 3OA3A 3PBVA 2W6RA 1W5OA 2BSLA 1TV8A 3B05A 1AMKA 4P61A 4JTTA 4K7YA 2OMAA 2VFGA 5K9DA 3P84A 3R8RA 5F2MA 5K9CA 1K02A 5G2WA 5MHBA 4K38A 1K7EA 2GQ8A 5SWUA 2WNQA 4LVFA 4I9AA 3TAKA 2E6FA 3PWAA 1G67A 5K2ZA 3L66A 3C2FA 2FPTA 4LV4A 3R5EA 3HPXA 5KSWA 4UFMA 2NUWA 4X22A 3NL2A 3S1WA 1TCDA 2Y6ZA 4JGDA 3W87A 1QCWA 1ICPA 3THQA 2E09A 3UNDA 3STEA 5CZSA 4H3DA 1T8XA 4PFMA 4LRSA 3TAOA 3UWVA 3KVKA 5F4WA 4ZVJA 3GDLA 1JJKA 1VYRA 1GVFA 2WJZA 1S5WA 1OX4B 3TA6A 4BFAA 4LUIA 4NUWA 1H60A 2QCMA 5HUOA 4UTIA 3T78A 3NG3A 1BWKA 4UFKA 3W2LA 4K36A 1K8ZA 4AVFA 1P4CA 1AW2A 3LGEA 3LXCA 3MBFA 4KFOA 2CZFA 1D9EA 3P81A 4YLWA 2PE4A 2GJLA 1VJIA 3G1SA 3NQVA 2F84A 1VCFA 4WJEA 4CCDA 4NJGA 3W2JA 3UWYA 4XTIA 1XC4A 3GR7A 1VR6A 2YW4A 4RK8A 2YPIA 3W2UA 2NX9A 2E68A 1ME8A 2VC6A 4O12A 3W85A 2ZYFA 5KZEA 2HS8A 3LXAA 3STCA 3LCHA 5CPOA 3SSJA 3C2VA 1GYLA 1WAUA 3EX2A 5F1UA 1XUUA 1M7OA 3GAKA 2QCFA 4UCGA 2JKAA 2Z0IA 1TMHA 1SZEA 3IV3A 4MY9A 4RLIA 1JRBA 3FYPA 3NZRA 1MEHA 1XBVA 5DCDA 3O6DA 1JVNA 3BGJA 3W74A 3W7RA 3GKFA 2H90A 4LY8A 5D2YA 1LTDA 1N7KA 2FFCA 4O4WA 4ZZ9A 2WPBA 4KKXA 4ADUA 4CLMA 3G0UA 3A24A 3PUDA 1S5TA 5EKYA 2Y70A 4X9SA 1K7XA 1W5NA 4FIQA 4FF7A 4LTSA 3JS3A 4UR7A 3LCIA 3IIOA 5DY3A 1MEWA 4E38A 2XN0A 4WY0A 2C1HA 4IMFA 4O1CA 1QO5A 3DFQA 4JDYA 4JNMA 4JX5A 1GJPA 3VE7A 3GDRA 5CGQA 2B7OA 5G1YA 2ZZ2A 4PODA 4GE8A 1CX9A 1KFJA 1RR2A 1L6WA 2KZHA 3L5AA 3PB2A 2G5WA 3EB2A 4PTNA 4BK9A 2C3ZA 1DL3A 4NX5A 3T40A 2H8XA 3B0PA 1MEIA 3NQ7A 3EWUA 2NXIA 2DJLA 2O7QA 2P10A 1PV8A 1BKSA 2R91A 5FF3A 1OFBA 1QPOA 3C2OA 4UFHA 5DBUA 1LBMA 4K37A 4QIUA 4DBEA 3LERA 2C14A 2Y89A 1Q3NA 4O14A 4K6AA 3DKJA 4YCOA 1Q6RA 5F4XA 1OFOA 4BI6A 2QCCA 4O28A 2AAMA 2EAWA 3BLIA 4LT9A 2CU0A 3HMJG 1QOPA 3LBCA 4Y8FA 5EBUA 1SZNA 4AWTA 3MHFA 3UPWA 1GZGA 3GVGA 1ZAHA 1EX5A 1OFEA 2H8ZA 2YX0A 4NNAA 2YFNA 2TPSA 2F7FA 1L9WA 2WV8A 5DELA 4OHQA 3NA8A 1O60A 3M9YA 5C6MA 4O50A 3EXRA 2FPVA 2QUVA 1LOLA 3W7QA 3TIMA 4FO4A 4PEKA 1LBLA 1YADA 3C61A 4BWLA 4FXSA 3W83A 3NQGA 1YPFA 3W1MA 1EWDA 2V2CA 4UTHA 3TH6A 4EVZA 2E5CA 1HG3A 4YWIA 3LB0A 1H51A 3FS2A 2GVJA 2ZRYA 3MW7A 1L2UA 4H6KA 3NNTA 5HULA 4O8RA 4BF9A 1J4EA 3GK0A 3B4UA 3TQVA 2XN2A 1F5ZA 4JS3A 4EF8A 2QF7A 5G4EA 1TYGA 1I2QA 4Z1CA 3IVSA 1T0OA 3BG3A 5EL1A 4RR4A 1TRIA 3LHZA 5CPMA 1TPFA 5G5IA 1J5TA 2P1FA 1FBAA 3GIYA 3W72A 3C0JA 4ZQPA 3MI3A 3SR7A 2NXGA 4OBTA 5LNRA 3C2EA 5E93A 5TIMA 4UTWA 3G3MA 2EGZA 3M44A 5EA9A 2ABBA 4RCXA 2QCLA 1GTHA 4L4LA 1G6CA 3G1FA 3BW2A 2BWGA 4GXMA 4ICNA 3DFTA 3S1UA 5F2LA 4POCA 3T4CA 2ZZ1A 4L4MA 2J27A 3QM3A 1UUOA 1SO4A 1WYIA 5AHFA 2GQ9A 1X7FA 2QUTA 3DBPA 3HPSA 1PVNA 4AXKA 3TU9A 3W7JA 1H63A 1KFKA 4DPPA 5EYWA 3TFCA 3O6YX 3UZJA 3GXTA 3W7EA 1FWTA 3EKLA 3NVTA 3H55A 1FDYA 2ALDA 5GVJA 4QJ1A 5HR7A 3OIXA 1KFEA 3NQAA 2OCZA 4ZQOA 3M5YA 1ZFJA 1FWRA 5C2XA 4FNUA 2QR6A 2JKEA 2YR1A 3UY7A 3MWAA 4PCFA 2WNZA 3TV8A 2I14A 1O95A 3I7RA 4IWWA 1WXJA 4O17A 1KW1A 2R8WA 5I3JA 3EWZA 3IRDA 5KZMA 4OU1A 3QW4B 1ICQA 4XUGA 4IQLA 2V5LA 4DO4A 4M7TA 3UWZA 2NLIA 5BW6A 2VFIA 1G4PA 1M5WA 3UXAA 4RV8A 3NQ2A 4MJZA 3TUUA 2P0OA 3C8FA 3O07A 4JTGA 3KRZA 3UYCA 1H7OA 1SW7A 3LV5A 4TIMA 1C29A 1O4UA 1GVRA 1XI3A 3HBLA 3WK3A 4XZ9A 3WJZA 3MJYA 4N9EA 4HT3A 3AO0A 1QFEA 4UFIA 2OT1A 2AQWA 5CPLA 3TSDA 3NQDA 3EKZA 5BMWA 3HQ1A 3NL5A 1PHWA 1LRNA 3NXFA 3P74A 2A6LA 1KV8A 2DZPA 1HUVA 3S5YA 3CWNA 3KVLA 4K8EA 5LGXA 2B7QA 1GPWA 3N73A 1FUYA 1LOQA 1YDVA 3W2NA 3RMJA 2VFHA 4WZHA 3LCGA 1VH7A 2TRSA 2I1OA 5FEWA 2QCHA 3W6YA 1DORA 2OX1A 1QDSA 3W1LA 4CQ9A 5F2IA 3QMRA 4C1KA 4JICA 1P1XA 2NXHA 2E5BA 1KM4A 2C13A 2I9EA 1OF8A 2OT0A 4WOQA 3TXZA 4OGZA 3PC0A 1YTEA 3TW6A 1W31A 1A5CA 3GYEA 3CB8A 1IXPA 3LOTA 3ELFA 4MOZA 1EIXA 3QW3A 3G1XA 3M1ZA 5LNWA 1KLZA 3G1VA 1VLWA 4QITA 3L65A 4O16A 3HOJA 3P8IA 1B3OA 3H54A 1R30A 1ZJIA 2ZZ4A 2A7RA 5CSSA 4M19A 4MVAA 1OX6A 4XKYB 1H7NA 3G1YA 3G22A 2VKZG 2Y62A 2E1DA 3LV6A 3CIXA 4QM1A 2V8ZA 3N2XA 3TJLA 5L6UA 3FLUA 4ZQNA 4O18A 4NVTA 4KWVA 2FIQA 3W1NA 3IVTA 4FNRA 3LCLA 5AFDA 1P0KA 3M43A 5KINA 1TB3A 1F2JA 5AHMA 5FEZA 3E96A 1JCLA 3QFEA 4JTKA 3LXBA 2C16A 1NAL1 1TPEA 4IPIA 4N4PA 2H3DA 3S42A 2NUXA 3LHTA 1X1OA 3QMSA 2Y61A 3W76A 2WNNA 1W3IA 3MO7A 4DF1A 4Q33A 3QSTA 1F6KA 3W9ZA 5FF2A 1KBIA 1XDLA 3KAOA 1A5SA 1JCYA 1TQXA 1AL8A 2B4GA 2A85A 3FJ6A 2YCEA 1SW0A 4MYAA 2FJKA 3A23A 4MY1A 5HWMA 2Q8LA 2VEMA 1SO3A 2VENA 5HWNA 4UFLA 1I45A 3P7YA 5AHLA 5G2IA 3QSRA 4HNNA 4CCEA 1FCQA 5AHNA 1YTKA 3EXTA 4JIPA 3QPYA 3B0UX 3VKJA 3WJWA 3DZ1A 4IOTA 2GUUA 1F76A 1AL7A 2CLLA 4I7VA 3P61A 3TMLA 1JULA 2TSYA 2J6XA 3SY5A 4HNUA 3BG9A 1DQWA 3CT7A 3LCFA 3PBUA 3W7LA 1AK5A 3OVPA 4GNJA 3QQ0A 2YFOA 3M6YA 5AC7A 4HIBA 4GWEA 2DP3A 5DLCA 1H5YA 3GB6A 1H1YA 1K8YA 3HG3A 3W1UA 4Z1BA 4EIVA 3C3NA 1N55A 1TV5A 1W3TA 2NX3A 3G8EA 4LVDA 4O4VA 2DORA 4UXDA 3L0GA 4UTKA 3M5ZA 3LRMA 1ZNNA 1TPC1 1FQ0A 3IGUA 3MYOA 4JTSA 5D2VA 2CW6A 1OVDA 4D2JA 3TX9A 5D04C 2V2DA 2YGYA 3BV4A 4FIRA 3MHUA 1V5XA 5LHEA 4MZYA 2CLOA 1TTIA 1U5JA 1OK4A 3IGXA 1I2RA 2PURA 3FJLA 2VEKA 4DELA 1GVOA 3NL6A 2G95A 5FESA 3R2GA 1IXNA 3BPWA 4P2VA 4O11A 3VFLA 1A5BA 2CLMA 3OHIA 4IXXA 3A22A 1KM1A 1O5XA 2B7PA 2H3BA 1RZMA 3VCRA 1VGAA 2R94A 3INPA 5C5YA 4ORMA 1H50A 3FYOA 3UD6A 3G1DA 3HG2A 1OHLA 3PG9A 1VPXA 3NQ8A 1OX4A 1RQHA 4NX0A 2Y85A 2R14A 1ICSA 3ATYA 2CZDA 4LS1A 3LTPA 1J2WA 1LRTA 1ONRA 4ZL1A 3HIJA 1IF2A 3U2OA 1PIIA 2VFEA 3P62A 2BLEA 1WDWA 3UY8A 1JCNA 3ABQA 4UMBA 5D30A 1ZAJA 3S5OA 3E9AA 4S2CA 4DEFA 5DBTA 1KM3A 3LHVA 3S5NA 3DXIA 1VHNA 4LVGA 2DJXA 1K8XA 3U8GA 4MFDA 2EPHA 1PCKA 1DV7A 4Z1DA 4K39A 2GVLA 1K3UA 3EX6A 4GUHA 1LDCA 4R33A 4TO8A 2A21A 2X30A 1PCWA 3NQFA 4AF0A 1SSDA 5CZ0A 4C1LA 3S1XA 5HMSA 5I3KA 3OEXA 3TE9A 3TFXA 3WK2A 2ZBTA 1DJNA 5AHIA 3AJXA 4AWUA 3MUXA 4N6FA 7TIMA 3GDMA 3NQCA 3TK7A 4X3ZA 1QOQA 3LRLA 4GUIA 1GTEA 5H2ZA 1DVJA 3W07A 2J9XA 3DFPA 2Y63A 2GOUA 5D2XA 5G1TA 1B4KA 3EWYA 4HHPA 1SPQA 4FNTA 1LCOA 1W54A 2WOQA 4PA8A 2A1YA 3DFOA 3SFKA 3LCXA 1G4EA 3L5MA 3G1HA 3GAYA 3KX6A 2ZZ5A 3K30A 1VCVA 3IVUA 4UUIA 3P60A 4JEQA 3I6RA 2ZRUA 3NDOA 5CZJA 5CKSA 3E02A 1FWSA 1TTJA 2C18A 2NV2A 2C15A 2GVGA 1JUEA 2NUYA 4JYFA 1S3HA 1EA0A 5U4NA 3STGA 3W7HA 2WSRA 4PC8A 4O10A 4M6VA 1VCGA 4JTHA 4N9DA 1ALDA 3TSBA 3SGUA 4ZMGA 3DHFA 3GNDA 3PVFA 3LCWA 2CLKA 3PSWA 4A22A 1KTBA 3DKLA 3UQNA 3GZ3A 1HO4A 2XFWA 4O57A 4MFEA 3G24A 3TQKA 1SUXA 1ZY9A 4MZ8A 4LVBA 2Y7GA 1XFBA 4N6EA 4O1DA 2VXNA 2FDSA 1YXDA 2XN1A 2A7NA 3T7VA 1VYPX 1YTDA 1XM3A 4FNQA 3W7PA 4MZ1A 1K03A 1LM1A 3HO8A 4IXHA 2QDGA 5FF7A 1I2OA 3D0CA 2YW3A 1SR9A 1I4NA 3E12A 1N8FA 3TJXA 5DCEA 2RDTA 4AAJA 3NO5A 4DBDA 5FF0A 3EX3A 4PH6A 1VYSX 5AC8A 3MP3A 1JUKA 4XQ6A 4ZQMA 2PRLA 2YDAA 1T96A 1F73A 4S1FA 1F05A 3F4NA 1ZAIA 4CQ8A 4GC4A 4FX8A 4BR1A 4EF9A 2CLFA 1W1ZA 3W1PA 5HINA 2ZFAA 5G4WA 4ML9A 1E51A 3DFSA 5LKYA 2JBMA 3NYZA 3SIZA 5TBOA 4JY9A 4JTIA 1FXPA 2ATSA 4FHAA 2B0MA 4CNNA 5LGZA 2ZRVA 3NQ6A 3W1AA 1HTIA 2QAFA 1IXOA 2E6YA 5DY2A 4TMBA 2C0AA 1UUMA 5FEXA 4WQ6A 3BK0A 2JGYA 1ZHAA 1DQXA 3W23A 3CU2A 1SO6A 4E0CA 5K4XA 3L5LA 3MMTA 3QZEA 3CPRA 2QCEA 3W7KA 2OZ0A 3DU0A 3BGGA 2D73A 1OFDA 1TIMA 4ONVA 5D02A 3THAA 1Z48A 4XBSA 4XWUA 3Q37A 1I2PA 4MKNA 4R53A 1NF0A 1R2RA 3W7OA 3WK0A 3NOEA 4LW7A 2Y88A 1ME9A 1I2NA 4GBUA 2ZRZA 1KFCA 5J5RA 3B03A 3ZS4A 1JRCA 5U7SA 3PULA 4IMCA 4BWLC 4IX0A 4LWWA 3N2MA 1KM6A 4NU7A 3QF0A 2H6RA 4WXYA 3W70A 2V30A 4N2YA 4FNSA 4WY0F 3LDVA 3M7WA 4G1KA 4JTEA 3O6CA 1Z42A 1IIGA 4JTUA 2HSAA 4LS2A 4X2RA 3SW6A 2CLEA 1R2TA 5LHFA 5D2WA 2YYTA 5D2TA 4EWND 1H7XA 1YXCA 1L6YA 1W8SA 1QAPA 3W7DA 2V2HA 3PR2A 3R89A 1LROA 4JN6A 4O1AA 4K7VA 5AYZA 1R46A 4UC5A 1RD5A 1TREA 1F7BA 1EP3A 3CWOX 4YL2A 4JX6A 4JDBA 2ZA1A 3BVJA 2RHGA 3TROA 3QRHA 5K4ZA 3R13A 5LZLA 1AW1A 2ZRXA 3FEMA 3DENA 2DU2A 2Z1BA 2FPYA 2X1RA 3SGZA 1HL2A 3LX9A 5TQLA 1VHCA 1XL9A 4OQVA 3CLMA 4KWWA 3P80A 1PL9A 1W0MA 4DQWA 3FOKA 4Z0SA 5HWJA 4A3UA 5HR6A 2JKPA 2QKFA 2WSYA 1Z44A 1KTCA 4Q32A 4HNTA 1GYNA 2QCGA 1ME7A 1UBSA 3OVRA 3JR2A 2ISWA 4AWSA 2Z2UA 3GR8A 3UWQA 2GJNA 1KA9F 1KM0A 1SZGA 2ZZ3A 3M47A 3T44A 1OYAA 4M6QA 3NGJA 4GFSA 3N9SA 4NJJA 4IMEA 4MIMA 5HQEA 4DXVA 3GDKA 1C9DA 1NSJA 4M7SA 1ML1A 4GUGA 1GT8A 5C55A 4QSHA 1OFRA 5FEPA 3LHUA 2YZRA 2DZWA 1SW3A 1WX0A 3QYQA 1TPVA 1LLWA 5DN1A 3M5VA 3V75A 4R7JA 5IM51 3VE9A 1QWGA 2PRHA 4UNKA 3W3OA 4Y90A 3TR2A 5D03A 3MYPA 4RX0A 4R34A 1M6JA 3KRSA 3G1AA 2Y7DA 3Q2DA 3EX4A 4U28A 8TIMA 1G7VA 3A9IA 4KFPA 2W0UA 1UASA 4WX2A 3A21A 4QAIA 4OV9A 1XUZA 2E6AA 3M0ZA 2A5HA 3PY2A 4GUJA 6ALDA 3C56A 1OYBA 3NPWA 4AF0B 4WY0B 2JGQA 4RZ4A 1LBFA 1GG0A 1WBHA 4JTLA 4LC6A 3NM1A 1X6UA 1TJRA 4Z0JA 3A5VA 1VRDA 2C19A 3DHDA 5AHEA 3LBMA 3NPXA 2PC4A 3JRKA 4RXGA 3I7QA 5A5WA 1MO0A 4UFJA 3W1QA 3IIPA 3S5ZA 3MHGA 2WO5A 1GWJA 3Q94A 2Q3RA 3P67A 4A2RA 1LLZA 4YXGA 4IPJA 2HS6A 1EP2A 2E5DA 2YXGA 4O52A 4TR9A 1PE1A 3W1RA 4LRTA 2Y7EA 5BOOA 3W1TA 4Q4KA 1F6PA 3GNNA 2DZSA 3W7CA 5CSRA 3B04A 2V9DA 3PBWA 2ZQ0A 1FCUA 1RVGA 3TKFA 1BWLA 4JX4A 1W56A 3ABRA 3BW3A 4LS0A 2CZ5A 3UXDA 1YPIA 3PM6A 4NZJA 2X1SA 2QAPA 4PL2A 4AHPA 3NAVA 3TW7A 1XKYA 2WKJA 4HSOA 4JXCA 1ZCOA 5KMYA 4UR8A 1NVMA 1P5BA 2VELA 3FA5A 1T99A 2HTMA 2ZA2A 2EF9A 4ADTA 1A50A 5DXYA 4ZQRA 1THFD 2GPTA 2QJGA 3IGSA 1HFBA 3WJYA 3E0IA 2ZRWA 3W88A 5AYXA 3QC3A 4CNOA 1D3HA 3GX9A 3LM7A 3BARA 4Z08A 2X16A 3W7MA 5LNUA 1O5KA 1VLIA 3G18A 4JYDA 1X8FA 3L68A 1Y0EA 1KV5A 5I3FA 4WXZA 2Z6IA 4RZ5A 1KM5A 3QEZA 1OFPA 3W2MA 3USBA 5DXXA 3O15A 2NV1A 4FX6M 1YLVA 3CEPA 3TSMA 1OFQA 1FDZA 1H62A 3PAJA 2FTPA 4LC8A 1QNVA 3BG5A 3UPBA 3HG5A 4CQAA 1FDJA 3WFAA 4N9BA 3N3MA 1EEPA 1TTPA 3Q58A 4NJHA 4TU1A 3G0SA 5CPNA 1H7PA 1TPB1 4NNCA 1IXQA 2TMDA 3TMQA 1V7YA 5CZTA 1FWWA 1UJPA 2GQAA 4RXFA 2QEZA 4FXRA 1WOAA 1FCBA 3HB9A 5L9FA 2O7SA 2NWRA 4XTDA 2RDWA 2YSWA 5ABTA 3R12A 3DI1A 4MYXA 1RPXA 2A4AA 1UCWA 4OWGA 4AH7A 2OJPA 1YXYA 3O06A 1FX6A 4LNYA 3PBYA 3T55A 1W5MA 2J24A 1O94A 1KFBA 4HKPA 2ZDRA 1OABA 3LTSA 2TYSA 2CLHA 3FFSA 4O0KA 1Q6LA 4HSNA 1WBJA 4NJKA 3OVQA 5E1QA 3KRUA 4JYEA 4IGHA 1EPXA 1LP6A 1LYXA 1FWNA 1S5VA 1VC4A 1TPH1 4UMCA 3S6DA 1H7RA 1LOSA 1ZALA 3PG8A 2V81A 4AHOA 3MI6A 3S0CA 1IIHA 3P8JA 4NJIA 1VS1A 2J9YA 4XKYA 3EWXA 3MBDA 3EWWA 1R47A 2FB2A 3QMTA 3LI1A 4UTTA 5D32A 1TTQA 1NF7A 4UTLA 1Q6OA 3TC6A 1NFBA 1SFLA 1GEQA 2E6DA 4UNLA 4BI7A 3W75A 3C4UA 4HPJA 1GQNA 3GLCA 1XDMA 1FCVA 1EUNA 3I68A 4Y96A 1ADOA 1JCXA 4NT0A 4UTTC 4MUZA 4NXKA 1SSGA 3OG3A 5KITA 4MY8A 4HNVA 1EUAA 5F4SA 1LRQA 3TXVA 4UTJA 3UWWA 3S1VA 4FEZA 4OE7A 1KFLA 1GOXA 3IEBA 5K7JA 1CW2A 2NWSA 1A5AA 1M7PA 1H1ZA 3CHVA 4YMZA 1WOBA 5A8GA 1QPRA 4CCCA 2UV8G 4QQ3A 1W3NA 2W79A 3RF9A 3HGJA 3NQMA 5T26A 5LNSA 1XXXA 1L6SA 3LTYA 2VFFA 1W37A 1W5QA 2V5BA 4O13A 3NZ1A 1TPUA 2J9ZA 2Q3OA 5J5DA 1G4TA 1SO5A 3PUOA 3FKKA 4I7WA 3W71A 4A29A 1RQEA 1BTMA 4AHQA 1RV8A 2DZVA 1DKWA 3B8DA 3N34A 4OV4A 3RU6A 3NPUA 1XBYA 3RNDA 4JR5A 3O05A 4MPQA 3FKRA 3NR0A 3CEUA 4O54A 3IIZA 3S9YA 1WQ5A 1QO2A 4WD0A 2RH9A 3HF3A 3ZR4A 2V82A 3DI0A 4S2BA 4W9TA 5K3VA 3CC1A 1TQJA 4DF0A 2IQTA 3O8AA 1H7WA 3KVJA 3MP5A
chains in the Genus database with same CATH superfamily
4HPHA 1QMLA 3WY1A 1PXGA 3M5XA 4GUFA 3G6MA 1MW1A 4GY0A 1SQ7A 1DIDA 2ISDA 1M53A 1Q45A 3LPGA 2NX1A 4IUOA 4D6DA 5HUPA 2VT0A 3O0FA 1YDYA 4AZGA 1R7AA 2WLZA 4XZLX 5HDRA 3BLEA 3FSUA 2A0NA 3FNDA 2XM2A 4DJFD 1TA3B 2E77A 2WSPA 5LIUX 1W8GA 2F8QA 4LUJA 1K9FA 3CZ8A 2Y4SA 5FCZA 2EG7A 3FV9A 3M41A 1VFFA 4QGCA 3FIGA 5AB3A 4O53A 2YL9A 3PJUA 2NQ9A 2QDEA 4PMJA 4ADSA 2ISFA 4HOXA 1ECQA 2YOCA 1EGMA 3KVMA 2YA2A 5BYWA 4CNPA 4RE2A 1KXVA 4UIOA 2Q71A 3I3BA 1OJXA 4GD0A 3ZOAA 5HJLA 1NARA 1TPWA 2VOMA 3CIWA 2WMHA 3DEQA 3W84A 1VFTA 4XBKA 4C6LA 1K1DA 1JCMP 3VGBA 4EKJA 4EOUA 2AQVA 1R2SA 2ZZ7A 1JD7A 3EKGA 5EMUA 3W4RA 1KM2A 5EY5A 3HJZA 1LJYA 1MXDA 1G5AA 1SFTA 4QHRA 1D8CA 1E0WA 1RY0A 1MRQA 4IHCA 3LHYA 2QJHA 1RUSA 1YYAA 5K9XA 1TRDA 4O19A 4DJDD 1J0ZA 4D6GA 3G2GA 3S8HA 1TV3A 4QXIA 4AG0A 3MUCA 2CFFA 1TKKA 5A8QA 2VFDA 5FOOA 2YYUA 4ALDA 5I00A 2P5NA 3EOEA 1VF8A 4IJCA 1R3QA 2VHLA 4ZB2A 2OSWA 1Z6KA 3RM8A 3E0LA 3V1PA 4JEJA 2IQ0A 4L4OA 2YA1A 4JTDA 4PTWA 3C0LA 3AMDA 1PS9A 1G69A 5H8UA 3QPZA 4R88A 1TV7A 1EZ2A 3CGTA 3R25A 1K4HA 1XYBA 1DJQA 3CHCA 5KTLA 2FZDA 2BZNA 5C9RA 4MLRA 3REQA 4UTMA 3EDJA 3WH6A 1B4EA 1CBGA 4P7QA 1DWIM 4PRRA 2AMGA 3HV9A 3H8AA 4CNSA 2C1IA 1XYZA 1C92A 1HJUA 3OLDA 4HBKA 2BHUA 2QCDB 2VP8A 2DZXA 3TC7A 3I7SA 3WJXA 3H24A 3RG6A 4H04A 1LWHA 1XH2A 4LU0A 3VNJA 1SFJA 1V6XA 4OUEA 2G97A 3W38A 1RBAA 1PHQA 4GH1A 5AYYA 4I90A 1VZWA 2WZMA 1DP0A 1JQVA 1VENA 2OYLA 4MB5A 1RK6A 3ABOA 3VNDA 3EB3A 1SMDA 4TX9A 4WUIA 5BNKA 1OYCA 4GRSA 3EMZA 2ZZ6A 1GVQA 1MZHA 1XH0A 3LLDA 1XQLA 2PD9A 2PFHA 1XSIA 1XIHA 1KBJA 1TO3A 1DWFM 4OOUA 5F2GA 3ZVIA 1P6BA 1V0NA 1G9HA 1QW7A 1C8VA 1JAEA 4Y6GA 4MHBA 3FSTA 2Z6JA 3BSHA 2Z28A 1UD6A 1AFSA 1OX5A 5TF0A 2FVLA 5AOUA 3AZSA 3O16A 4S3BA 2G3IA 5FACA 4YVVA 4L64A 3RCMA 3URBA 5CCZA 1J0KA 2GL5A 3LI0A 1N82A 3OB8A 1Q6GA 3DH7A 2PF8A 4JTFA 4R85A 4A21A 3L0NA 4F2TA 2RKXA 2WMIA 3KOZA 3KCOA 2DSUA 1TX0A 1VEPA 4N9CA 3S5SA 3PPGA 2CNCA 2BX7A 1HO1A 3P5ZA 4QNWA 1OC7A 1QUMA 1UR1A 2DUZA 3QY7A 2O0TA 4EWJA 3ZO9A 4DWSC 1V0KA 3C6CA 1A0CA 2ZUMA 1SU5A 3NQEA 1E5JA 4MPKA 1NOUA 3I65A 5C9WA 4W8AA 4O0ZA 1E6SM 2X1IA 3AU2A 1QBAA 2DZUA 3LRKA 3WF1A 2X1TA 4DJFC 3TWBA 5DCBA 5CQ1A 1S1RA 4CN1A 1MNSA 2QYGA 1UPMB 4R27A 5HNRA 1B5TA 3EYPA 1JR1A 4GI4A 4AX7A 3B0VC 1FFRA 3TDFA 4E2OA 4B9YA 3W2KA 4DF2A 4RNHA 2V67A 4US6A 1P48A 2OR2A 2PDMA 2W63A 3BSGA 1OIMA 3KZPA 3ABSA 2BSLA 5AKQA 1AMKA 4P61A 4JTTA 1E9ZB 2PWEA 2OMAA 4XAPA 4M6UA 5MHBA 3A13A 1K7EA 5SWUA 4PTDA 3TAKA 4GQ0A 3UYIA 4XIMA 1YIXA 1R8LA 1UWUA 2X41A 3SDOA 2FPTA 3R5EA 3VIOA 3HPXA 3MCOA 5KSWA 4UFMA 5REQA 3TYZA 3NL2A 3W87A 1ICPA 3LEPA 4UWMA 1VJZA 2W9MA 3STEA 4W5UA 3WMLA 1KGWA 1RVKA 2VURA 2P88A 4LRSA 2WC7A 3CQKA 1E9LA 1EGZA 4EPBC 1JJKA 3OYXA 5HMEA 2ZUVA 4DI9A 1EJXC 1KCKA 4NUWA 1W1IE 3UESA 4Z2LA 1W3HA 4FXJA 2RJHA 1NWRA 3W26A 1LQ2A 2PD5A 4D6IA 1J0HA 3MANA 4UFKA 3W2LA 3WLLA 2FMOA 2QIIA 2WPGA 3H2CA 4UNIA 2PZ0A 3LGEA 3OGVA 4DLFA 3LXCA 2VO5A 4KFOA 2ASHA 4QX4A 2ONEA 1YQ2A 3N2BA 2PE4A 3NYDA 3NQVA 4PTMA 2AKMA 3W2JA 2YPIA 3W2UA 4FPSA 4BA0A 2E68A 2XGBA 4O12A 2VX6A 1CTNA 4M82A 3ZLHA 5CPOA 2DGAA 1M7XA 1TMQA 1WAUA 3N13A 1CPUA 4PMXA 5HJXA 3ZSTA 4IFKB 4JCMA 1EJSC 3RIKA 1MZRA 2JKAA 2P0IA 4NAFA 3BE7A 1M1BA 1JRBA 4XVEA 3UZYA 3NZRA 5LIWX 3WLSA 3N4FA 1KKRA 2NQLA 1PYMA 4BEQA 3GKFA 3U5YA 1LTDA 2Y8KA 4U2ZA 2FFCA 2B81A 3V4BA 4KKXA 2VDIA 3G0UA 3A24A 3WQFA 2Y70A 3GSMA 1E71M 3GHTA 1NDWA 3MVTA 4LTSA 1NU5A 3VPLA 2UY4A 4UR7A 5DY3A 3H4XA 4GIYA 3COTA 3GTXA 1DJXA 1J8VA 4JDYA 3VE7A 1JYVA 3M0KA 4DAFA 2ZZ2A 1FWIC 2PDWA 4BS0A 2KZHA 2G5WA 4C6BA 2OVLA 1DL3A 1JNDA 4GC3A 4HU0A 4GXWA 3WEOA 2ACSA 3E6EA 2NSXA 1TZ9A 1GVEA 1W1TA 2F6UA 4WF7A 3RJXA 2OO6A 4WGHA 5JIPA 4Q8NA 1BKSA 3QHOA 2R91A 3O7UA 3G6LA 2OB3A 2WVTA 1QPOA 4UFHA 4EK7A 4I5RA 1J0IA 2C14A 2Y89A 3WH9A 4O14A 2ZXBA 3DKJA 4FXFA 2QCCA 4FF5A 2AAMA 1MWOA 1PUDA 4LT9A 2J47A 3VO0A 2CITA 1QOPA 1ELSA 3WN6A 2QNEA 4G7EA 1GZGA 3GVGA 5HBFA 4NNAA 1HKWA 3U9IA 2F7FA 1L9WA 2INEA 5DELA 4O50A 1DWGM 3WQDA 2W27A 1B90A 3V0SA 4L61A 4PEKA 1DJGA 1LBLA 1XYMA 4J3XA 3W83A 1HJSA 3NQGA 1TZZA 3PJWA 4NIRA 3U3HA 3W1MA 4DJED 3TH6A 1NELA 3CUFA 5BXSA 2ALRA 3LMZA 1OADA 3S9ZA 5I2UA 3PZOA 1ADSA 4JFTA 3NNTA 3B4UA 4C5YA 2XN2A 1H4PA 2GWNA 1VBHA 2J8TA 2J7HA 1Q7QA 2QF7A 3DIPA 6A3HA 3UCQA 3IVSA 3VDHA 3EA3A 3LHZA 5FJRA 1TPFA 3IUHA 3AICA 1J5TA 3W72A 1FBAA 4LANA 4AISA 2G3JA 1EGVA 2DSKA 5LNRA 4RNJA 4FLSA 5TIMA 4UTWA 2A3BA 2EGZA 5EMKA 4L4LA 3P0WA 2BWGA 3I4EA 2CHRA 2PGFA 4X60A 3W24A 3DFTA 5F2LA 4AYGA 3CPUA 3H22A 3VGDA 2ZZ1A 4L4MA 1VD6A 4LBUA 3OQEA 1X7FA 5C7VA 3I3EA 3AROA 1UKTA 3HQPA 1XV8A 3QGKC 1XRFA 2VL4A 3UZJA 1QJWA 3GXTA 4JQ2A 1Z9AA 1FWTA 3W7EA 3V7PA 6XIAA 3JU2A 4QJ1A 4IT1A 3M64A 2DW6A 3EAUA 4ICMA 4QE5A 4L1GA 4MF4A 1FWRA 2PB1A 2QR6A 5JH1A 4AFYA 1A5OC 4W93A 3NVDA 3MWAA 3HFYA 4PCFA 3TV8A 1W91A 2OKTA 1UWQA 3I7RA 3CHFA 1KW1A 2R8WA 3EWZA 2IPWA 2OEJA 2Y1HA 3R10A 4M7TA 3WNNA 3KHDA 1MW0A 4I3GA 3EDDA 3E2SA 1QK0A 2O9OA 3UW6A 2VFIA 4L9ZA 2YLLA 2FGBA 2QVNA 4JTGA 1XIFA 1WDRA 3O07A 2IXUA 3LV5A 3TOPA 2XIOA 1O4UA 3B0YA 4NAEB 3MJMA 4XZ9A 1XLKA 3MUIA 3MJYA 4N9EA 3CHDA 3CHEA 1XIJA 2VTFA 5CPLA 3WLJA 3U5UA 3EKZA 3NL5A 1PHWA 2GSHA 4WKHA 4OFCA 1FRBA 1HUVA 3CNYA 4A4AA 3KVLA 3FEQA 5LGXA 2B7QA 3NZGA 1FUYA 1B54A 3W2NA 1B1YA 5FEWA 2I1OA 2QCHA 3W6YA 5AZ1A 1DORA 2BY0A 4JBRA 3GVRA 2CC0A 1TUFA 3QMRA 4V15A 4JKMA 3F5KA 4CN4A 5D9NA 2OWCA 4PBEA 2E5BA 1KM4A 2ZUSA 2OT0A 3TXZA 1J6PA 3PC0A 3VOJA 2J7BA 2POZA 2HBXA 2PDGA 2RAGA 3GUGA 3KLKA 3GYEA 1TWZA 3LOTA 1E1EA 2ANUA 3HURA 3QW3A 3M1ZA 2QDDA 1VLWA 3UWEA 3CB3A 4GKTA 4XISA 2ACQA 2AL2A 4MVAA 4XKYB 1H7NA 1RBLA 4D6CA 5DMMA 5M17A 4ZQNA 5D8WA 4KWVA 3WLNA 4FNRA 3M43A 3GDBA 1UWIA 4IIDA 5FEZA 1C3FA 3IANA 3WLPA 4TXEA 4JTKA 4JHOA 1FHVA 1NAL1 1OC5A 3S42A 3JVAA 3R43A 3QV9A 3UG8A 1X1OA 5EU9A 1W3IA 4DWSD 4DF1A 4RE3A 1F6KA 2ZXAA 4OECA 2BOEX 2XUCA 3WELA 1B3WA 2WNWA 4MYAA 1WP6A 4E4UA 3SBFA 2BVYA 1M3UA 3Q4DA 2J13A 2VENA 5I0DA 5HWNA 2OQYA 4UFLA 2JIWA 1HGYA 3H23A 3CZKA 5AHLA 2XSBA 5MKGA 3QYSA 3QSRA 1KFWA 4INFA 3EDKA 4QE4A 2HROA 3QPYA 3DG7A 4QS6A 3B0UX 3WJWA 3AIEA 2GUUA 5ABEA 3UXLA 3P61A 2ZUNA 4GVGA 4EPDC 2EBNA 5H1WA 3APYA 3DFYA 4F66A 1DQWA 1HJVA 1MYRA 4PCNA 3MUY1 4CD4A 3PBUA 3BWWA 3W53A 3VD9A 2FZNA 2YFOA 5AC7A 3PZUA 4DZAA 1H5YA 1H1YA 3W1UA 3C3NA 1N55A 2NX3A 3VIPA 4LXFA 3WLKX 5FSEC 2X8RA 3H7RA 4EX4A 5E09A 4O4VA 4MKSA 3AI0A 2DORA 4CQDA 4UTKA 4LAZA 1TPC1 3U57A 4XD3A 3F7JA 1W2PA 3MYOA 1HP5A 2CW6A 3TYDA 4D2JA 2YGYA 4W7VA 4FIRA 3WFZA 1V5XA 4QS5A 1YW1A 5LHEA 4MZYA 3H7VA 1POKA 5EFDA 1OK4A 5LIXX 1I2RA 3TLQA 4DELA 4I6VA 5FESA 1OGBA 1IXNA 5CJNA 4O11A 2PDHA 2CLMA 1O1ZA 2HWGA 3OHIA 1QVBA 2H3BA 4H9XA 4PMNA 1H09A 4C7DA 4HA1A 1VPXA 3NQ8A 3VILA 1ICSA 3VKCA 2CZDA 1H41A 2GGIA 1J2WA 4YYFA 4ZL1A 1WDDA 3EEZA 3HIJA 1Q85A 1IF2A 3GNOA 2DUXA 2VFEA 2BLEA 1WDWA 3UY8A 1UKPA 4YVXA 4AD4A 3TLLA 3B9NA 1ZAJA 3S5OA 3E9AA 3WQVA 1ONXA 4MJ2A 2NQHA 3BICA 1A0EA 5DBTA 1KM3A 1KR1A 2DJXA 2GSEA 5A8PA 1BG9A 3M46A 4YJ5A 4ZOEA 1J5SA 1PCKA 2W92A 3RCYA 5I07A 3VOFA 4GUHA 4TO8A 3VDCA 4R33A 4DJDA 1DJYA 3NQFA 1SSDA 2D20A 1XRTA 3L4YA 5REQB 3TFXA 5DF0A 1DXFA 3WLMA 3V1HA 2JEPA 4YPJA 2VDHA 1U33A 4AWUA 1U1HA 2IQDA 3NQCA 2VX7A 4KRZA 1OQFA 1B3XA 1E6NA 4GUIA 5CJMA 3H6OA 5H2ZA 3W07A 3DFPA 3D6NA 4S3JA 2Z29A 1F6YA 3IS4A 4XAFA 3RR4A 4XD5A 5G1TA 1SFSA 1S38A 3CBWA 1LCOA 1FP8A 4DUVA 4PA8A 3SFKA 3LCXA 2QW5A 4GY7A 3GAYA 3KX6A 2XVKA 2ZZ5A 3K30A 1XIEA 2WXDM 4F40A 1S39A 2CHNA 4HU4A 2NV2A 3R8GA 2C15A 1JUEA 3QR1A 1OIFA 2HBVA 2CEQA 3STGA 2Z7GA 3GG8A 4PC8A 3I6EA 4FP1A 5CAHA 1FH8A 4N9DA 3XISA 1ALDA 4CQCA 4B15A 3RPMA 2PA6A 2CLKA 2QGHA 3PSWA 3MCMA 3WBWA 3OIHA 2XFWA 4O57A 1ZY9A 4MZ8A 5I24A 1XFBA 2FDSA 3SUVA 1NWTA 4GZ7A 2OYMA 1YTDA 3MB9A 3GRIA 3VNMA 4PBGA 4Y9MA 5FF7A 1SR9A 1I4NA 3WIJA 2VNCA 4AAJA 1JGIA 4KCUA 5M1TA 3EX3A 3VXGA 4PH6A 1ISWA 3LLXA 1JUKA 3IJQA 3LGGA 2PRLA 3VGGA 1EC8A 1T96A 2OELA 1XLGA 1F05A 3F4NA 2F2KA 4ZO7A 4EF9A 4RL3A 2VC9A 1E51A 1W1A1 5LKYA 1ZBKA 4JTIA 2WWDA 1QPKA 3AIQA 2Q6ZA 4TV6A 1IXOA 4NYUA 5DY2A 2C0AA 3T0TA 1UUMA 1PDYA 3W23A 3SUUA 3TTOA 4L1XA 4CQBA 1R3TA 1CYGA 3CQIA 2VD9A 1UP0A 4EACA 3RUBL 3W7KA 4CKQA 1QNQA 3BGGA 5GJNA 1TIMA 4ONVA 3WDPP 1WKEA 4MWAC 5D02A 4XSMA 4Q4PA 4XWUA 4MWAD 1J2BA 3TW9A 1RCQA 5GQBA 4MKNA 2I17A 3W7OA 1JGMA 3WK0A 1QHPA 1GKQA 3VIFA 4DWDA 3W0KA 1H0GA 4AEEA 1MW2A 3GG7A 4FLOA 1CGUA 4PUMA 3B9OA 4LWWA 1CXHA 1KM6A 1T41A 9XIMA 1UC4A 2JFEX 1D7FA 4K8GA 3EPOA 3UXKA 5JUVA 2DIJA 1R6WA 4G1KA 5FJTA 1NDZA 3RLGA 1IIGA 2E9MA 3O6AA 1YNYA 2VZVA 4L65A 4C6CA 2CBIA 3PK7A 4B5XA 5D2TA 4RZBA 5EB8A 4CD8A 4Q22A 4XG1A 4S23A 1QAPA 3VZXA 1GW1A 3DBNA 3N4EA 3PR2A 2HE8A 1GEHA 2HXUA 4O1AA 2J7DA 3IK4A 3C3UA 3CZEA 2UBPC 4MB4A 1TREA 3CWOX 3RM4A 4JX6A 4D1JA 4JDBA 1KXQA 3PP7A 2RHGA 1ZBWA 3CO8A 3QRHA 2D3NA 3GU9A 3DENA 2AGTA 3QBUA 2X1RA 4ZXOA 3SGZA 2YB1A 3ITCA 1HL2A 3LX9A 1Q6EA 1VHCA 5AY7A 1K70A 1Y5WA 2PU1A 4OBSA 3FOKA 4WSKA 3RM9A 3N4AA 1MVYA 3V0UA 4IGNA 4A3UA 3WQOA 1Z44A 1YRRA 1KTCA 1XC6A 4A8NA 1GYNA 2QCGA 2YJQA 2VGBA 3E1F1 1V8EA 2Z2UA 3GR8A 3UWQA 1MFUA 3VX1A 2Y24A 4ICCX 4M1BA 5CG0A 3A9BA 3PJTA 1OYAA 3T44A 1GKPA 1WPCA 4GFSA 3N9SA 3AMLA 4IMEA 4MIMA 4CVWA 5BXRA 1O68A 5HQEA 4M7SA 4LAMA 1ML1A 1GT8A 5C55A 4QSHA 4KQNA 3WQ4A 3FVMA 1OFRA 4R3UA 4CUCA 2INFA 3V75A 5C70A 1R87A 5IM51 1QWGA 2J7CA 1VAHA 4F0SA 3W3OA 1JL8A 2BBFA 1OC6A 4ZEPA 3VCCA 3SRHA 3KRSA 4KEZA 1AJ0A 1WZMA 3DG6A 4UB9A 2Y7DA 3Q2DA 2VC5A 1LUCB 4CD7A 5CBBA 1EBGA 1UASA 4FZIA 4WX2A 2O9RA 2YCIX 2PP3A 2E6AA 1F3WA 2EPOA 2DQXA 3PY2A 4ZODA 4AYSA 4MAVA 4EPKA 3WH8A 1OYBA 2ZX6A 3ERPA 4WY0B 1UP2A 1YPXA 1GG0A 1I6NA 4EP8C 1WBHA 3LGDA 4JTLA 4LC6A 1X6UA 1TJRA 3RX2A 3MZNA 1J0JA 3NPXA 2ACRA 1REQA 2WVSA 4DAIA 3R11A 2NT1A 1YMYA 5A5WA 4JIEA 5FIPA 3TA9A 3VM5A 2DV0A 3EOLA 3S5ZA 2PPGA 2INZA 1E0TA 2WO5A 5I5RA 4FR1A 1LLZA 3UA3A 2PUZA 3ZT6A 2YXGA 3MSRA 2Y7EA 5BOOA 3W1TA 1F6PA 3GNNA 4NZ4A 4LYRA 1US3A 3W7CA 5CBIA 2FGLA 3AYTA 4J3VA 1N2VA 3PBWA 2ZQ0A 3TKFA 1BWLA 5XIAA 1PKMA 1W56A 3ABRA 2CZ5A 2BASA 4TVUA 4IPPA 4IL2A 3S47A 3FCPA 1TWDA 2PMQA 1JZ3A 1XKYA 1JF6A 3S1GA 1ZPTA 1CB2A 4U10A 5KMYA 2AOSA 1P5BA 3FA5A 3TEVA 3TYAA 2PGRA 2EF9A 1A50A 1FHDA 4ZQRA 2GPTA 2QJGA 3WH5A 1XLJA 1VFHA 3WD2A 5ABHA 5LXEA 1RAKA 1XYLA 2EEXA 3BARA 3GH7A 3L4XA 4C7FA 1RP8A 1VLIA 2L5HA 3N2CA 1GHRA 4UCFA 7TAAA 2G50A 5G4HC 4PYSA 1BD0A 3QEZA 4XD6A 2BG5A 3USBA 1ZLPA 3O15A 2NV1A 1YLVA 1OFQA 1FDZA 4HK5A 3TJ4A 3UPBA 2VEFA 3HG5A 2HNHA 4I8YA 4OVXA 1TTPA 3N1AA 4M8UA 4NJHA 1OZMA 2MANA 5CPNA 1H7PA 1V7YA 3WD1A 2VM8A 2BNJA 1UJPA 4RXFA 2QEZA 4FXRA 4H8VA 5JIWA 1FCBA 1UD4A 3DDMA 3DYOA 2RDWA 2YSWA 2I5GA 3ZYZA 2G8ZA 4GVHA 3KBJA 1J10A 3DI1A 4MYXA 5JXQA 2A4AA 2C71A 3BLOA 3PBYA 3T55A 1W5MA 3VKDA 1JFXA 3M0IA 4HKPA 1OABA 3LTSA 3N2TA 2V68A 3STPA 4NG3A 3OVQA 2PU0A 5E1QA 3KRUA 3WLIA 1FWNA 1S5VA 1VC4A 4UMCA 3S6DA 1LOSA 3PG8A 2OQHA 4PUKA 3PNUA 3G77A 4OOZA 3ISIX 1X7IA 5CEWA 1IIHA 3GR4A 3WKZA 3P8JA 3ZJ6A 1I1XA 1QW9A 3R4IA 1VS1A 4KEVA 1R3YA 3MBDA 1R47A 2FB2A 4X9YA 1UC5A 4MSSA 4UTLA 3QHMA 4BI7A 1NFBA 1SFLA 1GEQA 2XH4A 2R1MA 4HPJA 1UIOA 2VR2A 1EUNA 4KWSA 5DFAA 1JCXA 1XLFA 1SSGA 3PBMA 1JEZA 5KITA 3GBEA 5F4SA 2QUMA 3VC6A 1AQFA 2WKGA 5IDIA 4CD6A 1JNEA 1ZZMA 1CW2A 2Y8VA 1WOBA 4UQCA 2CETA 2D1ZA 2O9PA 2UV8G 3OOQA 5A6BA 3NQMA 4DWSB 4GACA 5DRCA 5LNSA 2VFFA 1AUSL 4O13A 2J9ZA 2Q3OA 7REQA 2QJJA 3A3XA 3E38A 3KWXA 3W71A 3N34A 2DZVA 1TUXA 3O05A 1PO9A 3BV7A 3CUXA 1E43A 1EO7A 3DGBA 1JZ7A 2V82A 4GG9A 3W27A 4W9TA 5K3VA 4LAKA 5AYBA 1EH9A 3O8AA 2X0SA 3MP5A 4FLQA 1GNXA 1XBZA 4Q4QA 1X96A 3SEPA 2BTMA 3HM7A 3V5OA 3UVAA 2FB3A 3PWGA 1CLKA 3CV1A 3TCEA 4GO9A 1I0DA 4HP5A 4XZHA 3L9CA 3W7GA 3SZ8A 1Q63A 1US2A 5DQPA 3S2LA 3LLFA 2V6AA 2GGEA 4JY8A 2ZVRA 3PS7A 4V27A 1XP3A 3QQ1A 3KCJA 3SCPA 1EJWC 1ZSXA 3KOFA 3B06A 4R9XA 2CLIA 3K5XA 5FSDC 1S2VA 4ATWA 5BZAA 3ZWTA 2V0TA 4O1BA 1NP2A 2ATMA 3W1XA 4WOZA 4O1FA 3O1NA 2PDFA 4AEOA 2Q09A 3NEVA 4R9OA 1IGSA 2GK1A 2PTYA 3H53A 4MJMA 1X1ZA 2VRJA 5LNVA 3EXSA 2EJ1A 2WK2A 1S5NA 4JFUA 2VC7A 3GXPA 4AZHA 4PMZA 4L4PA 2HV5A 1QPNA 1DOSA 1Q6DA 4G1NA 1DIKA 2J77A 2HNEA 2QIWA 1OGGA 2QZRA 3UG3A 1UP3A 2PP1A 2XINA 4FB7A 2Z7KA 4Y9OA 2NZLA 1KLYA 4OT7A 1WKYA 3WG6A 4AY1A 3G0XA 3RX3A 3ITLA 4D71A 4AIBA 3ANUA 3TYCA 3L12A 4F3HA 3CTLA 3HGSA 4A2SA 4G5DA 1CB7B 2C6QA 4A8LA 1Z41A 4RW5A 1T8QA 2WBGA 1F4AA 3FDKA 2EPMX 4M0XA 3T05A 3YPIA 3SI9A 2CZEA 2ABAA 1CENA 2PS2A 1GVSA 2A3CA 4TMCA 1MSSA 4Q7IA 1LUCA 1BXNA 1A53A 4Z2GA 2WANA 1ISVA 3L2IA 3P5YA 3BCDA 1J9YA 3QLDA 2ISSA 1H49A 4QJ3B 1EP1A 4ZQCA 1B9BA 1MW3A 3QTGA 3VGHA 2VRKA 4IH3A 1ITCA 1WV2A 3F03K 2Z1WA 3P82A 3A4JA 4B16A 4ORIA 5AN7A 1ZJAA 3IACA 1V3KA 1W1PA 5C2CA 2YB4A 3QV7A 1QR7A 4IX2A 1CGVA 1ISYA 4BI5A 4JQ1A 4GJ1A 3WF0A 4F0KA 5I3GA 2FLIA 1LORA 3LHWA 3CV6A 1KTNA 1B0IA 4M3PA 5E70A 1JQXA 1PZ2A 2YL8A 4W88A 3S9IA 4I9TA 2CKRA 1XCFA 3DGRA 4M6PA 1AG1O 4IIFA 2RFGA 5CC6A 3GBDA 2QCDA 1FWHC 1QPQA 2YDQA 3RMEA 3BAIA 3QPEA 2ZA3A 4DYKA 5AZ0A 5I3HA 1G4SA 2CWNA 5FJUA 5LA2A 3MP4A 4XAZA 5B7YA 3N3TA 6TIMA 1P7TA 2WC3A 3SJ3A 4ZBCA 3WBAA 1JDCA 1L0PA 2GVYA 3ONCA 5DRIA 4ZO6A 2ZTJA 3AMCA 1GONA 5E0KA 2WM1A 4MB1A 3FAWA 2IXVA 4C6DA 4TOQA 1Z69A 2V3DA 4H9ZA 4B3LA 2E7FA 2OGYA 1DHPA 3DFNA 4NNBA 3BXWA 1H61A 3OA5A 4URIA 4FOUA 2ZTKA 2O55A 1W32A 1ONWA 1UZ1A 4BHYA 4RW3A 4GH3A 3WZ0E 4U4MA 3T0DA 1V77A 1E0UA 2GJXB 2C79A 2WW5A 3NDYA 3WQCA 4H8HA 4F79A 4MM1A 1I8JA 3VI2A 3EBVA 4FAMA 1RP9A 5C8BB 1GK8A 3FGCB 4NXSA 3IUDA 4HK6A 4DN1A 4IP4A 5D33A 1TSIA 3ZWSA 3ZJKA 5CAKA 4D9PA 2BHYA 5EPDA 2EXOA 4FNPA 1E6RA 4IIBA 2QJIA 3AIRA 4JN7A 1TR1A 3RLUA 3W82A 4JL1A 1J96A 2VZSA 3GQYA 3HG4A 4AB4A 5D37A 3RK8A 4JFSA 4PL1A 3OA3A 1I9CB 2W6RA 1W5OA 4R7OA 3B05A 4S3KA 5CH9A 4K7YA 1CGYA 5I03A 4QDWA 3P84A 3TCSA 5F2MA 1K02A 4HB7A 5G2WA 1LF1A 2HPMA 4MB3A 3HPAA 4I9AA 2WCGA 3PWAA 1HL8A 4ZENA 1Q7MA 3V36A 5K2ZA 3C2FA 4LV4A 1MUMA 1YNQA 4YTTA 3GM8A 1A3XA 3BMXA 1XGEA 2F6XA 1UROA 4TTUA 1MDRA 2D2JA 3S1WA 4JIHA 3TTYA 2E09A 2XIQA 4H3DA 3KVKA 4Q8TA 1WXYA 2OOFA 3GDLA 1VYRA 3H2MA 3H2EA 3SN1A 1WZLA 4ERIA 1S5WA 5CLWA 3QN3A 1OX4B 3TA6A 4LUIA 1KKOA 4OUIA 3T9PA 4UTIA 4BQ3A 2CYGA 4GQBA 2GJRA 4L6OA 1XGZA 4KBXA 2IPGA 1K8ZA 3WBXA 1AW2A 2XVLA 1KGXA 1DQUA 3GFZA 4E2VA 5BOEA 3R0KA 3B8IA 3MBFA 3P81A 1EDTA 7REQB 3PTQA 4AD2A 3QOKA 3L2MA 4WJEA 4CCDA 4I9MA 1CXKA 4NJGA 1TVNA 3UWYA 1U1JA 3GR7A 4RK8A 1VKFA 2NX9A 1PKNA 1ME8A 4L5ZA 4G7FA 5CC5A 3SSJA 1GYLA 3EX2A 4ASTA 5B7ZA 2VZTA 3R8HA 2WHMA 4H9VA 4IISA 3GAKA 1A3HA 3MUZ1 4KRTA 4EANA 3UA4A 4GYFA 4MWAA 3UP8A 3H2AA 4MY9A 1MEHA 5LA0A 1VPYA 3V5CA 5DCDA 3O6DA 1IEXA 1QNSA 2NLYA 3W7RA 3RX4A 2H90A 4LY8A 1N7KA 4N7QA 1IEWA 3CUIA 3MMUA 3DUGA 4C6EA 3PUDA 1S5TA 4L6DA 1W5NA 1GOKA 1Z89A 4FF7A 3WDHA 1KXHA 1QI4A 2VOTA 3A6OA 1IT7A 2DW7A 4WDTA 4FOKA 1UW9A 1PWLA 4IMFA 4O1CA 1QO5A 4JNMA 1GJPA 3B3DA 5G1YA 4PODA 1LWJA 4FS9A 4JIRA 4QEEA 1ISZA 1RR2A 2TAAA 4C6OA 1KXTA 1UKSA 2C3ZA 3R7MA 4S3FA 3B0PA 1W2VA 4DO7A 3EWUA 3TQPA 3PFMA 2O7QA 4GYPC 2P10A 1PV8A 4ECLA 1UZHA 4GIAA 4Z2HA 5FF3A 3ABZA 1EQCA 3C2OA 1LBMA 5A6BD 4K37A 4QIUA 4DBEA 3LERA 4MTVA 1Q3NA 2AAAA 1VEOA 2FGZA 4BI6A 2EAWA 1Q66A 3IV8A 3EOUA 4CU8A 3N29A 3BAKA 3C0QA 5EBUA 3UPWA 1ZAHA 2YX0A 2NT0A 2YFNA 2TPSA 1PX8A 1NOFA 4W5ZA 3JUGA 1O60A 2ZX8A 2P8BA 1R3WA 3TN4A 2XFRA 3AUOA 3VC5A 2ZWYA 1YPFA 1X6NA 1MUWA 1UOZA 1YX1A 2E5CA 3VNKA 3LB0A 3SM0A 1AH3A 1KCXA 2ZRYA 3URQA 2G3NA 3CZJA 4QP0A 2HXTA 4HNLA 3QV6A 2RGMA 4O8RA 1H5VA 2W61A 1RLDA 4JS3A 4H6QA 1I2QA 4Z1CA 4RR4A 5C71A 2DSZA 3KEHA 5G5IA 2P1FA 3TYEA 1QTWA 2DSWA 2WJEA 3MI3A 1Y65A 2Z1VA 3G3MA 3M44A 4RCXA 2QCLA 1G6CA 3G1FA 3UR2A 1VFLA 3BW2A 3W01A 1OINA 5HAOA 4HCHA 2VRQA 3S2JA 3VZZA 3HQNA 1CXFA 2CESA 4POCA 3K1GA 3T4CA 2BGQA 3E0VA 4CNTA 1UUOA 4DWSA 2Y5SA 5AHFA 1SVDA 3K46A 3W28A 2YBVA 2J62A 3IGHX 1IWPA 2QUTA 4H7CA 3VNZA 4K3ZA 4YIWA 1NQKA 4Z1YA 4DPPA 5EYWA 3THUA 4KESA 3NVTA 5A2CA 2D3LA 4AW7A 1R9YA 3OIXA 3UERA 1KFEA 2EO7A 3KUMA 2OCZA 4IP7A 3UJSA 1S2TA 2PWFA 2YR1A 4DJFA 2I14A 3LZ5A 4QG9A 4PFHA 1O95A 3USZA 3LM3A 1WXJA 4O17A 3BLPX 1Q6CA 2ZICA 2DIEA 4OU1A 3DYPA 4O8AA 4PUWA 1ICQA 4IQLA 3UWZA 3LG3A 3NOYA 2D22A 2WHKA 6PTDA 3A3HA 4GA8A 3BOLA 1XSKA 3TUUA 1H7OA 1SW7A 1ZP3A 1GVRA 3HBLA 1H11A 3WK3A 3WJZA 1TE1A 2PDNA 4HT3A 1M01A 3FXYA 3RRXA 2AQWA 4GQQA 3PBGA 3ZSSA 1YHTA 2ZOXA 1LRNA 1TA3A 3QOMA 3C8NA 1YNPA 1TJ1A 1KV8A 3PTKA 4UR9A 2DZPA 1A5NC 2OX4A 2WHLA 1UR0A 2PAJA 3S5YA 1HZYA 5HATA 3EMQA 4LSBA 1LOQA 2VFHA 2DT1A 2TRSA 2MNRA 2V5DA 4MNMA 5F2IA 2C91A 3UEQA 3RYSA 2HZGA 2B31A 4IQEA 4P8WA 4EE9A 3HMCA 2I9EA 1OF8A 2BY3A 4L9YA 3WMCA 2WKLA 2Z24A 3TW6A 3O2LA 4KCVA 1IXPA 4A8IA 2ZX7A 5PTDA 3ELFA 4MOZA 5GJPA 5LNWA 3G1VA 4QITA 3L65A 4O16A 3P8IA 3H54A 1R30A 2ZZ4A 5CSSA 1OX6A 1UHVA 2ZUWA 2VKZG 2Y62A 1IZKA 3NWRA 4QM1A 2V8ZA 4XB3A 3N2XA 4U31A 5L6UA 3VFCA 1WE5A 1ECEA 1P7TB 1GQKA 4KWUA 4IFOA 2FIQA 1S3TC 2YCLA 3IVTA 4RNFA 1Z3NA 3LCLA 3SADA 1P0KA 3ABXA 4M81A 2BHZA 2ZWZA 1JCLA 1C9WA 4NKCA 4IPIA 4N4PA 3LHTA 1W3LA 3RU8X 3AQUA 1K6WA 2VGGA 1WAWA 2P76A 4B91A 3MO7A 4Q8QA 3W9ZA 5FF2A 1KBIA 1PZ0A 1JCYA 2FTYA 1TQXA 1AL8A 2ZUUA 5I6SA 5JVLA 3ONBA 1AQ0A 2E67A 4MKVA 3A23A 4AD0A 5XINA 3ARTA 2Q8LA 4JTRA 2WMJA 1GOMA 2VUNA 4PR4A 4QBXA 1ZTVA 3ENLA 1M9HA 1XFCA 3P7YA 1M68A 4LUTA 4CCEA 2DT0A 6REQA 3VGFA 1HW6A 1YTKA 3F2CA 3GH5A 1OY0A 3AXIA 4JAWA 4JL2A 3AHXA 3TMLA 4P7OA 1O12A 4AVNA 4HZMA 2PEVA 3LCFA 2UY5A 4WEVX 4FLRA 1UH3A 3KRBA 3DFHA 3OZYA 1AK5A 4X2PA 3N04A 4GWEA 1EO5A 1K8YA 3WQ5A 3QGVA 4ZCWA 1TV5A 1AA1B 1PB0A 1W3TA 3E0FA 3EDFA 5LA1A 1F8IA 5GJMA 3WUBA 4B2DD 2OODA 4QJ5B 4UXDA 3M5ZA 1W3KA 3U2EA 1ZNNA 2NQJA 1B2YA 1PX4A 3IGUA 3TX9A 5D04C 4PUUA 4YHEA 1IQ8A 1SGJA 2CLOA 1TTIA 1XDJA 1U5JA 3ARZA 2PURA 4FOJA 3OG2A 3KBSA 2GOKA 4MWAE 4WDXA 3R2GA 3NCOA 4P2VA 3MWCA 2HK0A 4HZ6A 2Z2AA 8A3HA 3A22A 1KM1A 1O5XA 3SCRA 1DE6A 3PZGA 4RE0A 3VCRA 3INPA 5C5YA 1XYCA 2ZXDA 4LCRA 4ORMA 1OHLA 1OX4A 1RQHA 2E8ZA 2R14A 1XHGA 2UWFA 3S6OA 3ATYA 1AQHA 2XTKA 2GZXA 1LRTA 1ADDA 3B8VA 7ENLA 4IQDA 4CN6A 7ODCA 4D72A 1GVYA 3UGVA 4DEFA 4BEUA 5FJPA 4RUBA 3LHVA 2O9TA 2PBGA 4AXNA 1VHNA 4LVGA 1CIUA 4GNKB 4XZWA 3R1ZA 3P14A 4AIUA 4I8DA 4MFDA 2EPHA 1XS2A 3B8WA 4P8XA 3LMYA 5EMYA 1K3UA 3AYRA 2X30A 4AF0A 1ZRQA 5EFFA 4G56A 5I3KA 3OEXA 5CSYA 4ZFCA 4C7GA 3QQWA 3AJXA 3WUGA 1XX1A 1RA0A 4OBRA 2PP0A 4ATLA 1QOQA 4TX8A 2J9XA 4HU3A 4HJFA 2FTWA 2PDXA 3EWYA 4HHPA 4ES4A 1SPQA 1HKJA 1W54A 2G4FA 3ARUA 3U4AA 3DFOA 3L5MA 3T2QA 4I9JA 1VCVA 4UUIA 1QRQA 3GC5A 1ESWA 1G1YA 3NDOA 3E02A 4GI9A 1TTJA 2C18A 4TQTA 3K8MA 3UXIA 5U4NA 1CNVA 4ZSTA 3SCQA 1WUFA 1FWCC 1Z8AA 4O10A 3N2OA 4M6VA 2QJMA 1HL9A 3BJTA 1BFNA 1DJZA 4HMDA 1H1NA 3WQWA 3DKLA 2FMNA 2XGIA 1HO4A 4C6QA 1SUXA 2Y7GA 4O1DA 2VXNA 4ZO8A 4L1WA 3EPMA 3UJEA 4H8NA 3W7PA 1C90A 1JZ2A 2GQ3A 4IXHA 3W00A 5I79A 2YW3A 2V38A 3TJXA 3GIQA 4Z2KA 5FF0A 3A4WA 4PMUA 2VZUA 3PZ9A 3UG4A 4H2CA 1QT1A 2VUYA 4XQ6A 3VKBA 3HA1A 5LXXA 4ZB5A 2YDAA 1TVPA 1ZAIA 3M07A 4CEXC 4GC4A 1F61A 2CLFA 1W1ZA 2XGZA 3VABA 2G3FA 2ZFAA 3AISA 5G4WA 2JBMA 2VVNA 4H1ZA 1FWBC 2B0MA 4FHAA 4CNNA 5LGZA 3NQ6A 5E0CA 3W1AA 2EPNA 1UJQA 1EQPA 1YBQA 4NASA 4TMBA 4DBUA 5IDZA 4WLCA 1KRMA 3BK0A 1ZHAA 1DQXA 3TTQA 3CU2A 2OG9A 3MMTA 3CPRA 3UU0A 8RUCA 1J79A 2OZ0A 3LNMA 4BKNA 4HD5A 5I09A 3THAA 1U5HA 1NF0A 1R2RA 3WNLA 4LPCA 4Q4SA 5DMYA 4A8RA 2QMJA 2Y88A 5J5RA 1HT6A 4QLJA 4AD3A 3WMSA 2XH2A 2OZ8A 2VX4A 4QQUA 4BWLC 4GOAA 4IX0A 2IKHA 4W4QA 3WUFA 1BGGA 3DYMA 3N2MA 3MZ2A 2PTWA 3QF0A 1V6UA 4PUEA 3LU2A 3CQJA 3SQSA 2FFIA 6XIMA 1EKOA 4C91A 3M7WA 4NI3A 1Z42A 4JTUA 1B31A 2HSAA 3VU2A 3SW6A 1XYAA 3VOIA 4NRRA 5A6AA 2WLYA 2YYTA 1C93A 4EWND 3WO8A 3QR3A 3W7DA 2VZOA 3GVQA 1LROA 3ZJ8A 5A2BA 1BYBA 3F4CA 3KOXA 4UC5A 1R46A 1RD5A 1PSCA 1F7BA 3HQOA 2ZX9A 4YL2A 5A6SA 1E15A 2PWUA 3WF4A 1MXGA 3BVJA 1JPMA 3U0HA 3FJ4A 2QF8A 3TROA 3GFXA 5K4ZA 2QV5A 3R13A 2ZRXA 2P3EA 2WB5A 1CEOA 1E56A 1BF6A 3PTMA 3SCSA 1XH1A 4LYQA 2PTXA 3P6LA 1V03A 1N8WA 1XL9A 1OEPA 5A8NA 1ZB5A 3A64A 3K4AA 1PL9A 2POTA 3UPMA 4H01A 4B90A 1IEVA 5HR6A 4AU0A 3WSUA 3SCNA 1FWEC 3SN4A 4QG6A 1OM0A 4AQLA 4HNTA 4TTGA 1PDZA 5XIMA 1ME7A 1UBSA 3JR2A 2HVMA 3FA4A 4PB5A 3DHUA 2GJNA 4G2DA 3CL7A 4QJ4B 1GZ1A 1XLHA 2XVGA 2HCVA 4M6QA 1R3VA 5BWFA 2BVTA 4R5EA 1EJRC 4DXVA 3GDKA 4HVXA 1NSJA 1U5VA 1F3XA 3Q45A 1IEIA 5C9ZA 4KPLA 4NYYA 1UPPA 3LHUA 2YZRA 2DZWA 1TPVA 5DN1A 3M5VA 2FJUB 3VE9A 1EOMA 2D23A 1W1YA 4PUJA 3UVIA 2DZAA 4UNKA 4Z2JA 3AXXA 3I4KA 3WYZA 5D03A 3MYPA 2X2YA 3TNBA 1F07A 2JF6A 2GDUA 4GI6A 4QFUA 1E6XM 4NHVA 4D6EA 1NFPA 1TJ0A 2CWXA 1G7VA 4X61A 4KFPA 4YU1A 1CLXA 2W0UA 3MKVA 4FI4A 2YCKX 2GDQA 3S2CA 3EGJA 3A21A 4QAIA 1XUZA 4GUJA 4HHHA 1FP9A 6ALDA 1BQCA 2VYOA 4P7RA 2JEQA 3C56A 4M29A 4AF0B 1RD6A 3I6TA 2WZIA 2PWVA 1UWRA 3VMPA 1S1PA 4Z0JA 3DC0A 2YCLB 3ANVA 3BQ5A 4QCEA 3VOHA 4HNCA 3JRKA 3KBMA 4WSHA 2CCRA 3I7QA 4UFJA 2R9RA 3IIPA 3HU7A 2YL6A 3R79A 1XJBA 2Q3RA 4A2RA 1OT2A 1DE5A 4TR9A 1KD0A 1TMLA 2J75A 3VUSA 4PRTA 2AMXA 3ARYA 4KT2A 2DZSA 2OZ3A 5CSRA 3KOYA 3VD4A 1B9ZA 1FCUA 1RVGA 2IKIA 4JX4A 1YPIA 3PM6A 1MRAA 4UQEA 2QT3A 5CC3A 2X1SA 2QAPA 3TW7A 6REQB 1RBOB 4ERGA 3L7RA 1NVMA 3FAXA 1ZJHA 4GJJA 5JH2A 2QS8A 1NIUA 2ZA2A 3WF2A 1K9DA 3LUTA 2DVUA 1EDGA 1THFD 1HFBA 2IS7A 1Q2SA 3W88A 3W29A 1QNPA 3U48A 4CNOA 3LM7A 3GX9A 4MADA 3QZ6A 2FH8A 3KDOA 3W7MA 4HOWA 4LF1A 3G18A 3B97A 4JYDA 1Y0EA 3KLLA 3LA4A 4WXZA 2Z6IA 5CGMA 1KM5A 1P43A 3W2MA 2IKJA 1OD0A 4PMYA 4FX6M 1DJWA 3H12A 1EF3A 2GGHA 1O6IA 3BG5A 2ZKMX 3WFAA 1N8IA 3T2PA 1E1FA 3G0SA 1XLDA 4NNCA 1IXQA 1R38A 3TMQA 5CZTA 2GQAA 2FZMA 4F0RA 4XO6A 1WOAA 4PGLA 4LB4A 1C8YA 3ARQA 1Q13A 2I9UA 4XTDA 5JQ9A 1LL6A 1HKKA 1CZ1A 2C0HA 1R9ZA 5EMLA 1EJTC 3VD7A 1RPXA 4AH7A 4J7RA 4E4PA 1FX6A 3A12A 2YBUA 1VFOA 3SJNA 2J24A 2ZDRA 4DBSA 3VKKA 2DIKA 5IHSA 1X98A 2TYSA 4REQA 1HNYA 3L2LA 5HOSA 1YE6A 4NJKA 4JYEA 1F3TA 5AC5A 1NWSA 4KS0A 4KGJA 1H7RA 2YCJA 2E3ZA 1IR2A 5JMUA 5DX7A 2GUBA 4DUXA 3BJSA 4DYJA 2I16A 2VR4A 4IG2B 2WVVA 4NJIA 2J9YA 1V02A 1X38A 4XKYA 4TV5A 3EWXA 4NZ1A 3F2DA 4FMVA 3PFRA 3QMTA 1V79A 1PPIA 1NF7A 3RAOA 1PBGA 1HF6A 3MMWA 1U22A 3TR9A 3W6MA 2WM0A 4QAWA 4B9ZA 3GLCA 1XDMA 1ADOA 4NT0A 4HMEA 2PF0A 2BGSA 1KWGA 3CHVA 3VTRA 5FAJA 1J93A 4QQ3A 2I5IA 3ES8A 1OBAA 1YKWA 1NJJA 5T26A 3SUSA 4V2XA 3LTYA 2V5BA 1TCMA 2J78A 3T2OA 4H2HA 3AHTA 5KETA 2JALA 5T9BG 1G4TA 3HN3A 1SO5A 3PUOA 3A4XA 1RV8A 3MDUA 3B8DA 2J7EA 3RU6A 5BCAA 3NPUA 4AC1X 2PDLA 4MPQA 3NR0A 3T42A 4O54A 3IIZA 1A4LA 3S9YA 5DMNA 3ZR4A 5MKGB 4LQ1A 4S2BA 4DF0A 2WJFA 1P1MA 1H7WA 4XX6A 4UBPC 5IFPA 3PN8A 4DO5A 2F38A 1NEYA 2OGJA 4HN4A 4RJEA 1JZ6A 2E9LA 3WDIA 3WLQA 5BROA 1QATA 1JI2A 1MI3A 3GNRA 1MXSA 2VEPA 2PCEA 2QUNA 1UG6A 1YDOA 4UOJA 3BH4A 1TJ2A 3TOYA 2VEIA 3M7SA 3O0KA 3GG1A 3ZLGA 1UD8A 3W7NA 1BEUA 5T91A 3EX1A 4GPNA 3CYVA 2QDHA 1TPDA 1EFZA 4PB4A 4E2BA 2DDXA 3FHAA 3AFBA 3HPZA 2E4TA 1Z7AA 4MLJA 3CO4A 1AZ1A 1DJIA 4JCLA 4A3YA 1O66A 2WQPA 4NF7A 4O0QA 2WMIB 1NM9A 2XG9A 2PCQA 3VK5A 4B5NA 1IZCA 3GC2A 2XIMA 2A7PA 1RCXB 3RLVA 3WK1A 1XIGA 3ECQA 2QPXA 3XINA 1KO0A 1F4HA 3RPDA 5T8GA 2JIEA 4HHLA 2V5KA 3IPWA 4JIQA 3PSVA 1U1UA 3U6WA 3KOWA 1CXIA 3EEGA 3OO2A 1OF6A 5I77A 2OFJA 3OLIA 4E2DA 1UD5A 3W22A 4MGGA 3L0KA 4O15A 5M03A 4Q8WA 4D6JA 2R1NA 1E6QM 1ZENA 3RFAA 2ZX5A 3QV8A 3GXIA 4NILA 1CLVA 3SRFA 4V33A 3GUWA 1YEYA 5BMXA 3QKZA 3N14A 3EWCA 3OBKA 3BANA 4JD4A 4HPXA 1U83A 2BV9A 3R94A 2J66A 3G3DA 3KE0A 2CERA 3KFTA 4Z1AA 2DT3A 5HPOA 3GKAA 5C9UA 2X0YA 2PDYA 1JUBA 1OCBA 1JXKA 1DHKA 2Z26A 2FHCA 1UMYA 4PSRA 3UR8A 4ZB0A 4ILSA 4H7VA 2XU2A 4YS1A 4U5IA 2OQLA 4GIEA 4PCSA 3F4VA 4RKAA 1W5PA 3TP4A 3GTFA 3NZPA 1L6GA 5JBEA 3KP1A 4BQ4A 5BRBA 3BW4A 1XINA 3CAVA 1Y5VA 3HGOA 2Q8ZA 4Y9AA 2YDRA 3RCNA 1PZ3A 2X40A 2YXOA 1E3ZA 1RXOB 1CT5A 3WJSA 9CGTA 1OK6A 3LSCA 3STFA 3GG0A 1P0NA 1ZJBA 3UBPC 1US0A 3ZR5A 1DEDA 3CMGA 2D2HA 2BVDA 5G2HA 4ZR8A 1TR9A 4IJBA 5CPSA 2QCNA 2PDPA 3PB0A 3DCPA 1V0MA 3NZQA 3W86A 4DB7A 1LQAA 4N4QA 1E4MM 4E8DA 2G37A 3H4WA 3RPTA 4WR3A 4AEFA 1H0IA 1D2KA 3CM4A 1Q6QA 1V3MA 1JIBA 3L21A 5I3IA 1AW5A 1CWYA 2EKGA 2EG8A 4GGBA 4DIAA 4REQB 1Q5MA 3KHJA 4LVAA 4K8HA 3UWUA 1FY6A 4HSHA 2X1UA 1BPLB 2QULA 1RHCA 2D24A 3BGAA 1AH0A 1UYQA 5FI8A 4C5ZA 4I7UA 5C54A 2BXVA 4RE4A 4AMAA 5CSUA 1RCOB 3W73A 1SZFA 1WA3A 3PF3A 3O63A 3VDBA 3NIYA 3NM3A 1OWQA 1D8WA 3GFYA 3EB4A 1UB3A 2WSQA 3R0DA 1V08A 1E3XA 2I56A 4IPNB 5M2FX 4A3QA 1O7AA 1XLIA 4Q4RA 1DIEA 1RY8A 1DWJM 3OHMB 4QNEA 3U7BA 4N02A 1CGXA 4UZUA 3N19B 5DO8A 2XSAA 3A47A 3G5EA 1JCJA 4DLMA 3PHAA 5C7HA 3DERA 5MF5A 7XIMA 1VFSA 3BLFA 2QUUA 4QG8A 4LB3A 1K4GA 2RDXA 5GNZA 1QI0A 3QH2A 1YDNA 3KTXA 4M51A 3VCNA 2RGLA 3GW3A 2BOGX 5K9DA 5K9CA 4IICA 3AJ7A 2BS9A 3FGCA 4DXXA 4K38A 4B4FA 4JQ3A 1R85A 4NSBA 1U30A 3FW6A 3IUIA 4G9PA 2A3AA 3L66A 1DYSA 2XPKA 3ZMRA 4H7ZA 3P2VA 2WVVB 3LQLA 2NUWA 4X22A 3QKEA 4ZOAA 1UR9A 2AKZA 1TCDA 2BB0A 1QCWA 1WDQA 3THQA 1ZL1A 5CZSA 5A8OA 1T8XA 4PFMA 2WSKA 3TAOA 4S3EA 3WBYA 2FZ8A 8XIAA 1M04A 2XIBA 3D3FA 3OGRA 1A3WA 1EHAA 4BFAA 2IPJA 3SAZA 1H60A 3M0VA 4AY7A 1JG9A 4RV3A 4LJ3A 3M6DA 4QCFA 1TWWA 1XIMA 1BWKA 2BY2A 4K36A 4J28A 1P4CA 4J5NA 3VDAA 3TZFA 2GVEA 4HHMA 3QZAA 1D9EA 2NW0A 3CJPA 5A6KA 4XVDA 1Q4WA 5D9OA 4YLWA 3OVGA 2GJLA 1VJIA 1M03A 3G1SA 2F84A 1VCFA 3ZVHB 2ACUA 1BWVA 1K9EA 5CJ5A 2YW4A 1V6VA 5KEZA 3E5BA 3W85A 3BC9A 5KZEA 2HS8A 3LXAA 2Z1SA 4QE1A 3STCA 3WX7A 3C2VA 3CL8A 4A05A 5ENLA 4PSPA 2HVNA 3MDWA 2XZ9A 4GYJA 1G94A 1UR2A 2QCFA 4UCGA 3CT2A 4WDWA 3WEMA 2Z0IA 1TMHA 1SZEA 1Y8BA 4WJXA 4RLIA 3VMOA 1B3ZA 1XBVA 2W67A 5HPCA 1D7KA 4QLLA 1JVNA 3BGJA 3W74A 3O9NA 1OGSA 4O4WA 4ZZ9A 4ADUA 3ARPA 1VBRA 4ZSUA 4CLMA 3ITTA 4B5WA 4X9SA 1KCZA 4LAUA 1LLOA 3JS3A 1MEWA 4WY0A 2DEPA 1K77A 3DFQA 2CPUA 2Z00A 4C1NA 5CGQA 4GE8A 3WD3A 1KFJA 4WK9A 1L6WA 3L5AA 4BCEA 4UTFA 4PTNA 4BK9A 4DJEA 1UUQA 3T40A 3T6CA 3GZAA 1MEIA 1MQQA 3NQ7A 4MDOA 3LPOA 5ECVA 3CQHA 4H6EA 1E70M 2NXIA 1MQRA 2DJLA 1V3JA 1W1VA 4DJEC 5DBUA 3J7HA 4NAEA 3LNPA 1UKQA 4J1OA 2CKSA 4Y9NA 1XRSA 4YCOA 1LG2A 1Q6RA 3BLIA 4AZ5A 5CZKA 2CU0A 3HMJG 3LBCA 2MUCA 4MUPA 4AWTA 3TN3A 3MHFA 1EX5A 2H8ZA 4C6JA 1EDQA 4ZO9A 3NA8A 1J0YA 1R86A 1MQPA 4OIFA 1V6TA 4XBJA 4J27A 2FPVA 4H8UA 3UJRA 3TIMA 1HN1A 4FO4A 1ENUA 3PZVA 4BWLA 2BOFX 4FXSA 4KERA 1UH2A 3GHUA 3K8KA 1RK5A 3BURA 3T0AA 2V2CA 1XQKA 4EVZA 4W7WA 1HG3A 1P0DA 2BFGA 4W8LA 4YWIA 1ZQ5A 1H51A 3FS2A 4LF2A 1L2UA 1JZ5A 3RLHA 1AJZA 2V5JA 1BRLB 4J2MA 3UZWA 4BF9A 2H9AA 1V3LA 1J4EA 2XSXA 3TQVA 3GXDA 4JFVA 4FK9A 1F5ZA 4ZFMA 1ONEA 4C65A 4EF8A 4GVFA 1SR0A 3VOCA 3CUHA 3RILA 5EL1A 2PLKA 4GQGA 1UWSA 1ZGDA 3GIYA 6TAAA 3C0JA 4U2YA 4ZQPA 2NXGA 4OBTA 5E93A 5GNXA 1BVZA 5EA9A 2ABBA 4ROQA 1XYFA 1T5AA 3WDJA 1GTHA 1W9UA 1GZJA 1YE4A 3CMJA 4UQ9A 3SY1A 1BVWA 2ON3A 1TG7A 4AD5A 2J27A 3AXKA 3B40A 3DC8A 4W86A 2GQ9A 4IGSA 3DBPA 1PVNA 3TU9A 3W7JA 3V3WA 1H63A 1KFKA 3TFCA 3NXLA 4ZGYA 3O6YX 2PDQA 4D1IA 1QK2A 3GY1A 3LD5A 4RPPA 3UJFA 4WIWA 4DNHA 3OZMA 1HIZA 1FDYA 2ALDA 5GVJA 3SCWA 3M5YA 1ZFJA 5C2XA 1KRAC 3KL3A 1UWAA 3Q67A 3AALA 1BYAA 2HRWA 3UY7A 4WJ8A 2WNZA 1JDFA 1B3VA 3PNZA 3OGSA 4IWWA 5I3JA 5KZMA 3QW4B 3WFLA 2ZXQA 4AX6A 2NSOA 4DO4A 2VR5A 1BHGA 3AZRA 5BW6A 5HNUA 2JF7A 3UXAA 1M5WA 1GHSA 2P0OA 4P7NA 3UYCA 4TIMA 1C29A 1HP4A 5FL1A 5BRPA 3AO0A 1DXIA 1QFEA