3NOHA

Crystal structure of a putative peptide binding protein (rumgna_00914) from ruminococcus gnavus atcc 29149 at 1.60 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENADYIILDSAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptide binding protein
publication title Crystal structure of a putative peptide binding protein (RUMGNA_00914) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Peptide binding protein
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.210 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3nohA00
3NOHA
chains in the Genus database with same CATH superfamily
1BTJA 1IMBA 1I6AA 5A5XA 1FPEA 2DYXA 4JWXA 1PC3A 4X1DA 3USDA 2OJTA 4P9KA 4R9FA 2WBDA 4QFKA 3S4UA 4P1EA 3F11A 1N3XA 5H8QB 2CZIA 1P99A 4FAJA 1MXVA 4P0IA 5I56B 3CI8A 3O6IA 1MM7A 1B7HA 1N7WA 1NV2A 2O69A 4NF5A 2RF1A 1IITA 3K6XA 1Z7ME 2VPOA 4QF9A 2Q74A 3K4UA 1LB9A 4EXLA 3EN3A 5JK4A 1N0TA 2ANJA 3RTWB 2MKZA 1B58A 1D9YA 4FORA 2ONSA 4JXIA 3OSRA 4M1VA 1B5IA 1QW0A 2GH9A 5IZ3B 4OFJA 3IB0A 2RC7A 1LBWA 3KZGA 4XEQA 3IJOB 3MP1A 1S50A 1QJMA 5IZ1A 3K6UA 1I69A 1B5JA 5LOMA 3S9NC 3T9XB 1Y3PA 4HE0A 2B4LA 2ZYMA 4PAIA 4NX1A 3FV1A 2UVIA 5F1QA 3ZSFA 2UYFA 4XKPA 1PB7A 3RN8A 3H03A 4MJOA 3VDFA 5AA2A 3C4MA 4KQPA 5DVFA 1UQWA 1FQDA 2QVUA 4TLLB 4H65A 2HZLA 2XD2A 4F2QA 2A5SA 3T9HB 1ZIUA 1FPKA 1IUDA 2XD3A 3G3GA 3TMGA 4PFUA 4LZ7A 3GBAA 2P3VA 3RTFB 4ELPA 3ISPA 2HHMA 3T66A 5I57B 1KWHA 4GIZA 4LQ5A 1Y4CA 4FEDA 3PUVE 2VT5A 2ZYOA 1G0HA 3O2AA 1MH4A 5I58B 1A40A 3UA8A 4N8GA 1PEBA 2G93A 2QS4A 2DOJA 3O9PA 3TODA 4R9GA 2OWTA 3W9WA 3I5OA 1GV8A 2DE3A 3RNNA 1D4NA 1QUIA 3E4RA 4ZEKA 4BDOA 2XXHA 4F22A 5I84A 2HAUA 1B1XA 1DTZA 2ESNA 4I3YA 1P1UA 3R7XA 4RY1A 1PB9A 1OQGA 2OLBA 4MX6A 4OVJA 5FTIA 3IB2A 2Q8JA 2YLNA 3N5LA 3CRBA 3TCGA 2XXUA 3FVKA 1B05A 3K02A 1LEVA 4YKIA 1XI6A 3H3GA 4EDPA 3FXUA 3ZKKA 1OLAA 4NF6B 1MXWA 2VD3A 2RINA 3IOUA 4L17A 2OWZA 1B7ZA 4GVOA 1SI1A 1B52A 3KGCA 1M5CA 4ZECA 3CG1A 5B70A 4PP0A 2B3BA 2P3NA 1OIBA 4EQ9A 1JW1A 4TOZA 2XX8A 2V4CA 3A3CA 1FQFA 1FBHA 1NI9A 4OWDA 1AH5A 1SYIA 4PFTA 3HSTA 4O7IA 4AB6A 1ELJA 4OYVA 3IO6A 3TTLA 3IFAA 5FBPA 3KJTA 1B51A 3U93A 5L9MA 4PE3A 3GZGA 3IJXB 3R6UA 5TP9B 1LBZA 5I59A 1NV6A 3MC2A 3H6WA 3U94A 2FA7A 4HW8A 2GRVA 2E1SA 4ZEIA 3U1OA 2OBGA 1UTBA 1IZ1A 2B3FA 4LZ8A 3RPWA 2F36A 4LP2B 2KQZA 3DM0A 5DEXA 2DWHA 5TU0A 1IMEA 3SEUA 3PPNA 3H06B 2E0SA 2CZHA 1UIVA 2R71A 4DLDA 2RCAA 3TUSA 1IMCA 2AIXA 3FXBA 1TT1A 4O7MA 3IK6B 4ELOA 3OO9A 3N6TA 3A09A 4Q0CA 1II5A 4OEVA 5ELVA 1B4HA 1B3LA 2THIA 2F7BA 2G29A 3T0JA 3E79A 2Y5KA 1SW5A 3O29A 3K01A 4IO2A 1RKMA 1MS7A 1MXZA 1AOVA 1ZMGA 4POWA 1AWBA 1B3FA 5IGAA 2FNCA 5CMMA 1BK4A 4OMBA 4RA1A 1NH8A 4NF4A 3V89B 3CVGA 3OO8A 4NWDA 4E0WA 3TDJA 1ZJLA 1MXUA 3GLBA 1FCKA 4GLIA 1D3KA 3TEPA 4G8NA 3TPAA 2CEXA 5HPQA 1B0LA 1MRPA 3U8QA 3K6VA 3LSXA 1Y4TA 3OELA 5CBRA 1J1NA 3FZVA 2YPNA 3FATA 5CM6A 5EQ7A 1B4ZA 3MVZA 4HE1A 4MF3A 4R6YA 3EHTA 3QUJA 2Q89A 3O66A 4LZ5A 2Z8EA 2I3VA 3TQWA 3K1NA 2R9JA 3KSJA 3CSGA 2FIEA 2DS9A 4I9DA 4G68C 2QS2A 3PMXA 1TXFA 4I62A 1LBBA 1RYXA 1POTA 4OZ9A 4MFIA 3G3IA 1ZKBA 3A29A 2ZZVA 4ESWA 4QXDA 3PPOA 4YB7A 1N7XA 3SEYA 5A5LA 3OENA 1YPNA 2I4CA 2O1MA 1RDZA 3Q25A 1LGBC 4OVTA 3G3FA 4F3BA 5I5PA 4X8RA 4HTGA 5CMBA 1LFGA 4ELRA 5DVJA 2WBBA 3M3FA 1MPCA 3HHFA 4RJZA 3MAMA 4EF2A 1B32A 4JBZA 1XVYA 5CBSA 3IAZA 5JTYA 4PFWA 2GHBA 1FBGA 5TPAB 2AL5A 3K0VA 2P0SA 3MBPA 4RPOA 4M4GA 1JP4A 4PBQA 3MSTA 5A5XB 2H98A 2O7IA 3TTKA 5AA4A 1NUWA 3C9HA 1P1OA 4KCCA 1Y3NA 5KDTA 4LQ2A 4PFIA 1B2HA 3MPLA 4NN3A 4NF5B 4PAFA 4R74A 3KJ7A 3GBBA 4N8YA 3N94A 3LC8A 5I3SA 1I6QA 4EXKA 5J1DA 4IY6A 1MG1A 1OVBA 1VFEA 4H46A 4OVQA 1POY1 2UVHA 2F6GA 3THIA 5DTBA 3EKIA 2PBWA 1Y20A 2GHAA 2PVUA 5LDZA 5L8DA 3GYYA 1R9QA 3B7DA 2ALUA 5AA2D 3QK6A 1MQHA 2DWJA 1MXXA 4K3FA 1INPA 2D21A 4ZEFA 4BDNA 4ZZAA 5FTHA 3FIRA 2O6AA 4E0XA 1FPJA 1FRPA 1IQ7A 2XXVA 5AA2B 1EYJA 1YTVA 4DXCA 3M3LA 3IOWA 1MY2A 1EZ9A 1BIYA 2HFBA 4YKJA 5I2NA 2DSFA 2QS3A 3SERA 1N76A 3W15C 3MW0A 1FBDA 1G0IA 4JB7A 4DDDA 2F3DA 2O68A 3KSXA 1FPIA 4ELQA 4OVSA 3LBSA 3FJGA 2QJEA 4HCYA 4BDMA 5BWJA 3D1RA 2V3UA 5FHOA 3CG3A 3UIFA 2CZLA 1A8EA 3FD3A 5F24A 1EYIA 1GTKA 2RC8A 3AXFA 3CIJA 1B3EA 3JZJA 3OMBA 2QMXA 1D9QA 1PB8A 5KCJA 2I0CA 4DI3D 4G2ZA 3VLUA 1A8FA 2XXKA 4F2OA 1B0HA 3O97A 2OX3A 2W7YA 2Z22A 3TYHA 4DXBA 5H8HA 2ZNUA 4QRZA 3UP9A 4NAPA 3PGFA 1NNFA 4FIMA 3ILUB 1R6ZA 4BDQA 3QAXA 3GXAA 1SW4A 1XOCA 1DTGA 3FV2A 1H45A 1FBCA 4BDLA 3EHUA 2Q8MA 1JVXA 3FXRA 1R9LA 2NVUB 3M3KA 1B46A 2F35A 3OXNA 4N91A 3IX1A 1FTKA 1MDP1 4PFYA 2V3TA 2DXYA 3E13X 1SW2A 3FVGA 4EUOA 1WDNA 4F1VA 2BJJX 1QKAA 2Y7RA 3C34A 4GXSB 3KOTA 3PD8A 3MZBA 1SYHA 2HPGA 1A55A 1JETA 4IO7A 3VFJA 2A5TA 4UACA 3BIHA 3UN6A 5I59B 4KHZE 4X1BA 3KN7A 1GGGA 1MQGA 4PDHA 2Y7WA 5L9SA 1IXCA 1NV7A 4P0GA 5EYFA 2ZZWA 3FVOA 2UYEA 3H6TA 2H9BA 3B8BA 1H44A 5K2YA 5IM2A 4G61A 5I2KA 4BDRA 1UTBB 1KA1A 1B7UA 2H5YA 3V83A 4OESA 5DT6A 5DEXB 4Z7EA 5I7IA 4GWYA 1N3WA 1IMFA 2VPNA 4F39A 3KN3A 1JEVA 1VDWA 3CR9A 3DP8A 1QUKA 3B6TA 5HM4B 2ZZXA 4QFLA 3UGWA 5HBCA 1FJ6A 4U2RA 2P1SA 2ZMBA 2XXXA 3MVYA 3BKIB 5DVIA 4O3CA 1MPDA 2L5VA 4YKPA 4YB6A 3BFTA 4PTKA 1FQEA 4QSEA 3QUFA 1NMUA 3DLNA 2Y7IA 3O28A 1BKAA 2LAOA 1PBQA 5EQAA 1B1HA 1NV3A 2O84X 1SW1A 5ITPA 2NUVA 4P56A 2DDKA 4IGTA 1NNPA 2V93A 1FTOA 3KFMA 5H8SA 3JV9A 3SZPA 1CNQA 5ITOA 3BBRA 3TTNA 2HZKA 4NF4B 4NEDA 2Y84A 4ZS9A 4H8JA 4P1LA 4ESXA 1DMBA 3IOVA 3IR1A 1QUJA 4NQ8A 2NOOA 2HCAA 1I6BA 5KZTA 1SPIA 2Z8DA 1MY0A 1Q1KA 1A99A 2QMWA 1LAGE 4PQJA 2XXIA 1IXHA 2AYSA 4FJPA 4LVQA 3PTYA 3PPRA 2Y5LA 1SD3A 4FECA 2QPQA 3RGYA 5H8NA 1DPEA 5L9OA 1B5HA 1ZBMA 3RPLA 4R6KA 2QFLA 3PUWE 4LA9A 2PT2A 2AL4A 2ZYKA 4RXLA 1O63A 1LBVA 5EYHA 3HCQA 3VVDA 3C31A 1FBPA 2DQVA 2PYYA 2WX9A 3B50A 1R1NA 1FPBA 3K00A 1DBZA 4GBVA 4GX4A 4BLAA 2I58A 1LAXA 5CRYA 4F19A 1UTHA 1CB6A 3V5AA 4G68A 4WEPA 4KYDA 4XFEA 1VR5A 3PUZE 1F9BA 3LR1A 4GRKA 1O7TA 3I3VA 1Y9UA 1Y1MA 4I1DA 5AA1A 2FVZA 4POXA 4MEVA 4IO6A 4U1OA 3OEMA 3EPEA 5JTYB 4HXVA 5CMKA 1FTJA 3MP6A 4P11A 3IFCA 4H5FA 3RQTA 3A3UA 4XXUA 4HS7A 2O1LA 2ZNTA 2HAVA 3FBPA 3N6UA 5AE4A 2DXRA 2UVJA 4TLMB 1YAEA 2CMOA 4ND9A 3EHSA 1XVXA 1FTAA 4IR8A 5AA4B 3H6VA 1NUYA 4PDDA 1JW5A 4AQ4A 2Y7PA 1BP5A 1HSJA 3QMFA 1AL3A 4GXAA 5KDTB 1ZU0A 4IO5A 4R2BA 2ZXTA 4WEDA 3VLWA 4NMYA 2PCRA 3CHGA 4MNIA 4IY5A 2XWVA 1JNFA 1P1NA 1MY4A 5CMCA 4OA4A 4YZZA 5H8FA 4MLVA 1IMDA 2ABHA 1Y3QA 4WXJA 2VP1A 3T96B 2F5XA 4GQOA 1NNTA 1TFDA 3ECRA 4F18A 1BLFA 4THIA 4XF5A 1LAFE 2VD2A 1SVXB 3KEIA 3SETA 4QSCA 4OVRA 3CFXA 3PD9A 4U23A 1URDA 1NV5A 1EYKA 2DE4A 3OSQA 1NFTA 4NHBA 1US4A 1LFHA 3C36A 3LUYA 4G8MA 3PUYE 2BJIA 4R6HA 3KG2A 3C35A 4OENA 3OEKA 3H4ZA 1B3HA 1YZ0A 4QFPA 3SDFA 4RYAA 3C33A 4DZ1A 2I6EA 1NKXA 2CZKA 2F78A 4JVDA 3LSFB 2OZZA 1US5A 2XWOA 4MIJA 4NF8A 3U72A 4OFOA 5I2NB 1NUZA 4EQ7A 3S2VA 4GWSA 2FIXA 3H7MA 1H76A 4MCOA 4OXVA 2ZYNA 3Q28A 3MUQA 2OCUA 4H5GA 4GOTA 3T9UA 3QYTA 3E78A 1FQAA 5EQ9A 3KC1A 1QKBA 3BFUA 4KD5A 3VXCA 1IEJA 1T0KA 4DI4B 1FJ9A 3IOTA 4U21A 1NNKA 1XC1A 4QSDA 2XXYA 1AIVA 3CFZA 4R73A 3VLVA 1EZPA 1M5FA 3PPQA 4DCXA 2B65A 3KBRA 1LBXA 1B40A 2KLFA 2HXRA 1VE4A 5KCJB 2FYIA 5FHNA 2HQ0A 3KBZA 5DW8A 3RYDA 1Q35A 4C1UA 1M5EA 1XS5A 1EH3A 3VVFA 2I4BA 1Z7NE 3MP8A 4GFRA 3RUMA 1LLSA 1N04A 3SESA 4GWOA 4DCYA 1A7LA 1AMFA 3PU5A 3IORA 3Q29A 4N6DA 5EHSA 2CEYA 1SQYA 5H8HB 4XKRA 5BUUA 1MY1A 2PX1A 4FBPA 2Q2AA 1YCJA 3RT6B 2X7PA 4F3PA 3MPKA 5ICTA 5ISUA 3PPPA 5CI5A 3LSWA 1FPGA 3CFLA 1K9YA 4Z0IA 3OD7A 4OERA 2M8CA 1USYH 5M2VA 3E3KA 4N6KA 3SEVA 4O3BA 4QFNA 1MH3A 1M5BA 3G3JA 1SDXA 4PE5B 1USYE 4N07A 5AA3A 4PFBA 4QHQA 4EF1A 3FASA 3PMVA 2GQ1A 4XIGQ 4KPTA 3D4GA 1OMPA 3ILTB 2QVRA 4OETA 3HHGA 1RDXA 5ICQA 2PFYA 5F7VA 1MQJA 2DVZA 1MQIA 2DP8A 5EQ8A 3RLFE 4H6DA 4WKMA 3LUZA 4R72A 2A5TB 1LBYA 1DK4A 3L6GA 1HSLA 3VE1B 2I3WA 2REGA 5LTCA 4JVIA 1XT8A 1S7YA 3FJMA 2XWKA 2HEUA 4YICA 4N6PA 1MPBA 3UK4A 4RK9A 3K1PA 3B6QA 4IO4A 2Y7KA 2F3BA 4N15A 1NV0A 5I2KB 1DSNA 2ZNSA 4GX3A 4KI0E 5FHMA 4MLQA 3NOHA 3OO6A 4Q5TA 4OEUA 2IEEA 4PGPA 5IZZA 4OQOA 3L6HA 5ESYA 2OK2A 1ANFA 1HSEA 2FBPA 3HO7A 3D4CA 3SKPA 4MNCA 4PF6A 1A54A 1SBPA 2B4MA 2UVGA 1QULA 1LB8A 4KXPA 4GBWA 3G7WA 5EYGA 4JDFA 5T3JA 4NGUA 2XX7A 4KR5A 1FPLA 1B3GA 4YMAA 2I0BA 3S9EA 3G3KA 4KCDA 4YAHX 3PMWA 2HXWA 4RK2A 4U1ZA 2H4IA 3T22A 5B7DA 1B9JA 4ISUA 3FJ7A 4JSDA 2XXWA 3K1MA 4LONB 1DCUA 1D9VA 1MDQA 2F8DA 4NG7A 3K6WA 3MJNA 2WKYA 4MH5A 1OVTA 3MWBA 5H8QA 4PAKA 2JJKA 1YXIA 2P2AA 2R6GE 2F7AA 5I56A 3MYUA 1LSTA 4YKKA 4ZDMA 3TCFA 4ECFA 2GFEA 2RKMA 3T1BA 1ATGA 4Q30B 4R2FA 3DELB 1FPDA 3LV0A 3KC0A 5IZ3A 3FXQA 2H25A 1FPFA 1EZOA 2O51A 4I8CA 3B6WA 2D5WA 3SEXA 4QFOA 4GWXA 4AB5A 4C1TA 4O3AA 1NH7A 1URGA 4YU0A 1MM6A 4U22A 4LUBA 2REJA 1WVJA 4X48A 5H8NB 4YMBA 1XHYA 3MZ9A 3RPLB 4LN5A 2XX9A 3LSLA 3HV1A 4GF8A 5ET5A 1FW0A 3O6HA 4JWYA 2QRYA 3ODBA 4KFQA 4H1XA 1ZTYA 1IXIA 4OANA 3MVWA 1H43A 3QIMA 4YB5A 4HE2A 1M5DA 3I6VA 4PETA 2XA5A 5K2XA 3O6GA 1FQBA 1UTHB 3N26A 4G68B 2XWIA 4DXUA 5I57A 1VSOA 3TAJA 2I48A 4MMPA 2PFZA 2Z23A 4HCWA 4N4UA 1Y1ZA 1LAHE 5DYHA 3KOSA 5I58A 1NUXA 1IIWA 3U92A 1LBCA 4FE8A 5ET6A 2V84A 3P7IA 3E9XA 1URSA 2XXQA 3ROJA 2F34A 2DWAA 3Q27A 3V8XB 4FATA 4UA8A 4NE4A 1L5TA 4F3SA 4GL8A 1EU8A 4MBPA 1SI0A 4P8BA 3T93B 3C32A 1MY3A 1MQDA 1JVYA 4H45A 3R26A 3TCHA 5JEIA 1QVSA 4G4PA 2F97A 2RCBA 1CE2A 2FHYA 5H8FB 2VGQA 2V25A 2I49A 1YYZA 4NF6A 2X26A 5EHMA 1LFIA 2F7CA 4Q8RA 4OFLA 4GX6A 2UXAA 4PC9A 2ONRA 3CSBA 4JWOA 3EQ1A 3SEWA 3TELA 1KZ8A 1FTMA 4F1UA 4X04A 1DOTA 3W9VA 1NL5A 1PBPA 4ONYA 3UORA 3K2DA 3BIGA 2WYPA 1S9TA 1WODA 4UABA 3TQLA 4NTLA 4NWCA 2XHDA 2WEFA 2ONKE 3G3HA 4MHFA 1OQHA 4O94A 2QL3A 3Q26A 4NF8B 1JEUA 4OVPA 2PT1A 3IO4A 5TP9A 1GVCA 3PV0E 2PMSA 1ZLQA 2F6PA 4C0RA 1OLCA 3FUZA 4GL0A 2O7UA 2VHAA 2KR0A 4F1YA 1FQCA 4KYSA 4ZEBA 3HN0A 3H6UA 3HFUA 4GWWA 4ZE8A 4JVCA 2OWSA 4XKNA 3TTRA 1IMAA 1FTLA 4G8HA 3VV5A 4N13A 3QSLA 3ONMA 4R75A 1QGXA 4F3GA 4XKQA 4EQBA 2R8TA 3PUXE 4RPNA 4O8MA 2DWIA 4G77A 1FSAA 3FGSA 3ZKLA 4P47A 3OO7A 4PFRA 4AS5A 4DE8A 3TTMA 3ZS6A 5ET8A 1O64A 3MZ1A 2QVVA 1B6HA 3T9VA 4P3LA 4GWZA 3S9MC 3WAFA 3VXBA 3RY3A 3KN8A 2Q2CA 4H0WA 2XXTA 1UIUA 3OOAA 1KA0A 4OHNA 3M8UA 3U65A 2QS1A 4X9TA 3JYRA 4PGNA 1TFAA 4ZZEA 2Q9TA 5IAIA 4IGRA 4N17A 4GD5A 4LATA 2Z8FA 1FBEA 3RT8A 2RC9A 2V3QA 4H67A 4MNPA 3WAEA 2H99A 3DP4A 4I3EA 4OTEA 1DPPA 1RDYA 3QXMA 4GWUA 1NV1A 1GR2A 5IKBA 3EF7A 2NWJA 3DP6A 2WYKA 4TQUQ 5ET7A 1Q9DA 3FVNA 4RNSA 4PF8A 4JSOA 1LCTA 1LCFA 2VOZA 4I40A 1VFDA 4IB2A 4DIGA 1JQFA 4NF0A 1TWYA 4F29A 3IB1A 4ZE9A 4ZEDA 4U4SA 5CC2A 3TFLA 3MVXA 4AS4A 4PCDA 3HPIA 1P1WA 2IA4A 2QSXA 1K9ZA 1RYOA 2D3IA 3IL1B 4KYEA 2DE2A 1FBFA 4QBAA 4FEBA 2Q88A 2DVCA 4PBHA 4U4XA 2X7QA 1IXGA 1H3DA 1N84A 2XXPA 4XTCQ 3S9LC 1P1QA 4MAGA 2NXOA 2YJPA 3TZAA 4F31B 1NV4A 1PDAA 1MXYA 4H8IA 4IO3A 3MQ9A 1JW4A 2XXRA 3TKDA 5J16A 5TPAA 3VVEA 4N81A
chains in the Genus database with same CATH topology
1RDZA 1IMBA 1FPEA 3T1BA 4OVTA 5I5PA 1FPDA 4X8RA 3LV0A 4P9KA 2WBDA 3KC0A 1LBVA 2WBBA 4P1EA 5EYHA 5IZ3A 1FBPA 1FPFA 2CZIA 2WX9A 3B50A 1FPBA 4GWXA 1DBZA 4GBVA 4GX4A 1NV2A 1FBGA 2VPOA 2Q74A 3RPLB 4LN5A 4F19A 5JK4A 5ET5A 1JP4A 4XFEA 2MKZA 4PBQA 3MSTA 4M1VA 1NUWA 4OANA 5IZ3B 2FVZA 4MEVA 1LBWA 4XEQA 4HE2A 5IZ1A 4PFIA 4HXVA 4NN3A 3IFCA 4HE0A 2B4LA 4PETA 4PAFA 2XA5A 4PAIA 4NX1A 4N8YA 5I3SA 3FBPA 5J1DA 4H46A 2XWIA 4OVQA 4MJOA 4MMPA 1FTAA 2PFZA 4IR8A 3EKIA 1NUYA 2QVUA 4HCWA 4N4UA 4PDDA 2HZLA 5LDZA 3GYYA 3QMFA 1NUXA 1FPKA 2PCRA 3CHGA 4MNIA 2XWVA 1INPA 5ET6A 2P3VA 4OA4A 4YZZA 3ISPA 2HHMA 1IMDA 1FPJA 3ROJA 1FRPA 2F5XA 1EYJA 4F18A 2VT5A 4XF5A 1G0HA 4OVRA 4P8BA 4N8GA 1NV5A 1EYKA 4H45A 3W9WA 2DE4A 4NHBA 2DE3A 2FHYA 1FBDA 1G0IA 2BJIA 1YYZA 2F3DA 1FPIA 4I3YA 1YZ0A 4OVSA 4GX6A 2CZKA 4JVDA 4MX6A 4HCYA 4PC9A 3D1RA 2XWOA 4MIJA 1NUZA 4GWSA 1KZ8A 5F24A 2FIXA 4F1UA 1EYIA 1LEVA 4X04A 3W9VA 1XI6A 4MCOA 1D9QA 2OWZA 3BIGA 2WYPA 4UABA 4DI3D 3E78A 5EQ9A 3KC1A 2WEFA 2XXKA 4MHFA 4O94A 4DI4B 2OX3A 1FJ9A 4OVPA 2P3NA 4NAPA 2V4CA 1FBHA 1NI9A 1LBXA 1FBCA 2HXRA 2KR0A 2Q8MA 4O7IA 3KBZA 3RYDA 5DW8A 3HFUA 3IFAA 4GWWA 5FBPA 4JVCA 4N91A 1IMAA 4PE3A 4N6DA 2CEYA 1LBZA 1NV6A 1QGXA 4FBPA 2R8TA 4O8MA 4F1VA 1FPGA 1FSAA 4P47A 1K9YA 4PFRA 4AS5A 2HPGA 4N6KA 5ET8A 2QVVA 2KQZA 1IMEA 3BIHA 4P3LA 4GWZA 4PFBA 4PDHA 2CZHA 2GQ1A 2QVRA 1NV7A 1IMCA 2ZZWA 1KA0A 1RDXA 3U65A 3B8BA 3FXBA 4X9TA 2PFYA 4O7MA 4PGNA 5IM2A 4G61A 2DVZA 1KA1A 2Q9TA 5EQ8A 3LUZA 1LBYA 4N17A 1DK4A 5I7IA 4GWYA 1FBEA 3T0JA 1IMFA 2VPNA 3E79A 2Y5KA 1VDWA 5LTCA 4JVIA 2V3QA 2ZZXA 2XWKA 4MNPA 4YICA 1FJ6A 4I3EA 1AWBA 2F3BA 2L5VA 1RDYA 1NV0A 4N15A 5IGAA 4PTKA 4GWUA 1NV1A 1BK4A 4GX3A 2WYKA 3NOHA 5EQAA 5ET7A 1Q9DA 4PGPA 4PF8A 5IZZA 1NV3A 5ESYA 2CEXA 2FBPA 4P56A 2DDKA 4MNCA 4PF6A 4I40A 2B4MA 4KXPA 4GBWA 5CM6A 4NF0A 5EQ7A 5EYGA 3SZPA 1CNQA 2HZKA 4HE1A 4AS4A 5T3JA 4NGUA 1FPLA 4PCDA 1K9ZA 2DE2A 4P1LA 1FBFA 4QBAA 4NQ8A 4PBHA 1SPIA 1DCUA 2FIEA 4NG7A 4MAGA 3PTYA 1NV4A 4PAKA 2JJKA 1YXIA 2Y5LA 3MYUA 3A29A 2ZZVA 2QPQA 4QXDA 5J16A 3RPLA 5A5LA 4N81A 2QFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOH A; 
#chains in the Genus database with same CATH topology
 1BTJ A;  1IMB A;  1I6A A;  5A5X A;  1FPE A;  2DYX A;  4JWX A;  1PC3 A;  4X1D A;  3USD A;  2OJT A;  4P9K A;  4R9F A;  2WBD A;  4QFK A;  3S4U A;  4P1E A;  3F11 A;  1N3X A;  5H8Q B;  2CZI A;  1P99 A;  4FAJ A;  1MXV A;  4P0I A;  5I56 B;  3CI8 A;  3O6I A;  1MM7 A;  1B7H A;  1N7W A;  1NV2 A;  2O69 A;  4NF5 A;  2RF1 A;  1IIT A;  3K6X A;  1Z7M E;  2VPO A;  4QF9 A;  2Q74 A;  3K4U A;  1LB9 A;  4EXL A;  3EN3 A;  5JK4 A;  1N0T A;  2ANJ A;  3RTW B;  2MKZ A;  1B58 A;  1D9Y A;  4FOR A;  2ONS A;  4JXI A;  3OSR A;  4M1V A;  1B5I A;  1QW0 A;  2GH9 A;  5IZ3 B;  4OFJ A;  3IB0 A;  2RC7 A;  1LBW A;  3KZG A;  4XEQ A;  3IJO B;  3MP1 A;  1S50 A;  1QJM A;  5IZ1 A;  3K6U A;  1I69 A;  1B5J A;  5LOM A;  3S9N C;  3T9X B;  1Y3P A;  4HE0 A;  2B4L A;  2ZYM A;  4PAI A;  4NX1 A;  3FV1 A;  2UVI A;  5F1Q A;  3ZSF A;  2UYF A;  4XKP A;  1PB7 A;  3RN8 A;  3H03 A;  4MJO A;  3VDF A;  5AA2 A;  3C4M A;  4KQP A;  5DVF A;  1UQW A;  1FQD A;  2QVU A;  4TLL B;  4H65 A;  2HZL A;  2XD2 A;  4F2Q A;  2A5S A;  3T9H B;  1ZIU A;  1FPK A;  1IUD A;  2XD3 A;  3G3G A;  3TMG A;  4PFU A;  4LZ7 A;  3GBA A;  2P3V A;  3RTF B;  4ELP A;  3ISP A;  2HHM A;  3T66 A;  5I57 B;  1KWH A;  4GIZ A;  4LQ5 A;  1Y4C A;  4FED A;  3PUV E;  2VT5 A;  2ZYO A;  1G0H A;  3O2A A;  1MH4 A;  5I58 B;  1A40 A;  3UA8 A;  4N8G A;  1PEB A;  2G93 A;  2QS4 A;  2DOJ A;  3O9P A;  3TOD A;  4R9G A;  2OWT A;  3W9W A;  3I5O A;  1GV8 A;  2DE3 A;  3RNN A;  1D4N A;  1QUI A;  3E4R A;  4ZEK A;  4BDO A;  2XXH A;  4F22 A;  5I84 A;  2HAU A;  1B1X A;  1DTZ A;  2ESN A;  4I3Y A;  1P1U A;  3R7X A;  4RY1 A;  1PB9 A;  1OQG A;  2OLB A;  4MX6 A;  4OVJ A;  5FTI A;  3IB2 A;  2Q8J A;  2YLN A;  3N5L A;  3CRB A;  3TCG A;  2XXU A;  3FVK A;  1B05 A;  3K02 A;  1LEV A;  4YKI A;  1XI6 A;  3H3G A;  4EDP A;  3FXU A;  3ZKK A;  1OLA A;  4NF6 B;  1MXW A;  2VD3 A;  2RIN A;  3IOU A;  4L17 A;  2OWZ A;  1B7Z A;  4GVO A;  1SI1 A;  1B52 A;  3KGC A;  1M5C A;  4ZEC A;  3CG1 A;  5B70 A;  4PP0 A;  2B3B A;  2P3N A;  1OIB A;  4EQ9 A;  1JW1 A;  4TOZ A;  2XX8 A;  2V4C A;  3A3C A;  1FQF A;  1FBH A;  1NI9 A;  4OWD A;  1AH5 A;  1SYI A;  4PFT A;  3HST A;  4O7I A;  4AB6 A;  1ELJ A;  4OYV A;  3IO6 A;  3TTL A;  3IFA A;  5FBP A;  3KJT A;  1B51 A;  3U93 A;  5L9M A;  4PE3 A;  3GZG A;  3IJX B;  3R6U A;  5TP9 B;  1LBZ A;  5I59 A;  1NV6 A;  3MC2 A;  3H6W A;  3U94 A;  2FA7 A;  4HW8 A;  2GRV A;  2E1S A;  4ZEI A;  3U1O A;  2OBG A;  1UTB A;  1IZ1 A;  2B3F A;  4LZ8 A;  3RPW A;  2F36 A;  4LP2 B;  2KQZ A;  3DM0 A;  5DEX A;  2DWH A;  5TU0 A;  1IME A;  3SEU A;  3PPN A;  3H06 B;  2E0S A;  2CZH A;  1UIV A;  2R71 A;  4DLD A;  2RCA A;  3TUS A;  1IMC A;  2AIX A;  3FXB A;  1TT1 A;  4O7M A;  3IK6 B;  4ELO A;  3OO9 A;  3N6T A;  3A09 A;  4Q0C A;  1II5 A;  4OEV A;  5ELV A;  1B4H A;  1B3L A;  2THI A;  2F7B A;  2G29 A;  3T0J A;  3E79 A;  2Y5K A;  1SW5 A;  3O29 A;  3K01 A;  4IO2 A;  1RKM A;  1MS7 A;  1MXZ A;  1AOV A;  1ZMG A;  4POW A;  1AWB A;  1B3F A;  5IGA A;  2FNC A;  5CMM A;  1BK4 A;  4OMB A;  4RA1 A;  1NH8 A;  4NF4 A;  3V89 B;  3CVG A;  3OO8 A;  4NWD A;  4E0W A;  3TDJ A;  1ZJL A;  1MXU A;  3GLB A;  1FCK A;  4GLI A;  1D3K A;  3TEP A;  4G8N A;  3TPA A;  2CEX A;  5HPQ A;  1B0L A;  1MRP A;  3U8Q A;  3K6V A;  3LSX A;  1Y4T A;  3OEL A;  5CBR A;  1J1N A;  3FZV A;  2YPN A;  3FAT A;  5CM6 A;  5EQ7 A;  1B4Z A;  3MVZ A;  4HE1 A;  4MF3 A;  4R6Y A;  3EHT A;  3QUJ A;  2Q89 A;  3O66 A;  4LZ5 A;  2Z8E A;  2I3V A;  3TQW A;  3K1N A;  2R9J A;  3KSJ A;  3CSG A;  2FIE A;  2DS9 A;  4I9D A;  4G68 C;  2QS2 A;  3PMX A;  1TXF A;  4I62 A;  1LBB A;  1RYX A;  1POT A;  4OZ9 A;  4MFI A;  3G3I A;  1ZKB A;  3A29 A;  2ZZV A;  4ESW A;  4QXD A;  3PPO A;  4YB7 A;  1N7X A;  3SEY A;  5A5L A;  3OEN A;  1YPN A;  2I4C A;  2O1M A;  1RDZ A;  3Q25 A;  1LGB C;  4OVT A;  3G3F A;  4F3B A;  5I5P A;  4X8R A;  4HTG A;  5CMB A;  1LFG A;  4ELR A;  5DVJ A;  2WBB A;  3M3F A;  1MPC A;  3HHF A;  4RJZ A;  3MAM A;  4EF2 A;  1B32 A;  4JBZ A;  1XVY A;  5CBS A;  3IAZ A;  5JTY A;  4PFW A;  2GHB A;  1FBG A;  5TPA B;  2AL5 A;  3K0V A;  2P0S A;  3MBP A;  4RPO A;  4M4G A;  1JP4 A;  4PBQ A;  3MST A;  5A5X B;  2H98 A;  2O7I A;  3TTK A;  5AA4 A;  1NUW A;  3C9H A;  1P1O A;  4KCC A;  1Y3N A;  5KDT A;  4LQ2 A;  4PFI A;  1B2H A;  3MPL A;  4NN3 A;  4NF5 B;  4PAF A;  4R74 A;  3KJ7 A;  3GBB A;  4N8Y A;  3N94 A;  3LC8 A;  5I3S A;  1I6Q A;  4EXK A;  5J1D A;  4IY6 A;  1MG1 A;  1OVB A;  1VFE A;  4H46 A;  4OVQ A;  1POY 1;  2UVH A;  2F6G A;  3THI A;  5DTB A;  3EKI A;  2PBW A;  1Y20 A;  2GHA A;  2PVU A;  5LDZ A;  5L8D A;  3GYY A;  1R9Q A;  3B7D A;  2ALU A;  5AA2 D;  3QK6 A;  1MQH A;  2DWJ A;  1MXX A;  4K3F A;  1INP A;  2D21 A;  4ZEF A;  4BDN A;  4ZZA A;  5FTH A;  3FIR A;  2O6A A;  4E0X A;  1FPJ A;  1FRP A;  1IQ7 A;  2XXV A;  5AA2 B;  1EYJ A;  1YTV A;  4DXC A;  3M3L A;  3IOW A;  1MY2 A;  1EZ9 A;  1BIY A;  2HFB A;  4YKJ A;  5I2N A;  2DSF A;  2QS3 A;  3SER A;  1N76 A;  3W15 C;  3MW0 A;  1FBD A;  1G0I A;  4JB7 A;  4DDD A;  2F3D A;  2O68 A;  3KSX A;  1FPI A;  4ELQ A;  4OVS A;  3LBS A;  3FJG A;  2QJE A;  4HCY A;  4BDM A;  5BWJ A;  3D1R A;  2V3U A;  5FHO A;  3CG3 A;  3UIF A;  2CZL A;  1A8E A;  3FD3 A;  5F24 A;  1EYI A;  1GTK A;  2RC8 A;  3AXF A;  3CIJ A;  1B3E A;  3JZJ A;  3OMB A;  2QMX A;  1D9Q A;  1PB8 A;  5KCJ A;  2I0C A;  4DI3 D;  4G2Z A;  3VLU A;  1A8F A;  2XXK A;  4F2O A;  1B0H A;  3O97 A;  2OX3 A;  2W7Y A;  2Z22 A;  3TYH A;  4DXB A;  5H8H A;  2ZNU A;  4QRZ A;  3UP9 A;  4NAP A;  3PGF A;  1NNF A;  4FIM A;  3ILU B;  1R6Z A;  4BDQ A;  3QAX A;  3GXA A;  1SW4 A;  1XOC A;  1DTG A;  3FV2 A;  1H45 A;  1FBC A;  4BDL A;  3EHU A;  2Q8M A;  1JVX A;  3FXR A;  1R9L A;  2NVU B;  3M3K A;  1B46 A;  2F35 A;  3OXN A;  4N91 A;  3IX1 A;  1FTK A;  1MDP 1;  4PFY A;  2V3T A;  2DXY A;  3E13 X;  1SW2 A;  3FVG A;  4EUO A;  1WDN A;  4F1V A;  2BJJ X;  1QKA A;  2Y7R A;  3C34 A;  4GXS B;  3KOT A;  3PD8 A;  3MZB A;  1SYH A;  2HPG A;  1A55 A;  1JET A;  4IO7 A;  3VFJ A;  2A5T A;  4UAC A;  3BIH A;  3UN6 A;  5I59 B;  4KHZ E;  4X1B A;  3KN7 A;  1GGG A;  1MQG A;  4PDH A;  2Y7W A;  5L9S A;  1IXC A;  1NV7 A;  4P0G A;  5EYF A;  2ZZW A;  3FVO A;  2UYE A;  3H6T A;  2H9B A;  3B8B A;  1H44 A;  5K2Y A;  5IM2 A;  4G61 A;  5I2K A;  4BDR A;  1UTB B;  1KA1 A;  1B7U A;  2H5Y A;  3V83 A;  4OES A;  5DT6 A;  5DEX B;  4Z7E A;  5I7I A;  4GWY A;  1N3W A;  1IMF A;  2VPN A;  4F39 A;  3KN3 A;  1JEV A;  1VDW A;  3CR9 A;  3DP8 A;  1QUK A;  3B6T A;  5HM4 B;  2ZZX A;  4QFL A;  3UGW A;  5HBC A;  1FJ6 A;  4U2R A;  2P1S A;  2ZMB A;  2XXX A;  3MVY A;  3BKI B;  5DVI A;  4O3C A;  1MPD A;  2L5V A;  4YKP A;  4YB6 A;  3BFT A;  4PTK A;  1FQE A;  4QSE A;  3QUF A;  1NMU A;  3DLN A;  2Y7I A;  3O28 A;  1BKA A;  2LAO A;  1PBQ A;  5EQA A;  1B1H A;  1NV3 A;  2O84 X;  1SW1 A;  5ITP A;  2NUV A;  4P56 A;  2DDK A;  4IGT A;  1NNP A;  2V93 A;  1FTO A;  3KFM A;  5H8S A;  3JV9 A;  3SZP A;  1CNQ A;  5ITO A;  3BBR A;  3TTN A;  2HZK A;  4NF4 B;  4NED A;  2Y84 A;  4ZS9 A;  4H8J A;  4P1L A;  4ESX A;  1DMB A;  3IOV A;  3IR1 A;  1QUJ A;  4NQ8 A;  2NOO A;  2HCA A;  1I6B A;  5KZT A;  1SPI A;  2Z8D A;  1MY0 A;  1Q1K A;  1A99 A;  2QMW A;  1LAG E;  4PQJ A;  2XXI A;  1IXH A;  2AYS A;  4FJP A;  4LVQ A;  3PTY A;  3PPR A;  2Y5L A;  1SD3 A;  4FEC A;  2QPQ A;  3RGY A;  5H8N A;  1DPE A;  5L9O A;  1B5H A;  1ZBM A;  3RPL A;  4R6K A;  2QFL A;  3PUW E;  4LA9 A;  2PT2 A;  2AL4 A;  2ZYK A;  4RXL A;  1O63 A;  1LBV A;  5EYH A;  3HCQ A;  3VVD A;  3C31 A;  1FBP A;  2DQV A;  2PYY A;  2WX9 A;  3B50 A;  1R1N A;  1FPB A;  3K00 A;  1DBZ A;  4GBV A;  4GX4 A;  4BLA A;  2I58 A;  1LAX A;  5CRY A;  4F19 A;  1UTH A;  1CB6 A;  3V5A A;  4G68 A;  4WEP A;  4KYD A;  4XFE A;  1VR5 A;  3PUZ E;  1F9B A;  3LR1 A;  4GRK A;  1O7T A;  3I3V A;  1Y9U A;  1Y1M A;  4I1D A;  5AA1 A;  2FVZ A;  4POX A;  4MEV A;  4IO6 A;  4U1O A;  3OEM A;  3EPE A;  5JTY B;  4HXV A;  5CMK A;  1FTJ A;  3MP6 A;  4P11 A;  3IFC A;  4H5F A;  3RQT A;  3A3U A;  4XXU A;  4HS7 A;  2O1L A;  2ZNT A;  2HAV A;  3FBP A;  3N6U A;  5AE4 A;  2DXR A;  2UVJ A;  4TLM B;  1YAE A;  2CMO A;  4ND9 A;  3EHS A;  1XVX A;  1FTA A;  4IR8 A;  5AA4 B;  3H6V A;  1NUY A;  4PDD A;  1JW5 A;  4AQ4 A;  2Y7P A;  1BP5 A;  1HSJ A;  3QMF A;  1AL3 A;  4GXA A;  5KDT B;  1ZU0 A;  4IO5 A;  4R2B A;  2ZXT A;  4WED A;  3VLW A;  4NMY A;  2PCR A;  3CHG A;  4MNI A;  4IY5 A;  2XWV A;  1JNF A;  1P1N A;  1MY4 A;  5CMC A;  4OA4 A;  4YZZ A;  5H8F A;  4MLV A;  1IMD A;  2ABH A;  1Y3Q A;  4WXJ A;  2VP1 A;  3T96 B;  2F5X A;  4GQO A;  1NNT A;  1TFD A;  3ECR A;  4F18 A;  1BLF A;  4THI A;  4XF5 A;  1LAF E;  2VD2 A;  1SVX B;  3KEI A;  3SET A;  4QSC A;  4OVR A;  3CFX A;  3PD9 A;  4U23 A;  1URD A;  1NV5 A;  1EYK A;  2DE4 A;  3OSQ A;  1NFT A;  4NHB A;  1US4 A;  1LFH A;  3C36 A;  3LUY A;  4G8M A;  3PUY E;  2BJI A;  4R6H A;  3KG2 A;  3C35 A;  4OEN A;  3OEK A;  3H4Z A;  1B3H A;  1YZ0 A;  4QFP A;  3SDF A;  4RYA A;  3C33 A;  4DZ1 A;  2I6E A;  1NKX A;  2CZK A;  2F78 A;  4JVD A;  3LSF B;  2OZZ A;  1US5 A;  2XWO A;  4MIJ A;  4NF8 A;  3U72 A;  4OFO A;  5I2N B;  1NUZ A;  4EQ7 A;  3S2V A;  4GWS A;  2FIX A;  3H7M A;  1H76 A;  4MCO A;  4OXV A;  2ZYN A;  3Q28 A;  3MUQ A;  2OCU A;  4H5G A;  4GOT A;  3T9U A;  3QYT A;  3E78 A;  1FQA A;  5EQ9 A;  3KC1 A;  1QKB A;  3BFU A;  4KD5 A;  3VXC A;  1IEJ A;  1T0K A;  4DI4 B;  1FJ9 A;  3IOT A;  4U21 A;  1NNK A;  1XC1 A;  4QSD A;  2XXY A;  1AIV A;  3CFZ A;  4R73 A;  3VLV A;  1EZP A;  1M5F A;  3PPQ A;  4DCX A;  2B65 A;  3KBR A;  1LBX A;  1B40 A;  2KLF A;  2HXR A;  1VE4 A;  5KCJ B;  2FYI A;  5FHN A;  2HQ0 A;  3KBZ A;  5DW8 A;  3RYD A;  1Q35 A;  4C1U A;  1M5E A;  1XS5 A;  1EH3 A;  3VVF A;  2I4B A;  1Z7N E;  3MP8 A;  4GFR A;  3RUM A;  1LLS A;  1N04 A;  3SES A;  4GWO A;  4DCY A;  1A7L A;  1AMF A;  3PU5 A;  3IOR A;  3Q29 A;  4N6D A;  5EHS A;  2CEY A;  1SQY A;  5H8H B;  4XKR A;  5BUU A;  1MY1 A;  2PX1 A;  4FBP A;  2Q2A A;  1YCJ A;  3RT6 B;  2X7P A;  4F3P A;  3MPK A;  5ICT A;  5ISU A;  3PPP A;  5CI5 A;  3LSW A;  1FPG A;  3CFL A;  1K9Y A;  4Z0I A;  3OD7 A;  4OER A;  2M8C A;  1USY H;  5M2V A;  3E3K A;  4N6K A;  3SEV A;  4O3B A;  4QFN A;  1MH3 A;  1M5B A;  3G3J A;  1SDX A;  4PE5 B;  1USY E;  4N07 A;  5AA3 A;  4PFB A;  4QHQ A;  4EF1 A;  3FAS A;  3PMV A;  2GQ1 A;  4XIG Q;  4KPT A;  3D4G A;  1OMP A;  3ILT B;  2QVR A;  4OET A;  3HHG A;  1RDX A;  5ICQ A;  2PFY A;  5F7V A;  1MQJ A;  2DVZ A;  1MQI A;  2DP8 A;  5EQ8 A;  3RLF E;  4H6D A;  4WKM A;  3LUZ A;  4R72 A;  2A5T B;  1LBY A;  1DK4 A;  3L6G A;  1HSL A;  3VE1 B;  2I3W A;  2REG A;  5LTC A;  4JVI A;  1XT8 A;  1S7Y A;  3FJM A;  2XWK A;  2HEU A;  4YIC A;  4N6P A;  1MPB A;  3UK4 A;  4RK9 A;  3K1P A;  3B6Q A;  4IO4 A;  2Y7K A;  2F3B A;  4N15 A;  1NV0 A;  5I2K B;  1DSN A;  2ZNS A;  4GX3 A;  4KI0 E;  5FHM A;  4MLQ A;  3NOH A;  3OO6 A;  4Q5T A;  4OEU A;  2IEE A;  4PGP A;  5IZZ A;  4OQO A;  3L6H A;  5ESY A;  2OK2 A;  1ANF A;  1HSE A;  2FBP A;  3HO7 A;  3D4C A;  3SKP A;  4MNC A;  4PF6 A;  1A54 A;  1SBP A;  2B4M A;  2UVG A;  1QUL A;  1LB8 A;  4KXP A;  4GBW A;  3G7W A;  5EYG A;  4JDF A;  5T3J A;  4NGU A;  2XX7 A;  4KR5 A;  1FPL A;  1B3G A;  4YMA A;  2I0B A;  3S9E A;  3G3K A;  4KCD A;  4YAH X;  3PMW A;  2HXW A;  4RK2 A;  4U1Z A;  2H4I A;  3T22 A;  5B7D A;  1B9J A;  4ISU A;  3FJ7 A;  4JSD A;  2XXW A;  3K1M A;  4LON B;  1DCU A;  1D9V A;  1MDQ A;  2F8D A;  4NG7 A;  3K6W A;  3MJN A;  2WKY A;  4MH5 A;  1OVT A;  3MWB A;  5H8Q A;  4PAK A;  2JJK A;  1YXI A;  2P2A A;  2R6G E;  2F7A A;  5I56 A;  3MYU A;  1LST A;  4YKK A;  4ZDM A;  3TCF A;  4ECF A;  2GFE A;  2RKM A;  3T1B A;  1ATG A;  4Q30 B;  4R2F A;  3DEL B;  1FPD A;  3LV0 A;  3KC0 A;  5IZ3 A;  3FXQ A;  2H25 A;  1FPF A;  1EZO A;  2O51 A;  4I8C A;  3B6W A;  2D5W A;  3SEX A;  4QFO A;  4GWX A;  4AB5 A;  4C1T A;  4O3A A;  1NH7 A;  1URG A;  4YU0 A;  1MM6 A;  4U22 A;  4LUB A;  2REJ A;  1WVJ A;  4X48 A;  5H8N B;  4YMB A;  1XHY A;  3MZ9 A;  3RPL B;  4LN5 A;  2XX9 A;  3LSL A;  3HV1 A;  4GF8 A;  5ET5 A;  1FW0 A;  3O6H A;  4JWY A;  2QRY A;  3ODB A;  4KFQ A;  4H1X A;  1ZTY A;  1IXI A;  4OAN A;  3MVW A;  1H43 A;  3QIM A;  4YB5 A;  4HE2 A;  1M5D A;  3I6V A;  4PET A;  2XA5 A;  5K2X A;  3O6G A;  1FQB A;  1UTH B;  3N26 A;  4G68 B;  2XWI A;  4DXU A;  5I57 A;  1VSO A;  3TAJ A;  2I48 A;  4MMP A;  2PFZ A;  2Z23 A;  4HCW A;  4N4U A;  1Y1Z A;  1LAH E;  5DYH A;  3KOS A;  5I58 A;  1NUX A;  1IIW A;  3U92 A;  1LBC A;  4FE8 A;  5ET6 A;  2V84 A;  3P7I A;  3E9X A;  1URS A;  2XXQ A;  3ROJ A;  2F34 A;  2DWA A;  3Q27 A;  3V8X B;  4FAT A;  4UA8 A;  4NE4 A;  1L5T A;  4F3S A;  4GL8 A;  1EU8 A;  4MBP A;  1SI0 A;  4P8B A;  3T93 B;  3C32 A;  1MY3 A;  1MQD A;  1JVY A;  4H45 A;  3R26 A;  3TCH A;  5JEI A;  1QVS A;  4G4P A;  2F97 A;  2RCB A;  1CE2 A;  2FHY A;  5H8F B;  2VGQ A;  2V25 A;  2I49 A;  1YYZ A;  4NF6 A;  2X26 A;  5EHM A;  1LFI A;  2F7C A;  4Q8R A;  4OFL A;  4GX6 A;  2UXA A;  4PC9 A;  2ONR A;  3CSB A;  4JWO A;  3EQ1 A;  3SEW A;  3TEL A;  1KZ8 A;  1FTM A;  4F1U A;  4X04 A;  1DOT A;  3W9V A;  1NL5 A;  1PBP A;  4ONY A;  3UOR A;  3K2D A;  3BIG A;  2WYP A;  1S9T A;  1WOD A;  4UAB A;  3TQL A;  4NTL A;  4NWC A;  2XHD A;  2WEF A;  2ONK E;  3G3H A;  4MHF A;  1OQH A;  4O94 A;  2QL3 A;  3Q26 A;  4NF8 B;  1JEU A;  4OVP A;  2PT1 A;  3IO4 A;  5TP9 A;  1GVC A;  3PV0 E;  2PMS A;  1ZLQ A;  2F6P A;  4C0R A;  1OLC A;  3FUZ A;  4GL0 A;  2O7U A;  2VHA A;  2KR0 A;  4F1Y A;  1FQC A;  4KYS A;  4ZEB A;  3HN0 A;  3H6U A;  3HFU A;  4GWW A;  4ZE8 A;  4JVC A;  2OWS A;  4XKN A;  3TTR A;  1IMA A;  1FTL A;  4G8H A;  3VV5 A;  4N13 A;  3QSL A;  3ONM A;  4R75 A;  1QGX A;  4F3G A;  4XKQ A;  4EQB A;  2R8T A;  3PUX E;  4RPN A;  4O8M A;  2DWI A;  4G77 A;  1FSA A;  3FGS A;  3ZKL A;  4P47 A;  3OO7 A;  4PFR A;  4AS5 A;  4DE8 A;  3TTM A;  3ZS6 A;  5ET8 A;  1O64 A;  3MZ1 A;  2QVV A;  1B6H A;  3T9V A;  4P3L A;  4GWZ A;  3S9M C;  3WAF A;  3VXB A;  3RY3 A;  3KN8 A;  2Q2C A;  4H0W A;  2XXT A;  1UIU A;  3OOA A;  1KA0 A;  4OHN A;  3M8U A;  3U65 A;  2QS1 A;  4X9T A;  3JYR A;  4PGN A;  1TFA A;  4ZZE A;  2Q9T A;  5IAI A;  4IGR A;  4N17 A;  4GD5 A;  4LAT A;  2Z8F A;  1FBE A;  3RT8 A;  2RC9 A;  2V3Q A;  4H67 A;  4MNP A;  3WAE A;  2H99 A;  3DP4 A;  4I3E A;  4OTE A;  1DPP A;  1RDY A;  3QXM A;  4GWU A;  1NV1 A;  1GR2 A;  5IKB A;  3EF7 A;  2NWJ A;  3DP6 A;  2WYK A;  4TQU Q;  5ET7 A;  1Q9D A;  3FVN A;  4RNS A;  4PF8 A;  4JSO A;  1LCT A;  1LCF A;  2VOZ A;  4I40 A;  1VFD A;  4IB2 A;  4DIG A;  1JQF A;  4NF0 A;  1TWY A;  4F29 A;  3IB1 A;  4ZE9 A;  4ZED A;  4U4S A;  5CC2 A;  3TFL A;  3MVX A;  4AS4 A;  4PCD A;  3HPI A;  1P1W A;  2IA4 A;  2QSX A;  1K9Z A;  1RYO A;  2D3I A;  3IL1 B;  4KYE A;  2DE2 A;  1FBF A;  4QBA A;  4FEB A;  2Q88 A;  2DVC A;  4PBH A;  4U4X A;  2X7Q A;  1IXG A;  1H3D A;  1N84 A;  2XXP A;  4XTC Q;  3S9L C;  1P1Q A;  4MAG A;  2NXO A;  2YJP A;  3TZA A;  4F31 B;  1NV4 A;  1PDA A;  1MXY A;  4H8I A;  4IO3 A;  3MQ9 A;  1JW4 A;  2XXR A;  3TKD A;  5J16 A;  5TPA A;  3VVE A;  4N81 A; 
#chains in the Genus database with same CATH homology
 1RDZ A;  1IMB A;  1FPE A;  3T1B A;  4OVT A;  5I5P A;  1FPD A;  4X8R A;  3LV0 A;  4P9K A;  2WBD A;  3KC0 A;  1LBV A;  2WBB A;  4P1E A;  5EYH A;  5IZ3 A;  1FBP A;  1FPF A;  2CZI A;  2WX9 A;  3B50 A;  1FPB A;  4GWX A;  1DBZ A;  4GBV A;  4GX4 A;  1NV2 A;  1FBG A;  2VPO A;  2Q74 A;  3RPL B;  4LN5 A;  4F19 A;  5JK4 A;  5ET5 A;  1JP4 A;  4XFE A;  2MKZ A;  4PBQ A;  3MST A;  4M1V A;  1NUW A;  4OAN A;  5IZ3 B;  2FVZ A;  4MEV A;  1LBW A;  4XEQ A;  4HE2 A;  5IZ1 A;  4PFI A;  4HXV A;  4NN3 A;  3IFC A;  4HE0 A;  2B4L A;  4PET A;  4PAF A;  2XA5 A;  4PAI A;  4NX1 A;  4N8Y A;  5I3S A;  3FBP A;  5J1D A;  4H46 A;  2XWI A;  4OVQ A;  4MJO A;  4MMP A;  1FTA A;  2PFZ A;  4IR8 A;  3EKI A;  1NUY A;  2QVU A;  4HCW A;  4N4U A;  4PDD A;  2HZL A;  5LDZ A;  3GYY A;  3QMF A;  1NUX A;  1FPK A;  2PCR A;  3CHG A;  4MNI A;  2XWV A;  1INP A;  5ET6 A;  2P3V A;  4OA4 A;  4YZZ A;  3ISP A;  2HHM A;  1IMD A;  1FPJ A;  3ROJ A;  1FRP A;  2F5X A;  1EYJ A;  4F18 A;  2VT5 A;  4XF5 A;  1G0H A;  4OVR A;  4P8B A;  4N8G A;  1NV5 A;  1EYK A;  4H45 A;  3W9W A;  2DE4 A;  4NHB A;  2DE3 A;  2FHY A;  1FBD A;  1G0I A;  2BJI A;  1YYZ A;  2F3D A;  1FPI A;  4I3Y A;  1YZ0 A;  4OVS A;  4GX6 A;  2CZK A;  4JVD A;  4MX6 A;  4HCY A;  4PC9 A;  3D1R A;  2XWO A;  4MIJ A;  1NUZ A;  4GWS A;  1KZ8 A;  5F24 A;  2FIX A;  4F1U A;  1EYI A;  1LEV A;  4X04 A;  3W9V A;  1XI6 A;  4MCO A;  1D9Q A;  2OWZ A;  3BIG A;  2WYP A;  4UAB A;  4DI3 D;  3E78 A;  5EQ9 A;  3KC1 A;  2WEF A;  2XXK A;  4MHF A;  4O94 A;  4DI4 B;  2OX3 A;  1FJ9 A;  4OVP A;  2P3N A;  4NAP A;  2V4C A;  1FBH A;  1NI9 A;  1LBX A;  1FBC A;  2HXR A;  2KR0 A;  2Q8M A;  4O7I A;  3KBZ A;  3RYD A;  5DW8 A;  3HFU A;  3IFA A;  4GWW A;  5FBP A;  4JVC A;  4N91 A;  1IMA A;  4PE3 A;  4N6D A;  2CEY A;  1LBZ A;  1NV6 A;  1QGX A;  4FBP A;  2R8T A;  4O8M A;  4F1V A;  1FPG A;  1FSA A;  4P47 A;  1K9Y A;  4PFR A;  4AS5 A;  2HPG A;  4N6K A;  5ET8 A;  2QVV A;  2KQZ A;  1IME A;  3BIH A;  4P3L A;  4GWZ A;  4PFB A;  4PDH A;  2CZH A;  2GQ1 A;  2QVR A;  1NV7 A;  1IMC A;  2ZZW A;  1KA0 A;  1RDX A;  3U65 A;  3B8B A;  3FXB A;  4X9T A;  2PFY A;  4O7M A;  4PGN A;  5IM2 A;  4G61 A;  2DVZ A;  1KA1 A;  2Q9T A;  5EQ8 A;  3LUZ A;  1LBY A;  4N17 A;  1DK4 A;  5I7I A;  4GWY A;  1FBE A;  3T0J A;  1IMF A;  2VPN A;  3E79 A;  2Y5K A;  1VDW A;  5LTC A;  4JVI A;  2V3Q A;  2ZZX A;  2XWK A;  4MNP A;  4YIC A;  1FJ6 A;  4I3E A;  1AWB A;  2F3B A;  2L5V A;  1RDY A;  1NV0 A;  4N15 A;  5IGA A;  4PTK A;  4GWU A;  1NV1 A;  1BK4 A;  4GX3 A;  2WYK A;  3NOH A;  5EQA A;  5ET7 A;  1Q9D A;  4PGP A;  4PF8 A;  5IZZ A;  1NV3 A;  5ESY A;  2CEX A;  2FBP A;  4P56 A;  2DDK A;  4MNC A;  4PF6 A;  4I40 A;  2B4M A;  4KXP A;  4GBW A;  5CM6 A;  4NF0 A;  5EQ7 A;  5EYG A;  3SZP A;  1CNQ A;  2HZK A;  4HE1 A;  4AS4 A;  5T3J A;  4NGU A;  1FPL A;  4PCD A;  1K9Z A;  2DE2 A;  4P1L A;  1FBF A;  4QBA A;  4NQ8 A;  4PBH A;  1SPI A;  1DCU A;  2FIE A;  4NG7 A;  4MAG A;  3PTY A;  1NV4 A;  4PAK A;  2JJK A;  1YXI A;  2Y5L A;  3MYU A;  3A29 A;  2ZZV A;  2QPQ A;  4QXD A;  5J16 A;  3RPL A;  5A5L A;  4N81 A;  2QFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...