3NNTA

Crystal structure of k170m mutant of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in non-covalent complex with dehydroquinate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
YFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nntA00
2YXGA 3UWYA 1DKWA 1O5KA 3BO9A 3DXIA 3TAKA 2E77A 1F76A 4AB4A 3TKFA 3KRUA 1VHCA 1T0OA 3LDVA 1VJIA 3QMRA 4O1CA 5G5IA 1W37A 4P2VA 1NF7A 1XC4A 1UCWA 2O7QA 1RR2A 3CWOX 4O0ZA 3QEZA 1QR7A 4NXSA 5KINA 1T8XA 1JCYA 4LW7A 4FNRA 3NM3A 2RDTA 3NL3A 2C18A 2QCMA 2PURA 1ZENA 4O1DA 2Z2UA 3FOKA 3CEPA 2AAMA 5CZSA 5HR7A 4QQ3A 2TYSA 1OYAA 5HWJA 1GG1A 3KOFA 1DQWA 3QYQA 4N02A 3SGUA 3NG3A 5U4NA 3W6YA 4DO4A 5LKYA 1ML1A 2UV8G 3NPWA 3WJXA 5TIMA 3NQ7A 3EWUA 3F1QA 3QQ1A 1KW1A 2C13A 4C1KA 3T7VA 3O05A 4E38A 2CZEA 4FNTA 2WNZA 1S5TA 1LLZA 1EWEA 1LBFA 3W85A 3ATZA 3W7OA 4A29A 5I3IA 5CZJA 4KWWA 3MBFA 2Y7EA 5LNSA 3B0VC 3MI3A 2H6RA 3HG5A 5AOUA 5D03A 3E96A 1G4SA 3W2NA 1WOAA 4NX0A 2WJZA 5AHEA 3TSMA 3MI2A 3PR2A 3IEBA 3R2GA 4GNJA 3LLDA 1OFDA 4NVTA 3LHWA 3I68A 3NQ2A 1EP2A 4CCEA 3W70A 3TC7A 3W1RA 4O13A 4M6PA 1TPUA 2QAPA 1EIXA 4O50A 5KSWA 1ZNNA 3NO5A 4R53A 1LRQA 3EWBX 4AXKA 4CNOA 4WD0A 4O53A 3W76A 5HWNA 1TQJA 2FDSA 5LNRA 2JKEA 1NAL1 2EGZA 3LHUA 4N6FA 1YTKA 2QR6A 2J24A 5EY5A 2G5WA 4H4IA 3QMSA 3P8JA 4MYAA 3KX6A 3W7MA 2YPIA 3RFAA 4DF0A 3R8RA 4MZ8A 1H7OA 2TMDA 3KRZA 4LVFA 4BF9A 3OA3A 4O4VA 3TNOA 3L0KA 1B3OA 3LXCA 1VYRA 4U28A 1IGSA 3S8HA 1ONRA 2FPYA 3Q58A 4K39A 5AHMA 3QQ0A 2IQTA 2VC6A 5U7SA 3C3NA 1X1OA 1JCNA 2X2GA 5AHIA 2V2DA 4UIOA 4XUGA 1IXPA 1ZJIA 4NQ1A 2BTMA 3LHTA 3BVJA 3VE9A 5BRBA 2NXGA 4EF9A 3NNTA 1YYAA 3W1TA 1NF0A 2F7FA 4K6AA 5FF7A 3UY8A 3WFAA 2QJIA 3P82A 2E6DA 2V82A 3IVUA 1QPNA 3A5FA 2FTPA 1MXSA 3KFTA 4JIQA 1F2JA 2YZRA 1B9BA 2ISWA 3UWVA 1IIHA 1SU5A 3I7RA 3G1SA 3W7GA 5J5RA 2E6YA 3GXTA 1S5VA 3STFA 4QJ1A 1H1YA 1H61A 2X30A 3LGEA 1XCFA 4HHPA 4ORIA 4E2DA 1R30A 4UTKA 3PSWA 2C3ZA 4UTLA 1V5XA 2Y85A 3DHDA 3HPXA 4M7SA 5BOOA 2ZYFA 1HUVA 2CFFA 1G67A 3FKKA 3E49A 2RDUA 3LTYA 1V7YA 5AC6A 1FDZA 1FWWA 1TJRA 5CZ0A 1XDLA 2V9DA 3TE9A 3GNDA 3INPA 3W75A 4LVDA 4H6KA 1WQ5A 4BWLC 1FDYA 3LCWA 3UWZA 3TQ0A 3UNDA 2WO5A 3NQFA 4HNUA 1OX6A 3L5MA 1K7FA 2ZZ5A 4Z1AA 2P10A 1W54A 4IX2A 4ZQMA 1OX4B 4TO8A 3W73A 4OHQA 3M5XA 2FB3A 3EXRA 3JRKA 2QJGA 3O15A 1E51A 3QF0A 3THAA 4GRSA 5D05A 4NZJA 5FESA 2C1HA 1DOSA 4AH7A 3A9IA 4EWND 1H7NA 1QOQA 3DU0A 3GAKA 4WUIA 4X2RA 4NJHA 4OV4A 3BW4A 1Z48A 2FPVA 3GYEA 4Z0SA 3MHUA 4XKYB 1WX0A 3W7LA 3DFOA 1FWRA 5FEPA 2Y88A 5BMWA 3TU9A 1TREA 2NUXA 1K7XA 5D2TA 3TQVA 2FLIA 2JK2A 4O1BA 3GIYA 3LERA 3WJWA 1YPFA 3EWZA 3C2FA 5MHBA 1EWDA 3U2OA 1H7PA 3WJYA 3ZWTA 3P80A 5D2VA 3PB0A 1JR1A 2E5CA 5K3VA 2I1OA 4U4MA 3C2RA 3TIMA 5DXYA 1LOQA 4CQ9A 3LXAA 1PHQA 1UUOA 4J9JA 5D37A 3SFKA 3HMJG 5FI8A 5A5WA 1HO4A 1GOXA 3O63A 3MYOA 2ZDRA 3STGA 1O60A 4RR4A 3W7HA 1XL9A 3L66A 4DQWA 1MO0A 2WQPA 1DORA 3MW7A 2H3DA 5G2IA 4ZQRA 4Z1BA 4JTEA 5F1UA 3ABOA 4MZ1A 5C55A 1QNVA 3Q94A 1A5SA 3Q37A 1OFOA 1LP6A 2X1RA 2ABBA 3NZ1A 2FB2A 1QO2A 2YFNA 5D2WA 2CW6A 5FEWA 4RJEA 1BEUA 4R7JA 4YL2A 4DF1A 1SO5A 5AC7A 1U5JA 3N2XA 3FLUA 3W7PA 3G1YA 3W2KA 1TTJA 1KM0A 1FWTA 1XBXA 1RPXA 3CIWA 4XTIA 4YXGA 1SSGA 2PRMA 3F4NA 3TMQA 2C14A 5EBUA 3B4UA 1ADOA 5FEZA 1H60A 4AHOA 1H7XA 3IGXA 1Q45A 2EKCA 5A8GA 3B03A 3BG9A 3G1XA 5IM51 3S1VA 3A5VA 2Q8ZA 4LC6A 3PAJA 1GTEA 2J88A 4FB7A 3T4CA 6ALDA 1GEQA 1ME9A 3IRDA 3G18A 2ZZ3A 1SFJA 4FNQA 1CI1A 1TIMA 4KFPA 1KM1A 3LI0A 4JYEA 4Y8FA 1C8VA 5D02A 4TMCA 3TUUA 1QOPA 1GPWA 4PODA 2OZ0A 3G1HA 5KTLA 3QZEA 3UQNA 4ML9A 4N9CA 2WOQA 4N6EA 5CG7A 3GDRA 3PWAA 5CPMA 3P81A 1VPXA 3UXDA 1GVOA 3GDMA 1R2RA 4ZQPA 1WOBA 1AK5A 3P60A 3W83A 4Z1DA 3DHFA 1XKYA 3DZ1A 2G97A 2PE4A 4PH6A 4CQ8A 2QUVA 3W2MA 3RLVA 3B04A 4MYXA 2GVJA 3GKFA 5F2IA 2FFCA 4JY9A 2J9XA 1YXCA 4MY1A 1XXXA 1R2TA 1MSSA 3O6DA 4JTTA 1XUUA 3UPBA 3PUOA 1B4KA 3HGSA 4JD4A 3QPZA 1QPRA 3E9AA 3IIPA 1DV7A 1SSDA 4FXSA 1OG0A 5I3HA 1KV8A 4JYFA 1JCMP 3L5AA 2NX1A 5FF3A 1M7OA 2ZRZA 4HN4A 1RZMA 3BV4A 1F74A 1YTDA 1KM4A 2DZSA 4JX5A 2VXNA 4HSOA 4A21A 3OIXA 3MO7A 3O6YX 1WBHA 4O19A 1OYCA 4UTTC 5EKYA 3I6RA 5CZTA 3PBUA 2ZQ0A 3NR0A 1BKSA 1O4UA 2P0OA 4ALDA 1OF6A 3BGGA 5AYYA 3W88A 1PL9A 3OHIA 4K7YA 4XKYA 3G24A 3NZRA 3ABRA 2QCEA 3ZR4A 4BWLA 2ZA2A 1TO3A 2BLEA 4KKXA 2ZTKA 3HGOA 4MVAA 3SGZA 2V2CA 4NU7A 1FQ0A 2EHHA 2RHGA 2Y89A 2YFOA 1UB3A 3W1XA 4M6VA 5K2ZA 5K4ZA 4O0KA 3C6CA 3OVPA 1KFEA 3HPZA 4IMDA 4DO5A 4GJ1A 4UTWA 5DXXA 3UWUA 3G1VA 5IBXA 2A2IA 3CWNA 3CU2A 3W1LA 4RK8A 2I9EA 4FEZA 4L4MA 2VOMA 3L68A 1EP3A 1TPH1 3TA6A 1EA0A 3PUDA 1UASA 3RMJA 2AQWA 4CCDA 3HIJA 3S0CA 1VZWA 2LLEA 3ANYA 1I2PA 1OX4A 3TW7A 4O10A 5KZDA 1G4TA 1BTMA 3I7SA 2YYUA 1K7EA 2GUUA 3P8IA 5DCBA 1P4CA 2PRLA 4OQVA 1CX9A 1TTIA 3RNDA 1I45A 3W84A 1PCWA 1SPQA 1W0MA 1MZHA 1XBVA 2NLIA 1DHPA 2B7OA 1SO4A 1TTQA 3PS7A 3F4WA 4HPJA 4GUFA 4UTHA 1OF8A 5EMUA 1ICQA 4MOZA 4N9DA 2DJLA 3W1PA 3FJ6A 2ZTJA 4NNCA 1W3TA 5GVJA 1TPB1 1LLWA 2A0NA 3QH2A 4RX0A 4DPPA 4UR7A 3WK2A 1A5AA 1GVSA 1H62A 5C2XA 2CZDA 4O28A 1TRIA 2ABAA 4GBUA 3N34A 4CNNA 3NL2A 2A1YA 1F7BA 2X16A 3A22A 2ALDA 3BPWA 4A2RA 1C9DA 5G2WA 1ICPA 1UBSA 3NL5A 4XQ6A 4PL2A 4WY0A 2CLOA 2WNQA 3DGRA 3UPWA 1P1XA 2B7PA 1VYPX 3LV5A 4RV8A 5LZLA 1K8XA 4UC5A 3L65A 3A24A 4L4LA 3MP5A 4K38A 1QMLA 1P5BA 4O16A 1LZOA 3HO8A 3P74A 3LX9A 2WNNA 1EUAA 2ZZ7A 2WSYA 5KZMA 1LCOA 2NV2A 3HOJA 4WXYA 3TJXA 2X1TA 2ATSA 4X22A 3FA5A 3PG9A 2TRSA 1FBAA 1OFPA 2B7NA 2CWNA 4E2BA 2A5HA 1SW3A 3LTPA 1LOLA 2XN1A 1W5QA 3IGUA 1X8FA 1PIIA 3LLFA 1LROA 1O94A 3O8AA 2A7NA 5F2MA 1SW7A 4K37A 2VFFA 1J5TA 1DJQA 3W7DA 3O1NA 2E68A 4O57A 4JS3A 4IWWA 3IVSA 1VC4A 4HIBA 4AWSA 2QUTA 4NNAA 2QCDB 1HTIA 1SZFA 1TPWA 3VFLA 2CLFA 4FO4A 4JTFA 1YPIA 3W86A 3A21A 3JR2A 3TV8A 4MFEA 2A4AA 4N2YA 3VNDA 2B7QA 3W7JA 4XTDA 3S5YA 5G4WA 4JYDA 4JR5A 1ZY9A 1J2WA 1GYNA 2DU2A 1TPFA 3G3DA 4IUOA 1KLZA 1SFLA 1VH7A 1OJXA 1WYIA 4IMEA 4LUJA 4FNSA 1YXDA 2BZNA 1JJKA 1TSIA 3EX4A 1K8YA 3QW3A 5DLCA 5G1TA 3LTSA 3GXPA 1AW1A 1DJNA 2OX1A 4O18A 1K3UA 3LBCA 3NQAA 3KXQA 3E02A 3NQ8A 5D09A 1OFEA 1W1ZA 4JXCA 2FJKA 8TIMA 1FWSA 4UFLA 2DORA 1SO6A 1W5OA 3C2VA 4RLIA 4TMBA 4JEQA 3B06A 1XM3A 4IPJA 1Q6RA 5H91A 1YADA 3P5YA 4YWIA 1ZALA 3C52A 5F2LA 4JTJA 2Y63A 3A23A 3W7KA 4IQLA 3O6CA 3NA8A 5KITA 1G4EA 1Q3NA 1ZAIA 4BR1A 3TR2A 1D3HA 3C2EA 3V75A 1FUYA 3QSTA 1ICSA 4JX6A 4EOUA 5CPNA 4XZ9A 2R8WA 3UZJA 1OX5A 4I7VA 4JTHA 1FXPA 3TCEA 4GE8A 2RFGA 4NJKA 5TBOA 3TFXA 2EPHA 2DZUA 4LC8A 4AHQA 2YW4A 3M7WA 4P61A 5AHFA 3FKRA 5HMSA 3HG3A 4NXKA 1ZFJA 3QJAA 3QC3A 1VCVA 4ZL1A 3NQGA 2X1UA 3PG8A 3TQKA 3W2JA 1WBJA 5DBUA 2GJNA 3S5NA 3N73A 3P61A 1LORA 4OBTA 2DZWA 4IMFA 2BWGA 4ICNA 5FEXA 4RKAA 4PA8A 4XBSA 1SQ7A 2RDWA 2ZZ6A 1MEIA 1O95A 1W8SA 4MUZA 2NUYA 2QCNA 3M5ZA 1VLWA 4Y9AA 1X7FA 3EXTA 4G1KA 4DEFA 3MJYA 4WZHA 1S3HA 4O52A 3L9CA 3TX9A 3DI1A 3NYZA 2WSRA 3R89A 4NUWA 2ZRYA 4LWWA 1Z42A 1G7VA 2H3BA 1T96A 3M41A 3VE7A 3THQA 4R34A 1TPDA 1K8ZA 3N14A 1GTHA 2JGYA 4XWUA 1JVNA 1XUZA 1TCDA 3NAVA 5FF4A 3VKJA 4YMZA 3PB2A 5HINA 6TIMA 3NQEA 2H8ZA 1F5ZA 4MLJA 1H5YA 3GAYA 5DN1A 1ZCOA 3C4UA 3JS3A 4GXMA 3WK1A 1G69A 2V2HA 1KA9F 3FFSA 4B5NA 5DY2A 3GB6A 4JY8A 3N3MA 1PVNA 2YX0A 3W7NA 5BW6A 4PC8A 4ZMGA 4TR9A 4W9TA 1S5WA 5EA9A 2YW3A 5D33A 1JQXA 3MWAA 1X6UA 3W71A 4LVBA 3NPXA 2CLMA 5K9XA 1XBYA 4WY0B 3UD6A 3Q2DA 1B4EA 5IBXC 3GKAA 2CU0A 3NPUA 2QDGA 1TMHA 5KZEA 3CTLA 1KM2A 3TAOA 4FX6M 4HKPA 2QDHA 4TIMA 3ELFA 3B0UX 4UCGA 2WKJA 3GZ3A 4X9SA 4Y90A 5AFDA 5CSRA 2H8XA 3BG3A 4LV9A 3RF9A 4AEOA 1VYSX 4O11A 1WAUA 2ATMA 3CIXA 1QWGA 4MJMA 2CLHA 3TH6A 2ZZ1A 2DZTA 4BI5A 3GXNA 1OK6A 4O15A 3TSBA 1H50A 1JRBA 4FIRA 3W07A 4RXFA 4IPIA 4UFJA 4QSHA 5F4WA 3LCHA 3NQMA 3ABQA 3LBMA 4JIPA 7TIMA 1PV8A 1R46A 2Q3OA 4M5PA 3NVTA 3IVTA 1QDSA 1TPEA 1XI3A 3PF3A 3EX6A 4ADTA 1C29A 4AHPA 2DZXA 5E0KA 4QISA 4FXRA 3E12A 5CPLA 3KHJA 4JDBA 4PTNA 1DBTA 3UYCA 4MLRA 3S5OA 3M5YA 3R13A 5TQLA 3BG5A 5LHFA 3HG2A 4ZQCA 3EWWA 3DKLA 3PC0A 3NM1A 3C2OA 1OFBA 4UUIA 4WOZA 4AWUA 3CM4A 3QM3A 4UXDA 4TX9A 4MY9A 1DL3A 5HUPA 3P7YA 3SECA 4K8EA 1TV5A 4UMBA 1LDCA 3B0PA 3LV6A 1KTBA 1ME8A 2ISVA 4KFOA 4LS0A 1WXJA 1ZAHA 2R14A 2QCDA 3TFCA 1KFBA 2Y6ZA 1FCQA 1F6KA 5D04C 3TJLA 1TQXA 4N9BA 4AF0B 1M5WA 1IF2A 1ZAJA 2GQAA 3QRHA 4N9EA 4UTIA 1JUBA 4ADSA 3B8DA 4LU0A 4IMGA 3S1UA 3PUEA 3EEGA 3QPYA 1GVFA 3LOTA 2NWSA 2W6RA 4UMAA 1TV7A 1A5BA 3S9YA 4UTJA 3PSVA 2E5BA 2D73A 4FX8A 4E0CA 4LY8A 5F2GA 4LVGA 1K02A 3KVLA 2X1SA 2PRHA 3HPSA 3I65A 1U83A 3PY2A 3LCFA 1OK4A 2J9YA 2JKAA 4X3ZA 1GYLA 4YLWA 3MHGA 3O07A 3NOEA 3W1QA 4UFHA 4QNWA 2YSWA 5D2YA 5DCEA 3TW6A 1IXOA 2A6LA 4Z08A 1FWNA 1FX6A 4Q4KA 1B57A 2PC4A 1VQTA 4HNVA 5G2HA 2YDAA 3IIXA 4IXXA 1BWLA 1QPOA 5I3KA 4JTUA 3GR7A 4JNMA 3YPIA 5SWUA 2Y7DA 2ZRXA 3WJSA 4LV4A 3KVKA 4UTMA 3SIZA 3M47A 4POCA 2C6QA 2DZPA 3H55A 1F6PA 1OFRA 2ZRWA 3H53A 2OCZA 2ZBTA 4GUGA 1CW2A 2A7PA 3C0JA 3OVQA 1Z41A 1Z44A 2YCEA 3KRSA 4I7WA 1FCBA 4ADUA 3S1XA 4LNYA 1RV8A 4MJZA 4OU1A 4ZVJA 3FEMA 4JICA 2A21A 1Y0EA 4IXHA 4K7VA 1VHNA 2BSLA 4RZ6A 4QAIA 4Z1CA 2FPTA 2W0UA 2WPBA 5CGQA 4QNEA 3M0ZA 4EIVA 1Q6QA 4CQAA 1GZGA 2BXVA 1F73A 5HUOA 1AW5A 4NZFA 3PULA 2QEZA 4GUHA 3LCXA 5D30A 2KZHA 4S1FA 1JCLA 2ZZ4A 3QW4B 4RXGA 3G0XA 3TK7A 3W2UA 3S6DA 3RK8A 1W3NA 2VENA 3MUXA 3TC6A 1KLYA 3MP4A 3NDOA 5LGZA 1FCUA 1SZEA 1YDOA 1KFJA 4LS2A 1VCFA 4FIQA 2QCFA 1IXNA 1BWKA 3D0CA 3UWWA 4Y96A 1L2UA 2Y7FA 1GT8A 5K9CA 3SW6A 1W5MA 3ATYA 4HT3A 1GQNA 4K8HA 2V5LA 4JX4A 3UZ5A 2J9ZA 2WV8A 1G6CA 5C5YA 4EF8A 5D38A 1EP1A 4CNPA 5DELA 3OVRA 1YLVA 4ONVA 4KFNA 1PE1A 3GDLA 1VCGA 2YR1A 3MI6A 5D32A 2JBMA 4RCXA 4AWTA 4HNNA 1Q6LA 1YXYA 2AGKA 3W7CA 4GWEA 2EF9A 1AL8A 5ABTA 2QCCA 3CC1A 4MPQA 3CPRA 2C16A 2XN0A 1TB3A 3HGRA 4CLMA 3IIVA 1N55A 5AB3A 3ZFHA 4WQ6A 4Q33A 3C61A 4GC4A 3EWXA 3PBYA 2G96A 1M7PA 1JULA 3CHVA 5DBTA 1HG3A 3NXFA 1D3GA 1L6YA 4AVFA 4UNLA 2GJLA 2F84A 3LCIA 3M44A 3ZWSA 3VCRA 1W31A 4NJIA 4O4WA 4MFDA 4DO6A 1I4NA 4PCFA 5AHNA 4IGHA 5J5DA 1O5XA 2TSYA 3SSJA 3MP3A 1ZHAA 4NT0A 2V8ZA 5HQEA 3W1UA 4MY8A 4M6QA 3W74A 3G8EA 4BK9A 1FXQA 2QCHA 2NZLA 3T55A 1SO3A 3DFSA 4MKNA 3O06A 4LTSA 3HG4A 1GJPA 4Z0JA 2YGYA 4N4PA 4Y6GA 3UWQA 3LRKA 4A3UA 3LB0A 2VKZG 3IIOA 4JTKA 1VR6A 4O14A 2XFWA 1LRNA 1TV8A 3KVMA 2FIQA 1OHLA 1NFBA 2ZRUA 3FIGA 4LVAA 4IX0A 3W7RA 5AYXA 4QM1A 1XBZA 4O54A 2Z0IA 2DP3A 3S5ZA 1OFQA 5E93A 4WY0F 3KVJA 3B05A 2O7SA 1KFKA 2VFEA 3P67A 2VFHA 1SZGA 3G0SA 2EAWA 3W1AA 2DZVA 3TXVA 3DAQA 5LSMA 2NV1A 3VI2A 1P0KA 3NQVA 4S2BA 2OMAA 5E1QA 1TTPA 2ZA3A 2E6FA 3CT7A 1LM1A 1Q6OA 4UR8A 1LRTA 3DFNA 1F05A 2J27A 1N7KA 2QJHA 1JUKA 4O1AA 1WV2A 3AO0A 1VS1A 3W7IA 1SZNA 1X1ZA 4O12A 4S2CA 4BI7A 4R33A 3DENA 2GOUA 3W2LA 5G1YA 2VEIA 2QF7A 3T44A 1R47A 3IGSA 4JTSA 2C15A 3P62A 3M43A 5KMYA 1EEPA 3SJ3A 3DFTA 3QSRA 5HULA 2ZA1A 3BLFA 2Y61A 1KFCA 4GUJA 3WK3A 5FF0A 3CEUA 5HWMA 1HO1A 1UJPA 1YDNA 4FX7A 3USBA 1XFBA 3O16A 1QFEA 4O8RA 2VFGA 2Z1BA 3BLEA 3EWYA 4BI6A 3SI9A 1K03A 1VGAA 2VFDA 1KBJA 1JCJA 2CLKA 2ZCGA 1OABA 5D2XA 1KM5A 4IJBA 3BGJA 1TJPA 3MHFA 2E6AA 3LRLA 2R91A 4MIMA 4I7UA 3ABSA 4NJGA 3T40A 5CSSA 5HJLA 1TPVA 5DY3A 1XDMA 3G1FA 1W5PA 2P1FA 4UTWC 3L0NA 1W56A 3NEVA 4PL1A 2V5BA 3CQ0A 3QMTA 4O17A 1SR9A 3M9YA 2GQ9A 1JCXA 1QO5A 3IIZA 3GLCA 2RKXA 3FJLA 3W72A 2B0MA 3R12A 4NNBA 3EKZA 4N4QA 4PFMA 4XBKA 4AMAA 4C1LA 3N9SA 3PBVA 4QIUA 3OEXA 1YDVA 5L6UA 3BW3A 4AAJA 3KAOA 3S1WA 3SR7A 2BX7A 4K36A 5AC8A 3M6YA 2VEPA 2QKFA 2QCGA 4GUIA 4LRTA 3G1DA 1UUMA 1GVQA 4OGZA 2V81A 4IMCA 4LT9A 4NJJA 3M1ZA 3W87A 4DPQA 5BMXA 3DBPA 3LHYA 3PVFA 4GFSA 3UXAA 3WK0A 5C6MA 3RU6A 4A22A 1I2RA 2HMCA 3T78A 3PBWA 1W3IA 1EUNA 5H2ZA 1I2OA 1RVGA 4HPXA 3I7QA 4M7TA 5I3FA 4LUIA 4DF2A 3TDFA 3W7EA 1VRDA 2GVGA 1RD5A 3GDTA 2H90A 1QCWA 2OT0A 2G95A 2Q3RA 4UTUA 3L67A 1KV5A 1KFLA 3W1NA 4UFMA 1SW0A 2E5DA 4WX2A 3UY7A 1KM3A 3F03K 5F1VA 2Z6JA 4QITA 3AJXA 1W5NA 3TSDA 3NGJA 1LOSA 4HSNA 3SZ8A 4FNPA 3LM7A 2Q8LA 4WJEA 1I8JA 1NEYA 4A2SA 2VELA 4JDYA 4LOCA 1M6JA 3CLMA 1IXQA 3R5EA 2JGQA 3L2IA 3M5VA 1A53A 2OT1A 4RZ4A 3ZS4A 1L6WA 4NX5A 3LXBA 3GNNA 1VLIA 3GK0A 2HSAA 2V0TA 4OWGA 3L0GA 1PHWA 1FDJA 1LBMA 1OFAA 2R94A 2JKPA 1DQXA 4BFAA 3N19B 2ZZ2A 4EVZA 1L9WA 3E0IA 5I3JA 3G22A 2GVLA 2FQIA 2J6XA 4OE7A 1PCKA 4JTIA 1AG1O 3MMTA 1NSJA 1P0NA 2V30A 5LNWA 2Y70A 2HS6A 4CCCA 3DI0A 3S42A 1WA3A 4AF0A 3OG3A 1RQEA 1KTNA 2NXHA 3DH7A 2TPSA 2VEKA 3NQ6A 2I14A 4DBDA 1H7RA 3V1PA 2Z6IA 5I3GA 2GQ8A 1ME7A 1D9EA 5F4XA 4WXZA 1LBLA 5HR6A 3PM6A 5DCDA 3BARA 2CLIA 4D2JA 2CZ5A 4DBEA 1FCVA 1LYXA 2A7RA 2HS8A 3GVGA 3EX3A 3L21A 4WOQA 1G7UA 5LNVA 2NUWA 3HB9A 1RQHA 3M16A 3W22A 4KWVA 4YCOA 3TROA 4RZ5A 4UFIA 2DJXA 3MBDA 3BK0A 2ISSA 1JUEA 4I9AA 3STEA 2ZFAA 4LS1A 3EKLA 1WDWA 1IIGA 3TXZA 3WJZA 2HTMA 2XN2A 1H7WA 5LGXA 2CLEA 1I2QA 3NL6A 1GVRA 1A50A 3LHVA 1RQBA 1EX5A 1H63A 1YTEA 3NQCA 1N8FA 5CKSA 3W9ZA 2A85A 2RH9A 3EXSA 1THFD 3OBKA 5L9FA 3FYPA 1J4EA 1JRCA 3W7QA 4JGDA 3P84A 3U8GA 4ZQOA 2A6NA 5T26A 1AL7A 2C0AA 2VFIA 5G4EA 1ALDA 5FF2A 2B4GA 4UTTA 3DFPA 3STCA 5AN7A 1AMKA 2Y62A 1KTCA 4DXVA 3SY5A 1HL2A 3HJZA 3N2MA 4UMCA 1AW2A 4HNTA 2GPTA 3IV3A 2W79A 3HGJA 3BLIA 3RLUA 3HBLA 1H1ZA 3NPVA 3G0UA 2NX9A 4Q32A 1GWJA 1SUXA 3GR8A 5C54A 3EX1A 5AYZA 1MEHA 1PS9A 3DKJA 4TU1A 3EB2A 2C19A 2QUUA 3EX2A 2NWRA 3N9RA 2YYTA 1KBIA 1EB3A 4MZYA 4OT7A 5K9DA 5F4SA 2QCLA 3GX9A 1L6SA 4LRSA 5EL1A 4IOTA 3TMLA 3NQDA 2CLLA 1HFBA 1NVMA 3DFQA 1H51A 3HQ1A 5K4XA 4FNUA 5CPOA 4H3DA 4ZQNA 3P5ZA 4JTGA 1GG0A 3G3MA 4ORMA 4YCPA 3LCLA 1QAPA 1T99A 2NX3A 1TRDA 3C56A 3LCGA 4DELA 3MYPA 2PCQA 1JQVA 1FY6A 2OJPA 3FYOA 3L5LA 4ZZ9A 3H54A 1MEWA 5EYWA 3G8RA 4PEKA 1I2NA 3GDKA 4JN6A 3BW2A 4UNKA 2VEMA 3U6WA 4JTLA 1DVJA 2E1DA 3W23A 1G4PA 2CZFA 3HF3A 3LRMA 3K30A 1OYBA 5AHLA 1TYGA 1QPQA 1R2SA 2Y7GA 3FS2A 2E09A 5BNKA 2ZRVA 3LI1A 5HNRA 1OVDA 5K7JA 5LHEA 4FHAA 5EPDA 4UFKA 1LTDA 4OV9A 3QFEA 1EPXA 4FF7A 1KM6A 5LNUA 1TPC1 1A5CA 3LHZA 3G1AA 2QAFA 3CB8A 4M19A 3W1MA 2NXIA 3W3OA 2WSQA 3C8FA
chains in the Genus database with same CATH superfamily
2GSJA 2PWUA 3UWYA 1MWOA 4ATWA 3SJNA 3TAKA 1U2YA 1PWMA 3CXOA 2BY0A 1EJSC 2CPUA 4BKNA 1RP9A 1T0OA 1JYXA 1NH6A 4D71A 5G5IA 1XFCA 1ZGDA 3DECA 1RR2A 1XRFA 1SGJA 1GHRA 5KINA 4RDVA 2RDTA 2QPXA 1MW3A 1WDDA 4IHCA 3A3HA 3DFYA 2BXZA 3V7PA 3FOKA 4K8GA 4HCDA 4LBUA 4F9DA 5CZSA 1GG1A 3KOFA 3MPGA 3E2QA 4FZIA 2PDBA 5LKYA 1I1XA 2HDJA 1ML1A 1CGYA 4HTYA 2C13A 1C92A 3CMGA 3T7VA 1QUMA 2CZEA 4FNTA 1WPCA 1EWEA 3AHXA 3ATZA 4ZOBA 3W7OA 2JQXA 5LNSA 3QN3A 3VIOA 2JF6A 3MI3A 1ISVA 2H6RA 5AOUA 3E96A 3A12A 4GQQA 2WJZA 5AHEA 3GIQA 4E2VA 3LLDA 1OFDA 3LHWA 3I68A 1R7AA 1MQQA 3TC7A 1TPUA 3VYLA 1P6BA 5KSWA 4PUMA 1YEYA 1DXIA 2IUZA 5E9AA 3W76A 2FDSA 2XZ9A 1NAL1 4CD8A 3VTRA 2J24A 1DE5A 2G5WA 4H4IA 4HOWA 3QMSA 1NTHA 3P8JA 2C8NA 2V69A 3KX6A 1GQLA 3RFAA 4LB3A 2CIPA 3BMWA 4MZ8A 1H7OA 4B16A 4LVFA 3NSXA 1B3OA 3LPFA 2ZUMA 4H9XA 3RO6A 1EIBA 2E7FA 2GYIA 2OG9A 4K39A 1D7FA 1QHZA 3C3NA 5AHIA 2EEXA 2V2DA 4UIOA 5M3WA 3MSDA 5A6BD 2DUAA 3AIRA 1KKRA 2BTMA 3BVJA 5BRBA 4TOQA 5D9PA 4A3RA 2GOKA 3IANA 2EQDA 3S2NA 2QJIA 1UA3A 2I9UA 3QY8A 5ABGA 1LJYA 2E6DA 2WHKA 1JZ7A 3A5FA 3AMLA 3SBFA 2FTPA 3KFTA 1UZ4A 5T8GA 4PFHA 1Q13A 2VYOA 3DEQA 3MUIA 4H9ZA 1FP8A 2I57A 3W7GA 3GXTA 1W91A 2ZX8A 4ZTXA 1XCFA 1ZBWA 4PSPA 3SQLA 1R30A 3TN4A 4UTKA 3PSWA 2YDSA 1C7TA 1VAHA 2Y85A 2I5IA 3DHDA 4M7SA 1G1YA 1HUVA 2CFFA 3QY7A 4V15A 3WYZA 3ARSA 3E49A 4FLRA 2RDUA 4MAZA 3TOPA 3TE9A 3WNPA 3IS4A 3ABXA 3KBSA 4LVDA 4BWLC 4ZSUA 3EOLA 1XPYA 1CXKA 1A5NC 1U22A 2WJFA 4L9YA 3LPGA 4XO6A 1HL9A 2Z1WA 3L5MA 3WLJA 1QI3A 1E71M 1K7FA 2PBOA 1XR2A 4GHRA 4IX2A 1V7AA 4ZQMA 4TO8A 3W73A 3M5XA 2FB3A 3JRKA 1FWJC 1EFZA 3OLIA 1E1CB 4NZJA 3H23A 1EO5A 5FESA 4LUSA 3IV8A 3A9IA 1QOQA 3DU0A 2E9MA 1EBGA 1EDQA 4NJHA 1KBKA 4XKYB 1UKSA 3B3DA 5FL0A 4EKJA 4KCTA 5AYBA 3BZGA 2VDIA 4I8DA 1GVEA 3TQVA 2FLIA 4ZFCA 3LERA 4G6CA 5JUVA 1EWDA 1RBLA 3U2OA 3ZWTA 2J77A 3QGVA 3P80A 3PB0A 3L4YA 1WKFA 3GG1A 5JXQA 2WVUA 3ITCA 3CYJA 1VBUA 1PHQA 2WM1A 1CLKA 5A5WA 4F0KA 3BLDA 1S2VA 3MYOA 1E56A 1VEMA 1XL9A 2E1WA 9XIMA 3VGFA 2H3DA 1UC4A 1H5VA 2X41A 2YA2A 4JTEA 3ANUA 1QI4A 1PTAA 5C55A 1QNVA 2PD9A 1G5AA 1S2WA 1LP6A 4PMUA 3WD3A 3NZ1A 4FXJA 2FB2A 2YFNA 3MY9A 1Q66A 2CW6A 4L61A 4RJEA 5I6SA 3VFCA 4P7OA 4W7VA 4DF1A 1UW9A 2XVLA 3APYA 3FLUA 2HEJA 3G1YA 2WWCA 3W2KA 4ZGYA 2QF8A 1KM0A 1VF8A 1RPXA 2PDHA 3PPCA 1R3VA 2PRMA 3TMQA 4I5XA 1WZLA 1PJ9A 4YIWA 1TVLA 2EKCA 3A5VA 4Q4OA 2OOGA 4FB7A 3T4CA 6ALDA 3SIMA 3MUZ1 3AOFA 2ZZ3A 4FNQA 2O9OA 3QOMA 1SR0A 1Q6CA 3GBEA 3PAOA 5FD0A 5DMMA 4Y8FA 3AS1A 1US2A 3TUUA 4MB1A 4AVNA 3U0HA 1O68A 5KTLA 3BJTA 3QZEA 1G9HA 3P81A 1U30A 1GVOA 1VFLA 4ZQPA 1R86A 4AYSA 2QLYA 1GKQA 3BL3A 3DHFA 3BAXA 2ZADA 3W2MA 2ZUUA 1PIFA 3RLVA 3BQ5A 4A4AA 4MYXA 3M46A 4L64A 1XISA 3IUDA 2FFCA 4L80A 2F6KA 2YL5A 1SMAA 1ISYA 4JFWA 1XXXA 4PZVA 4Q7NA 3B9EA 4C6OA 3EDKA 3VCNA 4J3SA 1AQFA 3UPBA 4A8NA 3PUOA 3HGSA 1D8WA 3E9AA 1Y5WA 4F2BA 5M03A 4RW5A 1KV8A 1JCMP 1S2TA 3SDOA 1Z3NA 4ZB2A 1KM4A 1ITQA 4H7CA 3N2CA 1UZ1A 3QPEA 4UOJA 5CZTA 4CN1A 2DH3A 1UUQA 2P0OA 1RA5A 4H8NA 5AYYA 3R43A 2QCEA 3ZR4A 1TO3A 4FPSA 1B2YA 3FDKA 4O0KA 5J04A 3ZSSA 3C6CA 3E2VA 3OVPA 3UJ2A 4UR9A 3DC0A 4DJDA 3HPZA 4GQBA 3CUXA 1MXGA 3PNZA 4IMDA 1TA3A 5DXXA 1UD6A 1NIUA 4KS0A 5HAOA 3F4DA 4QG9A 3CLWA 3VM7A 2I9EA 2OTDA 3L68A 5A8QA 1TPH1 4GYPC 2JE8A 2QVNA 1Q6GA 4DJED 2XU2A 2MNRA 4RE3A 1H49A 3UGVA 2FYMA 1G4TA 4Q6XA 1L2QA 2YYUA 3P8IA 2GUUA 5DCBA 3PZTA 2PRLA 2R9RA 1TTIA 4AISA 1OC7A 4GMEA 3S2CA 1PCWA 3B8VA 3BLPX 2NLIA 3L23A 4D6IA 1SO4A 1TTQA 3EYPA 3E0LA 5JMUA 5TAOA 2VNCA 2VL4A 4AQLA 5AZ1A 1OF8A 1ICQA 3L7RA 4N9DA 1O1ZA 2DJLA 3WDPP 1YE6A 3FJ6A 1B31A 3RGTA 3QH2A 3AIQA 1LT7A 4RX0A 3WK2A 1ONXA 4X0NA 2WC4A 4O28A 3W25A 1EJXC 1TRIA 1UKPA 2ABAA 2HROA 3N34A 4LF2A 1F7BA 5I7GA 1KO0A 3DGRA 3GWQA 3H2MA 1VYPX 2GL5A 3EOOA 3NJ3A 3MP5A 2D1ZA 3PJWA 5CG0A 1P5BA 2OYMA 3WN6A 2OKTA 3GHUA 4JQ4A 3AU6A 1I9CB 1TELA 1KRBC 4WXYA 3TJXA 2X1TA 4X60A 3PG9A 1A5KC 2CWNA 2I7GA 3UG8A 2BOEX 3W6LA 1LOLA 2FZNA 3LTPA 3T0DA 3IJQA 3OO2A 4D6FA 4HHHA 1R0MA 2ZICA 4K37A 2C71A 2VFFA 1H3GA 1DJQA 5FCZA 4DB7A 2PI6A 4HA4A 4I5RA 3T4WA 1DWFM 1VBJA 2RGMA 3E5PA 2QCDB 4H04A 4JTFA 1YPIA 1GOIA 1JDFA 4LPCA 3L2MA 3TYDA 3TV8A 1MRQA 1ECQA 2A4AA 4N2YA 3VNDA 3W7JA 4C7GA 2PDNA 6ENLA 4XTDA 3S5YA 2WC3A 3MMWA 5G4WA 1ZY9A 2FH6A 3G3DA 2EBNA 2P0IA 1GGOA 2X42A 1VH7A 3AIVA 4IMEA 4FNSA 4U31A 2PLJA 1GORA 5EMMA 1K8YA 4GZEA 3UESA 1YHTA 5DLCA 5G1TA 3LTSA 3GXPA 2YCLA 4Y9NA 1SFSA 2OX1A 4PMOA 3AUJA 1BYBA 3HQPA 4BQ4A 1OY0A 4O18A 3NQAA 1JDAA 3KXQA 4HPGA 3ZLFA 1OFEA 5BRQA 4HCHA 3KL0A 1UMLA 1FWSA 1OZQA 4UFLA 3C2VA 1YRRA 2GK1B 4RLIA 1CECA 4LYRA 2PSNA 1GZ1A 1CBGA 5BWAA 3M0XA 2NQJA 4IPJA 1CPUA 2F9RA 3APGA 1Q63A 2OLSA 3CO8A 1B1YA 1QNQA 2FTWA 3HQNA 3VOCA 1ZALA 2IKJA 5KITA 1XCXA 3FSTA 1VB9A 3ZLHA 4M51A 2PTXA 3GTHA 3QSTA 1ICSA 4JX6A 1PWLA 4OZOA 3UZJA 5BXTA 3TCEA 3VOHA 4GE8A 2RFGA 1WB0A 3TFXA 1M03A 2XJ7A 4W87A 4LC8A 3F2DA 2Z26A 4Q7IA 3WL0A 1F3XA 1AVAA 3FKRA 5HMSA 1U5HA 4HK5A 4XVEA 4NXKA 4M29A 3QC3A 2DW7A 3CPUA 1A0CA 5LIKX 1VKFA 1R3WA 5HMDA 2ODOA 3K2GA 2ISFA 2DV0A 4IFOA 1OADA 1EPVA 1LORA 1EHNA 1T5AA 1QW9A 1W1PA 1MEIA 2O55A 1O95A 5CAKA 4LAUA 1W8SA 4AIOA 1J10A 3VU2A 1X7FA 3BSMA 4DEFA 3B8UA 3DX5A 4WGXA 3FA3A 3TX9A 3DI1A 4Y9MA 3ZVHA 1SJDA 4R34A 3ZIZA 4QROA 2JGYA 3CH0A 3KL5A 3CL6A 5FF4A 4YMZA 3OGSA 2GUYA 1MDLA 3STPA 1F5ZA 4N0RA 2AL2B 4YYCA 2GGHA 5DN1A 1XD1A 4DO7A 3FFSA 2INFA 4B5NA 3N3MA 4WKHA 1PVNA 1IT8A 3A64A 2QV4A 1P48A 4PC8A 4ZMGA 4W9TA 2WB5A 4WSHA 3W6MA 2CZVA 2I17A 3FW6A 3MWAA 4UZUA 3II1A 1X6UA 5DFAA 1GW9A 2Q8XA 5HPOA 3Q2DA 4JBRA 4MWAA 1SVDA 3GKAA 2CU0A 1DJYA 3WENA 1TMHA 5KZEA 2WMHA 2HWGA 4HKPA 1K8CA 1PDZA 4UCGA 2FMOA 3GZ3A 4OVXA 4NZCA 2MANA 3LEPA 2IQ0A 1ADSA 4AEOA 1WO2A 1VYSX 4O11A 1WAUA 2CXEA 2VHLA 3TH6A 2A3HA 2HE8A 4BI5A 3GXNA 1OD8A 2WYSA 3BICA 2Y0FA 5D8ZA 4FIRA 1PPIA 4RXFA 3GHSA 1TV4A 4H9VA 1F3TA 5F4WA 1BF2A 3ABQA 3CUFA 7TIMA 4DWDA 1LWIA 4DAIA 2ZX7A 3S4TA 3D3FA 1TPEA 1XI3A 4AC1X 5CSYA 5A6MA 3QXBA 4QISA 2AL1A 3V0SA 3ZJKA 3ZYZA 1MZRA 3R13A 2Q01A 3HG2A 3EWWA 3TQPA 3AS3A 2HBXA 4UUIA 4KMQA 4LYQA 1B3XA 3ARQA 2NVCA 1EGZA 1I0BA 4MY9A 3RXZA 5HUPA 2EPOA 4K8EA 4URIA 3QZ6A 3LV6A 1ME8A 4Z2LA 2IQDA 1ZAHA 1Q7MA 3GO2A 1HVQA 3H2FA 2QCDA 2QYGA 1FCQA 5D04C 6A3HA 3V5CA 1TQXA 1ZAJA 1YE4A 4NYUA 1KKOA 4J3WA 3PUEA 5A2CA 3EEGA 4PCTA 3QPYA 3CNYA 4XISA 4IFKB 2FJUB 1TV7A 1V08A 4UTJA 2E5BA 4LY8A 1S5MA 2DQWA 4AZCA 4G7EB 3I65A 1U83A 4H7ZA 3QOKA 4ZA0A 4MJ2A 5D2YA 4V1XA 2FZDA 1IXOA 3A3WA 1FX6A 1B57A 2XZ7A 3FCPA 1VQTA 1PUDA 2J78A 4HNVA 1HNYA 1V03A 2PGRA 4XAYA 4JTUA 1GEHA 3GR7A 4Z1YA 4JNMA 5FACA 4W4QA 2XVPA 3LG3A 1XIFA 3WJSA 1O66A 1RPKA 3KVKA 4J3ZA 3NGFA 2OSYA 2PLCA 4POCA 1F6PA 5A2AA 4GUGA 1CW2A 2A7PA 4Q4QA 1Z44A 3KBWA 4UQEA 5TD4A 2F8QA 3CO4A 3FEMA 3H24A 4JICA 3AIUA 4HU3A 1Y0EA 4K7VA 3ARRA 2QPSA 3CAQA 4Z1CA 1T8QA 2QNEA 1G0CA 1KFWA 2NVAA 1JI2A 5AKQA 1Q6QA 1ZB5A 1GZGA 2GJPA 1OT2A 2AQVA 4FLSA 4DRSA 2UY2A 1GZJA 1FP9A 3ES7A 3OJGA 4GUHA 1UBPC 4UZSA 1JCLA 2ZZ4A 4D6JA 5JIPA 4AD3A 3AZTA 3TK7A 3IJ7A 3UG5A 3W2UA 1ONEA 4NI8A 1KLYA 3MP4A 1FCUA 1SZEA 2OOFA 3C5QA 3V5OA 1JYVA 4FIQA 5LA2A 3UWWA 3R0KA 2DT2A 2E4TA 4A35A 4C90A 4BCEA 1X38A 4I9JA 3ATYA 4K8HA 4IGNA 3UZ5A 3U5YA 4L4OA 4L6OA 1PEZA 3M0IA 3BMXA 5JIWA 1TWZA 3OVRA 3GDLA 1E43A 2VTFA 4GZIA 1CGUA 3B4YA 3AHYA 4HNNA 5AY7A 3EDEA 4MJ4A 5A1AA 4IP7A 3PZQA 2J74A 3GFZA 5AVNA 1FHDA 1JXKA 5ABTA 2QJJA 1UQZA 5DMYA 3CPRA 2D2GA 2XN0A 4RE4A 2YDQA 1EQCA 4RNHA 2HBVA 1OCBA 3C61A 4M6UA 1M7PA 3PZIA 3WD2A 1HG3A 2D3LA 1D3GA 3NXFA 1L6YA 3ARVA 3VDBA 2F84A 1W31A 1VD6A 4E8GA 3M0YA 5J5DA 5I07A 4IIFA 2P50A 1O5XA 3VDAA 3A13A 2CITA 3ES8A 5FJTA 4BS0A 3OU8A 4JIRA 2XVKA 2Q09A 4BK9A 3VMOA 4HVXA 2DT1A 3T55A 3DFSA 3TP4A 3B8TA 3SUVA 4MDPA 2WBKA 1XLLA 3KRBA 1PDYA 1ZL1A 1JGMA 4O14A 1OHLA 3WF3A 1FFQA 4NHVA 4LVAA 4PBEA 1XBZA 4BEQA 1TFVA 2OVLA 2DP3A 3S5ZA 1GYMA 3LSCA 3MS8A 4WY0F 5HANA 1ZP3A 1E0WA 3MUY1 3CBWA 3WDIA 1EJ7L 2ACRA 3RCYA 4WGHA 4W8LA 4IIEA 3FGCA 5LSMA 3W38A 2EG7A 3NQVA 2D2HA 4R9OA 2OMAA 3QC0A 4K2SA 1PIGA 3UXLA 3DFNA 2ADAA 3MDUA 1OGSA 1X1ZA 4O12A 4Y7EA 2TAAA 2WZEA 3T44A 4JTSA 2PF8A 4XO7A 1NFGA 5IHRA 2OQHA 4QTGA 4D8LA 4HMEA 4M24A 3M0KA 1JZ4A 3LS9A 1AJ2A 1KFCA 3WK3A 1HO1A 1UJPA 4FX7A 5RUBA 1CZ1A 1QI5A 3WQCA 2A3BA 3EWYA 4B5WA 2XTKA 3C0QA 2BP1A 1K03A 1EZWA 4DVOA 3SCVA 1JCJA 1E9YB 1BD0A 5D2XA 1BSLA 4IJBA 3BGJA 5CZKA 3NDYA 3AXIA 2E6AA 2QJNA 4AD0A 2R91A 3OODA 1XH0A 2WMIA 4MTVA 3NXLA 4I7UA 3TN6A 4W88A 3VIJA 3T40A 3T42A 4I6KA 1TPVA 1XDMA 4UTWC 1W56A 3VNIA 4QSFA 2ZXBA 3QMTA 1RXOB 4O17A 4GJJA 1JCXA 1UD5A 3FJLA 3R12A 2O56A 4NNBA 4N4QA 4XBKA 1V51A 3N9SA 3O2LA 4PUUA 3OEXA 2PUZA 3MVIA 1DQUA 3WQ8A 5HPCA 4LUSB 3S1WA 3TZFA 2J7EA 4NZ4A 5AC8A 2QKFA 4GI9A 1OIFA 3LZ5A 2PA6A 4WJ8A 2Y8UA 1NOFA 3RPDA 4B15A 4XAZA 4ZXOA 3VNKA 1IZJA 2IPGA 4DPQA 3DBPA 1GHSA 4GFSA 3B97A 3N04A 3UXAA 1JNDA 1BQCA 5C6MA 5BCAA 4IJRA 4LANA 3PBWA 1W3IA 1D2KA 2XGZA 1I2OA 3I7QA 3CQJA 2WWDA 1AMYA 2HE5A 2R1KA 1KR0A 4LAOA 2OB3A 4RNJA 3UZXA 3WLRA 2KAUC 3LSBA 4GVHA 1NQKA 1E6XM 4DJEA 1QCWA 3B0XA 4HMCA 1KV5A 1KFLA 3W1NA 4HNOA 4U10A 3UY7A 1KM3A 5F1VA 1XC6A 2V68A 1M7XA 1EDGA 1W5NA 3TSDA 1LOSA 2Q8LA 3FYYA 4A2SA 4JDYA 2J79A 4LOCA 3HFTA 1U1HA 4A3HA 4ATDA 4AYGA 3M5VA 1A53A 4ICMA 3UA3A 2OT1A 4RZ4A 4B5UA 4E4PA 4LYPA 2OELA 3TNBA 3GNNA 1J0ZA 3AHTA 3VUSA 2AOSA 1B3ZA 3MJMA 3W53A 1F8IA 1TWSA 1NQ6A 4KEUA 1LBMA 1OFAA 3TEVA 2R94A 2JKPA 3UR2A 3WDRA 2FZMA 1UMYA 4EVZA 4AIEA 1L9WA 3E0IA 5I3JA 4JTCA 4HU8A 4CCCA 3DI0A 5CBIA 3S42A 3OG3A 4U5KA 3WZ0E 4XSLA 3K1GA 4DBDA 1ENUA 2VX4A 5I3GA 1HJWA 3HZ3A 4YWSA 3PM6A 4GIYA 5DCDA 3T09A 3WD1A 1OD0A 2CZ5A 1ZCCA 2HS8A 2VC9A 5B7ZA 3EDDA 5LNVA 2PTWA 3HB9A 4JFSA 3WY1A 3RLGA 4YCOA 3TTSA 1H4PA 1XIGA 1XLIA 4H00A 2IW0A 2X2YA 1FFRA 4ML4A 4DZAA 5AC5A 1UIOA 2XH2A 5BROA 2XN2A 5CJ5A 1V6VA 3VUPA 4TV6A 4IICA 4LFYA 1I2QA 4JHMA 1RQBA 1H63A 2QT3A 1YTEA 4TX6A 5CKSA 3VC6A 2F2HA 4ILSA 4V33A 3FYPA 1J4EA 4ZB5A 3P84A 2PDJA 3U8GA 4ZQOA 3URQA 4FF5A 3AYRA 2Z7GA 4UTTA 3SY1A 3STCA 1AMKA 4Q4PA 3ZLGA 3SY5A 1WKDA 4CQCA 3WQVA 2UY3A 3HJZA 1AW2A 3ARPA 2NQ9A 3OHMB 3UYIA 2W79A 3MVTA 3W0KA 3VNJA 3PHAA 3VNYA 3HBLA 1H1ZA 3PN8A 3WBXA 4Q32A 5A6JA 4W7WA 3GR8A 1IGWA 4AY7A 2BODX 4RL3A 1MNSA 3W02A 1IT0A 1MEHA 5DT7A 3EB2A 2C19A 4IG2B 3MQTA 1KBIA 1EB3A 3RJYA 5CGMA 1W9UA 4JZ5A 2QCLA 1HJQA 1EO7A 3KOXA 1NVMA 4HYRA 2QS8A 4GVIA 4H3DA 4ZQNA 4JTGA 3PFMA 1S3TC 1KCXA 1QBBA 3KS6A 4DELA 2YCLB 1IEXA 3OA5A 2OJPA 3H54A 5DRCA 1BYDA 2PP1A 1XYMA 5GNXA 2OWXA 1ZU8A 4QJ4B 5CLTA 3BW2A 1MUMA 3C3UA 2VRKA 4UNKA 2G8ZA 3NCOA 2VVSA 4DYKA 5XIAA 1A5LC 4QS6A 1UWTA 3T8QA 2X7VA 2E9LA 5AHLA 1E3ZA 4DI8A 2PU0A 3TCSA 2E09A 2ZRVA 1AQ0A 4W93A 5EPDA 3KBMA 4J4KA 2WKGA 1LG1A 1U5VA 1YNPA 1A5CA 2XHYA 3CB8A 3W1MA 2NXIA 3W3OA 1BTCA 1DKWA 3R8GA 1JYNA 1O5KA 4IGMA 1F76A 4AB4A 3KRUA 4B9YA 2VO5A 1GVYA 5FIPA 1XD0A 4O1CA 3CAKA 1Q65A 1CWYA 1GQKA 3TONA 2O7QA 3GY1A 3QEZA 1XIIA 1Z6KA 1JCYA 4LW7A 1SJAA 2QCMA 4FR6A 1ZENA 4ZTYA 3W4RA 1CYGA 5CCZA 1HGYA 3CHEA 2AAMA 2V5DA 1Q7QA 1OYAA 3QYQA 3NG3A 2V5CA 3NPWA 2WKLA 3NQ7A 4JL2A 1YKWA 5C8BB 4E38A 2CNCA 1U1UA 4ZOAA 3N3TA 1S5TA 1LLZA 1LBFA 3W85A 3CL8A 4CU6A 3R6IA 1P7TA 4A29A 5I3IA 2GVYA 2UBPC 3RM4A 3L2LA 1Q6EA 1CXIA 4KWWA 3MBFA 2IKGA 2Y7EA 1C91A 3MA8A 2F61A 1U33A 4GJIA 3HG5A 9XIAA 1EJTC 3W2NA 4GKTA 3SCSA 3TSMA 1KXHA 3PR2A 4DX3A 3IEBA 3R2GA 3I10A 4NVTA 1BSIA 3LYEA 1EP2A 4CCEA 3W70A 3WCZA 2UZ9A 1XHGA 3H8AA 1VEPA 1E0XA 4QLJA 2XM1A 1PO9A 4AXKA 4CNOA 4WD0A 3U7VA 4O53A 4IL2A 5DRIA 5LNRA 3XISA 1YTKA 2CHOA 5EY5A 1KQYA 1QHPA 3W7MA 4J3VA 1BVNP 1EL3A 3R7MA 3S2MA 4DF0A 4BF9A 2EPMX 3TNOA 2P3ZA 3L0KA 2J8GA 4AD4A 4U28A 2WMFA 1RP8A 4EANA 3D5HA 2WCAA 4DLMA 3S8HA 1ONRA 3IACA 4LGXA 3FEQA 2FPYA 4QFUA 4ASTA 2V6AA 4CD4A 2X2GA 1IE7C 4G5DA 3GTXA 4DI9A 4GH3A 2PDGA 2DVXA 1IXPA 1ZJIA 2FKPA 4NQ1A 3LHTA 2VDHA 3VE9A 2NXGA 1UWIA 3U2EA 4EK7A 4EF9A 1D8CA 3W1TA 3A3XA 2F7FA 4N7QA 3KBVA 3M07A 4IGSA 3B40A 3UY8A 1JPMA 1OINA 3IAPA 1Q2RA 2DDXA 3EDFA 1DJXA 3UWVA 1SU5A 3AIEA 5A94A 5J5RA 4LUYA 3PJXA 3AMGA 3MC5A 2HV5A 2BVTA 3JZEA 5EFFA 3SN0A 2OU4A 1NWSA 4AY1A 1E70M 1B90A 1J0IA 3WQ5A 4UTLA 3PP7A 3T0BA 1PKMA 1E6NA 5BOOA 5AECA 3MCNA 6REQB 3H4XA 2PZNA 3FKKA 2WC7A 3CL7A 1V7YA 5AC6A 1DJWA 1FWWA 3M6DA 1TJRA 1UHVA 3GNDA 3INPA 5CQ1A 1J2BA 1MVYA 3T1GA 3UWZA 4HMNA 1R9XA 3NQFA 2WAGA 1DXFA 2P10A 1W54A 2DT0A 4LQ1A 1OX4B 2UWFA 3PTQA 4MUPA 3LQGA 3QHMA 4OHQA 5JH2A 1UP2A 5CPQA 2QJGA 4FAMA 3QF0A 1J5SA 4GRSA 4B5SA 4OTKA 4AH7A 3ID7A 1H7NA 3GAKA 3B0YA 4E8DA 3I3EA 4K68A 3BW4A 3GYEA 3RIKA 4Z0SA 3MSGA 3MHUA 1EX1A 1WX0A 1GOKA 3DFOA 5FEPA 1XLMA 1WXYA 2R1PA 1TE1A 2ZUTA 2NUXA 1A49A 4NAEB 4L9ZA 2XINA 2V3FA 1A5OC 2GJXA 2JK2A 3WL1A 5C9WA 1IYXA 3XINA 3SCWA 3SO7A 5D2VA 1VJSA 2E5CA 4KF1A 4PMDA 1X98A 3VIKA 2I1OA 3HQOA 4BEUA 4WEVX 3WBYA 5DXYA 4CQ9A 3P14A 3LXAA 4I90A 4H9TA 1UUOA 1E9ZB 5CAHA 2OQLA 4J9JA 5D37A 3HMJG 5FI8A 1HO4A 4HNCA 2ZDRA 3STGA 5IXEA 4DZ5A 1MO0A 4IPLA 1BXNA 3EEZA 5I23A 2PB1A 4Z1BA 5C9UA 2Z28A 1BXBA 1Q6DA 3L4TA 3Q94A 1A5SA 2PDLA 2X05A 1BEUA 4R7JA 5LXEA 1IT7A 4YL2A 1OCQA 4JCMA 4JFTA 2A3CA 1SO5A 1U5JA 1UR1A 3W7PA 1C9WA 1FWTA 2BGNE 2V5KA 4EPBC 4AX6A 1SSGA 1UZHA 4DJFC 5JBDA 4GXWA 2C14A 1A5MC 4D8AA 5FEZA 2CLPA 4DWSC 1Q45A 1Q4NX 4S38A 2G50A 2GGIA 5IM51 3S1VA 3VGDA 2Q8ZA 2J88A 3N15A 1FVPA 2DT3A 3BAWA 2C0HA 3KL3A 1GEQA 4MSSA 4YPJA 4GY0A 5ABFB 3EOSA 4RW3A 1BRLA 1HP5A 1TIMA 5HNNA 1KM1A 1X7IA 4TMCA 1E1CA 2PMQA 1RHCA 4PODA 3VD9A 1MW1A 3K8MA 4N6EA 3KUMA 3UXDA 3BGAA 2G3NA 3GDMA 1R2RA 1WOBA 3P60A 3W83A 1M01A 4PUNA 4Z1DA 2HPMA 4IMAA 2OODA 2XYLA 3DZ1A 1WKYA 1GQJA 1I1WA 3WEOA 2XWDA 3S6OA 1YXCA 4MY1A 1DWAM 1MSSA 3LNMA 3O6DA 4DBUA 1XUUA 1XGEA 3QPZA 4QQUA 4FXSA 3NURA 1EF3A 3VKAA 3QFWA 3BV7A 2NX1A 5LA0A 2ZRZA 2ZXQA 4ZO7A 1F07A 5HATA 1F74A 4QX4A 1YTDA 4JX5A 3GC2A 3ZT5A 3CUGA 2J75A 1F8MA 3O6YX 1NOWA 4O19A 4WLCA 5EKYA 1XQLA 4KEZA 3LMYA 1P0EA 2PGFA 3OZPA 1OF6A 5BU9A 1XKJA 2PWEA 3AXMA 2BGQA 2R1LA 3WUEA 1KXQA 1PZ0A 5T9BG 3VOGA 4KKXA 4MVAA 4GYFA 4PBFA 4NU7A 2RHGA 4HZ8A 1ADDA 1UP3A 1X1NA 5K4ZA 2YJQA 2VUYA 2Z1XA 1XSKA 4GJ1A 1LL7A 3GHRA 3UWUA 3G1VA 1D3CA 2BHYA 2A2IA 4FOUA 3T08A 2BB0A 4L4MA 2VOMA 4JL1A 1B54A 3CMJA 3E0VA 3ANVA 1UASA 3CASA 3HIJA 1AA1B 1I2PA 3PBMA 3TW7A 4HK7A 5KZDA 1BTMA 4IIHA 1K7EA 2DQXA 4B90A 4OQVA 3TYZA 1I45A 3UJFA 1PTDA 3MCOA 4CD5A 4CN4A 1XBVA 3RCNA 1DHPA 3AIWA 3UJSA 4QAWA 2B7OA 3F4WA 2VWTA 4HPJA 4ENLA 4U5IA 4GUFA 4UTHA 3N2BA 3QKZA 4KH2A 2QZRA 2D2JA 4MG4A 3L12A 5GVJA 1TPB1 2A0NA 1O7AA 4UR7A 1GVSA 1E4LA 3VCCA 4YTUA 2DIJA 4CNNA 3NL2A 1OC6A 1C9DA 4L6DA 5G2WA 4UQAA 1ICPA 3GC5A 1JNEA 4WY0A 4G7EA 1P1XA 3LV5A 4RV8A 4UC5A 3I6EA 1XH1A 4L4LA 1M7JA 3WNNA 4NAFA 3SRFA 8RUCA 3TWBA 4EXAA 4O16A 3HO8A 1E4MM 3P74A 3LX9A 3MU7A 1TA3B 2ZZ7A 1N82A 3UP8A 1C8XA 5J8LA 3IJIA 3F7JA 4WSKA 2ZX9A 5C2CA 1RCOB 4CVWA 2TRSA 2X1IA 1FBAA 1OFPA 3JUGA 1SW3A 1X8FA 2PS2A 2C1IA 1PIIA 2EJ1A 3F2BA 3MANA 3O8AA 3QR0A 4REQB 1SW7A 2BVDA 4NRSA 2E68A 4JS3A 2OYKA 3UCQA 3SB0A 4HIBA 4HSHA 1HTIA 1SZFA 3G5EA 1XLFA 1AUSL 2CLFA 4FO4A 4GH1A 3W86A 1XLKA 3DESA 3AUOA 5CJMA 3RX2A 4XBJA 4BA0A 4OUEA 4C65A 1REQB 4NZ3A 2ZWZA 2VCBA 4JPGA 1GYNA 1HKKA 2Z24A 4IUOA 1KLZA 2BS9A 2D0FA 1SFLA 1WYIA 3RDKA 3Q45A 2CETA 1JJKA 4TTGA 1FH8A 3K1DA 3BANA 1TZ7A 1ISXA 3WIJA 3V18A 1XGDA 2D0GA 4LUTA 1K3UA 5D09A 4JXCA 5C70A 3GS6A 6CGTA 2DORA 1SO6A 3ZM8A 2GUBA 4L4PA 3UFYA 1Y7VA 4JEQA 3B06A 4PRWA 1F6YA 1VFUA 4UTFA 3A9BA 1XM3A 1Q6RA 5H91A 3H7VA 2OZ3A 3F5JA 3W7KA 1G4EA 4I9MA 1FUYA 4UWMA 2WZIA 2O9RA 2R8WA 1FXPA 4KWOA 2VUNA 1VENA 4DN1A 5TBOA 1UP0A 4C1NB 1MYRA 3M7WA 4P61A 1S2CA 1XCWA 3EPOA 3WEMA 3HG3A 3FA4A 3B8WA 3USZA 3AXHA 2GLKA 3TVAA 1WBJA 1Z89A 5EU9A 3P61A 4OBTA 3ZJ8A 1E5JA 2BWGA 4ICNA 2WVVA 2RDWA 2ZZ6A 3H6OA 1XQKA 1NDZA 4MUZA 1EJVC 3EA1A 2NUYA 2QCNA 1HKWA 3M5ZA 3T2PA 4Y9AA 3VZYA 3EXTA 4WZHA 2GDQA 2XDFA 1S3HA 4M0XA 3L9CA 4WJXA 3R89A 4P8WA 4LWWA 1G7VA 2H3BA 1T96A 2AKMA 3M41A 5KETA 4JQ1A 3ME3A 2PDIA 2YXXA 1TCDA 4JNZA 3VKJA 3JZUA 3W29A 4TQTA 3CWHA 4GX8A 1BYAA 3NIYA 5HINA 1PX8A 4MLJA 1GQIA 1ZBCA 1G69A 1QNPA 1EC8A 4S3DA 3S46A 3GB6A 5JVLA 3QLDA 3D6NA 2O4MA 3KTSA 3H21A 3CYVA 3W7NA 1K1DA 1C90A 2Y5EA 4AEFA 1S5WA 2YW3A 1XSIA 4IF2A 4F4RA 1W17A 3MZNA 5IDIA 2WZTA 2WMJA 1EXBA 3ENLA 3O0FA 3RCMA 3R94A 1B4EA 3DERA 3KOZA 4W8AA 2ASHA 5I3DA 3TAOA 4FX6M 1NP0A 1BAGA 3B0UX 4RE0A 4A3YA 3WMLA 2WANA 4PTVA 2QPUA 4LV9A 4AD5A 1X39A 1DPMA 1V77A 2XIJA 3MT1A 5LYRA 3CUIA 3TSBA 3GG0A 4IPIA 4YTSA 5HMEA 3LCHA 3NQMA 1J79A 3VX1A 3LBMA 1PV8A 2J62A 1FH9A 4C7FA 1JFHA 3IVTA 3UF9A 3O7UA 3ITYA 1C29A 5GQBA 2DZXA 4RZBA 3Q4DA 4PMYA 3KHJA 2X09A 4TVCA 3UYCA 2YOCA 2FFIA 3S5OA 4QDPA 5BOEA 4PUEA 3LK6A 3DKLA 2DUZA 5A6BA 2XIQA 3GUWA 4LH8A 3NM1A 3C2OA 4IUGA 4WOZA 1PBGA 3QM3A 4D72A 4UXDA 5A6KA 4TX9A 1P6CA 1DL3A 1RD6A 3KWXA 1RBAA 5A8MA 3AC0A 3JVAA 4LJ3A 2DIEA 4UMBA 2WBGA 1WXJA 4OKDA 3BCJA 3PJUA 3C86A 3SCOA 3TFCA 3KLKA 4QE1A 3TJLA 1J18A 2O9TA 4AF0B 1M5WA 3G6LA 3EPNA 1X96A 5A6SA 1IF2A 5GNYA 2Z00A 2DEPA 3VABA 1ZUAX 4W85A 2W6RA 1ESWA 3R25A 3VINA 3PANA 3EDJA 1A5BA 5EMLA 3S9YA 3PSVA 4ZCWA 3BUVA 9CGTA 4E0CA 5F2GA 4R7OA 4WHBA 1A4MA 4CUCA 1GYLA 5EMYA 4YLWA 3MHGA 2YSWA 4M81A 3TW6A 4KERA 2XPKA 3U48A 3SUUA 1AJ0A 3BDKA 1XV8A 4M8UA 3WQ4A 4N42A 3ARYA 4IXXA 3ARXA 2PDPA 4M1RA 3GTFA 3VXGA 4BJHA 2W27A 3YPIA 2Y7DA 2ZRXA 4M3PA 4LV4A 1M3UA 1KGWA 3SIZA 3ZOAA 3M47A 2C6QA 3H55A 1ZPTA 2ZRWA 1X8CA 3H53A 4PE8A 3NDZA 4IIGA 3C0JA 3OVQA 2GJRA 1FCBA 1MW0A 3G6MA 4E4UA 5DX7A 2F6XA 3FGCB 4BF7A 1BVWA 1R87A 1W9DM 2NSOA 4RZ6A 4MDOA 1QNRA 1ITUA 2PWHA 4NZ5A 4Q8NA 4QHRA 3P0XA 3NOYA 3M0ZA 2BOFX 4LBRA 3OZMA 1F73A 1GVIA 5HUOA 3SFWA 1XLAA 1R3SA 4OFCA 2YXOA 3PULA 2QEZA 2KZHA 3CT2A 3LPOA 4RXGA 3PPGA 2F6UA 3HU7A 4L56A 3RK8A 3GRIA 3TC6A 3NDOA 5LGZA 3E38A 4S3GA 1KFJA 4ROPA 1BG4A 3UWEA 2PCEA 4HJWA 1BWKA 3D0CA 3KWSA 4DWSB 4KESA 1FTXA 4BZYA 3W01A 3N18A 4F66A 2DSUA 2V5LA 4IPNB 2WV8A 4Q4RA 3H70A 5C5YA 5D38A 1R9YA 3WMCA 4P7QA 3MI6A 2PTYA 4RCXA 1V6YA 4C6LA 2AGKA 1YXYA 2RDXA 4WDWA 3W7CA 3A4XA 4GWEA 3UJEA 1AL8A 2QCCA 3UG3A 4GBDA 5BZAA 2C16A 3RILA 1OBAA 5AB3A 4YJ5A 1R38A 4XAPA 4OBSA 4GC4A 3EWXA 2OFJA 1JULA 3CHVA 2V3EA 3LCIA 3W26A 3M44A 4J2PA 4DZIA 1KBBA 3VCRA 4NJIA 4MFDA 4DO6A 3FJ4A 3DBNA 4MNKA 4PCFA 2TSYA 3SSJA 4NT0A 4IQEA 2QDDA 1J11A 4XSMA 5HQEA 3UW6A 1UZDA 5KEZA 4PTDA 4NAEA 2JEQA 1J6OA 2QCHA 1POJA 3BURA 1VRXA 3EMZA 4IT1A 5JQ9A 4MKNA 4F40A 3HG4A 1GJPA 3WUGA 2YGYA 1DIEA 1L8NA 4N4PA 1BVZA 3T81A 3IIOA 3W28A 5GNZA 3QZAA 2XFWA 2VURA 2FIQA 3R1ZA 2OQYA 3FIGA 5AYXA 2Z0IA 3PK7A 4ZE4A 4KEVA 5HNTA 3RPMA 3KVJA 1ZTVA 3B05A 2PWDA 2O7SA 4PB4A 2BNJA 1KFKA 2VFHA 2EAWA 1XIBA 4B5TA 3BOFA 2NV1A 1P0KA 1YX1A 1XIMA 2AAAA 3MKKA 3OOQA 4U3CA 1TJ2A 2XIIA 2VQUA 3G1RA 4UR8A 4GXPA 4AZ5A 1F05A 1ISZA 1OT1A 4O1AA 1WV2A 3PPFA 4S2CA 3DENA 3NYDA 1REQA 4HJFA 3IGSA 1RCQA 4ICCX 3HPFA 2C15A 3DHPA 3P62A 3TLLA 3AHZA 3M43A 5KMYA 3R79A 3DFTA 1RA0A 3SJ3A 3LGGA 4XZIA 3V3WA 5HWMA 4RV3A 5FF0A 3CEUA 1YNQA 2Z2AA 1XFBA 1KBLA 2IPWA 3O16A 1QFEA 2VFGA 4AU0A 3BLEA 2BVYA 2PZ0A 4DJDD 1SFTA 1TJPA 3MHFA 4EP8C 2CC0A 4ZXLA 5ABEA 1E1EA 1W1A1 1W2VA 4HA1A 1CGXA 2DVTA 1J0HA 3ITTA 2XVNA 3VIFA 1E0VA 5DY3A 2WHJA 5E09A 8XIMA 3L0NA 1W2PA 1XDJA 2V5BA 4HNLA 3RU8X 5BOFA 4PUKA 2J13A 2GQ9A 3W24A 4P8XA 3IUIA 5FSDC 2RKXA 2B0MA 3ZVIA 2ZVIA 1IEWA 3EKZA 4DYJA 2GGGA 4C1LA 1DWJM 5I0DA 3EPMA 4QIUA 1QK2A 3MMUA 1OCJA 1WDRA 2ZWYA 1XYFA 3LNPA 4PMVA 3OYZA 1K6WA 2WMIB 4BQ2A 3KAOA 4A8RA 4G56A 3SUSA 3PZUA 2BX7A 1J96A 1PX4A 1JDDA 2XH4A 4LUTB 4GUIA 3RX4A 3SN4A 4LRTA 1UUMA 3LLXA 7TAAA 4IMCA 4LT9A 4NJJA 2W91A 2BY1A 4PMJA 2VI0A 4PMXA 3UCCA 1JAKA 4Z2KA 1O12A 2WVSA 4A22A 2HMCA 3T78A 4J35A 3H12A 1BHGA 4HPXA 4QS5A 1WXZA 1M41A 2R1NA 1B9ZA 4DF2A 2WMKA 3W7EA 3V36A 2XM2A 2H90A 3CAWA 1HXJA 2OT0A 4WDUA 1CXEA 1NJJA 4JKMA 4HQVA 3L67A 1N8WA 4P8UA 4UFMA 1A3WA 4WX2A 3PZGA 3KTXA 4L65A 2Z6JA 3R58A 2WM0A 4QITA 3RRAA 1ECEA 2QIWA 3SZ8A 4HSNA 3FVMA 2OYLA 3DG6A 1I8JA 1NEYA 2QGHA 1M6JA 1P0BA 3CLMA 3R5EA 4R85A 2JGQA 3MTWA 2E67A 3QV8A 1L6WA 4J7RA 1ONWA 3OBEA 3GK0A 2HSAA 4OWGA 3WBWA 4HHMA 4LAZA 3L0GA 4LBSA 4PUWA 1PHWA 1FDJA 1T7LA 3DOPA 2PD5A 4GISA 3N19B 3LPPA 2FQIA 1CXFA 1P0NA 3I4KA 5LNWA 2Y70A 2HS6A 4GCXA 1KTNA 1OSEA 2NXHA 4WVXA 5I02A 1QK0A 3NQ6A 3BLKA 3CV7A 4YS1A 1H7RA 2Z6IA 1ME7A 3VGGA 5HR6A 4UCFA 5CH9A 4A6GA 1W1B1 4AZGA 5JBFA 2CLIA 3GVGA 2X8RA 5DMLA 2WHLA 4AWEA 1HP4A 3ALFA 4XVDA 1RQHA 5EMKA 1KC7A 2ISSA 3IK4A 1S2AA 2BG5A 4GA8A 1JZ8A 3T0CA 3N6JA 1IIGA 3TXZA 3WJZA 3CUHA 1VPYA 3GNPA 3ECQA 4HZMA 2HNHA 3TZNA 1W32A 2EG8A 2CLEA 3EA3A 1GVRA 2FDMA 2FHCA 3R4IA 3N1AA 1N8FA 4CEUC 4Q8OA 1FRBA 1YDYA 3W82A 1R3TA 3CGTA 2INEA 2VR5A 4YU1A 4AEEA 2VZOA 2WW5A 1US0A 5T26A 2VFIA 1JF5A 5BRPA 5FF2A 2B4GA 4L6HA 3QHOA 3DFPA 3GC4A 1EHAA 4TX8A 5HJYA 1XF0A 4GIEA 4Q22A 4DWSA 2R82A 4DXVA 5LA1A 4X9YA 3FY1A 3RO8A 3MUAA 1MFUA 2PP0A 1HL2A 4YHEA 4LALA 1TX0A 3LA4A 1WDPA 1NM9A 1LT8A 3TWAA 1UPMB 3G0UA 3WLNA 1TMQA 1DIDA 3EX1A 5AYZA 2QUUA 5HBFA 5F7UA 3P0WA 3N9RA 2J7GA 1DWHM 4AZBA 2PTZA 2PC8A 5K9DA 1Z7AA 4LRSA 4Q8PA 3NQDA 5TF0A 1HFBA 3DFQA 3HQ1A 1DP0A 1UR2A 4IP4A 4S3FA 4US5D 4PTWA 2XGIA 3P5ZA 1UKTA 3VGHA 3G3MA 4ORMA 4YCPA 3LCLA 1EOMA 1Z69A 2EKGA 5REQA 2NX3A 3LCGA 4MADA 4D9PA 2PCQA 4XZMX 4HOXA 4UQDA 3WFZA 3WNKA 3VNLA 3GDKA 1EJWC 3ARZA 3VZXA 2VEMA 3U6WA 1DVJA 1H0GA 1RUSA 3HF3A 2W62A 1XPGA 1JZ3A 3K30A 4IIDA 1OYBA 1IEIA 1QPQA 1R2SA 4XAFA 5HNRA 4E3VA 3ARUA 5K7JA 5LHEA 4FHAA 3CUZA 1LTDA 2C1GA 1K70A 2OR2A 3E5BA 1KM6A 1Q5MA 1TPC1 3B9NA 3LHZA 4IJCA 3N25A 2J25A 4UTWA 3CPGA 4A05A 3BZJA 1MRAA 2ACSA 2E77A 4FXFA 3TKFA 1VHCA 4X63A 1UH4A 1W37A 4P7RA 1NF7A 4O0ZA 4X2PA 1QR7A 4Y9OA 4NZ1A 4RNIA 3NM3A 3NL3A 2C18A 2PURA 2BMBA 3KCLA 3MZ2A 4EPEC 3CEPA 1QTWA 3HV9A 5HR7A 4QQ3A 1S5NA 2TYSA 5HWJA 5DT5A 4N02A 2XFYA 5U4NA 1VFSA 3W6YA 4DO4A 3FJNA 5TIMA 1A0DA 2Q02A 3EWUA 4JKKA 4C1KA 3O05A 4LX4A 1XYAA 5EGRA 2WNZA 1V0NA 3NZQA 1JZ2A 2FH8A 4WDTA 2D20A 3TW9A 2Z1SA 5D03A 1G4SA 1WOAA 4NX0A 4EE9A 3SCRA 1W3HA 4GNJA 4CN6A 2CESA 2NT0A 4B91A 4Z2JA 4O13A 4M6PA 1V6UA 1AJZA 2QAPA 1EIXA 5XINA 1ZNNA 3NO5A 3TLQA 2VVNA 3GVQA 1LRQA 3EWBX 1S1RA 3GZAA 1E1FA 1QOXA 1E6SM 4IQJA 1GOWA 3SN1A 1TQJA 3UXIA 2JKEA 2EGZA 3LHUA 3WUFA 3EOUA 1TZZA 1O6IA 4MYAA 4A8IA 4D1IA 1M68A 2B31A 4FA3A 4R7WA 4DUWA 3OA3A 4O4VA 1UPPA 5I00A 1VYRA 2E8YA 4GQGA 3QYSA 5FAGA 2ZKMX 3S83A 1E6PA 3B9AA 1EOKA 2DGAA 4DLFA 4QLLA 3Q58A 5AHMA 3FV9A 3QQ0A 4B2DD 2W92A 2J66A 3G77A 3WQEA 2V3DA 5H6HA 5U7SA 1X1OA 1JCNA 3EKGA 3LMZA 1L0PA 1WDSA 1VFOA 1BGAA 4K3ZA 5IDZA 2FVKA 3VC5A 1D7KA 1YYAA 3SUWA 4GI6A 3DUGA 5FF7A 3N9KA 3MO4A 4G2DA 2V82A 3IVUA 1QPNA 4JIQA 1ZBKA 1F2JA 3OP2A 4EAMA 1E6QM 2ISWA 3GH4A 3VOIA 3I7RA 4FLQA 4KT2A 3G1SA 1SJBA 5E9XA 1S5VA 1XICA 3STFA 1SJCA 1H1YA 1H61A 2X30A 1PKYA 2PWVA 4XD4A 1XRSA 4HHPA 4KIEA 4E2DA 1QW8A 4KWSA 4QGCA 2PDUA 2ZVRA 2PPGA 1PYMA 1G67A 4NYYA 1P7TB 2VJXA 1XWYA 2VGBA 1FDZA 4MB3A 1RSCA 3O3RA 5CZ0A 1XDLA 2QJMA 3POHA 3R11A 4Z42C 4P5UA 2YB1A 5A8PA 3W75A 1FDYA 4KRTA 3WBEA 2Z29A 3ZR5A 3SCNA 3TQ0A 1CNVA 3SCPA 5BU6A 4HN8A 3ICJA 5AZ0A 2WO5A 2DSVA 4HNUA 2ZOXA 3SGGA 2ZZ5A 4XKMA 4GO8A 2GZXA 1XINA 3VDCA 1LWJA 3GNOA 4AX7A 3EXRA 2L5HA 4GZJA 5D05A 1CDGA 1GOOA 2CHNA 1DOSA 1DIKA 3F5LA 4TVUA 4X2RA 3FHQA 1IZCA 1Z48A 4G9PA 3KLLA 5DANA 3W7LA 5BMWA 4X61A 3WELA 3TU9A 2QW5A 1TREA 3WH5A 1BF6A 1V02A 4O1FA 1JFXA 3IGHX 3GIYA 1C93A 3WJWA 2AL2A 4XAGA 1YPFA 3EWZA 3C2FA 3R0UA 4JQ3A 4M80A 4MNMA 1H7PA 2Z2BA 3WJYA 3B8SA 2ONEA 1R85A 3OIHA 2XISA 3ARTA 4U4MA 3KDNA 3EB4A 4KW2A 6TAAA 1LOQA 1XLEA 3DYPA 4XIAA 3BSGA 4PCNA 3FVDA 3SM0A 4J27A 1GOXA 3O63A 2XFFA 4Q8TA 3W7HA 2Z4GA 1XRVA 1FHVA 3L66A 4DHGA 4RDYA 1DORA 4L1XA 3MW7A 4DUOA 5I5RA 5F1UA 3ABOA 4MZ1A 4OIFA 2X1RA 4AMCA 1QO2A 1ZSXA 5D2WA 1PSCA 5FEWA 1ZBVA 1R8LA 2E40A 2PDYA 1EH9A 3PZOA 3VILA 5AC7A 3N2XA 3PTKA 2P88A 4YTQA 3UVAA 1TTJA 1RY0A 1XBXA 3N13A 4UQBA 3CIWA 4YXGA 2O0TA 2OSXA 1XLHA 3B4UA 1W3LA 1ADOA 2REQB 4AHOA 1H7XA 3IGXA 3RHGA 5FOOA 2PDXA 4YNGA 1E4IA 3B03A 4H2CA 2UY5A 3PAJA 2QIIA 3TR9A 2C79A 5ECUA 4KQNA 4C60A 1W9BM 3TTYA 3GE7A 1ME9A 3DYMA 1KRAC 8A3HA 3IRDA 4PBGA 3N2TA 1UR9A 1SFJA 1UD3A 1SZRA 2SFPA 1K9DA 3LI0A 2BHUA 3N4EA 2WNWA 2OWWA 1GPWA 4BF5A 3UQNA 3SRKA 4ML9A 5CG7A 3GDRA 4NG3A 1VPXA 3AALA 4OJYA 1HVXA 1AK5A 4IL0A 1U1JA 1G94A 1V4YA 1XKYA 1XYZA 4HP5A 2ANUA 2G97A 2PE4A 2VX5A 4CQ8A 4PUDA 2ON3A 2QVHA 4UBPC 3REQB 1K6AA 3B04A 5F2IA 3EMCA 1NDVA 1YMYA 4JY9A 4AZ6A 2J9XA 2X7WA 4GX9A 2IPFA 4J3UA 3EZ4A 2FMNA 2DY3A 1B4KA 1WZAA 1CEOA 3IIPA 5C9XA 5I3HA 1CXLA 2YBTA 1UD4A 3L5AA 5FF3A 3AXXA 3MCMA 2CBUA 4KRZA 5A6TC 5I79A 1AZ1A 1EEXA 2FGZA 3S1GA 2DZSA 3OBAA 4AZCB 4CGTA 2VXNA 4HSOA 2PDWA 7CGTA 5C7VA 1WBHA 4KIRA 2HXUA 4UTTC 5CJNA 4WCJA 3BAIA 3PBUA 1TWDA 2ZQ0A 2DW6A 3NR0A 1BKSA 2YL9A 3OB8A 1E15A 3WDJA 3BGGA 3W88A 1PL9A 4K7YA 4DUVA 4NL1A 2EXOA 3ABRA 1JZ5A 3CZ8A 4FP1A 5T9CE 2ZUVA 2YBVA 2ZTKA 3H2OA 4L1GA 3APTA 3SGZA 2V2CA 2EHHA 2QMJA 2Y89A 3H26A 2YFOA 1HT6A 4M6VA 1RBOB 3VD7A 1GW1A 1W8GA 3BCDA 3SAZA 2Y2WA 2E3ZA 4RDWA 1V3LA 5GJMA 4YVVA 5EMJA 5D9MA 5IBXA 1A3XA 3CU2A 4RK8A 4GO9A 4DXKA 3N12A 2O9PA 4NSBA 1NFPA 1XLJA 1X6LA 1EA0A 3N11A 3XIMA 3RMJA 3THUA 2AQWA 1FKWA 1VZWA 3ANYA 2ZC8A 4O10A 3I7SA 4PTXA 1P4CA 4Z2GA 3W84A 1XS2A 1UOZA 3NWRA 4JFVA 1S38A 1SPQA 1DTNA 1PX3A 1FWHC 3PUGA 1KCLA 3UZYA 4B3KA 3HM7A 3LD5A 2A3AA 1RJRA 4XZLX 3THCA 5EMUA 4MOZA 3U7BA 2ZTJA 2PF0A 1LLWA 4BY3A 3S2LA 4UOQA 1H62A 2CZDA 4S3CA 2A1YA 3A22A 2ALDA 4A2RA 3GHTA 1UBSA 3NL5A 4XQ6A 2B7PA 3BC9A 8CGTA 5E5CA 3C0SA 1K8XA 3A24A 3WNLA 3GM8A 2ISDA 4JFUA 1QMLA 2E8ZA 2VCAA 4NRRA 3OGRA 4JN7A 1LZOA 1V3IA 2CERA 1EUAA 1CLXA 1DXEA 2WSYA 5KZMA 2NV2A 4U2ZA 3E2SA 3HOJA 4ERAA 3AICA 1I60A 5HK4A 3FA5A 1Q4WA 3TN5A 3GU2A 1TUXA 2FVLA 2B7NA 4E2BA 1FWAC 2A5HA 3WQGA 1W5QA 2WCGA 3DYOA 3N6QA 1GONA 4GOAA 3VGEA 1LROA 2A7NA 2FGLA 1J5TA 3O1NA 2BBFA 1B5TA 3GH5A 3SCQA 1UWQA 3IVSA 1VC4A 1Y5XA 3DG3A 5D9NA 4Q8QA 2QUTA 2RAGA 2W61A 5FJUA 2G0WA 1TPWA 3VFLA 5EB8A 3BXWA 2G41A 1EKOA 3E3HA 1OWQA 4H83A 4MFEA 3FAXA 2PGEA 5C71A 4JAWA 2XIOA 4JYDA 1JL8A 4JR5A 5CC7A 2ICSA 2DU2A 4XD5A 1TPFA 3QV7A 1XLCA 3QY6A 3A6OA 4XX6A 4RNFA 1CIUA 1IZKA 2BZNA 3IJ8A 1EDTA 5CEWA 4CQDA 1KB3A 1QJWA 1AW1A 3AMDA 2IPJA 4PTMA 3W00A 2INZA 3TTQA 3E02A 1ZZMA 3NQ8A 4KEMA 2FJKA 3N4FA 3WF1A 2ZX6A 4G8TA 3EWCA 5PTDA 2G3JA 1P1MA 2VT0A 2I56A 3P93A 1YADA 3P5YA 4YWIA 4QR6A 3QV6A 3KCOA 1GKPA 1WUEA 5F2LA 2P3EA 3A23A 3K4WA 4AZHA 5DO8A 3MKVA 3UG4A 3NA8A 1EC7A 2E28A 4C1NA 1ZAIA 3I4EA 4BR1A 4E8CA 4EOUA 3K46A 5CPNA 3BOXA 2ZIDA 3GTIA 2EPKX 2NSXA 2OSWA 3OG2A 2DZUA 5FJPA 3CZKA 4NKCA 3ZSTA 2GGEA 4OECA 1UWUA 4OUIA 2OLAA 2PEVA 3W37A 1ZFJA 3QJAA 3FN9A 2VDGA 1VCVA 3AS0A 2X1UA 3PG8A 3TQKA 4YTRA 4GIAA 2WSPA 2GK1A 2GJNA 5EBAA 3KE0A 2J7CA 2DZWA 4IMFA 4RKAA 4G7FA 4PA8A 1SQ7A 4H6RA 1VLWA 4G1KA 3MJYA 4GQ0A 2KX9A 3M0JA 3L4UA 1UOKA 1YW1A 1JCTA 2EPLX 5G1MA 3VIHA 3VE7A 1K8ZA 3N14A 4FI4A 1N8IA 4XWUA 1JVNA 1XYBA 3NQBA 1UROA 4REQA 6TIMA 3NQEA 1A0EA 2DUXA 3VPLA 4V27A 2VWSA 1H5YA 2VEGA 4QLKA 2W9MA 1P43A 3C4UA 3RRXA 2FVMA 2V2HA 2PP3A 5DY2A 1H09A 4JY8A 4HZ6A 7PTDA 4FLOA 4R9XA 1SMDA 1IWPA 2P5NA