3NNTA

Crystal structure of k170m mutant of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in non-covalent complex with dehydroquinate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
YFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nntA00
4Z1DA 3IGUA 3E12A 3F03K 1EP3A 4BWLC 3RMJA 2QCFA 3W6YA 3C2FA 4HSNA 1KA9F 3NQ2A 3EXTA 1C8VA 3L0NA 1LDCA 1TPFA 1GJPA 2H6RA 4UFHA 3EWZA 4AB4A 4BI7A 5AB3A 1DJNA 2VFDA 4O10A 4OV4A 4FF7A 5HR6A 3L2IA 3KHJA 1YADA 5HNRA 1R46A 1I2NA 2E5CA 3F4NA 3PUDA 3HB9A 1OYAA 2G5WA 1K03A 4L4MA 2A6LA 1KTBA 3R5EA 4X2RA 2QR6A 5KMYA 1NEYA 2OX1A 4N02A 1KW1A 3FEMA 4GUGA 4K6AA 2TMDA 1P1XA 2V2DA 2VENA 5K2ZA 3MMTA 2V2CA 5FEPA 3NQVA 2V30A 2QCLA 1F73A 4JEQA 3SSJA 3CTLA 1UB3A 2C14A 3FLUA 3BARA 1O5KA 5I3HA 2QKFA 4IX2A 1IIGA 4KWWA 1F2JA 3DFTA 2ZZ3A 1UUOA 1MEWA 4M6PA 3W75A 4ZQNA 1ZENA 4LC8A 2PRHA 5EBUA 4UMAA 4IMFA 1XBYA 5LZLA 1DVJA 2GJNA 3MYPA 5HQEA 5CPLA 1A5AA 1YYAA 3LB0A 4QSHA 1R2RA 3G1SA 3EB2A 1HO1A 4QISA 5D37A 2CZEA 1JCNA 1W3NA 3UNDA 2J27A 3SFKA 1Z42A 1KM3A 4LWWA 1TRDA 2TYSA 4LRSA 1TQXA 1TYGA 4P61A 4O12A 1HL2A 1KM4A 3DBPA 3SGUA 2DZUA 1WAUA 3PB0A 2HTMA 2JGQA 3STCA 1W8SA 5D33A 3HPSA 4JDYA 5D2YA 5AOUA 3W7NA 3UY7A 4LVAA 4AHOA 4O17A 2Z1BA 1LOSA 2TPSA 1A5CA 1K7EA 5AYYA 3TH6A 1TB3A 3LHZA 5LGXA 2V0TA 2VEMA 1QDSA 2H3BA 2G96A 3C2RA 4R7JA 3M44A 4N6EA 1BKSA 1LBLA 5F4XA 4S2BA 4DBEA 3G0UA 4MY1A 2JK2A 5F2LA 2Y88A 2YW4A 3B06A 3UWYA 3W84A 3TA6A 3LTSA 2ZRVA 2J6XA 4R33A 4A3UA 1L9WA 1GPWA 2PRMA 1XXXA 1ZNNA 4CCDA 1H1YA 2YSWA 3O1NA 4DO4A 4AAJA 4UTKA 3CWOX 3O16A 1VC4A 2A7PA 2XN0A 2QF7A 3L67A 3PG9A 3T7VA 3W2LA 4DQWA 1W5PA 3MUXA 3U6WA 3UYCA 1L6SA 4P2VA 1OX6A 3HOJA 1Z48A 5CSRA 4JYEA 1SR9A 1F7BA 1F74A 5TIMA 3IIZA 4H3DA 2ZZ7A 3G1DA 3R8RA 1OF6A 3TSDA 3G1FA 3PWAA 3NPWA 1DORA 3QC3A 3PSWA 2WNZA 5LKYA 4LVFA 1VYRA 1SW7A 3NPVA 3T40A 3USBA 3EXSA 1R2TA 1EWDA 3GIYA 4DO6A 2Z2UA 4NJKA 1TJRA 1GG0A 4QM1A 5FF2A 3OA3A 3P74A 1MZHA 1O5XA 2I9EA 3W7IA 1JVNA 3QQ1A 3KVKA 1TPB1 3QJAA 1H62A 1TJPA 1VYPX 4K37A 1GVSA 3WJSA 5KZMA 3EX6A 2O7QA 3W7EA 5DLCA 2TRSA 1RR2A 4FO4A 1OYCA 1EWEA 4E2DA 1ADOA 2NV2A 3LCIA 4HPJA 2A85A 4LC6A 2FB2A 3FFSA 4XUGA 5CPOA 2J9XA 5HWMA 3PVFA 3UXDA 5I3GA 4YCOA 1ME7A 4I7UA 3TCEA 3TQKA 3W7RA 4JTIA 4Y96A 1EA0A 3UXAA 4PCFA 3L9CA 1Q6RA 1K7XA 4GUFA 4HKPA 4QNEA 2QCDA 3LHVA 4S2CA 3GLCA 1O95A 4O1AA 1TMHA 5D03A 4G1KA 4JX5A 4JTEA 3GXPA 4ZQRA 4UNLA 2ZA1A 3S5YA 1GVRA 4NXSA 2BSLA 3ZR4A 5E1QA 1ICQA 1FDJA 1TO3A 1JCJA 3TNOA 1VR6A 3W7GA 1K3UA 4LY8A 3MP3A 3E49A 1KTCA 4ZZ9A 1W56A 4UTTA 1D9EA 3O05A 1JJKA 5BMWA 3C2VA 1TPWA 3OHIA 2V5LA 3RU6A 5D2VA 4NUWA 4WZHA 1QPQA 3TJLA 3ELFA 3L68A 2UV8G 4MJZA 2R91A 5FEWA 3B4UA 4M7TA 1VHCA 1C9DA 2OZ0A 3P81A 3P5ZA 2CW6A 3LI0A 4O4WA 3NOEA 1VZWA 1WBHA 1OFBA 1YTDA 1XFBA 2G97A 5HUOA 4K7YA 1SQ7A 5F2MA 3A5FA 3CC1A 3GXNA 3NQDA 1H50A 4UFJA 2LLEA 4OWGA 3GR8A 1LRTA 2ALDA 3T44A 3G1YA 1GYLA 2BWGA 4ZQCA 3G8RA 3QFEA 5H91A 4C1KA 5AHNA 1T8XA 1GOXA 1W5QA 4NT0A 2J9YA 3W86A 2B0MA 4XKYB 1LZOA 5FESA 4O18A 2V9DA 2W79A 4YLWA 3THAA 1VCGA 5D09A 1LBFA 2NUXA 4A21A 5G4WA 4PC8A 3AJXA 5A8GA 4QAIA 4RK8A 4MZ8A 4WJEA 4FX7A 2VELA 2BZNA 1EUNA 4RZ4A 4NXKA 5CZTA 3WK3A 1KFKA 1PV8A 1JUBA 4PA8A 3S5ZA 5KTLA 1ME8A 3C3NA 1JR1A 4DF2A 1JUEA 2Y7EA 3LX9A 3TMLA 5D38A 1XBXA 1TPC1 2DORA 3NAVA 1UASA 3NPUA 3TQVA 1G6CA 1OX4A 2WKJA 3MHFA 4UR8A 4JTUA 2DZVA 5J5DA 3W23A 2CLHA 1WQ5A 4A2SA 4N9EA 4OHQA 1LBMA 1H7RA 4ALDA 3YPIA 1K7FA 1G4PA 2QCEA 1GG1A 3FKKA 5F4WA 2NX9A 3MBDA 3IGSA 3UWUA 1H51A 5DCBA 4Z1BA 3S1WA 1CI1A 5HMSA 3NQCA 1PHQA 2XFWA 4K7VA 2X1SA 1XC4A 5G1YA 1I45A 2VEIA 4YWIA 1EPXA 4OQVA 2CLMA 3GKAA 1SZEA 5EMUA 4PEKA 1K02A 2Y7FA 5T26A 3TSBA 5EPDA 2E68A 3L0GA 3TK7A 1I8JA 2OT1A 1QR7A 1YTEA 4K36A 4NQ1A 5D04C 2WSQA 3PUOA 4M6VA 1MXSA 1YXCA 3TXZA 4O57A 3KOFA 1RQEA 1QNVA 1VGAA 5BW6A 1FXQA 4UTTC 4JNMA 4BFAA 1IGSA 1X6UA 4LVGA 3S1VA 1J5TA 3LV5A 4FNSA 2E1DA 3NL6A 3UQNA 3EX4A 4MOZA 2CLEA 4FXSA 4Z0SA 1UJPA 3DKLA 2QCMA 1QCWA 3FJLA 1T0OA 2WJZA 5CSSA 3WJXA 3L5AA 1GVOA 4QJ1A 3W7PA 1V7YA 4DO5A 2YCEA 4DF0A 3NQFA 1EUAA 1RQHA 1F6KA 2WQPA 1Q45A 2C6QA 4KFNA 4HSOA 4NU7A 2HMCA 3PAJA 4CQAA 3FJ6A 3CHVA 1B57A 4EF8A 5FF3A 1GZGA 4NVTA 3ZWTA 4GUIA 4YXGA 3OVPA 4A2RA 4XTDA 1YPIA 4HNUA 1G4EA 1S3HA 5LSMA 1KM1A 3B0VC 3TFCA 3PY2A 1Z44A 5IBXA 5CZSA 3BK0A 1P4CA 3N19B 1FCQA 4UTJA 1A50A 1A53A 2H3DA 2O7SA 3EEGA 4AMAA 3NDOA 3OG3A 3V75A 3TW7A 3OEXA 1R2SA 4UTWA 2DZXA 4QNWA 3LI1A 3K30A 4JIQA 2ZYFA 5LHEA 4BF9A 1D3GA 3F1QA 2PCQA 4UFIA 4O11A 5AHLA 3Q94A 5SWUA 3ABQA 4EWND 4GWEA 1F5ZA 1GEQA 4LV9A 1ZY9A 5LNWA 1W54A 1DQXA 3DHDA 1XI3A 3NQMA 4D2JA 4FNTA 1O94A 4OT7A 3G1AA 3STGA 1OJXA 1H7XA 2R94A 1P0KA 5L6UA 3BPWA 1JRBA 3MBFA 1EP1A 2NXGA 3S1XA 1G67A 1F76A 2YFNA 1G4TA 4WY0F 4JTGA 3RLUA 1SSGA 1OK4A 1OFPA 1SZFA 1SO3A 4RZ5A 4JIPA 2DU2A 3FOKA 2RFGA 5EY5A 1DL3A 3E96A 2GJLA 4X9SA 4GFSA 3L0KA 3PBWA 4O4VA 1H7NA 5KZEA 5LNUA 4XZ9A 2JBMA 5BMXA 2Z0IA 4KFOA 3IRDA 1TTIA 3W1MA 3WK0A 3LCWA 5TQLA 3W07A 1ICPA 5AC7A 3W7OA 3M1ZA 4O1DA 1JRCA 1TREA 4KFPA 3BLIA 2A0NA 4N9BA 1FWTA 2GQ8A 4AHPA 1ZJIA 1H63A 1OFRA 2Q3RA 4ZVJA 3ZFHA 2ZA2A 4CCEA 4Y9AA 4FEZA 2FIQA 1FUYA 4JYDA 3TMQA 2B7PA 2ZTJA 4CCCA 3HJZA 4WXYA 3LRMA 5U7SA 3TX9A 2A2IA 1FCVA 3G8EA 3GK0A 1HTIA 1LOQA 1JQVA 3IIVA 5K9DA 1A5BA 1KM5A 2NWRA 3EX3A 1UBSA 2Q3OA 2YZRA 3DHFA 4NJJA 2YYTA 1OG0A 2OCZA 5HULA 5HJLA 4NJHA 1BEUA 3GZ3A 3M16A 3R12A 1Q3NA 3PBVA 4Y8FA 4NJGA 2NUYA 2Y61A 4DELA 1AG1O 4C1LA 3P8IA 3DFQA 5IBXC 2V2HA 3C56A 3SJ3A 3STEA 5C2XA 3LXAA 1P5BA 3FA5A 4LUIA 3N9RA 3WK2A 2NX1A 3W1NA 4Q33A 2GVLA 3GDMA 3OIXA 4UTWC 3LV6A 2DJLA 3QYQA 4O54A 1LLZA 1G4SA 4M6QA 4BI5A 4HNTA 1I2QA 5DY3A 3N2XA 3PS7A 1GYNA 2E5DA 3LCFA 1XUUA 1S5TA 1GVFA 3IIXA 3CM4A 5G2WA 2Y6ZA 4UFLA 3TKFA 3M9YA 4LW7A 4PFMA 1TTJA 4R53A 4JTKA 4IMGA 3GDKA 4JTTA 3LTYA 5K4ZA 4O19A 1H61A 1DOSA 1YXYA 4RR4A 3T78A 1YLVA 2YYUA 2CLOA 4OE7A 4I9AA 1I4NA 4JTHA 1I2OA 2EKCA 3W9ZA 1ZALA 2BLEA 4LTSA 1RD5A 1TTPA 4IOTA 1HG3A 4KKXA 1K8XA 1ZAJA 4UTLA 5G1TA 1RPXA 3LLFA 4PTNA 3GDRA 1OFEA 4MFEA 1A5SA 3CWNA 3LRLA 3LHYA 1AK5A 1YPFA 4RKAA 3FYOA 3W76A 3KRUA 4JTFA 5AN7A 2A7RA 3PC0A 3RK8A 3PM6A 3R2GA 4H4IA 2YPIA 3CU2A 4PH6A 1T96A 3OVRA 4O0ZA 3G22A 2YR1A 4TMCA 3DAQA 4IXXA 3T4CA 3TC6A 4AWSA 3I6RA 3KX6A 5D2WA 3S1UA 3EKLA 1D3HA 1NVMA 2NXHA 4AF0A 4ADSA 3P8JA 3A5VA 4IPIA 3Q58A 2ZA3A 1FWNA 2WO5A 1W3TA 3WFAA 3NM3A 3FIGA 2ZZ6A 4RXGA 1XDMA 1LRNA 1NSJA 3C4UA 4Z0JA 5CPNA 1JCYA 3PBUA 4WD0A 4WY0B 4GNJA 5KINA 2CU0A 4O52A 3LXBA 3W1PA 5I3JA 2FJKA 1YDOA 2XN2A 1H5YA 3QSRA 2H90A 1BTMA 2Y89A 3DENA 4GUHA 4LV4A 4CNOA 2Q8ZA 3RLVA 1KFLA 2E6AA 4X3ZA 1VH7A 2DZWA 1KM6A 3DI0A 4FX6M 4IX0A 5I3IA 3T55A 3W7JA 5FF0A 5F2GA 3W7HA 3VFLA 1BWKA 1QWGA 3GVGA 5C54A 3H54A 3L66A 5F1UA 4IMEA 5GVJA 1DJQA 4TMBA 4EIVA 3P84A 4HN4A 5E0KA 2X1RA 2BXVA 1E51A 5TBOA 3HF3A 4PL1A 4U4MA 3VE9A 4LS2A 1X1ZA 2C18A 5DY2A 1QAPA 1OVDA 2Q8LA 2OMAA 4KWVA 3HMJG 1SU5A 2V81A 4MVAA 4MKNA 2V8ZA 3BGGA 5IM51 4HHPA 1XKYA 1TV8A 2BX7A 2QCGA 5D2TA 4ADTA 2EGZA 4EF9A 4UFMA 3E0IA 3LDVA 2E6FA 4MY9A 2PC4A 1DBTA 3FKRA 3LCGA 3G1HA 4HPXA 2YX0A 5AC6A 3MHUA 5U4NA 4QQ3A 5HINA 2FLIA 5DBTA 4MYAA 1PE1A 2QUTA 1R30A 5C5YA 2ZRYA 1IXOA 4NZFA 1I2PA 5AHIA 3CT7A 4N9CA 1VHNA 3A9IA 2NWSA 1DQWA 2Y62A 4MIMA 2RH9A 3TV8A 5AHEA 3W85A 4ML9A 5L9FA 1QPOA 3WJZA 2C16A 5ABTA 3NQ8A 3NM1A 2ABAA 3LHWA 3BVJA 1AW2A 1K8YA 3QMTA 5K3VA 5DXXA 1C29A 3A23A 3MO7A 4LOCA 2Z6JA 4RLIA 3IVUA 4RXFA 3DFOA 4M19A 4QITA 1L2UA 2ZRXA 5K7JA 3QW4B 4JGDA 5K4XA 3THQA 1YXDA 4Q4KA 2CLIA 3HGSA 2ZRZA 4MY8A 1W5NA 4I7WA 4NZJA 2RDTA 3GNNA 5DELA 5FF4A 3QMRA 2HSAA 1L6YA 4N9DA 3W1TA 3Q2DA 3W22A 3S6DA 2E5BA 3W7CA 2ZFAA 1KFEA 3P82A 2E6YA 3LOTA 3QQ0A 3SI9A 3IIOA 3N34A 3BGJA 3P7YA 4JY8A 2AAMA 4A22A 4MFDA 4FIQA 3GAKA 4DBDA 4HIBA 4GE8A 3W1UA 1FWRA 3NO5A 4H6KA 2VFFA 2CFFA 4UTHA 5F4SA 4RX0A 3QEZA 2A6NA 1VJIA 1HO4A 4AEOA 3DFNA 3G1VA 5G5IA 3B04A 1EB3A 2A5HA 4CQ9A 5CZJA 1H7OA 1DHPA 2WSRA 1FDZA 5D30A 3U2OA 4OU1A 3KRSA 1FXPA 4OBTA 3DU0A 3TAOA 1XL9A 3HG2A 2FPTA 4MLJA 1QPRA 3W74A 3UZJA 1KFJA 2FPYA 1ALDA 1VCVA 3EWXA 1B4EA 3A21A 1OK6A 5I3FA 1KV5A 3G3DA 1G7UA 3R13A 3B8DA 1M7OA 3UD6A 4XBSA 3QF0A 2ZRUA 4XBKA 4ZQOA 4LS0A 1TPUA 4JX4A 3TE9A 4YCPA 1IXNA 1CW2A 3HQ1A 3DFPA 4LNYA 4MZ1A 5DBUA 3G1XA 3UWVA 3SR7A 4LU0A 5EKYA 2WNQA 3EWWA 3LBMA 3IVSA 3KVMA 1IIHA 1JULA 3CIXA 3BW3A 3W2JA 3CEPA 4LVBA 3MI2A 3VCRA 5D02A 4TU1A 3M6YA 1AW1A 3GKFA 1WYIA 2FB3A 3ZS4A 3N14A 1K8ZA 5AYXA 3GXTA 1B9BA 5AHFA 3B0PA 2Y63A 4ORMA 2VFHA 1HFBA 1S5WA 3LRKA 2C3ZA 2Y70A 2GUUA 3LCLA 3G18A 4E0CA 1VS1A 3QH2A 5AYZA 4UTMA 3LCXA 2YDAA 3G0XA 4ZQPA 2DZPA 2Y7GA 1XUZA 3PR2A 4M7SA 1ZCOA 5I3KA 4CNPA 4FNPA 4A29A 1TPDA 1WDWA 3LHUA 3B03A 1SSDA 5KITA 4XTIA 1PIIA 2W0UA 3MW7A 3VKJA 2ZZ4A 3M0ZA 1GTEA 3W7KA 1Q6QA 4ZL1A 2JKPA 3LTPA 4JR5A 5CGQA 3W3OA 3TXVA 4POCA 1AMKA 3ATYA 1EP2A 3NA8A 4ICNA 3DKJA 2I14A 2ZRWA 5FEZA 6TIMA 2NLIA 2QEZA 4B5NA 1VQTA 3NPXA 4O1CA 4UFKA 3NQ7A 5LGZA 1XDLA 1ME9A 4PODA 2RKXA 1FY6A 3NQEA 4M5PA 5J5RA 2JKEA 2GPTA 4JTJA 4FB7A 2X1TA 1LM1A 4WOZA 4PL2A 5FI8A 1NF0A 2VFEA 3KAOA 1O60A 2CLKA 5DXYA 5EYWA 4TIMA 3UWZA 1FCUA 3S42A 3GDLA 3MP4A 5E93A 1TTQA 1SFLA 2E77A 1H7WA 3ANYA 5CPMA 2W6RA 3HG5A 1TV7A 4AHQA 3NGJA 1GQNA 3VE7A 2OT0A 3L5LA 4K8HA 3TC7A 1OHLA 3AO0A 4N4PA 4ZQMA 4UTIA 1WOAA 1OFOA 4EVZA 3G24A 5KSWA 3PG8A 3RFAA 1JCLA 3W1LA 2J88A 4MYXA 2J24A 1U5JA 3C2OA 3OVQA 1LYXA 4X22A 1KFBA 4TX9A 3C61A 3TJXA 5BRBA 4IWWA 4O28A 5K9XA 1F05A 3EXRA 3QW3A 3GR7A 3M5VA 5F1VA 2NV1A 2YW3A 2FPVA 4XKYA 3W72A 3DXIA 1Q6OA 4JTSA 1SO6A 1YTKA 2QUUA 1PVNA 3MJYA 2ZZ5A 5H2ZA 2QAPA 1P0NA 2B7OA 3N73A 2GQAA 2H8XA 1WV2A 1QOQA 2F7FA 3W7QA 4NX0A 2C19A 3LERA 4IGHA 3LCHA 2DJXA 1QPNA 3O15A 4LS1A 1H7PA 2TSYA 3W1QA 4NNBA 3TQ0A 3L65A 4N6FA 2ZQ0A 4S1FA 3W7LA 3MP5A 3GB6A 1SZGA 1OABA 1XM3A 5CG7A 8TIMA 2QCDB 4MZYA 1RZMA 2G95A 4N4QA 4UTUA 4JS3A 1B3OA 3EX1A 2B4GA 3IV3A 3WK1A 2Y85A 3GX9A 5A5WA 2B7NA 4IUOA 1SW0A 2OJPA 4IXHA 3S5NA 5FF7A 3R89A 3W2UA 3C8FA 1FWSA 3DFSA 1U83A 3NEVA 4NNAA 3TAKA 3MWAA 2QUVA 1J2WA 1QO2A 1W0MA 3M5YA 1DV7A 4FNUA 1W31A 1I2RA 1OX5A 5HR7A 4AH7A 2VKZG 3QM3A 2YGYA 1OYBA 1FCBA 4IPJA 3SGZA 1TV5A 4FNRA 3NZRA 1PS9A 4O14A 4O53A 4CQ8A 4JICA 3LLDA 1EEPA 3DGRA 5DN1A 4Y90A 2CZ5A 3CQ0A 4AXKA 4GJ1A 3KVLA 4ZMGA 3EWYA 5LNVA 3BW4A 3TROA 4DPQA 3L5MA 3F4WA 2FFCA 2WSYA 2ISVA 3B05A 1Q6LA 2NZLA 3WJYA 4YMZA 2KZHA 1AL8A 1R47A 1TPH1 4E38A 2QJHA 3BG5A 3KXQA 1PCKA 3M41A 1ML1A 4FXRA 2ZBTA 3QPYA 2RDUA 5HWJA 3SZ8A 2A21A 3W2KA 4FHAA 1M7PA 1KM2A 1THFD 3RNDA 3P62A 1WA3A 1IF2A 4WX2A 3H55A 5CKSA 2R14A 3ATZA 1S5VA 3NXFA 1ZFJA 1KFCA 1TIMA 4RCXA 5BNKA 1TSIA 2DZTA 2A7NA 1OX4B 3NL2A 3P67A 3BW2A 1TCDA 2R8WA 4ORIA 3ABOA 5DCDA 3SY5A 4MPQA 3LXCA 4DXVA 2VC6A 4OV9A 1W5MA 2EF9A 3S8HA 3WJWA 3NQ6A 3MI6A 2GQ9A 5G4EA 1GVQA 4I7VA 1H1ZA 4GC4A 1KBJA 2VFIA 2GVGA 2JGYA 3G3MA 3CB8A 1OFQA 2I1OA 4IQLA 5K9CA 3QZEA 2V5BA 1ZAIA 1FWWA 3KVJA 3HG4A 5D2XA 1QO5A 1X1OA 2QDGA 4O15A 1SW3A 3S0CA 2CLFA 4BR1A 4UNKA 3I68A 1GT8A 1KM0A 4CNNA 1TPVA 1VCFA 1FBAA 2P0OA 4Q32A 3TUUA 3W83A 3NYZA 5C55A 4AWTA 1JUKA 2BTMA 3HGOA 1LCOA 2VEPA 1YDVA 4UCGA 2QJGA 2E6DA 3HIJA 2JKAA 3VNDA 3VI2A 2PURA 4GBUA 2WPBA 3KFTA 3W71A 1OF8A 4J9JA 2PE4A 2CZDA 4MUZA 3UZ5A 3JS3A 4JN6A 4U28A 3N2MA 2ISWA 4RJEA 4K38A 2FDSA 4XWUA 2ZCGA 3HGJA 3PUEA 3GAYA 1LORA 3GYEA 3UWQA 2V82A 2NX3A 1HUVA 3UPBA 2ABBA 1RVGA 1KV8A 1WOBA 4OGZA 4JTLA 1XCFA 4DPPA 3JR2A 2WV8A 2A4AA 4RZ6A 1X7FA 2PRLA 3LM7A 4GXMA 4LUJA 4UMCA 1WXJA 5G2IA 2CWNA 3EX2A 5HUPA 1LROA 4LT9A 1MSSA 4JDBA 3LHTA 4W9TA 5DCEA 3STFA 2HS6A 4AWUA 2CLLA 3GNDA 3ABRA 3NQAA 4O50A 3C2EA 5AHMA 1IXPA 3MHGA 3TIMA 4FX8A 1UCWA 2ATSA 5HWNA 3CPRA 3W2NA 4UUIA 1NFBA 3W1RA 4NNCA 4CLMA 1G69A 3O6CA 1NAL1 2QCHA 3C52A 3PSVA 4O0KA 4IMCA 3PBYA 3O6DA 3FYPA 1GTHA 1KBIA 4R34A 1VLWA 3N9SA 2XN1A 2X16A 2X1UA 4WUIA 5BOOA 3IGXA 1WBJA 4O1BA 1QOPA 1NF7A 2NUWA 3BG3A 3INPA 3I7RA 1W5OA 1W3IA 1N8FA 1TQJA 1FDYA 4JYFA 2DZSA 3I65A 4O13A 1LTDA 2VEKA 2H8ZA 2WOQA 3M5ZA 4QIUA 4UIOA 2C13A 2QJIA 1PHWA 3QSTA 3O8AA 3BG9A 1N55A 1KTNA 3NZ1A 1T99A 4HNVA 3MI3A 1DKWA 2VFGA 2FQIA 3E02A 4L4LA 4TO8A 5LNRA 1B4KA 4DF1A 1Z41A 3RF9A 1XBZA 3NG3A 3IEBA 4GRSA 1V5XA 2QCCA 1TPEA 2P10A 4LRTA 4NJIA 5EA9A 1J4EA 5EL1A 4K8EA 3CLMA 4DEFA 3HGRA 2WNNA 3HG3A 3IVTA 3A24A 6ALDA 3I7QA 2J9ZA 3M7WA 3PB2A 3OBKA 1FQ0A 2GVJA 4MLRA 3W73A 3W88A 5FEXA 1BWLA 1X8FA 4Y6GA 2ZTKA 1JCXA 4TR9A 2EAWA 3TFXA 2CZFA 3W7DA 1SO4A 5D05A 4JD4A 3P80A 3U8GA 1L6WA 1ONRA 3EWBX 4GUJA 1PCWA 1LRQA 4WQ6A 3W1XA 3O06A 2ZZ2A 3S9YA 2X2GA 3O6YX 1LOLA 3QPZA 3ZWSA 1AL7A 2Y7DA 1SFJA 4JX6A 3H53A 1LP6A 2C15A 3W1AA 4AVFA 3NQGA 1MEIA 3JRKA 3P60A 1M5WA 4IJBA 4WY0A 3UPWA 3Q37A 2E09A 4BWLA 3GDTA 5AFDA 4JXCA 1SO5A 1W1ZA 5D32A 2GOUA 4O8RA 4UC5A 1N7KA 3M43A 3M47A 1GWJA 3EKZA 3HO8A 3DI1A 1VYSX 3W87A 2VOMA 4HT3A 2QDHA 1PL9A 4BK9A 3TW6A 4LVDA 4BI6A 2ISSA 3B0UX 3DZ1A 1JCMP 1G7VA 3TR2A 2P1FA 4NX5A 1LLWA 2DP3A 3P5YA 1AW5A 1VPXA 3O63A 4YL2A 4EOUA 3QMSA 1Y0EA 3PULA 2X30A 4WOQA 2QCNA 1ZAHA 3C6CA 2C0AA 4XQ6A 5CZ0A 3TSMA 3HPXA 5F2IA 1F6PA 3PF3A 2RHGA 3CIWA 4ADUA 1O4UA 2YXGA 3SIZA 3S5OA 3D0CA 3NVTA 3BLFA 3W70A 3BLEA 3E9AA 1EIXA 3ABSA 1EX5A 2RDWA 2FTPA 2VXNA 1MEHA 1SUXA 3MYOA 1YDNA 7TIMA 3NR0A 1ZHAA 2NXIA 5MHBA 2QAFA 2YFOA 4UXDA 1KLZA 2Z6IA 1SPQA 3SW6A 3W2MA 4Z1AA 1W37A 3BV4A 4WXZA 1IXQA 2IQTA 2C1HA 4Z1CA 4FNQA 1VLIA 3TU9A 2A1YA 4MJMA 1FX6A 3NNTA 1XBVA 5LNSA 4E2BA 1QMLA 3V1PA 5KZDA 3UY8A 2ZZ1A 3N3MA 2EPHA 1OFAA 3LGEA 1JQXA 1M6JA 4AF0B 3A22A 3W7MA 2ZDRA 5C6MA 3UWWA 3L21A 3HBLA 1RV8A 3CEUA 3SECA 4UR7A 3M5XA 1QFEA 3C0JA 3HPZA 5AC8A 3FS2A 3NL3A 4JY9A 4IMDA 4ONVA 3P61A 2D73A 4O16A 3KRZA 4N2YA 3BO9A 4FIRA 3EWUA 3DH7A 1KLYA 1UUMA 4HNNA 4UMBA 5G2HA 3TDFA 2F84A 1MO0A 2B7QA 1ICSA 4Z08A 2EHHA 4RV8A 2ATMA 3NL5A 1CX9A 1VRDA 5LHFA 1SZNA 3O07A 1H60A 1RQBA 2HS8A 4K39A 2AGKA 2AQWA 3LBCA 1WX0A 3IIPA 1TRIA 3G0SA 1OFDA 3QRHA 3I7SA
chains in the Genus database with same CATH superfamily
1BRLA 2VDIA 1TJ2A 4ZO9A 1F4HA 1RLCL 3OHMB 3U3HA 3SCUA 1PKLA 1EP3A 4RDZA 4YN5A 4JNYA 3RMJA 2WZMA 3C2FA 4MNLA 1KA9F 5KEZA 1LDCA 4UFHA 1DJNA 1QNOA 2Z1SA 3B8WA 1M03A 1VFLA 1JNEA 1BSLA 3L2IA 2JQXA 5CAKA 5HNRA 1WB0A 1I2NA 2E5CA 4ICMA 2OPJA 5A95A 3HB9A 1EHAA 3SJNA 4X2RA 1V6UA 2QR6A 2PWDA 4F9DA 3UG3A 2OX1A 1KW1A 4JHMA 4PB5A 1SJBA 3MMTA 4XVDA 4D9PA 4Q6XA 4TV6A 3R11A 5A6JA 5CCZA 2V30A 3G5EA 2WLZA 4QG9A 1NDWA 4V27A 3CTLA 3FLUA 4MHBA 5I3HA 4IX2A 1F2JA 3DFTA 4XAPA 1UUOA 1CGYA 3VIKA 1KR1A 1WUFA 4O8AA 1RSCA 1X98A 4MB5A 4DX3A 3EB4A 4IMFA 1XBYA 5LZLA 2G37A 1W1B1 2YOCA 1A5AA 1YYAA 4CEUC 4QSHA 4RL3A 3G1SA 4XZWA 4MB4A 2OTDA 1JCNA 3UNDA 3TTQA 4DZIA 3XIMA 1Z42A 1TRDA 2TYSA 3FVDA 1TQXA 4UB9A 3C5QA 4O12A 2QS8A 2P3EA 1HL2A 2ZX5A 2C1IA 1KM4A 3U2ZA 4IHCA 3WD4A 1QK2A 3DESA 5DFAA 3M0VA 2ZXAA 2ZUUA 2IKJA 3UY7A 4AHOA 3QTPA 4QJ4B 1A5CA 4WR3A 5BXTA 5AYYA 3TH6A 1TB3A 1GK8A 5LGXA 9XIAA 1V4YA 2V0TA 2G3NA 2VEMA 5GJNA 1TJ1A 3V5FA 1LBLA 2A3EA 1ITUA 1S5MA 1LWHA 4MY1A 3HURA 3RHGA 1VKFA 3TA6A 3LTSA 4KEUA 1BF6A 1ZP3A 3I3EA 4A3UA 1XXXA 3DDMA 1H1YA 8XIAA 3SUVA 3ZJ7A 3TYZA 4C65A 1VC4A 2BOEX 3SBFA 4PR4A 4IG2B 1W5PA 3MUXA 3U6WA 1FHDA 4S3FA 5CSUA 4NKCA 4QTGA 5TIMA 3UNTA 1UKSA 1UR0A 4UQ9A 2ZZ7A 3R8RA 1DORA 1X39A 2R24A 3PSWA 1FH8A 4LVFA 1VYRA 1D7FA 4XK2A 5MKGB 3EXSA 4IIHA 1KCLA 1EWDA 1H2JA 3QLLA 2J7EA 3GIYA 3H24A 4DO6A 2Z2UA 4KEVA 3CHEA 1TJRA 1GG0A 4QM1A 3OA3A 3P74A 1GVYA 1O5XA 2I9EA 3W7IA 2HE8A 3KVKA 1H62A 4F2UA 3MUZ1 4UR9A 1FFQA 1GVSA 1YEYA 3IUIA 3CPUA 4Q8TA 4FO4A 4E2DA 2NV2A 1WE5A 2GGGA 3LCIA 4HPJA 2A85A 4M80A 2XIMA 3T8LA 3WENA 4YCOA 4N42A 2J7BA 3TCEA 3AXIA 5HAOA 4PCFA 1Y5XA 1K6WA 1GQLA 3M0LA 2QCDA 3LHVA 4DJFD 4NZCA 4QE1A 2HVMA 2PTWA 1ODUA 4UNLA 3QV6A 3S5YA 2JEQA 4NXSA 3KDNA 1MZRA 1AQ0A 1KRAC 1JCJA 1X8CA 3N3TA 4XSLA 3U7BA 4ACYA 1K3UA 4A8NA 4PMQA 2ZOXA 3FGCA 1W32A 4QJ3B 1PTAA 2REQA 1JAKA 1JJKA 3LN3A 3RU6A 2WPGA 3EA3A 2R6OA 1QPQA 3D3AA 1BYAA 1AZ2A 2OZ0A 5BXPA 3F2BA 5I07A 3AC0A 2XVKA 5IRPA 1VZWA 5CJNA 2R82A 5HUOA 1PEZA 2G97A 1SQ7A 2BXYA 2LLEA 3SQLA 4W8LA 1LRTA 2ALDA 3T44A 1J79A 2BWGA 4ZQCA 3G8RA 3UW6A 2QYGA 3UR5A 3ZXWA 1GOXA 2J9YA 1BXCA 4KIRA 2GSEA 4XKYB 3MUCA 1J6OA 5FESA 1Q8AA 1A80A 1UWUA 1TJ0A 3BH4A 4IQDA 5A8GA 3AJXA 4JFVA 4HA0A 4H04A 4MZ8A 2R1MA 4AY7A 4NAEB 2WCSA 3WNKA 2BZNA 5CZTA 4NXKA 4E2VA 4ZSUA 5LIXX 3H7RA 1V08A 1CGXA 1FKXA 2Y7EA 3F5KA 4QE5A 5D38A 4IT1A 3NSNA 1UJQA 4IIDA 3TQVA 9XIMA 1OX4A 2QV4A 4C6CA 4TTGA 2XWDA 3VZYA 3GXFA 3W23A 1J93A 4H8VA 4US6A 4TVUA 2X7WA 4KRUA 5JBDA 3JZUA 2QCEA 3FKKA 4WK9A 4XD3A 5DCBA 3VIMA 1UC4A 2NVCA 1A3XA 3HM7A 5CC7A 3IJ8A 1PIFA 1XC4A 1UMLA 2PWHA 4IF2A 1I45A 3ZYZA 1E4MM 3MUIA 5EMUA 4C7DA 3KW3A 1W1TA 3HN3A 5A94A 5E70A 3MO4A 4UQDA 5EPDA 2E68A 3L0GA 3TK7A 4W88A 3REQB 1YTEA 1EX1A 1EL3A 3HA1A 1YXCA 3EDEA 2AGTA 5LXEA 1XLMA 1RQEA 3UCDA 1BG9A 1AQFA 3S1VA 2OO0A 4A3QA 3VIPA 3AHXA 4JQ4A 4KESA 4Z0SA 1UJPA 2DVTA 2RUSA 4XZIA 1WKYA 2QCMA 1XR2A 3FJLA 5FJUA 1T0OA 3NO3A 4L65A 5CSSA 3WJXA 3L5AA 4QJ1A 1V7YA 4DF0A 4S3KA 1RQHA 2HMCA 2XIQA 4AZGA 1NWSA 3M0HA 5FF3A 3ZWTA 4GUIA 3S2LA 4MAVA 4YJ5A 4NILA 1C7TA 4YXGA 3OVPA 1E6SM 1V6YA 1G4EA 2PAJA 3B0VC 4RW5A 3PY2A 1ZUAX 5IBXA 5A8MA 4LYKA 1A53A 4GYKA 2XGZA 4MKSA 3CUZA 3V75A 4DWDA 1R2SA 4REQB 4RNJA 4UTWA 7ODCA 2WANA 4QNWA 2MUCA 2G0WA 4OBSA 3LI1A 3K30A 2ZYFA 3WLOA 4BF9A 5AHLA 4H9YA 1F5ZA 1ZY9A 5LNWA 1DQXA 3WLSA 3NQMA 4HZ8A 2GWNA 4D2JA 4W84A 4J3UA 3NCOA 2IS7A 1OJXA 2D2JA 2NXGA 2YFNA 1PZ2A 1LG1A 3W29A 4FLQA 1Z7AA 1OIFA 4RZ5A 3FOKA 3DYMA 5EY5A 4O4VA 3L4TA 5KZEA 2BODX 5BMXA 3EOLA 3MU7A 1W1YA 4U2YA 4LH8A 5JXQA 3W07A 4BS0A 3W7OA 4GABA 2J7GA 1JRCA 1TREA 3BLIA 2DIJA 1M7JA 1FWTA 2X05A 2WCAA 1JDAA 2O9OA 2UWFA 3AXKA 1VB9A 1SFTA 3MZ2A 3QY7A 2G3IA 5T91A 2PPGA 3QQWA 4JYDA 3A9BA 3GR4A 3UEQA 2Q6ZA 4LUTA 3LRMA 4MGGA 2V3FA 3TX9A 3GXIA 2DEPA 3P2VA 2EPOA 4HZ7A 3WDIA 3GK0A 4I90A 1JQVA 2CESA 1A5BA 1KM5A 1W3HA 2WZEA 2NWRA 3OTRA 3EX3A 2DT0A 2YZRA 4IFOA 3DC0A 3RO6A 3B97A 2ZX8A 1GJWA 4QDPA 4HNOA 1TV4A 1PTDA 1OG0A 5HULA 3BLDA 2EXOA 3M16A 3CH0A 3MB9A 5J8LA 3WBAA 2MANA 3PBVA 4V1YA 1XYZA 3ZLGA 3IJQA 3DFQA 5IBXC 3S1GA 3SJ3A 5C2XA 3LXAA 1ZTVA 1EYEA 2NX1A 3ZJ8A 4UTWC 1IE7C 2ZXBA 1M3UA 1LLZA 3CQKA 4M6QA 4HK6A 5RUBA 3S6TA 3AU6A 3AMCA 1GYNA 3GH4A 3R58A 2PWVA 3RMEA 4H8HA 1GVFA 3H2CA 3IIXA 5I02A 1A3HA 3ZT5A 4Z2KA 3M9YA 3W38A 1EBHA 4R53A 4GVFA 2IPJA 3SEPA 3GU9A 1TX0A 2P5NA 5K4ZA 1DYSA 3LUTA 3L4UA 4PTDA 1UIOA 3T78A 2VP8A 2YL8A 1F9CA 2YYUA 2CLOA 1RY8A 1W3JA 1QW7A 4RUBA 1Y5WA 4LTSA 1RD5A 4KKXA 3QOKA 3HQNA 3MKCA 1C8XA 2Z25A 1VPQA 3ANVA 4IJRA 3GDRA 2VGBA 3CWNA 2VD8A 3FYOA 5AN7A 2HQAA 1LQAA 2A7RA 2WXDM 1B0IA 3R2GA 4H4IA 3DCPA 2Y0FA 3H2AA 1T96A 1XPGA 4O0ZA 4YU1A 3CHDA 1J0IA 1ZBKA 1M65A 4TMCA 4J7RA 3DAQA 3T4CA 1J6PA 3U57A 1V0KA 2WYSA 3WBWA 1D3CA 1XD1A 1D3HA 1BYCA 1QNQA 3WH8A 2GJXA 1V3IA 4MADA 3M64A 2C8NA 4IPIA 1ISWA 1KKOA 2WO5A 1W3TA 3HFYA 3DIPA 2ZZ6A 1XDMA 2PDFA 1UP2A 2GOKA 3N13A 3C4UA 2PS2A 5CPNA 3PBUA 2CU0A 4UQAA 3W1PA 4C60A 1AH0A 2NVAA 5I3JA 1TA3B 2H90A 4A8IA 1BTMA 4DZ5A 4GUHA 4PCPA 2BP1A 4GQBA 2DZWA 1TG7A 3W7JA 1AH3A 2CWXA 3AI0A 4HZ6A 1PDZA 1BWKA 1QWGA 5F1UA 4B91A 3OBAA 1DJQA 4I8DA 3OZYA 4TMBA 5FKYA 3NQBA 1XYLA 4EIVA 3ONBA 5E0KA 1Q66A 1E51A 1F3XA 2VUYA 3VE9A 4LS2A 4HMCA 2PFHA 1UR4A 3BJSA 2O9PA 4AVOA 4WJ8A 1XRSA 1SU5A 3LPPA 3VNZA 4B9ZA 4F2TA 4MVAA 4AD2A 2V8ZA 2PD5A 4GKLA 2DSKA 1IZCA 1XCXA 1A5OC 4GYJA 1RBAA 4BQ2A 5IM51 3UA3A 1TV8A 2QCGA 4ADTA 3CAQA 3T81A 3OP2A 4JKKA 3UP8A 2YCLB 1KQYA 4ACZB 3MSRA 3QVQA 4HPXA 3KWSA 4NYUA 4QQ3A 5HINA 5DBTA 1E3XA 4CVWA 1XJBA 4PTWA 1PE1A 3VGHA 4AMCA 3P0WA 2QUTA 3BTNA 3PJWA 3H26A 1Y7VA 2ZRYA 3OO2A 4NZFA 5AHIA 2QJMA 2AMXA 3ARUA 2Y62A 2Z4GA 4MIMA 5AHEA 4ML9A 2C16A 3NQ8A 3T2PA 2ABAA 3LENA 1PIGA 3BVJA 3QMTA 5K3VA 3WLKX 1QI0A 3KM8A 2C7FA 5CGTA 4GNVA 1XYMA 1EBGA 2POTA 3THQA 3UJ2A 1YXDA 2CLIA 3GC4A 3PZ9A 3G6MA 1DTNA 1KXTA 4KWUA 3GNNA 2OVLA 3GUGA 2HSAA 1GKRA 4RW3A 1L6YA 2VD9A 4N9DA 3W1TA 3AHVA 2OKTA 1S2CA 3W22A 3W7CA 3KBVA 2VGGA 2E6YA 3WN6A 4FF5A 3BGJA 1PKMA 1BRLB 2DGAA 4JY8A 5BOEA 4V2XA 4H41A 4HIBA 4NHVA 4X63A 2VFFA 3N1AA 2HNEA 5F4SA 5EMYA 3SCTA 1EOMA 3UESA 2PF8A 4EWJA 4AEOA 3DFNA 3B04A 1EB3A 4CQ9A 3VA8A 2XZ9A 5EB8A 3AHTA 1FDZA 3GWQA 3VK5A 1XYFA 2PDHA 3TAOA 1OADA 1EJUC 4MLJA 3W74A 3UZJA 2H9AA 2IKGA 1ALDA 1VCVA 4NAFB 1KV5A 3G3DA 1XLEA 4FK9A 1TFVA 2QF8A 5A6LA 3PHAA 5EFDA 1XLKA 4XBSA 4GGBA 2ZRUA 4XBKA 3R94A 4H9VA 1TPUA 1ZZMA 4PMVA 4MZ1A 3OZPA 1Q7MA 3SR7A 4LU0A 4PYSA 5EKYA 3EWWA 5ENLA 3VM7A 3AISA 3IVSA 3KVMA 2PODA 1UBPC 3W2JA 3MI2A 2X09A 2OWWA 4JQAA 4DWSA 2EBNA 4YS1A 1AW1A 3ZS4A 4GIAA 4NZ1A 2Y4SA 4C6KA 1RH9A 1ADDA 3WKZA 2PDNA 1HFBA 4GY1A 4Q4SA 1QU4A 4FR6A 3GIQA 1DEDA 4ZOEA 3LCXA 1N8WA 2YDAA 2HROA 1HJSA 3R79A 1V7AA 1P43A 2OG9A 1MUMA 5FL0A 1OZQA 4CNPA 4A29A 3VXGA 5KITA 4XTIA 3VKJA 1ZS2A 1FHLA 3W7KA 2CITA 1DJGA 2XH7A 3PZVA 4DLMA 2OLHA 5A6AA 2ZRWA 2J4GA 1JD9A 2NLIA 2QEZA 4H19A 4CCZA 3CIVA 3PJUA 4O1CA 1FWFC 3UA4A 2NV9A 4PODA 4HJWA 3AFBA 4M5PA 3A3WA 2GPTA 4FB7A 2G4JA 1LL6A 1LM1A 4LCSA 3CB3A 1XISA 1ENUA 4XZBA 4G9PA 4C6DA 1YBQA 4ZGYA 3KAOA 1I75A 1UQZA 4TIMA 3OA5A 1FCUA 2X41A 4S3JA 3RRXA 3S42A 3MP4A 3S2JA 1OD8A 1H7WA 1XRVA 2V5DA 1Q7QA 3L4WA 1E40A 2DDXA 3L5LA 4WKFA 2VC7A 4K8HA 4UOQA 2EQDA 1MUWA 4A3HA 3FEQA 4ZQMA 4UTIA 3KUMA 3N11A 1Q85A 2AAAA 4EVZA 3CAWA 3KLKA 4S3EA 3W1LA 2J88A 4MYXA 4AC1X 3MA8A 1XYBA 4PMRA 3K2GA 1LYXA 3CO4A 3NTYA 1ECQA 1WXZA 4TX9A 1WZKA 2VX6A 4DWSC 4LYQA 3W02A 2NV1A 1XLGA 2YW3A 5T9CE 5A6BA 4LCRA 1Q6OA 2Z1VA 1H1NA 4JTSA 2QUUA 2NQLA 3VM5A 5IOBA 4Y9OA 1PVNA 3VCCA 3VX0A 3DFYA 1P0NA 3RXZA 5JVLA 3N73A 3TYUA 3LERA 3LS9A 2DJXA 2TSYA 3W1QA 2JEPA 4J27A 4N6FA 2ZQ0A 2ADAA 3W7LA 2PP1A 2ZIDA 3VGGA 1XM3A 5CG7A 3OLGA 2QCDB 3WFLA 4NI3A 4XAZA 3LQGA 3WBXA 4AQLA 1WKEA 4JS3A 4EK7A 2GK1A 5BYWA 3SN1A 2FZ8A 3EBVA 5A5WA 4IUOA 4ZXLA 1H11A 3AALA 4YTUA 4NNAA 3FGCB 1J2WA 1QO2A 1W0MA 2REQB 4KIEA 3M5YA 4FNUA 3PN8A 4KQNA 1DJIA 3GSMA 3QM3A 2YGYA 4DLFA 3S6OA 1DJZA 3G77A 3SGZA 1AQHA 4IL2A 4MKVA 2CZVA 3NZRA 4P8XA 2QIWA 3LLDA 1MQQA 4GQQA 4HCLA 3B9AA 2CZ5A 2HDJA 2FVMA 4JBRA 3B9NA 3KVLA 3VIOA 3WL0A 2P50A 1YIXA 3EWYA 3IV8A 3BW4A 2DPEA 1VFUA 4DPQA 4Z2GA 3F4WA 2CYGA 2ISVA 3B05A 3V3WA 3SUWA 3CUXA 5FJOA 2NZLA 3PZOA 3WJYA 3OYXA 1C9WA 4LUYA 3M07A 4KBXA 4YMZA 2KZHA 3A4AA 3B4YA 2F61A 2QJHA 3BG5A 3LD5A 2YDRA 2D0HA 2ACUA 1K9DA 1ML1A 3ITLA 2ZBTA 3QPYA 4DJDD 3MSDA 3SZ8A 1DTUA 4GH3A 3QGKC 1THFD 2WMIA 3BE7A 4WX2A 1MXGA 3R7MA 3AIQA 1QNRA 1ZFJA 4F66A 1TIMA 1EIBA 4RCXA 3VNJA 1GHSA 1TSIA 4BF7A 1OX4B 1X38A 3N25A 3P67A 3C0QA 2AMGA 1TCDA 2R8WA 4ORIA 3VCNA 1WCGA 3SY5A 4B4FA 4MPQA 2JE8A 3UGRA 3ES8A 4GXPA 3S8HA 3WJWA 3MI6A 4YTRA 5G4EA 3H21A 4IQEA 3K8MA 1UWTA 4P7NA 1TZZA 3VO0A 3QZEA 3IUHA 1B9ZA 2XVGA 1QO5A 4R3UA 2YBVA 1DIOA 2D3LA 3N15A 2VDHA 3S0CA 2CLFA 4XV0A 5D9PA 4CNNA 1VCFA 3C86A 2P0OA 1KNWA 5C55A 3T2OA 4AWTA 3L4XA 1ZLPA 1OEPA 1PWLA 2J75A 4GMEA 1LCOA 1PAMA 3UFYA 1JPDX 3BLOA 4UCGA 3GE7A 3HIJA 3U2EA 3VI2A 4CD5A 2Z7KA 4U5IA 1OF8A 4AEEA 4J9JA 1XG4A 1E70M 3C3UA 5JUVA 1S5NA 4JN6A 2CHRA 4U28A 4QCFA 4AD3A 2WVTA 3DN5A 3QR0A 3V16A 1W9XA 2ZCGA 3HGJA 3PUEA 4GFIA 3RPTA 4V1XA 1E0TA 3APYA 1PB0A 1ZPTA 2NX3A 2V82A 1D7KA 2ABBA 1RVGA 1CXFA 4MNMA 1WOBA 3SDOA 5ABGA 2DSWA 1X7FA 1I60A 4ROQA 2A3HA 2EPMX 4EPBC 5HUPA 2Z29A 2OYMA 3LHTA 4W9TA 4AWUA 3S9ZA 3CAVA 3GNDA 3DGBA 5AHMA 2F6KA 3TIMA 1VBHA 4FX8A 1JZ2A 4PEEA 1NFBA 3MJMA 4HTYA 1G69A 2E67A 3C0SA 2QCHA 3P93A 1WDSA 5DMMA 3PBYA 4Q22A 3TOYA 4RE2A 3N4FA 1R0MA 3URNA 2XN1A 4UTFA 4XIAA 2BGSA 1WBJA 1K9EA 4C7FA 4M8UA 1RP9A 4YIWA 1FDYA 3I65A 1OD0A 1KXVA 4UIOA 3GYCA 4TTUA 4L6HA 4L7ZA 3WLNA 3G1RA 3ID7A 1DKWA 3MI3A 4IISA 3VILA 4L4LA 2BNJA 5LNRA 1UWIA 4LALA 4KWOA 4DF1A 1Z3NA 1W9BM 4KT2A 3RF9A 4BZYA 4ERAA 3IEBA 1PX4A 1V5XA 1JD7A 3ITTA 4NJIA 3EMQA 3EOUA 4IPLA 1JZ3A 5DMYA 3BAJA 4DRSA 1M04A 3KP1A 4XUYA 3STPA 3HGRA 1DHKA 3MV11 3A24A 6ALDA 4GVGA 3OBKA 4HK5A 2GVJA 3A64A 2GZXA 2PC8A 1JCXA 1WZAA 5LIUX 2CZFA 4S38A 5D05A 1JYXA 2PDXA 3EWBX 1JXJA 2E4TA 3VUPA 1LRQA 4WQ6A 2FZMA 1CGWA 1NFPA 2X2GA 1FWCC 4P8VA 2Y7DA 2AKZA 1L8NA 4JX6A 1MEIA 4E8DA 2KX9A 4WY0A 4IJBA 3N9KA 2E09A 4BWLA 1F8MA 3Q65A 1B3VA 2WMJA 1W1PA 3JUGA 2PGFA 1W1ZA 2GOUA 1V6XA 2FTYA 1VAHA 3COTA 2V68A 3EKZA 4O0QA 1GYMA 4HT3A 4JZ5A 4Q4RA 1CXHA 1PL9A 2PUZA 1M1BA 1AJZA 3THCA 4LVDA 4BI6A 2ISSA 4WIWA 3R1ZA 5A8QA 1G7VA 3TR2A 3B8IA 3UVIA 4H6QA 3KL5A 4YL2A 5XINA 3PULA 3VGDA 1EXPA 4Y9NA 4XQ6A 3TSMA 2YB1A 3TYBA 1CLXA 3T09A 3NVTA 3BLFA 1JGMA 3DERA 3W70A 4ERIA 4F2BA 3E9AA 4JHOA 1LQ0A 4RE3A 3AWNA 1P6BA 1SUXA 3NR0A 1LJYA 1PYFA 2YFOA 1ISXA 4OOUA 2Z6IA 1SPQA 3W2MA 4Z1AA 2PGEA 3OGVA 4Z1CA 1VLIA 2O55A 3FSUA 3M4HA 3M6DA 4GY0A 4E2BA 1ZGDA 1NWUA 4FR1A 2PLKA 3BURA 3N3MA 5HPCA 1A0DA 4OUEA 1M6JA 3AXXA 5D4YA 2GJXB 3W7MA 3UJRA 4PUMA 2YIHA 3HBLA 3SUUA 3USZA 3SECA 2Q01A 4UR7A 1QFEA 3C0JA 5E0CA 5AC8A 3NL3A 4IMDA 1YE4A 2D73A 4H9UA 5I77A 3KRZA 3SQMA 3BAYA 4IFKA 5TNVA 1UUMA 1MO0A 1OCNA 1V02E 2V67A 1ONEA 2EHHA 2ATMA 3NL5A 3O07A 2EPLX 1RQBA 2WB5A 1DWJM 4K39A 1WX0A 3G0SA 4QG8A 4GZIA 3I7SA 4AY1A 4HVXA 5CBIA 4Q8OA 3LBOA 3TN5A 3EWCA 2D2OA 4BWLC 5CAHA 4LAUA 4W5ZA 1B3ZA 3L0NA 4J3VA 2HBXA 3T2QA 2JFEX 4I5RA 3QY6A 4AB4A 5FSDC 2VFDA 2XHYA 1NU5A 3UCQA 5HR6A 3KHJA 1H49A 1IWBA 4AISA 2IKIA 3P14A 1CNVA 2G5WA 4L4MA 4MPKA 1KTBA 3UU0A 2HISA 4QDWA 4HK7A 4K6AA 2NSXA 3TEVA 1P1XA 2VENA 2HPIA 1UH2A 2V2CA 3NDZA 1SVDA 4PMYA 2I7GA 2QCLA 3UPMA 1U5VA 1F73A 4FZIA 4MF4A 5IDIA 4MWAD 4A05A 2C14A 3BARA 3DG3A 4F79A 1IIGA 4C6PA 4KWWA 4QR6A 2ZZ3A 4QEHA 3PTMA 1CZ1A 1W91A 1MEWA 1ZENA 4LC8A 3WLLA 2J8GA 1CT5A 5CPLA 2V69A 2UY2A 4F8XA 2ZKMX 3IJLA 3SFKA 4HOZA 5D9NA 1V77A 1REQA 3VKDA 3PZMA 3IACA 2J79A 2VURA 4P61A 4HHLA 1GVEA 1PJ9A 1GGOA 4GQGA 2ZADA 2GGJA 2BMBA 5GJMA 1W8SA 2EG8A 1Q6FA 4JEJA 2Z1BA 2TPSA 1L0PA 4Z2HA 2GSJA 2Z1KA 3ENLA 2FVLA 2H3BA 2OWXA 2DV0A 1RCOB 2G96A 3NOYA 3M44A 1XKJA 5BXSA 4S2BA 3G0UA 1VFSA 6A3HA 4LY4A 2P8BA 3M0JA 2UZ9A 4GC3A 3VAVA 2H9AB 3CQHA 2J13A 4YWSA 2HEJA 4A8LA 3T0TA 4AD1A 4YHGA 2XH4A 3O9NA 1UPMB 3N2OA 4AU0A 1GPWA 3O1NA 2NW0A 4HPHA 1LWJA 3LGDA 4PZVA 1OGGA 3O16A 1DXEA 2D0FA 4C6JA 3D6NA 2XN0A 3W2LA 4QLLA 3UYCA 2BHUA 1TE1A 3EMZA 4XO6A 2E25A 1OX6A 3GY1A 4P2VA 4JYEA 1ZQ5A 2PP3A 1F7BA 4GX9A 5FOOA 3AXMA 4FLSA 3FHQA 3KWXA 3G1DA 1GJUA 2A3CA 4H6RA 3NPWA 1RK6A 3K5XA 2WNZA 5AC5A 3ANUA 3GXDA 1SW7A 3T40A 2OEKA 2OELA 3GU2A 4PTXA 5LIWX 2X7VA 4NJKA 2OEMA 3PZNA 3VIJA 3EA2A 3R8GA 3QQ1A 1TPB1 4L1WA 4BHYA 1TJPA 3SIMA 4JIRA 3WJSA 1YX1A 4HMNA 2YLAA 3ZM8A 5DLCA 2TRSA 1S2TA 1ADOA 1Y8BA 4D1IA 4L5ZA 4HPNA 3VMNA 4XUGA 5HWMA 1IT0A 4XZNX 3UXDA 4GIEA 4QLKA 3U0HA 1JFXA 4Y96A 1N82A 1K7XA 4HYWA 4HCDA 4GUFA 2WSPA 3GLCA 3QOMA 1JYVA 5BZAA 1TMHA 4O1EA 3IAPA 1VIWA 3ZVHA 1RY0A 3I6TA 1YBQB 2PDQA 5E1QA 2HV5A 3CUGA 4ML4A 1VR6A 3KS6A 4HA3A 3B8SA 3UG4A 5CLTA 3W7GA 2ZWYA 4LY8A 4AC7C 1BVZA 2WWCA 1HP4A 5F7UA 4DM2A 3E38A 3RX3A 3GG8A 1PKNA 1W56A 4ZZ9A 4UTTA 4ERGA 1D9EA 3O05A 5BMWA 3C2VA 1TPWA 2VVNA 2CLPA 3I4EA 5AECA 4FLRA 3KTSA 3RCYA 4WZHA 2OSWA 3L68A 1GW9A 1PZ0A 4MJZA 2DZAA 2R91A 5DX7A 3R8HA 3BSHA 3U9IA 2CCRA 2XZ7A 3GTFA 5EMMA 2ZUVA 3KZSA 1BQCA 1BWVA 1TVPA 3TWBA 3K8LA 2KAUC 2O4MA 2V3EA 5F2MA 3GXNA 4Q8MA 3PP7A 3N18A 2O0TA 3I10A 1GYLA 2EEXA 1O7AA 1HNYA 2W62A 1T8XA 1ONWA 1W5QA 4MB3A 1HX0A 5D8WA 1LZOA 4GINA 4O18A 2W79A 3SCQA 2FGBA 3THAA 5ABFA 3SY1A 3E1F1 3R10A 4R88A 5D09A 4YTSA 2NUXA 4A21A 2VL4A 4ZENA 1US3A 4C1NB 4DUVA 2J8TA 2CC0A 3O0KA 1EUNA 3WK3A 4ASTA 1KFKA 4PA8A 3S5ZA 4XISA 1ME8A 3C3NA 1JR1A 1GCYA 3ARVA 1E0WA 1JUEA 4HTBA 1KBBA 1XBXA 1TPC1 1UASA 4UR8A 2DZVA 4M51A 1WQ5A 4A2SA 3V0SA 1RVKA 2GK1B 4ALDA 2E1WA 3BWWA 3YPIA 1LWIA 1K7FA 2VEGA 4QX4A 4A3YA 5F4WA 3TLLA 3S1WA 1CI1A 5HMSA 1X96A 2DVUA 2XFWA 2VEIA 3WEOA 1A3WA 1EPXA 4OQVA 2CLMA 4LAOA 3RR4A 5HJXA 3Q67A 4PEKA 1UOZA 2Y7FA 3ZLFA 3TSBA 4G5DA 3ICJA 3VINA 3TOPA 1I8JA 3B8TA 4QJ5B 4DUOA 4K36A 2WSQA 1NJJA 4XD5A 3IAQA 4XVEA 4O57A 3MKVA 1VGAA 4WKHA 2BVDA 5BW6A 1FXQA 1CB7B 2WHMA 4JNMA 4UTTC 1X6UA 4LVGA 1UD2A 3SB0A 1J5TA 3TCSA 4CU6A 3EX4A 1G0CA 2QJNA 3GDBA 2BDQA 2PDIA 4QLJA 1QCWA 3BCFA 4F0KA 4EP8C 2WJZA 4Q7NA 5M5DA 2YCEA 4MM1A 3II1A 4GZEA 4PUEA 4NU7A 1XC6A 4HSOA 1V3MA 3T6CA 2GUBA 4S3GA 3PAJA 1ITQA 3CHVA 3GU1A 4RDVA 3U4FA 1B57A 2VI0A 4X60A 5JBEA 4AUBA 3VNYA 1XQKA 3WDQA 3MCMA 2FTWA 4HNUA 1GPFA 2F6UA 1S3HA 5LSMA 1NDYA 1VBUA 1NDVA 5CZSA 1TWIA 2NT0A 2OSXA 2H3DA 3W01A 3EEGA 4AMAA 3NDOA 3OG3A 1CECA 4QGCA 2W92A 3NGFA 4ROPA 4Z2JA 4JIQA 1CEOA 5LHEA 1Z89A 3AZRA 1D3GA 4DNMA 4O11A 1SJAA 3Q94A 5SWUA 2YXOA 1XLBA 4GWEA 2DIEA 4LV9A 3SCWA 1XI3A 3CWHA 4QBXA 1PXGA 1HN1A 3CLWA 4OT7A 5I5RA 1VEMA 1YKWA 2CIPA 1EF3A 1HJVA 1H7XA 1TZ7A 1P0KA 4GH1A 5L6UA 3FN9A 3MBFA 1NQ6A 1WUEA 3NVDA 1G67A 3GHSA 3CV6A 1G4TA 4WY0F 2ZUMA 3MWCA 1OK4A 1SO3A 4GOAA 4DB7A 1NTHA 5E6YA 1DL3A 3E96A 2GJLA 4X9SA 4R7OA 3PBWA 3A3HA 2Z28A 3SURA 2JBMA 2Z0IA 4KFOA 3W1MA 1TTIA 3LCWA 1UR1A 1MW3A 4O1DA 5HDRA 4KFPA 1HJWA 2GQ8A 4CUCA 1MRAA 4AHPA 3BMWA 3NUKA 3MQTA 1DE5A 4ZVJA 5JU6A 2ZA2A 4IGNA 3CPGA 3LGGA 4PUDA 3TQPA 4D6EA 4PCSA 1Z69A 1EHNA 2FIQA 4JN8A 1CBGA 1LL7A 5BOFA 3TMQA 2RJHA 3EDKA 2B7PA 3HJZA 4WXYA 5E6ZA 1QRQA 3VIFA 3E74A 1LOQA 1XF0A 5K9DA 7ENLA 1U1JA 2HZGA 3AS2A 3MT1A 1OG6A 5C9RA 4PB4A 1E73M 2Q3OA 1K77A 3WLQA 3DHFA 4NJJA 2EJ1A 4X0VA 1O68A 2IPWA 4ES4A 1UD5A 3WNOA 1R6WA 2YYTA 1KC7A 1B90A 1OSEA 1XIIA 1LT7A 1O6IA 1Q2SA 2A3BA 3KDOA 5HNUA 3T1GA 2Z7GA 2V2HA 3C56A 4ECLA 3CHFA 4LUIA 1MYRA 1AVAA 3W1NA 3FY1A 3OIXA 1XIEA 3LV6A 3J7HA 1QTWA 4MMWA 5HMEA 2DJLA 4M1RA 5A3HA 4A3RA 3L4YA 3REQA 1G4SA 5FSEC 1XD0A 3RCMA 5GJPA 2BXZA 3PS7A 3LA4A 2J7DA 4GO8A 1S5TA 3RILA 4PMJA 2OGJA 2X40A 2PLJA 4J3WA 5G2WA 4CN6A 3TKFA 3TP4A 4LW7A 4PFMA 2GUYA 5HBFA 1WZLA 4D1JA 3N6HA 4DUXA 1GQIA 3W37A 3LTYA 1KXHA 5IFTA 4IM4A 2DW6A 1DOSA 3VZZA 1UUQA 1GKPA 4RR4A 3H2EA 4IZGA 1YLVA 2F2KA 4I9AA 1JPHA 3VUSA 4U3CA 1I2OA 1CB2A 2XH0A 3TTOA 3W9ZA 2BLEA 3WDPP 1HG3A 1K8XA 4UTLA 5G1TA 1X6NA 1RPXA 2OXNA 4MFEA 2YA2A 1A5SA 2J66A 1YPFA 3W76A 3AUJA 3PC0A 1MNZA 1V8EA 4JL2A 3RK8A 1H4PA 3SSZA 1JAEA 3T07A 4AZCB 3IJ9A 3PZUA 3AWOA 4PH6A 3F2DA 4PSRA 3G22A 5A6MA 2WKLA 2CETA 1ITCA 2YDQA 1GNXA 2OO6A 4CU8A 3TR9A 3KX6A 3N2CA 4PULA 1NVMA 1NM9A 3PWGA 1SMAA 3IANA 3Q58A 3GG7A 1FWNA 4BQ3A 3FIGA 3UF9A 4RXGA 3E5BA 1TE6A 1LRNA 1NSJA 3N12A 2GVEA 3SN0A 4WY0B 4GNJA 2FH8A 2FJKA 3QSRA 3HV9A 3B9OA 3CXOA 3BAXA 1H3GA 1IEWA 4CNOA 4V15A 1Y65A 1W1IE 4X3ZA 1VH7A 3DI0A 1KM6A 4JQ2A 2O9RA 3BGAA 1I9CB 2VVSA 5C7HA 5F2GA 3TA9A 1T41A 1D2KA 5GVJA 1B31A 1UPPA 3GW3A 1E3ZA 3CV7A 4HN4A 2X1RA 3VD7A 4PL1A 4NZ3A 3WQVA 4GNKB 3WLRA 3K1GA 1X1ZA 2C18A 1F3TA 1QAPA 4NRRA 1W2PA 3KTXA 4QFUA 2Q8LA 4KWVA 1NELA 5CC3A 3HMJG 1UKQA 4C5YA 2PBGA 1VIZA 4Y7EA 3NJ3A 3QR1A 1UD3A 5D2TA 3WUGA 3LDVA 3TJIA 4MY9A 3T8QA 2PC4A 3RIKA 1LT8A 4XAFA 1O1HA 1EXBA 3BAWA 2FLIA 4MYAA 4HU3A 4YVXA 4M24A 3CT2A 3M0MA 2NQ9A 1IXOA 1OZMA 4QE4A 5HK4A 2Z00A 2RH9A 3TV8A 3W85A 1QPOA 3NSMA 1M68A 5GQBA 3LHWA 3O7UA 3VDBA 3L23A 4M56A 1WO2A 1JDCA 4Q8QA 3W27A 3A23A 3MO7A 4JTDA 3N4EA 2Z6JA 7PTDA 3IVUA 4RXFA 3DFOA 1MDRA 2DQXA 2PWEA 3AOFA 4QITA 1L2UA 2ZRXA 1RUSA 2WLYA 4FOUA 3DUGA 3KOYA 2EPKX 2Z1XA 2ZRZA 4DBUA 4F3HA 4NZJA 1M41A 4UQCA 4IFKB 1DWHM 5DELA 3QMRA 2ZWZA 3CNYA 2Y1HA 3MKKA 2P0IA 3S6DA 2E5BA 1KFEA 3QQ0A 1R7AA 4BF5A 2AAMA 4IIEA 3CO8A 1P7TA 4DBDA 2BG5A 2OQLA 4H6KA 1A4MA 3RAOA 1U30A 4Y9PA 5G5IA 1FWBC 2J6VA 2X0SA 4LYRA 2JALA 1DHPA 4IMAA 4ZOAA 1HKKA 4JQ3A 1QWKA 4H9TA 4S3DA 1XL9A 5IXEA 2FPTA 5CLWA 1QPRA 3PAOA 2FPYA 3BAKA 3EWXA 1B4EA 3R13A 4F40A 2PDBA 3TZFA 3UD6A 4PFHA 4C6QA 4W4QA 3SCPA 4YCPA 1T5AA 1IXNA 3JW7A 1CW2A 2FKPA 4GQRA 4LNYA 4HU4A 5I03A 3PPCA 1IIHA 1JULA 3TLQA 2PMQA 2XIIA 3QV8A 3CEPA 4L4PA 1PDYA 3PZGA 1J0KA 3GVWA 2BOFX 3M6YA 1MVYA 4H83A 3N14A 4JTAA 4GXWA 3CL7A 5AYXA 3GXTA 3RJYA 2MNRA 1JFHA 4E0CA 1VS1A 1Q4WA 3QH2A 3KE0A 3WMBA 1XUZA 3PR2A 4M7SA 1OIMA 4XZLX 5LA1A 3T0CA 5I3KA 1REQB 2IPFA 1A4LA 4DJFA 2PSNA 1TPDA 1WDWA 1P6WA 4WRHA 1SSDA 3CGTA 1PIIA 3QV9A 2ZZ4A 1GTEA 1Q6QA 3LSCA 2JKPA 2OWCA 1YDYA 2VQUA 5KETA 1TVNA 2E9BA 3H70A 2F6XA 2X8RA 5LIKX 4H01A 2VC5A 3M0IA 5FEZA 4BCEA 4B5NA 3NPXA 4UFKA 4W87A 3NQEA 2JKEA 4JTJA 2QGYA 1U2YA 2X1TA 3FA3A 4PCTA 3WEMA 4ACZA 2VZOA 4S39A 1NF0A 3R0UA 1O60A 2CLKA 2HCVA 5DXYA 4BA0A 3UWZA 1OBAA 3GDLA 5E93A 1TTQA 1JDFA 1VD6A 3ANYA 4Y8EA 3HG5A 1V93A 3AZTA 3GIPA 2XSXA 1TV7A 4AHQA 4EXBA 2IXVA 3VE7A 1CTNA 1C90A 3H4XA 4EKJA 5BRPA 1K9FA 1QI4A 1OHLA 3AO0A 4U31A 4N4PA 2XIJA 5HA7A 3WQFA 4L80A 3TYAA 3G24A 4AYGA 5KSWA 1XCWA 3IJ6A 3WLMA 3WUFA 2J24A 4MWAE 2BB0A 3DHUA 1BPLB 3C2OA 5C0QA 2XIBA 1TUFA 3OVQA 1TV2A 4FXFA 4PMNA 2IUZA 2VCCA 3C61A 3TJXA 5BRBA 4AZ7A 4O28A 3QHMA 1UH4A 3GR7A 1BVNP 1XRTA 3EMCA 3UERA 1R3TA 1TWDA 4I5XA 1OWQA 2HJPA 3DXIA 4A6GA 1SO6A 1YTKA 4PUJA 4WDUA 4QQUA 5H2ZA 1E0UA 4R9XA 2QAPA 2WSKA 1IZKA 2GQAA 3IUDA 3V0TA 3RX2A 1L6GA 4NX0A 2C19A 3BMVA 4L6OA 2W67A 4RE0A 2IQ0A 1G9HA 4W7UA 4WVXA 4W5UA 1SFSA 4DJFC 4C6EA 4S1FA 3GB6A 1DJYA 4B92A 8TIMA 4ILSA 1EFZA 3WLPA 4NAFA 5HPOA 4MZYA 3T0DA 2G95A 2VGFA 4Q7IA 2J77A 4DI9A 4MUPA 4UTUA 1OY0A 3DC8A 1GOOA 1B3OA 3ZVHB 2QHAA 2Y85A 1V3HA 4IXHA 4V28A 4HOXA 5FF7A 3R89A 1AD1A 1OGBA 3T08A 1FWSA 3UVAA 1FFRA 3V4BA 3OW1A 1J0JA 1EGMA 4GPNA 4P5UA 5TAOA 2BGNE 3LY0A 3GFZA 2PZ0A 2VKZG 2XU2A 1TV5A 2PTDA 1PS9A 3TONA 3BSGA 3ONCA 1EEPA 5EFFA 2QQ6A 3GBDA 2J8FA 2YB4A 3CQ0A 4AXKA 2CBUA 4GJ1A 4ZMGA 3OZMA 1WKFA 1TWSA 1LLOA 4HBKA 4I6VA 4ZTYA 2OLAA 2FFCA 1F3WA 2SFPA 4MJ4A 1DQUA 2YBUA 1AL8A 5H8UA 5ABFB 4E38A 1PUDA 5LA2A 2OU4A 5FJTA 3KXQA 1PCKA 1UA7A 3EWDA 1SJCA 4LF1A 1JG9A 4FXRA 1MW0A 3BLKA 4ZBCA 4L61A 4AG0A 4U33A 3RNDA 3P62A 1WA3A 3LPGA 1HVQA 2PZNA 2INZA 1EC9A 4AWEA 1FWEC 1R3RA 1T8QA 1KFCA 3E2RA 1ZU8A 1FWJC 3RJXA 4HNCA 2DZTA 3QYSA 3NL2A 4N7QA 2YKKA 4NYYA 3WD1A 2PDPA 3ABOA 5DCDA 2VC6A 5I3DA 1N2VA 3N17A 1CXEA 4RPQA 1H1ZA 1KBJA 2VFIA 4MNKA 3G3MA 1XSIA 3CB8A 1J11A 1OFQA 2I1OA 5K9CA 2FMOA 2V3DA 1IT7A 4N0RA 5AZ1A 1KO0A 1B3WA 1V0NA 3WZ0E 2WQDA 1PSCA 3SUSA 1TELA 4AYSA 4KCWA 4UNKA 1TVLA 3I68A 1E9ZB 1KM0A 2WJFA 2PB1A 2FZNA 3NYZA 4F0MA 5LIYX 1JUKA 3W82A 2E8YA 2R9RA 1C92A 4CD6A 3RITA 3UG8A 4J5NA 2EKGA 2X2YA 1GKQA 3VNDA 1Z8AA 4GBUA 4IP7A 2WPBA 2YCIX 2QVNA 2CZDA 1KR0A 3UZ5A 1I1WA 2X0HA 3EZ4A 3N2MA 4RJEA 3BAIA 3U2CA 2VX5A 4XWUA 2FDSA 3L2MA 3AS0A 3L4VA 3GAYA 4RZBA 2XVNA 2CKRA 1QI5A 2XM1A 1V02A 3GFXA 1E0XA 4H1ZA 1HUVA 2GYIA 5B80A 7A3HA 2E9LA 2XSAA 3PFRA 1KV8A 1MQRA 2J62A 2AQVA 5H8PA 3T42A 1LL4A 2XWEA 1XCFA 2J7HA 4R5EA 4OTKA 1DJHA 4RZ6A 1QT1A 1E56A 2PEVA 2PRLA 4RV3A 4UMCA 3WEZA 3ZVIA 5G2IA 4GISA 3EX2A 1IEXA 4AXNA 1LROA 4LT9A 3STFA 2HS6A 2J74A 2I56A 4O50A 1XIMA 3FDKA 2OQYA 4NIRA 3DYOA 1UCWA 3EAUA 4UZUA 5HWNA 1UD4A 2D0GA 3W1RA 4J3ZA 3VKAA 4B5UA 1NAL1 3C52A 2V5KA 3I4KA 3RCNA 3KZPA 5EMJA 5FD0A 1XSKA 1VLWA 2VEFA 2ZC8A 3VYLA 1NDZA 3BZGA 2NUWA 3BG3A 3AROA 3RM9A 1V03A 3I7RA 1W5OA 2DZSA 3WMLA 1B3YA 4O13A 2H8ZA 3M5ZA 2XISA 3O8AA 2FQIA 3MDWA 1CGUA 3OLIA 1A5LC 3KOZA 3GZAA 2BASA 4CD7A 1Z41A 2ESCA 3NZGA 3KCJA 1TPEA 2P10A 4HSHA 4WHBA 2WNWA 3KOXA 3WF3A 2P53A 2PDYA 4K8EA 5HOSA 2QW5A 5IFPA 4DEFA 4GGHA 2WNNA 1NP2A 2J7FA 4J35A 1IQ8A 2D1ZA 3M7WA 3PB2A 3OIHA 2WM1A 3W73A 1X8FA 3WDRA 2Z2BA 3EOOA 3W7DA 3UZWA 1P1MA 4GUJA 1PCWA 2RDXA 2WJEA 3O06A 2F8QA 3S9YA 1XLDA 3O6YX 3EGJA 3IPWA 1AL7A 1SFJA 3WBEA 4C6FA 1LP6A 2QDEA 6PTDA 4AVFA 2ACQA 4I9JA 3WQGA 2CBVA 4IGSA 3LM3A 3Q37A 1CDGA 2GLKA 4IIGA 3AHZA 1ADSA 3G2GA 4GYPA 1HP5A 1HKVA 1P0EA 1UZ1A 2VOMA 4ZEPA 4BK9A 3B0UX 1CCWB 3DZ1A 1E6ZA 2P1FA 1LLWA 4G6CA 2RGLA 4GJIA 1E15A 3QMSA 1KB3A 1Y0EA 2QCNA 1ZAHA 3C6CA 4XD6A 4KEMA 3PPHA 2PWUA 2RHGA 3CIWA 2Z26A 1TV3A 4ADUA 1O4UA 3SIZA 1A5MC 1TMLA 1IR1A 3CH9A 1EIXA 2PU1A 2VXNA 3W53A 1ELSA 2NXIA 5MHBA 5B7YA 4UXDA 4BJHA 1JZ7A 2G50A 1W37A 3BV4A 4WXZA 4E3TA 2IQTA 2C1HA 4M81A 3LEPA 1BHGA 1EGVA 4BY3A 2ZZ1A 1QVBA 3AIUA 4DY1A 1HQTA 1OFAA 3TYDA 3A22A 3MVIA 5EU9A 5JMUA 3RGTA 1E0VA 4K1GA 3GXMA 1RV8A 4ZCWA 4LQ1A 3HPZA 5ECUA 9RUBA 4ONVA 3VKKA 3P61A 4PMDA 4N2YA 4FIRA 4IICA 4HNNA 4UMBA 2ZUWA 3MC5A 4Z08A 1CX9A 5LHFA 4JFTA 1J0YA 4S3AA 3VFCA 2I5GA 2AQWA 3LBCA 4JTRA 3NZQA 3ZOAA 3CYJA 5E9XA 5FACA 4Z1DA 3AMGA 3E12A 2YL5A 3AYSA 3RG6A 4DUWA 1O5RA 1W9PA 3F03K 3OLEA 1YQ2A 2ZC1A 1KWKA 3ME3A 1E5NA 4HSNA 3EXTA 3K46A 4GYPC 1TPFA 4ATLA 5AB3A 3EWZA 1J12A 3ZLHA 3CK5A 4DJEA 1U22A 2O4QA 1FA2A 3LLXA 4K8GA 2OZTA 3IJDA 3DEQA 1W17A 4FF7A 3JU2A 3ALGA 1YADA 5EMLA 3WD3A 4DYJA 4B5SA 1E6NA 1OYAA 3SUTA 2A6LA 2YXXA 1IGWA 3R5EA 3FX4A 5KMYA 2XVLA 3FEMA 2TMDA 4JIEA 3P3BA 2V2DA 5K2ZA 5DT7A 1OQFA 3NQVA 3H2OA 4LGXA 1UHVA 2ZE0A 5C2CA 2XFFA 1UB3A 1KBKA 1O5KA 2D23A 3ZSSA 4CD4A 1KRBC 1I1XA 5EBUA 2PRHA 1A5KC 1DVJA 2GJNA 4Q8WA 5HQEA 3W6LA 3LB0A 4PBFA 1R2RA 2BHYA 1HO1A 4KW2A 1KCZA 4Q4QA 1W3NA 3UXIA 4PMUA 1KM3A 4G1NA 1XIBA 1EQPA 1F3EA 3WLJA 1B1YA 3ECQA 4PTMA 1J5SA 2DH3A 4WJXA 4E2OA 2DZUA 3ZT7A 3PB0A 2QDDA 2HTMA 3LZ3A 5JH2A 2FGZA 4J3TA 4JDYA 5D2YA 1XHGA 5AOUA 1NWRA 3W7NA 1P7TB 3NXLA 4LVAA 1GOKA 4O17A 1LOSA 2D2GA 2G3JA 4CVUA 1E6XM 1K7EA 4IL0A 1BGAA 4F0RA 2ISFA 1WDRA 3LHZA 3MUY1 1QDSA 2GWGA 4WDWA 4R7JA 3C2RA 4X2PA 5CGMA 1BKSA 2XGIA 7REQA 4DBEA 1DXFA 4B2DA 2Y88A 3B06A 3UWYA 2YL9A 4DN1A 4EPKA 1R38A 3ARZA 3O3RA 1XIHA 1UR2A 4R33A 1TX2A 3B0XA 3CQIA 1ZNNA 1SZRA 1UKOA 2DT2A 4JN7A 4UTKA 4IPPA 2QF7A 3L67A 3PG9A 1CXKA 3GM8A 2OFJA 4HGXA 3ZJKA 1L6SA 1Z48A 5CSRA 2WHJA 3DHPA 1SR9A 1KBLA 2PDUA 3IIZA 3WBYA 2F9RA 2PWGA 4H3DA 1JL8A 3G1FA 1XSJA 3TNBA 3GVRA 3QC3A 4JOMA 3PBMA 2QV5A 3QZAA 4M29A 3PBGA 2IMRA 2QULA 3WH5A 1R2TA 5REQA 3U5UA 3C2YA 3R25A 5FF2A 3PTQA 1DIDA 2IQDA 1JGIA 3THDA 4L9XA 2POZA 1VYPX 4K37A 1RR2A 1S1PA 1OYCA 1JDEA 3IJ7A 1IEIA 3FFSA 2ZVIA 3PVFA 4LSBA 1UYQA 3WG6A 3TQKA 3W7RA 4JTIA 3UXAA 4U5KA 2YLLA 3T05A 4HKPA 4F0LA 3AMKA 5DRIA 4O1AA 1PX3A 3RDKA 1XX1A 2VJXA 1MXDA 4JTEA 3B40A 1FHUA 5EMKA 4XZHA 2ZA1A 2BSLA 4Q3MA 2DUXA 1ICQA 2RAGA 1FDJA 4WDXA 1UZ4A 3FVMA 1KTCA 2HWGA 3FJ4A 3PZQA 1QK0A 4HU8A 1XWYA 2V5LA 1QXLA 4NUWA 1O66A 1EDTA 1MI3A 3VGFA 3OVGA 1MDLA 5FEWA 4XB3A 3MMUA 4M7TA 4U2ZA 4WKAA 4X61A 3P5ZA 2CW6A 2R1PA 1OFBA 3FXYA 1XFBA 4OZOA 1XPYA 3DG7A 4DJDA 4OOZA 3CC1A 3NQDA 1H50A 4UFJA 4OWGA 4DIAA 3WF4A 1AFSA 3KS5A 2P3ZA 3G1YA 3ITGA 5AHNA 1O1ZA 4C91A 5C2GA 3RYSA 1P48A 4J4KA 1EJ7L 2QJJA 4GD0A 2Z1WA 4G7FA 2V9DA 3D3FA 3EPOA 1VCGA 2NQZA 4PC8A 2GDVA 1JIBA 1IT8A 4FX7A 2VELA 1IZJA 7TAAA 4RZ4A 3U7VA 1PV8A 1FHVA 1HKMA 1JUBA 3H4GA 2EG7A 2NQ5A 5KTLA 1WKDA 1XP3A 3S47A 4DF2A 3TMLA 1XGZA 2X0YA 4YTTA 1BLIA 3VOIA 2W91A 2WKJA 3MHFA 3ITVA 2FZBA 2DT1A 5J5DA 4N9EA 4OHQA 1H7RA 1WNOA 2ZE3A 2NX9A 5HNTA 4Z2LA 4CGTA 1PZ3A 4P7RA 4DJED 1YRRA 1ITXA 3NQCA 1PHQA 3FSTA 1Q13A 4WLCA 3CTTA 5G1YA 5FJJA 3BANA 3AS3A 3NFUA 4H9MA 3CJPA 1QR7A 4XKMA 4KF1A 5D04C 4CNSA 4M6VA 1ISZA 3IRSA 3WNLA 1SM9A 2ZXDA 4DAIA 1JF6A 4BFAA 1IGSA 2DH2A 4DHGA 3LV5A 3CMGA 4B3KA 3UQNA 4MOZA 2CERA 3GD6A 5BWFA 2G4FA 3MSYA 5A2CA 2XJ7A 4CQBA 4TVDA 3UXKA 2YA0A 1JPKA 4J28A 3NQFA 4H7ZA 3ARTA 1F6KA 2WQPA 1Q45A 4KFNA 4DJDC 3NEHA 4CQAA 3FJ6A 4EAMA 1GZGA 5TD4A 2VM8A 1D8CA 3UG5A 1EQCA 2BY3A 2XYLA 3WQEA 4XTDA 5CC5A 2WMFA 1KM1A 4K68A 3TFCA 1Z44A 1W6TA 1FCQA 4UTJA 1A50A 1F4AA 4JCLA 4H7CA 1GOWA 2OQHA 1N8IA 2DZXA 2EG6A 4LXFA 3SQSA 5I00A 3H22A 1TCMA 2DUAA 4B90A 3CZKA 4AEFA 4KRTA 2PCQA 4UFIA 2FDMA 5CPTA 3CUFA 4EWND 2CHNA 4D6IA 1HW6A 1AD4A 2Y8UA 1W54A 1E9IA 4FNTA 3BLPX 4B2DD 3G1AA 7CGTA 1QI3A 4R7WA 2R94A 3KLLA 1V3LA 3BUVA 4Y9MA 2NLYA 3S1XA 1F76A 5JH1A 1KRCC 3WLTA 9CGTA 1SSGA 1OFPA 5HMFA 4F9JA 5LXXA 2GFTA 4UZSA 4GFSA 4KPLA 3WMCA 2J47A 3BJTA 4MDOA 5E0FA 1LUCA 5TQLA 2PGRA 2OYKA 3M1ZA 2A0NA 3TZNA 4TX6A 4QP0A 3P6LA 1ZJIA 1H63A 3FXGA 1M01A 1GORA 4CCEA 2D20A 3BXWA 1Z9AA 4Y9AA 2OB3A 4FEZA 4C1NA 4H2CA 4CCCA 3FYYA 5U7SA 3NIYA 3QLDA 1FCVA 1OCBA 1M7XA 3G8EA 3EB3A 2B81A 3VDGA 1VFTA 1HTIA 5AYIA 3IIVA 2WHLA 4UCFA 3GNXA 1UBSA 4L1GA 3RU8X 4PRWA 2ACSA 1K1DA 3AYRA 2OCZA 3SY8A 1DE6A 1CLVA 4NJHA 4NY2A 5CZKA 5FIPA 4NJGA 2NUYA 1E9LA 2Y61A 4DELA 1AG1O 2PDCA 4C1LA 1TR9A 2PP0A 2Z27A 3FA5A 1W3KA 4JNZA 3K8KA 2WJDA 4Q33A 4AVNA 4E4PA 3AIWA 1WDDA 3QYQA 4H9XA 4LEQA 1VFHA 4EXAA 3XISA 3OGRA 5DY3A 3LCFA 4IFRA 4YPJA 1YW1A 1YNQA 3CM4A 2JF7A 3PUGA 1ZJBA 4JTKA 4IMGA 3GDKA 3C0LA 3DBNA 4O19A 3FCPA 1H61A 5I78A 1YXYA 1U5HA 1F61A 5A69A 4ZO8A 3EDJA 4OE7A 1AMYA 1I4NA 3M7SA 1FOBA 3W25A 1XW8A 2EKCA 1ZALA 4YHEA 1TTPA 4IOTA 3FJNA 1ZAJA 1R5YA 4GYFA 4RKAA 3BQ6A 1XQLA 2YDSA 1O5QA 3S2NA 3PM6A 3NO1A 3CU2A 1QW8A 1XGDA 3OVRA 4H2HA 1XH1A 4Q7BA 4IXXA 3EA1A 3TC6A 1MFVA 3I6RA 3S4TA 1AODA 3KCOA 3ZZ1A 4QDMA 1EJXC 1X7IA 4ADSA 1GQKA 3A5VA 3M0KA 2ZA3A 3HTWA 1XICA 5G4HC 1H5VA 3WFAA 3NM3A 4G8TA 2INEA 4W8BA 3S3GA 1Z6KA 4CQCA 1J96A 2XN2A 2X1IA 2Y89A 3DENA 4B5WA 3ARQA 1E4IA 4IX0A 5I3IA 1QI2A 3T55A 1FRBA 1IV8A 2E7FA 5FF0A 3W7HA 3VFLA 1A5NC 3GVGA 4K1WA 4CD8A 3L66A 4TX8A 2V3GA 1ISVA 2PA6A 2AKMA 3P84A 3VC6A 4I8YA 1QBBA 3QY8A 2IPGA 5DY2A 1QHPA 1HT6A 2OMAA 1T6MA 5AY7A 4M3PA 3K1DA 3T0AA 1BGGA 3TC3A 4MWAA 4IUGA 2EGZA 4EF9A 4UFMA 1XH0A 3ARSA 3LYEA 1SR0A 2E6FA 4LBRA 5CPQA 1DBTA 3FKRA 3HZ3A 3TYCA 4GKTA 3LQLA 5C70A 3GUWA 2YX0A 2PLMA 3MHUA 5U4NA