3NNTA

Crystal structure of k170m mutant of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in non-covalent complex with dehydroquinate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
b'YFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nntA00
2CLOA 1YLVA 2ZRYA 1A5AA 4POCA 2QCEA 3CWNA 1V5XA 3B0VC 2EF9A 1TTQA 4UMBA 5DLCA 1WOBA 1THFD 3MP4A 1WBHA 3WJXA 3M7WA 3SZ8A 3ABOA 4MY1A 3W7MA 1ZCOA 5HUPA 4CQ8A 3VCRA 4XTDA 1QR7A 1MZHA 4LVFA 2P10A 3W72A 1WV2A 1SO5A 3RK8A 5AHNA 2H8XA 3W7OA 1I4NA 3F03K 1ZAJA 2NXHA 3U8GA 1E51A 3GAYA 3TJLA 3V1PA 4IOTA 1LRTA 2PRMA 2A6LA 4KFPA 4H6KA 4LY8A 3WJWA 3TROA 4IGHA 5L6UA 5AC7A 3FLUA 1ZAHA 2DJLA 3F4WA 3DKJA 3RF9A 1SUXA 2A21A 3FYPA 3C2RA 2Q8LA 3S1VA 1Q6OA 2QCCA 2ABAA 4MOZA 3BPWA 2ZZ5A 2DZTA 3GR7A 3G8RA 1PE1A 3QH2A 4ZQNA 3TV8A 4WQ6A 5DCBA 4UTTC 1G4PA 3W7GA 1IXPA 2QKFA 4MYXA 1W3NA 4O15A 3W76A 1G4EA 4KFOA 1KW1A 1ZALA 2Y70A 5FF4A 2ZRWA 5EY5A 1MEHA 1BKSA 4WY0A 3Q94A 4YL2A 3O8AA 2A2IA 3S1XA 5F2GA 3VE9A 3ABRA 1JJKA 3LI1A 4JX4A 4WD0A 4KKXA 3HMJG 5CZTA 3W07A 4Z1AA 1HL2A 1EEPA 5DBUA 4GUFA 3W7HA 5KZDA 3WK1A 2E5DA 3NQ6A 1F05A 1TB3A 3M5XA 4JTEA 5I3KA 1Q6LA 2HMCA 1LCOA 3TC7A 1G4SA 4MKNA 2GOUA 3TR2A 4FX7A 1EIXA 1MSSA 3PULA 2R8WA 1UUMA 4N4PA 1Q6RA 5A8GA 3NQ2A 4O16A 1TRDA 3EKLA 5HMSA 2F7FA 1SPQA 1PL9A 1R47A 3STFA 2XN2A 2QCDB 4JTGA 1KLZA 3IIXA 4OWGA 4UUIA 1ZAIA 3DI0A 5T26A 3P62A 4ZMGA 3TSDA 3M44A 2YDAA 4PA8A 1C8VA 5H91A 2VKZG 3LLDA 4BK9A 2FPTA 3HG4A 3W1PA 4BI7A 5AYYA 3ZFHA 4DELA 3S0CA 4AF0B 2E1DA 3B8DA 4IPJA 2OT1A 2QUVA 2FB3A 4RZ5A 1KFCA 1MEIA 2C6QA 3SIZA 3N9SA 4GNJA 5LZLA 4FNQA 1JUEA 4QM1A 4HNVA 1J2WA 5TBOA 1HFBA 5CPMA 3MP5A 3PUOA 5D38A 3NQ8A 4I7WA 1SR9A 3NQEA 4QISA 2HTMA 1W5NA 3UD6A 1LBMA 3W1AA 4N9DA 2NX9A 1LRQA 4MFEA 1AW1A 4DEFA 1OFQA 5GVJA 3NL3A 4GJ1A 3CC1A 3OEXA 4OV9A 5F4WA 3GK0A 3QFEA 1A5BA 4EVZA 2JKEA 1XUZA 6ALDA 1W3IA 1VCVA 5K4ZA 4BWLC 3P7YA 4UTJA 2E6FA 3CU2A 4GBUA 4LRSA 3FIGA 2YW4A 2CU0A 1H63A 4Z1BA 2I14A 4MPQA 3N14A 1IXQA 4LV4A 1GVFA 1UCWA 2ZRZA 2ZRVA 1OFAA 4BR1A 4O1CA 5C2XA 2ZRXA 3S8HA 3ZWSA 2R14A 2ATMA 1ME7A 4FNPA 1D3HA 5KZMA 1KFBA 3DFTA 1EUAA 2VEMA 3S5YA 2J6XA 1RQHA 2YFOA 3VKJA 4JTSA 2C19A 2P1FA 1F6KA 3NPXA 2CLMA 1LOLA 3UWZA 4JY9A 1K03A 5K3VA 1CW2A 5FF3A 3R2GA 2VC6A 3W2LA 2NXGA 1VYRA 3G1SA 3QRHA 3GDMA 5HNRA 3EX4A 4Y6GA 2ZA3A 1JCXA 4XWUA 4HT3A 5C5YA 3W85A 3L21A 3PBYA 1M6JA 2V30A 3BW4A 4PEKA 2QR6A 3GDKA 5D2XA 3O6CA 4I7VA 1OYAA 5G1TA 3TSBA 3I7QA 1DV7A 2G5WA 2C18A 1I2OA 3SY5A 1Q3NA 2ZZ6A 1K02A 2OX1A 1ADOA 3KX6A 4JTLA 3C52A 1QOQA 4WX2A 5K9DA 3EX3A 3LTYA 4NNCA 2DP3A 3O15A 1P0KA 1C29A 2QDGA 2GQ9A 5FEWA 4ML9A 4HN4A 1LBLA 3G1AA 1GVSA 3PM6A 1B3OA 2JGQA 1OVDA 4TX9A 1EWDA 2NV2A 3RLUA 2JGYA 3G0UA 3DH7A 4M7TA 3LCFA 4WZHA 3BGGA 1TPFA 2NV1A 3IGXA 1ME9A 4FF7A 3F1QA 1T99A 2W6RA 4HSOA 5LNSA 3EEGA 3IVTA 4LUJA 1VCFA 4IXXA 1RQEA 4AB4A 3LCLA 3IRDA 3IGUA 2G96A 2BLEA 5C6MA 1Q45A 3P5ZA 1A5CA 2VEIA 2FLIA 3W2UA 5D32A 2WSYA 3EXSA 4UFIA 3KAOA 1OF8A 5E1QA 4KWVA 5LNWA 2P0OA 3GNNA 3SECA 4CNOA 4PL1A 4NNAA 1T0OA 1W5MA 2FQIA 1QO2A 4O52A 3LBCA 3PBVA 5HR7A 4NZJA 2VFHA 1VYSX 1W5PA 2WOQA 4O19A 3TUUA 4FNTA 4CLMA 4LC8A 2VFEA 1IXNA 3QJAA 3AO0A 3FFSA 3PVFA 1SFJA 1LTDA 4FHAA 5D2TA 4NZFA 5IBXC 1GQNA 3W70A 3DHDA 3HG5A 3LXAA 1S5VA 4P2VA 1D3GA 1H7PA 3M5YA 1OK6A 1Z48A 3NGJA 4RJEA 5FEXA 4HIBA 3T78A 3M6YA 3O05A 4YWIA 1LOQA 3QC3A 4AWSA 1TTPA 5CGQA 4ADTA 1J5TA 1KM2A 3GB6A 4OU1A 1SW0A 5D09A 2QCFA 3G3DA 3Q37A 4GXMA 2C14A 2PE4A 3M41A 4ALDA 1ZHAA 1S5WA 2BX7A 3MI6A 1JCLA 3NVTA 1K3UA 2CLHA 4JEQA 4YXGA 2YGYA 4FB7A 1XBYA 2CZEA 4TIMA 2YPIA 4IMDA 2CLKA 3W84A 1HG3A 4LOCA 3N2XA 1FDJA 1FWRA 5LNRA 3GXNA 2PCQA 3PG9A 2ISSA 1OHLA 5HUOA 1WA3A 3ANYA 3P74A 4O13A 3MHGA 1IXOA 3W7RA 4LT9A 4HPXA 3Q2DA 3LCIA 4PCFA 2VXNA 4UFJA 3C2FA 4QAIA 4M7SA 4JTUA 1KLYA 1IF2A 5DXXA 3L67A 4KFNA 1O95A 3QF0A 4QIUA 5I3HA 3JR2A 5KZEA 2CFFA 2B7NA 3LX9A 1EX5A 3KVMA 2H3BA 4MFDA 2BTMA 2Z2UA 2C15A 2QDHA 3DFSA 5AHFA 1FY6A 1LLZA 1NEYA 1LORA 3HGOA 4GE8A 4OBTA 4D2JA 3A5VA 3A24A 1KFJA 2QCNA 2ZRUA 2H8ZA 5D2YA 1YDOA 1BTMA 3LHZA 3NXFA 3SFKA 3GNDA 2FFCA 3GZ3A 3MYPA 1G7UA 4AWTA 4QNEA 3LI0A 3W2MA 1EP1A 2DORA 2DZUA 1FXQA 1F6PA 4EWND 3P8JA 4O1BA 4OHQA 3HQ1A 3G0XA 3T7VA 3HPXA 1FBAA 1B4KA 4NJKA 5BRBA 5LHFA 4ZQPA 3TA6A 4O18A 1H5YA 3P80A 4Q32A 2ZFAA 3CEUA 3ATYA 5AHLA 4LRTA 5G4EA 2VFDA 3SJ3A 3TE9A 4N6EA 3SGUA 1OJXA 5LHEA 1KTBA 3TCEA 2CZ5A 2QCDA 1XM3A 4JXCA 2Y7GA 5DY3A 1T96A 1K8YA 2QCLA 3N3MA 3KVJA 3G18A 4K6AA 3W3OA 2TSYA 4ZVJA 3LDVA 2BXVA 3THQA 3IGSA 2YCEA 2A7RA 3NPVA 2J9XA 3LHUA 1LROA 1JULA 3KVKA 3NG3A 1H7OA 4CNNA 3W7NA 3E96A 1T8XA 4NX5A 3DGRA 4AF0A 4UTTA 4XBSA 5KSWA 3WK0A 5ABTA 1AL8A 3W7EA 1B9BA 3TSMA 1VQTA 3LM7A 4XUGA 1GVQA 2VELA 4UFLA 3T44A 4GUIA 4UTWA 2Y61A 4PH6A 1B57A 2X16A 1FCUA 2TMDA 4Y8FA 3G3MA 2V8ZA 4FO4A 1MXSA 2ZA1A 2ISWA 3P84A 3DFQA 1U5JA 1VJIA 4FIRA 3PWAA 4BF9A 1VPXA 1RZMA 5LSMA 5AN7A 3OG3A 2YFNA 2DZPA 4NXKA 5D2WA 1SO6A 1QDSA 5D03A 4FEZA 4O14A 4ZL1A 2I1OA 3EX1A 3GLCA 3U6WA 1NSJA 3W7PA 4N4QA 3SI9A 1FUYA 3A22A 3PF3A 2VFIA 1SZNA 1KM3A 3GR8A 1OYCA 3O1NA 1BWLA 2E68A 3USBA 1MO0A 1QOPA 3SW6A 2NX3A 1R2RA 1W54A 1ZNNA 3UY7A 5FESA 2YSWA 4O0ZA 2B7PA 2V2HA 1OFOA 3BG9A 1TTJA 1W37A 4LWWA 1FDYA 3QPZA 1AK5A 5HQEA 5F4SA 4JDBA 1L2UA 1KFKA 4NJHA 4JTFA 4M6VA 1X1OA 3C4UA 3TXVA 5C54A 4GC4A 2LLEA 4LVGA 4RZ6A 1O60A 4UFHA 4XTIA 3N73A 3NQVA 3R8RA 2ZCGA 2ZZ1A 3GKFA 1OFPA 5D2VA 1KFEA 5LGZA 4MUZA 1R30A 4JTIA 3N2MA 3PUEA 3QMTA 1F74A 2WSQA 3CTLA 5MHBA 4ICNA 2A7NA 4IJBA 3O16A 5AOUA 3PBWA 1AMKA 3A23A 5J5DA 1XBVA 1SZGA 1L6WA 4IQLA 2B0MA 3OVRA 1XBZA 1YDVA 4O10A 4HPJA 3VNDA 1F5ZA 2BZNA 2HS8A 3R13A 2B7QA 5EBUA 3UWQA 1TCDA 2C0AA 4K7VA 4YMZA 3DZ1A 1EUNA 1ME8A 3W1NA 1N8FA 1QWGA 1LDCA 5L9FA 3M5ZA 5EL1A 2E6AA 1J4EA 4MLJA 2PRHA 1DBTA 2VEPA 4XKYB 3S6DA 4IMEA 3DFPA 4WOQA 1NVMA 3I68A 3NQDA 5HINA 1H7NA 4UXDA 2A4AA 2G95A 5CSRA 1I2RA 2FPYA 4DPQA 1TV5A 3WFAA 5KTLA 1K7FA 4WY0F 1XKYA 1WBJA 2Y63A 4N6FA 1XL9A 5EMUA 4RZ4A 3M16A 3QQ1A 2V82A 4O0KA 3NPWA 3UWVA 3KRSA 4H3DA 5G5IA 2J24A 2OZ0A 4FX8A 2VFGA 4DO4A 1H62A 3L0GA 3W23A 1UASA 2WKJA 3IIPA 3LHYA 3O6YX 2Z0IA 4P61A 2C1HA 4RV8A 3HGJA 1PV8A 2A1YA 3N34A 3W88A 1MEWA 4AMAA 2ZBTA 3CB8A 1EA0A 4JIPA 1AG1O 4HHPA 2PURA 4TU1A 3NR0A 3L0NA 3E02A 4FXRA 1FWTA 4WUIA 5CPOA 1JCMP 3R12A 5G2IA 4R33A 4S2CA 4NJGA 1KM6A 1SO3A 5DN1A 1JCJA 4EOUA 1TV7A 2FTPA 3NAVA 1YTKA 1XI3A 3W2JA 4EF9A 3B4UA 1PHQA 2HS6A 2GVGA 4IWWA 4UNKA 3I7SA 2NUXA 4FNSA 2CLIA 4E0CA 5D33A 4Z0SA 4AXKA 2GQAA 3FS2A 5DY2A 1M7PA 3BG3A 1QPQA 3EX2A 2RH9A 3LRKA 3GDRA 3UYCA 3E49A 1TO3A 4N9CA 3EWBX 1N7KA 1FQ0A 3OBKA 2ZZ4A 3UY8A 3PC0A 4CQAA 5LNUA 1L6SA 2GPTA 2RHGA 3MUXA 1I2QA 5KINA 1FWSA 3B03A 3M1ZA 1OABA 2VEKA 5TQLA 1Z44A 4Z08A 1VH7A 1GVRA 3ABQA 5AC6A 1JRBA 4UFKA 3NQCA 3P82A 4Y96A 4IMCA 4M6QA 2YYUA 1QPNA 3ELFA 1VHNA 3G1XA 1LBFA 4RX0A 1K8ZA 1SSGA 3IVUA 3QSTA 2QUTA 4IXHA 1TPUA 1FX6A 4TR9A 1SW3A 1KM4A 2RDUA 4UNLA 4HSNA 3CPRA 1OX4B 3T55A 2E5BA 3PS7A 1SO4A 3LRLA 4WY0B 4M19A 2B7OA 8TIMA 3BLFA 3G1VA 1HO1A 3C6CA 1H51A 2RFGA 2JK2A 3MWAA 1TJRA 3M5VA 1PHWA 3HG2A 4JYDA 3PBUA 3BV4A 1EWEA 2DZVA 3EXRA 3IIVA 3GIYA 2AGKA 1TPVA 3M9YA 4O4VA 3WK3A 4GRSA 1PIIA 1AW2A 4HNUA 1QPOA 3O07A 1H7XA 2YW3A 3LCGA 3NM1A 3DBPA 5DCEA 1PS9A 4UTMA 3KRZA 4DO5A 2O7QA 5K7JA 3W1UA 1ZJIA 3W1TA 2EHHA 1R2TA 3GX9A 2CZDA 1TSIA 3GXTA 3EWZA 3M43A 5F2LA 1U83A 3N19B 3PB2A 4UTKA 3C0JA 3C56A 1RD5A 2TYSA 3RLVA 4UIOA 1OFBA 3L5AA 5J5RA 5LNVA 1G4TA 2I9EA 5HR6A 3HOJA 1X8FA 3EWYA 5EKYA 1XBXA 1R46A 1W5OA 2Y6ZA 2ZYFA 3EX6A 4RKAA 2X1RA 2W79A 4UTLA 3S5NA 4JD4A 3LXBA 4TMCA 4A22A 2PC4A 1XUUA 1M5WA 2V5BA 4LS0A 3NQFA 1NF7A 1RV8A 1JR1A 3GVGA 4AEOA 4GWEA 4I7UA 4IMFA 1OYBA 5HJLA 5AHIA 1JUBA 4BFAA 2ZTJA 1TTIA 3FEMA 3KRUA 4L4LA 5H2ZA 4ZQCA 3TW7A 1TPB1 2BWGA 2YXGA 4GUGA 3HO8A 3NZRA 3LB0A 4CCEA 4EF8A 1TMHA 3RMJA 1V7YA 3MI3A 2QUUA 3ZR4A 3NZ1A 1YPIA 1KM0A 2JKPA 2Q3RA 3QEZA 1GG0A 3W83A 1CX9A 3BLIA 3TX9A 3BG5A 4JTTA 4O4WA 2CWNA 4PTNA 4J9JA 3TH6A 1JQVA 2DZXA 4ADUA 5K9XA 5E93A 2C16A 4C1LA 3M0ZA 1IIHA 3NA8A 1GTHA 2WJZA 4EIVA 1N55A 1EPXA 2GVLA 2BSLA 1A50A 4Z1CA 1F73A 3HGSA 4O11A 3BK0A 2Z1BA 4RK8A 3G24A 4DF0A 2WNQA 4A29A 1NFBA 1CI1A 4Y90A 4Q4KA 3LHTA 4KWWA 4ZZ9A 3BW2A 4JX6A 3L66A 3VE7A 1SFLA 3R89A 2Z6IA 1YDNA 2QAPA 2TRSA 1KV5A 3K30A 3QM3A 4YCOA 5D02A 3UNDA 1JCYA 5G2HA 1P1XA 3TAOA 4X2RA 1W5QA 3T4CA 4NJJA 3EXTA 4B5NA 1Z41A 5U4NA 4GUHA 5AB3A 3HF3A 3MYOA 3MW7A 3UXDA 2ZZ7A 2GQ8A 3TW6A 3LLFA 1K7EA 4MYAA 3P67A 1LP6A 3CEPA 4DBEA 3MP3A 4WOZA 1OFRA 5G2WA 3OHIA 5DCDA 3C8FA 3EWUA 3WJYA 1XFBA 1KTNA 1YTDA 3B04A 1H7WA 1I45A 1SU5A 3UZJA 4MZ1A 1XDLA 5F2IA 4XKYA 3TNOA 2GJLA 4O28A 2AAMA 3W22A 2J88A 2EKCA 1F7BA 3DU0A 1SZEA 1ZY9A 1KBIA 3R5EA 1VRDA 5K9CA 1LLWA 4UR8A 3DAQA 1M7OA 3STGA 1FWNA 1ICSA 2JKAA 3HGRA 5HWJA 3Q58A 1LOSA 4N2YA 1P0NA 4R34A 3DENA 3F4NA 5AC8A 2CLLA 3UWWA 5D37A 2Q3OA 5DXYA 1QCWA 1FCQA 4PL2A 4NU7A 4A2SA 3GXPA 3B0PA 4U28A 1JQXA 1TPDA 2FIQA 2QF7A 3EKZA 1OFDA 3L5LA 3FJ6A 4N02A 4JTHA 3TAKA 3PR2A 4ZQMA 4G1KA 1HO4A 1O4UA 5KITA 1FWWA 1I2NA 1GYNA 3PAJA 4A2RA 3CLMA 3LCHA 3A21A 3IEBA 4XZ9A 3HIJA 3KOFA 3L68A 1GWJA 4CNPA 1S5TA 1Z42A 4Q33A 3A9IA 3BGJA 3GYEA 2TPSA 5TIMA 4A3UA 2GUUA 3NO5A 2E6DA 2W0UA 4C1KA 3DXIA 3KFTA 4L4MA 2X2GA 3MBFA 3MJYA 5U7SA 1DOSA 5FI8A 3FOKA 5G1YA 4WXYA 1UJPA 3QSRA 2CLEA 4NXSA 5BMWA 5D05A 4UMCA 3I6RA 3C61A 4FIQA 3THAA 1VLWA 3LHWA 1F2JA 3TIMA 1BEUA 3NYZA 5BNKA 2EPHA 2AQWA 2CW6A 1FDZA 4MLRA 4TMBA 4XBKA 4ZQRA 3D0CA 3HPSA 4ONVA 5FEZA 4JR5A 4IX0A 4N9EA 3BO9A 3CWOX 1TQJA 1SZFA 4NX0A 1S3HA 2X1TA 2QJIA 3E9AA 2XFWA 5CZJA 4PFMA 2WNNA 2R94A 4K38A 3LTSA 1GOXA 1VLIA 2ZTKA 1JUKA 1WQ5A 3FA5A 4NVTA 4NNBA 3W7KA 2QAFA 4O1AA 4AHOA 2Y7EA 3CIXA 2WNZA 4NT0A 2V0TA 3SSJA 3GDTA 2J27A 5CPNA 1WOAA 3W1MA 4CCCA 2QCMA 1GTEA 1FCVA 1GPWA 1ONRA 2WQPA 4LUIA 3W6YA 4UTIA 3W7DA 2V9DA 1OX4A 2F84A 3OA3A 2OCZA 4MIMA 3VI2A 1RPXA 4UTWC 1TPEA 5D04C 4MZ8A 1ALDA 1ICQA 4RR4A 2CLFA 3O06A 4OE7A 1YPFA 1UUOA 3TC6A 4GUJA 1VCGA 4BWLA 2NZLA 2ZDRA 1OX5A 1FCBA 1OK4A 3W7IA 4H4IA 3HBLA 4NJIA 3QMRA 5CPLA 3SGZA 2H3DA 4ORMA 5HWMA 7TIMA 1OF6A 1W56A 2X30A 1NF0A 2A6NA 3W1QA 2X1UA 4DQWA 1I8JA 4RCXA 3P60A 4DBDA 4QJ1A 3LV5A 4XQ6A 1QFEA 4GFSA 4JYEA 3IIOA 5E0KA 3CM4A 3UWUA 4HNNA 1C9DA 4RLIA 3NNTA 4YLWA 3L65A 5CSSA 1YXYA 3S5OA 3NL2A 4MJZA 3LV6A 5G4WA 3GDLA 3TMLA 4JDYA 4UCGA 2DZWA 1SW7A 3BARA 3E12A 3W1LA 2QJHA 3P61A 3MBDA 5CZ0A 1ICPA 5I3GA 3NOEA 4LTSA 5EYWA 3ATZA 2YYTA 4JNMA 4BI6A 2A85A 3AJXA 4A21A 5CZSA 3W7LA 3LRMA 4O57A 3NM3A 1YXDA 4PC8A 1OX6A 3G8EA 4HNTA 3W2KA 2VENA 2XN0A 2V5LA 1KM1A 3FKKA 5AFDA 1HUVA 4AHPA 3G1HA 2E09A 5F1VA 1DJQA 5I3IA 1PCKA 3FKRA 1K7XA 1NAL1 5DBTA 4LNYA 3LCXA 1W1ZA 1WDWA 1IIGA 3ZWTA 4WJEA 1ML1A 3DFNA 1TREA 1VZWA 3QMSA 1O94A 1VGAA 2JBMA 4AHQA 2RDTA 3QYQA 3PG8A 1D9EA 4O17A 2OMAA 2FDSA 1XC4A 3OVQA 5HWNA 4JX5A 1PVNA 1YXCA 3W87A 5F4XA 4M5PA 3TFXA 5BOOA 3L9CA 5AHMA 3KXQA 4IUOA 2QEZA 1LZOA 2Y62A 4S2BA 2WSRA 3W86A 1GJPA 2NX1A 2J9YA 3QZEA 1BWKA 3CT7A 2A7PA 3C3NA 4U4MA 4IPIA 4UMAA 4QSHA 4NQ1A 2G97A 3W7QA 1QO5A 1AL7A 4JYFA 2ZZ2A 2X1SA 3TXZA 4FX6M 3W74A 2VOMA 2C3ZA 3W73A 2GVJA 3CHVA 1G67A 5HULA 2ZZ3A 4OV4A 3HB9A 3TDFA 3C2VA 1VHCA 3JS3A 3G0SA 3STCA 2ALDA 3B06A 5I3FA 4IX2A 1GYLA 4HKPA 3PUDA 2QCGA 3TK7A 1H7RA 3G22A 1KM5A 2WO5A 4WXZA 4X9SA 2UV8G 3MI2A 3W71A 3ZS4A 2QCHA 1HTIA 3G1FA 3HG3A 4UFMA 3PY2A 1I2PA 2FJKA 4K7YA 4N9BA 1W8SA 3E0IA 1TPWA 5FF2A 3N9RA 2NUYA 2Y89A 2EGZA 1VR6A 5I3JA 3TFCA 3M47A 1VYPX 1EP3A 1YTEA 1KBJA 3RFAA 2YX0A 2XN1A 1IGSA 5KMYA 2FPVA 2CZFA 5IBXA 5BW6A 2OT0A 2WV8A 2PRLA 2KZHA 4DO6A 3I65A 3LBMA 2GJNA 4LVDA 3KHJA 4DF2A 1W3TA 2RKXA 2Y88A 4OT7A 3W9ZA 1FXPA 3W1RA 1LRNA 5AYZA 4E2BA 4AWUA 3FYOA 4O53A 6TIMA 2Y7DA 3DKLA 5CG7A 1QNVA 1TYGA 4MZYA 2Z6JA 1X1ZA 1H50A 3P8IA 4K39A 1DJNA 3NQ7A 2QJGA 3G1YA 3NL5A 5FF7A 5CKSA 4DPPA 3L2IA 3INPA 4AVFA 1DQWA 4W9TA 3MO7A 3TQ0A 2A5HA 1WXJA 3W1XA 4JIQA 1X7FA 3UQNA 2YR1A 5A5WA 1H60A 1X6UA 3O63A 2ATSA 2H6RA 3C2EA 2NUWA 2D73A 3UXAA 4JICA 3QQ0A 1AW5A 4X22A 3OVPA 5D30A 1A5SA 2DZSA 3QW4B 4R7JA 4Y9AA 4LW7A 3WK2A 3B05A 4FNRA 5K4XA 1F76A 4E38A 4LS2A 2ZA2A 3L0KA 1DVJA 1OG0A 1RQBA 1JCNA 1KV8A 1OFEA 1P5BA 1G7VA 3WJSA 1H61A 3H53A 3YPIA 3STEA 2V2CA 4K8HA 1O5KA 1GEQA 1GZGA 2DJXA 1SSDA 4QNWA 3U2OA 4AH7A 2V2DA 3SR7A 3V75A 1L9WA 2HSAA 1XDMA 1W31A 4RXFA 1JRCA 3P5YA 1P4CA 1GT8A 1LM1A 2E5CA 1VC4A 3T40A 5F1UA 1GVOA 4LU0A 4UTUA 1UBSA 2OJPA 3B0UX 4O1DA 3LTPA 3LXCA 3TQKA 3KVLA 4K36A 3G1DA 4UC5A 1R2SA 3LERA 2O7SA 1H1ZA 3NPUA 1G69A 4MY9A 4UR7A 3TKFA 3CIWA 4LS1A 1TJPA 1DQXA 3HPZA 5SWUA 2NLIA 1Q6QA 2Q8ZA 1VS1A 4QQ3A 3UZ5A 4OQVA 3W2NA 3NQMA 4O54A 5AHEA 4UTHA 3JRKA 3PSWA 3MHFA 4JN6A 4DXVA 4LC6A 3IIZA 1EB3A 4X3ZA 3EB2A 1KA9F 3NQGA 2IQTA 5IM51 3P81A 1WAUA 5EPDA 1XXXA 4BI5A 1ZFJA 3RU6A 1Y0EA 3BLEA 3S5ZA 3EWWA 5BMXA 1TQXA 1RR2A 4Z0JA 4TO8A 4FXSA 1UB3A 3LCWA 4DF1A 3DFOA 3W75A 5LGXA 4I9AA 3W7CA 3PB0A 4MVAA 2V81A 3O6DA 1WX0A 4JTJA 3RNDA 3TJXA 5DELA 3BVJA 4AAJA 3S1UA 4M6PA 4NUWA 4Z1DA 4O8RA 3TQVA 4R53A 5C55A 4PODA 4ZQOA 3IV3A 3S9YA 3QPYA 4IMGA 1XCFA 1B4EA 3VFLA 3S1WA 4LVBA 1QMLA 1DORA 2R91A 3C2OA 4JTKA 4CQ9A 4RXGA 1EP2A 1LYXA 4JS3A 5K2ZA 3I7RA 2FB2A 1DHPA 5FF0A 2B4GA 3PSVA 4QITA 2EAWA 1YYAA 3NEVA 4S1FA 1DL3A 3LGEA 2C13A 2WPBA 2ISVA 3QW3A 3ABSA 3FJLA 3NL6A 5F2MA 1GG1A 3IVSA 4YCPA 2YZRA 3CQ0A 1TPC1 4ORIA 2RDWA 2ABBA 3A5FA 2E6YA 3MHUA 1TRIA 3MMTA 2Y7FA 3GKAA 1K8XA 2E77A 1ZENA 2NWSA 1DKWA 1TIMA 3S42A 3DHFA 1YADA 2A0NA 3WJZA 1KFLA 3BW3A 3UWYA 3OIXA 3HJZA 3LHVA 4MY8A 1A53A 1QPRA 3L5MA 3UPWA 4LVAA 4LV9A 3H55A 1H1YA 3GAKA 4K8EA 4FNUA 4JY8A 1L6YA 1SQ7A 3NQAA 5FEPA 4MJMA 1JVNA 1TV8A 2Y85A 5EA9A 1QAPA 3TMQA 5LKYA 3W7JA 4ADSA 2DU2A 2VFFA 1RVGA 2H90A 2J9ZA 3H54A 4OGZA 4CCDA 4O12A 1W0MA 3TU9A 3LOTA 1TPH1 1G6CA 3DI1A 3NDOA 3UPBA 4O50A 2NXIA 2NWRA 1WYIA 1PCWA 4JGDA 3EWXA 4E2DA 2ZQ0A 5AYXA 1O5XA 4K37A 1KTCA
chains in the Genus database with same CATH superfamily
3AS3A 3ZT6A 2HPMA 2YBTA 4V15A 1JNDA 2CBIA 2QCEA 5LIXX 2J25A 4M1BA 2E9BA 2WLZA 3B0VC 2EF9A 5DLCA 1MXDA 1THFD 3MP4A 4B5VA 1CLKA 1MZHA 2EPLX 3H4GA 1SO5A 2J7DA 5AHNA 4GMEA 1YPXA 3JZEA 1BVNP 1A5NC 4IOTA 4LUSA 4EXBA 2D2GA 5AC7A 3FLUA 1ZAHA 4B3ZA 1E5JA 4GI6A 3F4WA 2YIHA 4C6DA 1OB0A 1RJQA 4GI4A 4KQNA 1A5UA 1I6NA 2R1NA 4IQEA 2CYGA 3S1VA 1Q6OA 2ABAA 3BPWA 1E55A 3MKKA 4H04A 1BWVA 1WDSA 2GQ3A 4B9ZA 3E2QA 4WQ6A 3FYYA 5DCBA 4HMNA 2BXZA 3VNYA 4ZSTA 3EDKA 4D6IA 4QLJA 1DIDA 4W7UA 1KW1A 1W3HA 3KBNA 4DJFD 1BQGA 5EY5A 4MM1A 4C6IA 1XYCA 1XQLA 2I57A 3QR3A 2QVHA 3ABRA 3ITCA 4RUBA 5I77A 3LI1A 4KKXA 3EGJA 1MZRA 3VIKA 5E09A 3A3XA 4HMEA 5I3KA 2DUXA 1UD6A 4D8LA 3TC7A 2OOGA 1CXIA 1UPPA 4JFUA 3VDBA 4HZMA 4O16A 3WH7A 1NP0A 4JTGA 1KLZA 1POJA 3FEQA 1ZAIA 1QXLA 1WKDA 4A8NA 3QHNA 1RBOB 4J27A 3R94A 2FPTA 3VK5A 1WZLA 3GD6A 2E1DA 2XUCA 1OG6A 3AROA 2QDDA 3WLQA 4AZ6A 2ASHA 4EAYA 2Z25A 5CGTA 3N9SA 4QM1A 3BJFA 4KIRA 4DWSB 5DRIA 1MRQA 4J3UA 2XYLA 1KXHA 4DJED 2NT1A 3W1AA 5BCAA 4N9DA 2OYKA 4WDXA 4PGLA 3BCDA 4E8CA 3VOGA 1OGSA 2FHFA 5JQ9A 4DEFA 5GVJA 4OV9A 4I8DA 6TAAA 3QLDA 1XUZA 1W3IA 4BWLC 3P7YA 1FH7A 4GBUA 4Q22A 3FIGA 3UF9A 4BF5A 1H63A 1ZLPA 4Z1BA 3OVGA 2I14A 4MPQA 3N14A 2HE8A 3NUKA 2ZRVA 4PRRA 2R9RA 3S8HA 3CAVA 3U57A 3UP8A 1ME7A 3A3HA 3CUIA 4C6MA 3ECQA 1J6PA 2GOKA 5H8PA 3OGVA 4QEHA 1RQHA 3KZPA 2YFOA 1K6AA 3VOJA 6XIAA 2V3FA 1WDPA 3CV1A 3W2LA 2NXGA 4KH2A 3AZSA 3GHUA 3QRHA 3PZOA 3EX4A 2ZA3A 1JCXA 5C5YA 4YTRA 3GXDA 1ONXA 2IXUA 3BW4A 3VKBA 1XIMA 1KRMA 3H2NA 5G1TA 4YNGA 4IL2A 1DV7A 3SY5A 2YL5A 2C7FA 3QR1A 2ZZ6A 2OX1A 3KX6A 2UY5A 5TD4A 2V3EA 3OB8A 4LCQA 4B5WA 4GQRA 5A8OA 1LWHA 4NNCA 5BXTA 1C29A 3AI0A 4C6JA 1GVSA 1HKIA 3H4XA 1E6QM 4PMJA 1B3OA 4OZOA 2JGQA 2WHMA 1EWDA 3RLUA 4M7TA 4S3KA 3BGGA 1TPFA 1JD9A 3BH4A 3T8QA 2X7VA 3T8LA 2EXOA 3IGXA 2YLLA 3V5OA 3F1QA 4HSOA 2CIPA 3SUSA 3IVTA 4CGTA 1MMFA 4LUJA 1VIWA 2WK2A 2J7EA 3ARXA 3MUIA 2NQ9A 1F61A 4AY7A 3EA2A 1A5CA 3EDDA 3POCA 4PBFA 5DO8A 5M03A 3B8UA 2WSYA 3OYXA 1ONEA 2P0OA 4AC7C 3GNNA 3SECA 4MNJA 3O9NA 3QVQA 4QQUA 4C7FA 4NNAA 2PDBA 1IT7A 3BCFA 3LSBA 1YE6A 2PWGA 3UJEA 1R3RA 4O52A 1EF3A 1W1IE 2XG9A 4NZJA 1W5PA 1W9PA 5FKYA 3M64A 1QOXA 1CDGA 4ZOCA 3QJAA 2PP1A 4D71A 3B4YA 3FFSA 5I78A 3PJUA 4BEUA 1QBBA 1XYBA 3HG5A 4P2VA 1D3GA 2CNCA 1H7PA 3M5YA 1OK6A 2WHJA 1TMLA 4C6LA 4PSPA 4YWIA 1LOQA 3I4KA 1PUDA 1FRBA 4OU1A 1V3MA 5A8QA 2DUAA 1JYWA 3GWQA 2BX7A 3NFUA 3MI6A 4F0RA 1JCLA 3BTNA 2J6VA 4FLSA 3H7UA 1ZRQA 2YPIA 4IMDA 2CLKA 4F0SA 4G6CA 3TR9A 3UGRA 4GYFA 2GYIA 1IZCA 1JDFA 5A8MA 1A47A 1FWRA 2PCQA 2OWCA 2INZA 4D1JA 3CMJA 3ITOA 3OW1A 3M46A 1DXIA 3B9NA 1NQ6A 2QV4A 2GJPA 1VFOA 3M0KA 2POZA 4UFJA 3B9OA 1JAEA 2ZE0A 3KBWA 2QXWA 1KLYA 4KFNA 5I3HA 2PLCA 3HFTA 3JR2A 4HNCA 5KZEA 2CFFA 2PZ0A 1R3WA 2B7NA 3RCNA 3MV11 4FPSA 2BTMA 2QDHA 5AHFA 1FY6A 1IEIA 4DO7A 5CLWA 1ZS2A 2IKGA 3RR4A 4D2JA 3A24A 4AUBA 1YDOA 2ZXBA 5CZKA 2FGBA 2FTYA 3MYPA 1G7UA 4LX4A 3N4AA 3LPGA 4QNEA 3LI0A 4PTVA 1FXQA 2BDQA 4U2ZA 1JXKA 1F6PA 3P8JA 3SJNA 3WLLA 3ZM8A 3HQ1A 3RGTA 3G0XA 4BHYA 3T7VA 2YLAA 3HPXA 1FBAA 4H00A 2PU0A 2Y5SA 4UZUA 1XLKA 3CMGA 4P7OA 5C71A 1E6RA 2PB1A 4S3JA 5FACA 5G4EA 3TE9A 3HM7A 3UT0A 3SEPA 2PSNA 3TCEA 2CZ5A 3MZNA 1XM3A 2Y7GA 4ZO7A 3N3MA 4K6AA 3G18A 1M68A 3KRBA 1I75A 4BQ2A 1E1FA 3WYZA 4EACA 4F40A 4AG0A 3H6OA 1FP8A 4E5TA 4J3TA 1RCXB 1JULA 4KCUA 1NP2A 4QJ3B 3NG3A 4G1NA 3E96A 4YN5A 1T8XA 1OIFA 5ECUA 5ABTA 3OO2A 3W7EA 3TSMA 1VQTA 3LM7A 3T44A 3LQGA 4GUIA 2I5IA 1XIFA 3AWOA 2Y61A 1B57A 2X16A 1FCUA 2TMDA 4Y8FA 2XWEA 2ZA1A 1G94A 4U3CA 4FSAA 3PWAA 4DJFA 4MKSA 3WH9A 5AN7A 1EQPA 4K68A 5EFFA 1QDSA 1KD0A 2CETA 2E0PA 3MKVA 4ZL1A 2I1OA 3EX1A 3N13A 1AUSL 3W7PA 3G2GA 3LZ5A 3SI9A 4L6HA 1BWLA 3USBA 3SW6A 2PLKA 2NX3A 5EB8A 1J0YA 3UY7A 1ZNNA 4QSFA 5FESA 2VOTA 1O6IA 4O0ZA 5CBJA 4Q7IA 3VOHA 1QI2A 3AU6A 4X0VA 3UR2A 2AL1A 5E0CA 1KFKA 1A3XA 5DMMA 4JTFA 3NZPA 3S47A 3EBVA 1F3XA 2GLKA 2LLEA 4LVGA 4RZ6A 2FH8A 4XTIA 1JGMA 3WQVA 3RN6A 3N73A 3R8RA 3WH8A 1V77A 2UBPC 3CZ8A 3T9PA 1YIXA 4FZIA 3KP1A 3MWCA 1OC7A 2Z7GA 4IM4A 4MUZA 3GU9A 4AZGA 3QMTA 4W5UA 2WSQA 4NKCA 3CTLA 2C8NA 5MHBA 2ZOXA 4IJBA 1AD4A 3O16A 3WEMA 5AOUA 4B2DD 3FXGA 3MMWA 3BLPX 3ZJ8A 1SZGA 1GOQA 4IQLA 3M0IA 2OEMA 2D0GA 2J74A 4HPJA 3VNDA 1F5ZA 4CN1A 3QHMA 2OSWA 4B91A 2BZNA 2B7QA 4RNFA 3T0BA 4GX9A 3DZ1A 3ONBA 3VO0A 4C5YA 2XGIA 3OGSA 1LDCA 3CZGA 5E5CA 1X6NA 2VEPA 3J7HA 4WGXA 4LBUA 1NVMA 3I68A 3CH9A 4DAFA 4KESA 3WX7A 2BASA 4AWEA 8XIMA 2OVLA 5M17A 1I2RA 3WO8A 2GDVA 1PTDA 2XU2A 1MQPA 1RA5A 1XL9A 3QQ1A 4Q6JA 2X8RA 1OM0A 3NPWA 2J24A 5DQPA 4FX8A 2VUNA 3DC0A 2AMGA 3W23A 1P0BA 4Y9MA 1UASA 5XIAA 3O6YX 1HKMA 4GC3A 1M03A 4DRSA 3TYUA 2G4JA 3DUGA 3KBJA 1XR2A 5IHSA 4AMAA 3N18A 3KBSA 3T08A 1M01A 3CB8A 4JIPA 3H8AA 1U2YA 3NR0A 2WKGA 1QNSA 4PYSA 4WUIA 3L4WA 4HNLA 1U1HA 2DFAA 1OEPA 3CIVA 5G2IA 3CQKA 5BOFA 1IWBA 4H2HA 3HMCA 1PKNA 3NAVA 6XIMA 4NHVA 1CGTA 4EF9A 1V02E 2NUXA 4DLFA 1F8MA 4FNSA 3JZUA 4AXKA 4W93A 4MG4A 5DY2A 1IV8A 3BG3A 2RH9A 3RCYA 3UYCA 2PDJA 2ZZ4A 4H6RA 3E74A 2RHGA 4AW7A 1I2QA 5KINA 4WKHA 3M1ZA 3H26A 1T40A 4CNTA 5TQLA 1ISWA 1NFPA 1JRBA 1ADSA 3M7SA 4M6QA 1QPNA 1HL9A 1JAKA 3ZLFA 3G1XA 1LBFA 1K8ZA 1FX6A 3TTYA 3V7PA 2AL2B 4QJ5B 8RUCA 5GNXA 3CPRA 3TWBA 4L6DA 5E9XA 3URQA 3R0UA 1HNYA 2E5BA 3LRLA 4WY0B 4CCZA 4M19A 2B7OA 4L56A 3C6CA 1KRAC 2ZUVA 3H2EA 2XIOA 2DZVA 4W89A 1F6YA 1E3XA 4HK7A 2XISA 2NQJA 1TPVA 3M9YA 4D6CA 3NSMA 3WF3A 2GZXA 4HNUA 5FCZA 1QPOA 3EZ4A 4XK2A 3NOYA 3DBPA 3GTXA 2YL8A 3MJMA 2O7QA 5K7JA 5ABGA 1F07A 1NH6A 1WZKA 3W1TA 3O0KA 3ALFA 3GXTA 3DIPA 3EWZA 3ABXA 1V0NA 3W29A 2V69A 3C56A 1BYCA 2IXVA 3WLNA 2TYSA 3LBOA 3WL0A 3OJGA 3MCMA 1G4TA 2E1WA 1X8FA 3EWYA 2PDNA 4L61A 3GH5A 1R46A 3ENLA 2Y6ZA 3MSYA 2WSKA 2X1RA 3ITVA 1E3ZA 1E6PA 1UBPC 4JD4A 4JTAA 4TMCA 4ZO8A 3GG8A 2V5BA 1RV8A 3HV8A 4GGBA 1JR1A 1CXEA 5CJ5A 3PJXA 1MRAA 4AEOA 3R8HA 1P7TA 5HJLA 5AHIA 5E6ZA 2ACQA 1NWSA 3VPLA 4BFAA 3KRUA 3U9IA 5H2ZA 4P8UA 4ZQCA 2WMIA 3TW7A 2BWGA 3EOLA 1JL8A 1UR3M 4PMQA 2F2HA 5FJTA 1UKPA 2VEGA 3T09A 1TG7A 2ON3A 2VURA 4TUFA 4IUGA 2JKPA 2YB4A 1J18A 4MJ4A 3U3HA 3VDAA 1CX9A 3BLIA 4H2CA 4BY3A 3BG5A 1PKYA 4JTTA 1EZ2A 4QDPA 5E93A 2C16A 2EPOA 1GW1A 2VZSA 1IIHA 1GTHA 1UR9A 4IIGA 3ONCA 2BSLA 1B3ZA 4Z1CA 1F73A 3IAPA 3M0XA 1QI3A 2Z1BA 1AZ1A 3G24A 4DF0A 2WC3A 2ZUWA 3K4DA 1F8IA 7REQA 1CI1A 4X2PA 4TX6A 3R25A 1POKA 4KWWA 1QI0A 3L66A 3ZOAA 1D3CA 2WVUA 1SFLA 3R89A 3PZGA 5JUVA 4D8ZA 2F2KA 1PWMA 2VVSA 1JCYA 1XD0A 1P1XA 3TAOA 1V6VA 2W27A 4E4UA 4KWSA 4B5NA 1Z41A 5U4NA 4GUHA 2X0YA 3A64A 3PFMA 4PCTA 1H49A 3UJ2A 3WUBA 3UXDA 1LLOA 3TW6A 2W3ZA 3TYAA 4PTXA 4AY8A 4MYAA 3AFBA 1LP6A 3GVWA 1LQAA 3CASA 3GVRA 3IJLA 1E40A 3DHPA 3AUOA 1XFBA 1KTNA 3IK2A 4MZ1A 4XKYA 3VILA 5FA5A 1SZEA 1U1JA 3UXIA 3NZQA 5K9CA 4UR8A 3STGA 1FWNA 2JKAA 1Z7AA 3LMYA 3Q58A 1LOSA 3VMNA 4HCDA 4N2YA 1B3WA 3SCSA 1GJWA 1UD5A 5DXYA 1FCQA 4PL2A 4RDVA 4NU7A 3B0PA 4LCRA 1JQXA 2FIQA 4DM2A 3NWRA 4IPPA 1OFDA 1T7LA 4GXPA 1B9ZA 3L5LA 1WCGA 3TAKA 2PTWA 4G1KA 5DT7A 2UY3A 3VAVA 4J3ZA 4A3YA 5KITA 2OKTA 1I2NA 3PAJA 2VM8A 2O0TA 3RLGA 3S2NA 3HIJA 3L68A 3VC6A 4CNPA 1S5TA 3GH7A 2XZ7A 2CKRA 1UR2A 2D2JA 3NO5A 2W0UA 1GYMA 2FFIA 4LBRA 3DXIA 3KFTA 2WB5A 4PN2A 2DVTA 3MJYA 4B2DA 4M81A 4N42A 4QBXA 2WZMA 3TTEA 4H9TA 3EMZA 2PF8A 4J40A 4NXSA 5BMWA 2PI6A 4UMCA 2Y5JA 2WMHA 3QOMA 3PP7A 3QFWA 1JZ8A 4HZ8A 2R1LA 4ACZA 5LIUX 1S2TA 4TMBA 3N04A 1U5VA 3WD3A 1W9BM 1S3TC 2JF7A 1TQJA 4GVFA 3SY8A 2QJIA 3E9AA 3WQFA 5T8GA 1JZ2A 4PFMA 2XDFA 4C65A 3ARYA 4K38A 2VD8A 4PRTA 3STPA 4G7EA 3K4WA 1JUKA 2FZDA 2BP1A 3N2OA 1K4GA 1Q6FA 4NVTA 4NNBA 1EHAA 2WWDA 1XS2A 4E4FA 2J27A 2Z1VA 2QCMA 5CH9A 3VA8A 3UW6A 3W6YA 3VI2A 1RPXA 2GDUA 5D9PA 1C8XA 2DZBA 1VB9A 2ANUA 3C5QA 4MZ8A 4DWSC 2MNRA 2Y1HA 1DWFM 1V3JA 4RR4A 1GJUA 2IQ0A 2VL4A 3G5EA 4RPPA 2XTKA 1ZTVA 4KIEA 3VYLA 4AVNA 4GUJA 1IE7C 1ZU8A 1VEOA 1OX5A 1FCBA 4H4IA 1PYFA 3VABA 1FFRA 4UOZA 2X1UA 2D2HA 3TOYA 1I8JA 4DYEA 3LV5A 1RBAA 4W8LA 5CPQA 1DJXA 4F0LA 4GFSA 1C9DA 3B0XA 2ZC1A 4QCEA 1YXYA 3NL2A 1UR4A 2EJAA 3LPPA 1FWDC 1XLAA 4Z1YA 2DZWA 3E12A 5EYWA 1NDZA 1ZQ5A 1CECA 3U7BA 4E8GA 4JNMA 4BI6A 1UG6A 3LRMA 1YXDA 4PC8A 1OX6A 1JPDX 5A2BA 4TX8A 1V3HA 3DHUA 3W2KA 5FOOA 1CGUA 1KM1A 3GTHA 3WQOA 3RLHA 3V16A 1NAL1 4LNYA 4BA0A 1J2BA 1W1ZA 3K1DA 1IIGA 2A79A 1ML1A 1BRLA 1TREA 3C8NA 3WEZA 2JBMA 4AHQA 1NY1A 2J78A 3BJSA 3PG8A 4DYKA 2R1PA 3URBA 1L8PA 2OMAA 3IS4A 3PWGA 4HZ6A 4MGGA 1Y5VA 4JZ5A 3C0LA 3CLWA 4M5PA 3L9CA 5AHMA 1A0CA 1TA3A 3W86A 1FWEC 1GJPA 2D20A 3WF4A 3ZMRA 3V4BA 2ZXQA 2A7PA 4LUSB 3KCJA 3C3NA 1AODA 4UMAA 5CC6A 2G97A 3FHAA 3RG6A 9RUBA 2PDUA 1TWDA 3BUVA 1C92A 4RV3A 4JYFA 1PB0A 3IK4A 1WE5A 5H1WA 3W73A 4XZLX 3LG3A 1E4NA 4OV4A 3S4TA 3TDFA 2VT0A 1Q66A 2VC5A 5C9RA 3B06A 3PZUA 1H2JA 4EWJA 1GYLA 3THCA 2PTXA 1MNZA 1H5VA 2QCGA 3TK7A 3G22A 5HATA 4LEQA 5ABFB 3ANVA 3ZS4A 2QCHA 3G1FA 4IIFA 2G4FA 4N9BA 2E67A 1JPHA 4L9YA 4EX4A 1W8SA 1VFUA 3E0IA 3LLXA 4GVHA 5FF2A 2NUYA 5HNUA 4CEXC 5I3JA 3TFCA 4HD5A 3ITLA 3EOSA 4LXFA 2G3FA 3E0FA 5BU6A 4LYKA 5I2UA 3AHXA 1ITXA 3M0LA 3U2CA 1JYNA 2WV8A 4QDWA 2HCVA 4KCVA 3I65A 3KHJA 1UUQA 4DF2A 3EB4A 3WLIA 2RKXA 2Y88A 1FXPA 3W1RA 4ERIA 4O53A 2QNEA 1TYGA 4NI8A 2Z6JA 1H50A 5IFTA 3ZR6A 2XIBA 2HEJA 4TVUA 4E3VA 3MPGA 3TQ0A 2EBNA 2A5HA 3HV9A 3VDHA 2YR1A 1C90A 5A5WA 4NI3A 4ZEPA 4Q8MA 2J7HA 3QQ0A 1AW5A 3IJDA 4X22A 3OVPA 1A5SA 3SUWA 1P1MA 4Y9AA 5C9WA 2E9LA 2Z2BA 3B05A 3AIQA 7ODCA 1F76A 3VGHA 2OYLA 2ZA2A 4J3XA 1DVJA 4AD2A 2E8ZA 1RQBA 1G7VA 3WJSA 1H61A 3NVDA 1J0ZA 4K8HA 1B90A 4L1GA 5HDRA 3TONA 2HSAA 3AXIA 3BC9A 4Z2LA 1MDLA 3P5YA 1GT8A 3KM8A 5AYBA 2E5CA 2DVXA 1RP9A 2OYMA 1L6GA 4WKAA 3N17A 1GQJA 3TQKA 1FWCC 3KVLA 4H8NA 3NPUA 4MY9A 1DQXA 2Q8ZA 3N2CA 1CXFA 2I5QA 1VS1A 4YTQA 2VR5A 1X8CA 4BF7A 4QQ3A 1Z69A 3NQMA 4DHGA 4MDOA 3JRKA 1EB3A 3KEHA 4AD5A 3NQGA 1KA9F 2IKHA 4A6GA 1XLIA 3KL5A 3BWWA 3ANUA 4HOWA 5LIWX 1PZ2A 1XXXA 1C8YA 4A3HA 1OY0A 1VBHA 4DF1A 1IWPA 2DSVA 5LGXA 4I5UA 3HA1A 3UPMA 4GACA 3PB0A 2V81A 2QIWA 3RNDA 4DI9A 3P93A 4Z1DA 3TQVA 3M4HA 1V3LA 2EG8A 4RNIA 3QPYA 1Q5MA 1X39A 1XCFA 3VFLA 3S1WA 4LVBA 1QMLA 2R91A 4JTKA 3RMEA 3GDBA 1VBRA 2DPEA 4JS3A 2RGMA 2FB2A 2DSKA 3M0VA 1XSIA 2VRJA 3TOPA 1V0LA 4MAZA 2EAWA 4WDUA 1YYAA 3VZYA 3FAWA 1ZBKA 4S1FA 1DL3A 1BF2A 3BSHA 4FLRA 2BOEX 5A3HA 4GZJA 5JH2A 3TN4A 4QXIA 3T07A 5IRPA 3AMGA 3C2YA 3TW9A 2ABBA 1JEZA 2E6YA 1HVXA 4UQAA 1KC7A 2G3JA 3TLQA 2XIIA 3SCRA 3FN9A 4NZ4A 1TIMA 4IHCA 1IEQA 2CBVA 1CWYA 1MW1A 4MY8A 4GIAA 1QPRA 4REQA 4LV9A 3FVMA 5D9MA 4URIA 3GAKA 2X7WA 4TVDA 3GYCA 1V02A 4P7LA 3ID7A 1SM9A 5BRQA 2OQHA 1TV8A 5EA9A 3GXIA 2VP8A 4Z2KA 4OOZA 4NAEA 3MV01 2VFFA 2J9ZA 3H23A 4OGZA 4KEVA 2WZEA 3DI1A 1XRTA 1YDYA 1UQYA 4MHBA 3UPBA 4Q7BA 3W0KA 3VZXA 3MT1A 5DANA 1E4MM 5AYXA 1O5XA 3L2MA 1YLVA 3DFHA 1TJ2A 3K8KA 1A5AA 1YX1A 2HZGA 4POCA 3URNA 2W66A 3BICA 1OADA 5C7VA 3AHVA 4UMBA 3GTNA 1GUVA 5T9CE 4H19A 3WJXA 3M7WA 3ABOA 4MY1A 3W7MA 1ZCOA 3VCRA 3SN0A 3TN6A 1QR7A 3GHSA 2P10A 4DJDD 1TZ7A 2WHLA 1WV2A 1ODZA 3RK8A 4I9TA 2H8XA 3TJIA 4DX3A 3LGDA 5A2AA 2A6LA 4LY8A 1PSCA 1Z9AA 5L6UA 2JEPA 1V6UA 4WLCA 1W1PA 3OU8A 1O7AA 3DKJA 3RF9A 1R87A 3FYPA 2Z27A 1SZRA 3I3EA 2ZZ5A 2DZTA 3GR7A 1PIGA 5FL0A 3LD5A 1PE1A 3QH2A 4ZQNA 4UTTC 3W7GA 4WRHA 4WK9A 1W3NA 4NZ3A 3SFWA 1G4EA 2Y70A 4GIEA 4UNIA 3Q94A 1FWGC 2NSXA 3CJPA 2AQVA 3GG7A 3GNOA 2A2IA 1W9UA 4MUPA 3S1XA 3OLEA 3VE9A 1JJKA 2BNJA 5CZTA 1HL2A 5KZDA 1BLIA 2E5DA 2VC9A 3MTWA 1EDQA 3R8GA 1QNRA 3AZRA 2PWEA 3THDA 1F05A 1TB3A 2G3NA 3WUGA 4JTEA 5CGMA 3OP2A 1BAGA 2JIWA 2ACRA 1X1NA 3WLKX 3K8LA 3EDEA 4MKNA 2GOUA 3TR2A 4I5XA 4IP7A 2DQWA 3E5BA 3TZNA 1UUMA 1Q6RA 5A8GA 3EKLA 3WMBA 5HMSA 2F7FA 1SPQA 2R6OA 4EAMA 1BD0A 2XN2A 3IIXA 2PF0A 3R0DA 1O12A 3DI0A 5T26A 2RGLA 4MTVA 2Z1SA 4CKQA 1C8VA 4EXQA 4CEUC 3HG4A 2PDIA 5HMFA 3WY1A 5AYYA 4DELA 3B8DA 2OQLA 3WLRA 3CZJA 1KFCA 3LENA 4RL3A 3GZAA 3R10A 4GNJA 5IDIA 4FI4A 3QKZA 4XAYA 1Y5WA 3AS2A 1HFBA 5CPMA 5HJXA 5D38A 4QISA 2F6XA 3SRFA 1UOZA 2BOGX 1LBMA 2Y8UA 2CERA 4M82A 1W1B1 1LWJA 2NX9A 4MFEA 1AW1A 3F5LA 4CD4A 1OFQA 2WZIA 4E2VA 3CV6A 1FHDA 4GJ1A 2PDMA 3AALA 1J8VA 3CZLA 4EVZA 2WHKA 4H83A 2JKEA 1DE5A 1VCVA 5K4ZA 2F61A 1EGZA 2E6FA 2YBVA 3CYVA 2VQUA 3TZFA 2YW4A 2CU0A 2GWNA 3EB3A 4H8VA 4PSRA 3EOUA 1GVFA 4MF4A 2ZRZA 3VNMA 4L9XA 1VAHA 2PODA 4Q4QA 5C2XA 2ZRXA 1VFMA 4XAPA 3S5SA 4KBXA 3K46A 4FNPA 4PUEA 1D3HA 5KZMA 4CUCA 3BANA 2VEMA 4JTDA 1UW9A 1GQIA 2C19A 1E70M 2P1FA 1LOLA 4JY9A 1K03A 1CW2A 5FF3A 4YYCA 1EL3A 3L4VA 2ZC8A 4BQ3A 1VYRA 1JDDA 3GDMA 2HK0A 3F4CA 4NP7A 4QLKA 3W25A 5D9NA 4HT3A 4XZNX 2DQXA 3L21A 4A4AA 3MDUA 2DY3A 3AXKA 1FA2A 3KLLA 2ZX9A 2G50A 1OYAA 3TSBA 4M0XA 3I7QA 2QLYA 2XIJA 1Q3NA 5BU9A 1ADOA 4RNHA 4WKFA 4JTLA 3W6LA 3A9BA 4AYGA 1CXKA 3WZ0E 2D0HA 4WX2A 5FAJA 1MUWA 3LTYA 3B40A 2GQ9A 3U2ZA 5FEWA 4ATDA 4PB4A 3QV9A 2GVYA 1OVDA 3DX5A 3OLDA 3DH7A 1GZJA 3LCFA 4WZHA 1OGGA 1JZ3A 1ME9A 1PTAA 3V1HA 3HFYA 1VFLA 1T99A 2OU4A 2RJHA 1RQEA 3MMUA 3LCLA 4KS0A 3IRDA 3IGUA 4HBKA 1XINA 2RJGA 2VEIA 5D32A 1DJWA 3EXSA 5E1QA 3KAOA 4GISA 4GZ7A 4PL1A 1W5MA 1QO2A 1GQKA 4Y7EA 4JAWA 3VINA 1C7TA 4FNTA 4CLMA 4LC8A 3B8WA 5D8ZA 3PPGA 4I8YA 5A95A 1C93A 4JQ2A 3WFZA 4DZHA 3PVFA 3W70A 3DHDA 3SCTA 2CZVA 3QR0A 4ICCX 2FZ8A 3EMQA 1ISVA 2GUBA 3QTGA 1WNOA 4HIBA 3NXLA 3K8MA 1S5MA 4W8BA 4XVDA 2PD5A 3O05A 3O3RA 1A3HA 5CGQA 1J5TA 3MZ2A 2YA1A 1AA1B 1CXLA 3MQTA 2BV9A 2CLPA 4S3DA 3IARA 2YB1A 1XYMA 4RW5A 3G3DA 4L6OA 2C14A 2PE4A 3OZOA 1UZ1A 2CLHA 4NIRA 1ELSA 3BOLA 1XBYA 4TIMA 1HG3A 4QE4A 4GY7A 3GR4A 4IG2A 4HA0A 4GNKB 2HWGA 2X40A 4GGHA 1VPQA 2V68A 1KR1A 4P7QA 1OHLA 1T5AA 4HA1A 2QULA 4ZXOA 4R7WA 5HNTA 4LT9A 4HPXA 3VGFA 3PK7A 3C2FA 4IFOA 1QHZA 4QS5A 3CB3A 2J7CA 1QK0A 4R27A 2GK1A 1XRSA 3II1A 3GC4A 3KVMA 2O4MA 4JKKA 4MFDA 2C15A 1NARA 4FS9A 1Q6CA 1LORA 2DV0A 3HGOA 3H21A 3A5VA 3VGEA 1U33A 2ZRUA 2QGYA 2H8ZA 3FCPA 3U48A 3ORWA 4AWTA 3G77A 1EP1A 2DZUA 2Q8XA 1K6WA 4R9XA 4NJKA 3WQ8A 2GFTA 5BRBA 5FL1A 5LHFA 1H5YA 4ERAA 2ZFAA 4WCJA 4OKDA 3ATYA 2AOSA 3P2VA 4Y9NA 4HB7A 3FAXA 4B3KA 3MSGA 1UIOA 4DJDA 1C7SA 5A6MA 4N6EA 4UQBA 3DG3A 4RE2A 3U4FA 5CC3A 3W3OA 1FHUA 3TYZA 4QTGA 1AZ2A 3UU0A 5TAOA 4FP1A 4DXKA 2J9XA 3KZSA 1KFWA 1XH0A 3LHUA 2J79A 1P7TB 3T2QA 2E8YA 3KTSA 4AF0A 4UTTA 3PZTA 5KSWA 3UZZA 1AL8A 1R5YA 5BZAA 4LUYA 3AXMA 2WMIB 4XUGA 2NLYA 3S1GA 4UTWA 2INEA 2PCEA 2EPMX 2V8ZA 1T41A 3RX2A 1KQYA 1MXSA 1PO9A 3AHYA 3DFQA 1U5JA 1VJIA 3RJXA 1MW3A 4GA8A 2I5GA 5D2WA 1ECQA 4AZ5A 5D03A 5GQBA 2E4TA 1GQLA 3GLCA 2CC0A 3AAMA 4HU3A 4N4QA 1KKRA 4PMYA 2VFIA 1GOKA 5AZ0A 2E68A 1R2RA 4QHRA 3UA4A 3T6CA 1MQQA 5HA7A 2B7PA 1OFOA 1W37A 7REQB 1AK5A 4Z2HA 4HCHA 4PCNA 3GG0A 3CAQA 3SQSA 5MF5A 1X1OA 5H6HA 4BQ4A 1CLVA 3AU2A 3TXVA 1H09A 4UFHA 3NQVA 3V35A 3HZ3A 3GKFA 1OFPA 3LGGA 3GNPA 5LGZA 2EG7A 1R7AA 3N2MA 1V6WA 2CEQA 1J01A 1F74A 3ALGA 2A7NA 1UZ4A 4YVXA 3V0SA 1G0CA 2XH2A 3GS6A 5J5DA 1XBVA 3CGTA 3RILA 5CXPA 1N8IA 1XBZA 1YDVA 2HPIA 3V3WA 4FXFA 2OQYA 3S46A 2HS8A 3R13A 1W9VA 3B8SA 2C0AA 2VRKA 1J9YA 5HPOA 4YMZA 2V5JA 1ME8A 1N8FA 2JE8A 1QWGA 5L9FA 3ZZ1A 1FH9A 5TF0A 2PRHA 4XKYB 3S6DA 5GPRA 3ARUA 3DFPA 2F6UA 1PZ1A 1J0KA 1EQCA 2Y0FA 3R58A 3BE7A 4GYKA 3F2CA 1UD4A 1ZBCA 1W17A 2G95A 3WUFA 5C9XA 4DPQA 3WFAA 5KTLA 1XKYA 4L5ZA 1WBJA 4Z42C 3WNPA 4BCEA 1HKJA 5EMUA 5LXXA 5CG0A 2WBKA 2V82A 4D6EA 2HDJA 3KUMA 3KRSA 2GGGA 3AHTA 2OZ0A 1M7JA 1A3WA 2VFGA 4DO4A 1H62A 2VX4A 4Q4OA 5CC5A 2WM0A 4HJWA 3VCCA 1R86A 3C0QA 2L5HA 2Z0IA 4P61A 4RV8A 5CC7A 5MKGA 2A1YA 3W88A 1MEWA 4P5UA 3W01A 1VP5A 4K8GA 2PURA 3L0NA 5CPOA 1RA0A 3KL3A 3F4VA 4S2CA 1KM6A 5DN1A 4ASTA 3CZEA 3TTSA 1EA9C 3ES8A 3R79A 2FVMA 3BXWA 2Z00A 4IIDA 3T0TA 1PHQA 2GVGA 2PTZA 3I7SA 3BAYA 1KO0A 1VIZA 3TQPA 1C8QA 4Z0SA 4ACZB 4Y9PA 1HJWA 1E56A 1IHIA 4XZWA 3GUGA 4GX8A 1M7PA 4KCTA 4EANA 2Z26A 3S6TA 4N9CA 3EWBX 1N7KA 2CXEA 1FQ0A 3OBKA 3WLPA 4AD4A 3PC0A 5DFAA 1L6SA 5GJMA 4G7EB 1RY0A 4Y8EA 1TELA 4A3QA 4AY1A 3QQWA 4WSHA 1VH7A 1XLBA 1XLFA 1GVRA 1E0XA 4KPLA 4IMCA 2J75A 3ELFA 1VHNA 3GY1A 4YU1A 3IVUA 4IXHA 2WZTA 1SJCA 1SW3A 1KM4A 2HJPA 4AZHA 3QN3A 3T55A 4AIOA 4U10A 2IW0A 1FWAC 1OCJA 4JYDA 4DWDA 3PBUA 1Z8AA 3BV4A 2AMXA 1A5LC 4INFA 4PFHA 2F8QA 2AGKA 2BY2A 4G2DA 3PTMA 3BQ5A 3KTCA 3CHFA 3QY8A 4GRSA 1EYWA 1KGXA 4ZODA 3LUTA 3EPNA 3O07A 1H7XA 2YW3A 1LUCA 3I4EA 3LCGA 3NM1A 4GIRA 4DO5A 1EC8A 1M9HA 3FW6A 3A47A 3CPGA 2ISDA 1ZJIA 3B9DA 3W1UA 4AZ7A 1R2TA 2YA2A 4AEEA 3WNMA 3M43A 1J0IA 3AMLA 1U83A 4Q7NA 3W24A 4B5SA 3IJIA 3RLVA 5AC5A 3IJ6A 4ATLA 2G3MA 4R88A 1I0BA 5HR6A 1WZAA 3K13A 3JVAA 1W5OA 3QY6A 1P6CA 3EOOA 4NAFA 5I3DA 1TMQA 4TXEA 2VR4A 1E15A 3S5NA 3LXBA 1L6FA 2GUYA 2VZUA 3L4YA 1XUUA 2I7GA 3MU7A 1DPMA 3NQFA 1ISZA 1NF7A 1W32A 3ARWA 1XGEA 1OD8A 4PMRA 1J10A 1UWIA 3GTIA 1NOUA 1BRLB 4I7UA 1V8EA 1JUBA 3URAA 4F48A 5I09A 5JU6A 2GWGA 2ZTJA 3ARVA 2PGRA 2YXGA 1TA3B 3WENA 4GUGA 3NZRA 4GXWA 2ZKMX 3TYEA 4CCEA 1KQZA 3RMJA 2V38A 3CL7A 3GHTA 3KOWA 1AQHA 4KEZA 3PZMA 3MI3A 8CGTA 4CQBA 4HMCA 1HIZA 1B5TA 5CQ1A 4DXXA 2KX9A 4B4FA 5LIKX 3TX9A 3IUDA 3VKAA 3MA8A 1EO5A 1JCTA 1JQVA 2DZXA 4MAVA 4WJ8A 4ADUA 3L4UA 5BOEA 3M0ZA 1YNYA 1B3VA 1EPXA 3UFYA 1UZHA 2GVLA 5HPCA 2XVKA 3ARZA 2WJDA 4RK8A 2Y24A 4A29A 1KWGA 4TQTA 4Q4KA 1X98A 5C0QA 3MUCA 1E4IA 1VKFA 4ZB5A 2BVYA 3BW2A 4JX6A 1BSLA 4H9YA 3W02A 1YDNA 5DX7A 3QM3A 1TR1A 4YCOA 4LUTA 5BRPA 4XD5A 1UA3A 1EXPA 4NJJA 3W00A 4O1EA 2FZ9A 4YVVA 5B80A 1JPIA 2VQTA 4PMUA 1X97A 3WD0A 2ZX6A 2VRQA 3XISA 1C9WA 4S39A 3MYOA 1GEHA 5GNYA 1P0EA 2VX5A 2ZZ7A 3T0CA 2GQ8A 3Q65A 2ZXAA 4RW3A 3CEPA 1G9HA 3MP3A 2VD9A 1DEDA 3DYPA 2Z1KA 5HAOA 3DCPA 3WJYA 2ZUUA 1H7WA 1I45A 1SU5A 3UZJA 1EC7A 2BY3A 5F2IA 3JUGA 3W22A 3WF1A 1O5RA 1SVDA 3T0AA 1ZY9A 1SR0A 1KBIA 1V6XA 1VRDA 1M7OA 4G8TA 4JCLA 1ZPTA 1P0NA 3DENA 3IACA 2CLLA 4XSMA 3UWWA 2BMBA 2HBVA 3VX0A 4A2SA 1TPDA 4ROQA 4N02A 2VI0A 4ZR8A 1CXHA 1HO4A 1O4UA 1QNQA 4YWSA 3CUHA 1S39A 3CUXA 3GFYA 3LCHA 4HCLA 3A21A 1EH9A 3IEBA 3N6HA 4BS0A 2ODOA 1W1YA 1GWJA 2HXTA 1Z42A 4J35A 4V1XA 4M1RA 3A9IA 3BGJA 3GYEA 4NRSA 5TIMA 4XO7A 5C2CA 2E6DA 2X2GA 1IEWA 1R3VA 3MBFA 1W3LA 4AIBA 4JQ3A 3FOKA 5FI8A 1V6TA 4FOJA 2EEXA 3AIVA 3V0TA 3KBMA 1UD3A 4GJJA 1Z3NA 2FMNA 4DUWA 3THAA 1IR2A 3LHWA 2YCIX 3N25A 3NYZA 4AISA 2EPHA 1UR0A 4B16A 2CW6A 1FDZA 2XVNA 4XBKA 2MANA 3U5UA 3D0CA 3ITYA 3RO8A 4PUMA 4AD1A 3BO9A 3CWOX 2V67A 3AMDA 1SZFA 1S3HA 2QYGA 3A4XA 3NSNA 2XFWA 5CZJA 3BGAA 2WNNA 1GHRA 3QZ6A 1LQ2A 4PBGA 4GI9A 2CWXA 7ENLA 2GDQA 2X1IA 4O1AA 2V3GA 2WNZA 3PANA 3FDGA 2V0TA 4ZCWA 2GJRA 3GDTA 3CUJA 1XC6A 1WOAA 1GTEA 4PEEA 1FCVA 1WAWA 4GKTA 1GPWA 1ONRA 4EKJA 2V9DA 1OX4A 4MIMA 1QU4A 3ICJA 2W63A 1NWUA 2ZVRA 5LXEA 1XLJA 3I10A 3VFCA 1NDWA 5D04C 1ICQA 3R43A 4PR4A 4DJFC 3AQUA 5AVHA 3VCNA 3TC6A 4C6PA 1VCGA 2ZDRA 1OK4A 3PNUA 3MMDA 3T0DA 2BHUA 3WCZA 4DN1A 1OF6A 1W56A 1YEYA 2QDEA 4TOQA 1M7XA 4DBDA 4REQB 2PWUA 3SSZA 2BGNE 3CM4A 2FMOA 3W81A 4CQCA 5I24A 1FOBA 1HF6A 5FSDC 3S5OA 1H0IA 5G4WA 3GDLA 1HW6A 3TMLA 4FLQA 4JDYA 2BY0A 3BARA 4NAEB 3P61A 3MBDA 1BXCA 2QW5A 5ECVA 5IOBA 1UKTA 3ATZA 4XX6A 3SBFA 4EPEC 3XINA 1P43A 3FXYA 3BSGA 3NM3A 1VFHA 1K9TA 2R1KA 5LA0A 2O92A 5CPTA 1UWRA 2VENA 3PWIA 2XN0A 4UOJA 4G9PA 4Q8VA 3M0HA 1HUVA 5AFDA 2RAGA 2NVAA 1PCKA 4HGXA 1K7XA 3NGFA 3LCXA 3ZWTA 4WJEA 3S2JA 3DFNA 3HQPA 4HOZA 3QMSA 4Z2GA 2RDTA 3QYQA 1MFVA 1D9EA 3WMLA 1BYAA 4F79A 1RCOB 2QZRA 1PVNA 1YXCA 3TYDA 1Q85A 5BOOA 4DJEC 3KXQA 2QEZA 2Y62A 1C91A 4ZOEA 4WGHA 2O9TA 1BWKA 3CT7A 5CBIA 3NEHA 3LY0A 3VIMA 2OFJA 4NQ1A 4F9DA 4GI8A 1WP6A 1ONWA 1QJWA 3WH6A 1RJRA 1V3KA 4WSJA 1AL7A 3TXZA 4FX6M 3W74A 4DIAA 4KWOA 4IGNA 3VD5A 1PX4A 4QG6A 4MWAE 5HULA 3H2OA 3U0HA 5HMEA 1EGVA 4CD6A 4HKPA 3RUBL 1H7RA 2IPWA 2WO5A 3WBYA 2PA6A 3HN3A 1PZ3A 2UV8G 3ARRA 3HG3A 3PY2A 1I2PA 4K7YA 1RY8A 3MUZ1 1WXZA 2Z29A 4DZIA 1TPWA 1BXNA 4DYJA 3N9RA 1TR9A 8A3HA 1VR6A 3M47A 1K70A 3HQNA 1YTEA 1KBJA 1V08A 2XN1A 5AKQA 2FPVA 1VEMA 1SJAA 5IBXA 1EOKA 4XO6A 2KZHA 1DHKA 4OT7A 5B7YA 2C71A 2NQZA 5AYZA 4E2BA 3SADA 3FYOA 2GVEA 3TLLA 3ARPA 3DKLA 1QNVA 3VNKA 1XG3A 3RAOA 5EMKA 1HKKA 3NQ7A 3G1YA 3NL5A 4C6FA 4PMXA 5FF7A 5CKSA 4DPPA 3INPA 1KCXA 1DTUA 2IPGA 3BAJA 1B3YA 3MO7A 2QUMA 2WVTA 5EMYA 3AS0A 2XPKA 4KERA 2NUWA 4DM1A 4R3UA 2XFFA 2D73A 2W62A 4JICA 1XLCA 1TUXA 5D30A 2DZSA 4HQVA 2YCLB 3PBGA 3UZWA 2NQHA 2BHYA 3IJ9A 3UR8A 3L0KA 1TZZA 4JIRA 1KV8A 1E5NA 3H53A 4FOUA 3YPIA 3UBPC 2ZADA 3ZXWA 1GZGA 1SSDA 4QNWA 1GZ1A 1S2VA 1UWUA 3V75A 3VVGA 1W31A 4QE1A 1CB7B 1XJBA 2VGFA 1UWQA 3T40A 4K1WA 5F1UA 1LL6A 1EJUC 3N1AA 5E70A 4LU0A 4AD0A 1UBSA 3VM7A 2OJPA 3B0UX 1M1BA 4HYWA 1YRRA 3NSXA 3R4IA 2WMFA 2JF6A 1A5OC 4IPNB 3VNLA 2WMJA 1UYQA 2HISA 3TKFA 3CZKA 4I9JA 3UCDA 1M3UA 2YA0A 4GJIA 1EJTC 3V5CA 4PMVA 5LYRA 3MHFA 1S2UA 3EB2A 4DAIA 3BDKA 3WBXA 1EBGA 2DT1A 1BTCA 5C9UA 3FA3A 3P81A 4QGCA 5I03A 5JH1A 3RU6A 1Y0EA 3S5ZA 1PBGA 3DG7A 4FXSA 4OOUA 1UB3A 3LCWA 2GGEA 4KW2A 3N2TA 4TTGA 1QK2A 4ICMA 3W7CA 1JZ5A 5HANA 3BOXA 4AAJA 2Q6ZA 3S1UA 4M6PA 4NUWA 2PDXA 4IH3A 4R53A 4E8DA 5C55A 1TJ1A 3IV3A 5RUBA 3ZVHA 1B4EA 3KDNA 1RP8A 2ZVIA 5PTDA 3PTQA 1EP2A 5K2ZA 4PTWA 5FF0A 2PU1A 2C0HA 2BGSA 2ZUSA 4XIAA 3PZVA 3BLLA 1MUCA 3VD9A 1ITUA 3QW3A 1UP3A 2RDXA 4EP8C 1FKWA 1LL7A 1QBAA 2ZE3A 1PPIA 4ORIA 1O66A 2RDWA 3CL6A 5FSEC 4JIEA 3GKAA 4LALA 3CXOA 2BS9A 1ZENA 3GC2A 4DUVA 2A0NA 3BW3A 3OIXA 3HJZA 3LHVA 3L5MA 1EJ7L 3H55A 1JZ7A 4K8EA 3WDQA 5JMUA 4J1OA 2ADAA 2WM1A 2PC8A 3T42A 5A1AA 4ZTXA 1L6YA 1SQ7A 1UROA 1UR1A 4GK8A 4V28A 5FEPA 5A8NA 2DH3A 1W2PA 4MJMA 1P0DA 2Y85A 1E1CA 1QAPA 2O55A 5LKYA 2BFGA 4EPDC 3MS8A 1DQUA 3H54A 4ML4A 1TPH1 2EQDA 4LH8A 1G6CA 3NDOA 1DYSA 4LYPA 2X05A 4IGSA 1LT8A 4K37A 1IWAA 3THUA 1KTCA 2PTYA 1XRVA 5A2CA 3BCJA 6ENLA 2QPUA 4AD3A 4WF7A 3SZ8A 2ZWZA 4LVFA 1J0JA 4CD7A 3W7OA 1I4NA 2JIEA 4KEUA 2NXHA 3GAYA 4IG2B 3TJLA 5C8BB 1QASA 3V1PA 1G5AA 4KFPA 4H6KA 3WJWA 3VOCA 1TKKA 4H1ZA 4R5EA 5CAHA 4IQDA 3E1F1 1PJ9A 1D8CA 3IRSA 3B9AA 4LB4A 2MUCA 1SUXA 2Q8LA 3MKCA 2PP0A 2QCCA 3AIUA 1XLMA 2PDQA 1XIBA 3F4DA 3MSRA 2BGQA 4BEQA 3TV8A 3BL3A 2J62A 4MWAD 2GK1B 1G4PA 3WD2A 5H8MA 4KFOA 3S2CA 1ZALA 3REQA 3VIHA 4IJRA 3GVQA 4WY0A 4JTCA 2W61A 3O8AA 1GK8A 5F2GA 1FTXA 2V5DA 2HV5A 3PTDA 1QI5A 3AHZA 4JX4A 4WD0A 3C0SA 2DUZA 4Z1AA 1EEPA 1KKOA 4GUFA 2H9AA 1T6MA 3AMKA 1US0A 2P0IA 3NQ6A 3RO6A 5HK4A 1B30A 3LSCA 5A6TC 3WBWA 4FK9A 1Q6LA 3CT2A 4DJEA 2DVUA 1Q2SA 1E9LA 4FX7A 4IFRA 1EIXA 1MSSA 3PULA 3H4WA 1R47A 2VGGA 3NYDA 3STFA 5M5DA 4OWGA 4W7VA 1UHVA 2BXYA 4ZMGA 3M44A 1QUMA 3B3DA 4CNSA 2AQOA 1CT5A 2VDGA 1J0HA 2VYOA 3LLDA 1SMDA 1QATA 1MW0A 3W1PA 4IFKA 4BI7A 3ZFHA 4AF0B 1D2KA 4IPJA 2OT1A 1OCBA 4J3VA 2QUVA 2FB3A 3R6IA 4RPQA 4RZ5A 2ACSA 4F4RA 2FDMA 1MEIA 2C6QA 3SIZA 5I0DA 1JUEA 4BQ5A 4HNVA 2PWVA 1Q6EA 1J2WA 5TBOA 3JU2A 3MP5A 3PUOA 1Q7ZA 4M24A 4I7WA 3WQDA 1HJQA 2HTMA 2DIJA 4AZIA 1W5NA 3UZYA 4QJ4B 3CV7A 3LNPA 3AICA 2GL5A 4F66A 3OEXA 5F4WA 2O9RA 1A5BA 1JDEA 2QUNA 2DSUA 3ZVIA 1S46A 2WBGA 4ES4A 4S3GA 1OGBA 1XLHA 4LV4A 1EC9A 1UCWA 5D9OA 1OFAA 4W84A 4BR1A 4O1CA 2Z1XA 4OECA 2R14A 4V2XA 2ATMA 1UD8A 1HT6A 1KFBA 4GCAA 2VCAA 2WSPA 5FJOA 4J4KA 3NPXA 2CLMA 3WDPP 3UWZA 4GLEA 1QWKA 5K3VA 4NZCA 1BVZA 3N12A 3QZAA 2VC6A 2C79A 2ZUNA 4IISA 3UETA 3RRAA 3JW7A 5HNRA 5KETA 1YMYA 2GJXA 1TV4A 6CGTA 3IJ7A 1XSJA 1M6JA 4X60A 1RPKA 2PUZA 4PEKA 3NIYA 5D2XA 1B31A 3WF2A 2G5WA 3ZJKA 1JIBA 3ZIZA 4JHZA 5AY7A 3RPMA 2A3HA 3S2LA 2OTDA 5K9DA 1Q8JA 3TA9A 3NCOA 1E1EA 5HXMA 3FX4A 4HN4A 3ZR5A 1LBLA 2QF8A 1SFSA 3G1AA 3PM6A 5C2GA 4TX9A 4MJ2A 2W92A 2JGYA 2B31A 5JXQA 2QGHA 4QRNA 2ZUMA 2NV1A 1VD6A 1JXJA 2BBFA 1WO2A 3W53A 2W6RA 1BFNA 5LNSA 3EEGA 2PBOA 3SRKA 1VCFA 4IXXA 4AB4A 1EX1A 2GGHA 5CSYA 2OELA 1XKJA 3CUFA 2P3EA 5MKGB 1Q45A 4PUKA 1TE6A 3OA5A 4W4QA 3W2UA 4PB3A 1XLGA 4PULA 4FMVA 1UD2A 1OF8A 1Y5XA 4QAWA 4XD6A 4Q8PA 2J13A 2FQIA 4LAMA 5JVLA 3LBCA 3PBVA 5HR7A 2VFHA 3G6LA 1EXBA 1VYSX 4O19A 1OCQA 4FA3A 3MANA 1MNSA 4LB3A 4YHEA 2F9RA 1RH9A 3D46A 4FHAA 5D2TA 1GQNA 1IR1A 3LXAA 1NM9A 1S5VA 4ZTYA 4RJEA 4LBSA 5FEXA 3H12A 4MADA 2WWCA 3M6YA 4NASA 1CB2A 3QC3A 1TTPA 1KRCC 4ADTA 1KM2A 2D23A 3KWXA 3V0UA 1V3IA 3UYIA 2WPGA 5D09A 2QCFA 4GXMA 3UVAA 4AFYA 4ALDA 3M41A 1EJSC 4KMQA 4P8XA 4S3EA 1KWKA 2WMKA 2PS2A 3IV8A 3CH0A 1SFTA 3NVTA 4GCXA 5T91A 4JEQA 4YXGA 2YGYA 4FB7A 5J04A 2NSOA 2IS7A 3GH4A 3IJ8A 5CSUA 3GFXA 4MB4A 7PTDA 1ITCA 1UH4A 4Q4RA 2X42A 2VZTA 3LMZA 8XIAA 4YS1A 3GXNA 3D47A 4H7CA 3TC3A 4F8XA 1WA3A 2HBXA 3ANYA 3P74A 1DWGM 3MHGA 3W7RA 3TYBA 2ZIDA 4X61A 3QGVA 2HNEA 1XYFA 3L67A 4UQCA 3RPTA 3QF0A 1Q7QA 3VOIA 4HU0A 1VBJA 4AIEA 2IKIA 3LX9A 3VXGA 1G01A 1LLZA 1O68A 4JPGA 4GE8A 4OBTA 3VIOA 1KFJA 4MB5A 3CO8A 2J8FA 5D2YA 1DXFA 5JBFA 3SFKA 3GNDA 3POHA 3UJSA 3W2MA 5CJNA 3OQEA 2DORA 4US6A 4EWND 3PTKA 2PGFA 5C9ZA 3OTRA 3VMPA 2VEFA 1YBQA 1WPCA 4O18A 3P80A 2WVVA 4Q32A 5ABEA 4NYYA 2PDFA 5AHLA 3TN5A 2VFDA 3RU8X 3N9KA 3SJ3A 1OJXA 1AH0A 2P76A 1KTBA 4NAFB 1OT2A 2QCDA 4LQ1A 1T96A 1LJYA 2QCLA 2XH4A 2TSYA 3L4TA 4GFIA 4H6EA 4DBWA 1EJRC 3KVKA 1H7OA 4CNNA 1JFHA 3W7NA 4RE3A 4X63A 4NX5A 4IIEA 1FWFC 1ISXA 1GOWA 7TAAA 1B9BA 1GVQA 2O4QA 1HXJA 1EJWC 4MWAA 3P84A 3KS6A 4FIRA 3T1GA 4BF9A 3SCPA 1RZMA 5LSMA 3OG3A 1K4HA 2YFNA 4NXKA 1DIKA 1B2YA 1SO6A 2OB3A 1K1DA 5HMDA 2P5NA 1RBLA 3U6WA 5I02A 3CS2A 2QJJA 3L4ZA 1FUYA 3PF3A 1KM3A 4W8AA 1OWQA 3GR8A 1X96A 4AZCA 3WDIA 1IT8A 4P7RA 2CESA 1GKPA 4V33A 4DI8A 1W54A 1PTGA 1PDYA 5FAGA 4OBRA 4Q4MA 1L8NA 1TTJA 4LWWA 3QPZA 3KE0A 5F4SA 1L2UA 1GOMA 4M6VA 2R24A 4UQEA 3KLKA 4XG1A 1ZZMA 3AYVA 2VO5A 4GC4A 1W1VA 1F9CA 1QW9A 2ZCGA 2ZZ1A 3APYA 2EPKX 5ABFA 5D2VA 1KFEA 1R30A 4ATWA 4JTIA 3PUEA 4LUTB 4AU0A 1RVKA 4IF2A 4UWMA 4HPNA 3GU2A 4ICNA 1AQ0A 3RITA 3R7MA 4GZIA 1CLXA 3PBWA 4A8IA 4CU7A 3T05A 1L6WA 4B15A 3KOYA 3WFLA 3UCCA 1B3XA 3VD7A 4O10A 1W1TA 4PUNA 3UWQA 1TCDA 4K7VA 5CJMA 1EUNA 2VZVA 3M6DA 4PE8A 3DERA 1RD6A 3AS1A 5BWFA 1E6ZA 1TE1A 3LU2A 2VX6A 3M5ZA 1V4YA 4MLJA 4IMEA 4WOQA 4UB9A 5HINA 3VU2A 3ISIX 2A4AA 4I5RA 3DFYA 5CSRA 4C6OA 1K7FA 4WY0F 2Y63A 4I6VA 1E0TA 4RZ4A 2SFPA 1H1NA 2E28A 4O0KA 3TWAA 1RALA 4H3DA 3AC0A 1CBGA 1XYAA 2OG9A 1JPMA 4B5UA 1KXTA 3PPCA 3A6OA 2WKJA 1XF0A 3E2VA 4IQJA 2PMQA 1PV8A 1J5SA 1I1XA 1NWRA 1XX1A 2Y5EA 1V51A 2ZBTA 1V79A 3N4FA 1JZ4A 1AG1O 2J8GA 4TU1A 3E02A 4KETA 3H2FA 4FXRA 3OLGA 5AZ1A 3OQ8A 3ZYZA 1CGWA 1JCMP 4LYRA 2R82A 5E6YA 4UBPC 3AIRA 4ZENA 4R33A 4HJFA 4NJGA 1FWHC 4EOUA 1TV7A 2FTPA 4D72A 1DJHA 1ZJAA 3GRIA 4IWWA 4K1GA 4E0CA 5D33A 2PTDA 2GQAA 4YTUA 3WLHA 2CCRA 3KBVA 1QPQA 3EX2A 4PUDA 4ZO6A 3GDRA 4JTQA 3E49A 1JDAA 1TO3A 4F2TA 3UY8A 4CQAA 5LNUA 3ZJ6A 3USZA 1DIOA 1GONA 1FWSA 2NW0A 2IUZA 1OABA 4GVIA 4UQDA 1Z44A 4Z08A 4XUYA 1JYVA 1QHOA 3NQCA 1TV2A 3PJTA 4MKVA 2YYUA 3CL8A 1BQCA 1SSGA 3WDHA 4JN8A 1HVQA 1TJ0A 4UNLA 1I0DA 2WMGA 1WKEA 1OX4B 4YTTA 1HL8A 4QX4A 3PS7A 1FHVA 4GY0A 3H70A 8TIMA 1NOWA 2P53A 2RFGA 1PHWA 3HG2A 1XD1A 3IIVA 3ZT7A 4A05A 1HQTA 2CXGA 3QTPA 4O4VA 4BKNA 3S83A 4KWUA 4L64A 4TTUA 1SMAA 5DMLA 4LAKA 4I9MA 5DCEA 3V18A 4V27A 1PS9A 3LYEA 3CK5A 4UTMA 4UZSA 3KRZA 4J3WA 3RXZA 3N15A 4QP0A 1CENA 3MDWA 1K9DA 3GX9A 1TSIA 5F2LA 3OBAA 4GPNA 1OCNA 1U5HA 4GVGA 4KGJA 3PB2A 4W7WA 4UTKA 3B9EA 3C0JA 1ENUA 1RD5A 3QPEA 1EO7A 1PEZA 4PTMA 2FJUB 4UIOA 1OFBA