3NOHA

Crystal structure of a putative peptide binding protein (rumgna_00914) from ruminococcus gnavus atcc 29149 at 1.60 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENADYIILDSAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative peptide binding protein (RUMGNA_00914) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Peptide binding protein
molecule keywords putative peptide binding protein
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.210 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3nohA00
3NOHA
chains in the Genus database with same CATH superfamily
2D21A 3UK4A 4NF5A 1KA1A 2NOOA 4R73A 4OVTA 3HV1A 2V84A 1MH3A 3OO6A 4KI0E 4X1DA 3HFUA 2DYXA 2RINA 3FATA 1FBGA 3OOAA 4LONB 4PTKA 4PQJA 1MXWA 4XIGQ 2G93A 3M3LA 3GLBA 1FTOA 1LGBC 4KYDA 4X1BA 2YPNA 3BKIB 1GTKA 2YJPA 1LCFA 4HE0A 1UTBB 1XVXA 3G3IA 2I58A 1II5A 3CRBA 4M1VA 1MS7A 4YKKA 1N7XA 4FECA 4TLMB 2F35A 3HHGA 4NQ8A 4GX4A 3SZPA 2Y7WA 2Q2CA 2PVUA 4IB2A 4QFPA 2DE3A 3TEPA 1XVYA 5K2XA 2DWHA 2Z22A 4NF5B 4E0XA 3TCGA 2F34A 4FIMA 3RPLB 4FAJA 4C1UA 1VFDA 1PB7A 2DVZA 4Q0CA 4QXDA 1TT1A 3KFMA 4PE3A 5TPAA 3C35A 2F5XA 4DCXA 2ESNA 4GL0A 4GX6A 3IFAA 3OO7A 4G8HA 4RNSA 1OQGA 2I3VA 5F24A 5J1DA 2WEFA 1YZ0A 1JW5A 2ZYMA 3MZ9A 1H44A 5KZTA 3IJXB 3H6WA 1LLSA 4O7MA 4U2RA 5A5XA 3H6TA 1UTHA 1FTMA 3H03A 3MZBA 4G68B 1ELJA 4ZEDA 3TTNA 4H1XA 4GX3A 4GBWA 4HW8A 4GOTA 3C4MA 5JEIA 1EU8A 5H8HB 1AMFA 2Q74A 2F6GA 3A3UA 3H4ZA 4ELOA 3TPAA 4PE5B 3G3FA 3ZS6A 1AIVA 4XFEA 4OFJA 4ZE9A 3QYTA 1MQHA 4P47A 2I48A 3KGCA 4XKRA 2I3WA 4N8GA 3U94A 1QJMA 2XWIA 4P0IA 1RDYA 3KJ7A 5FHNA 3OELA 4MLVA 4NX1A 3FBPA 3JYRA 1N0TA 3KBZA 4H5GA 4BLAA 3C31A 2AL5A 3ZKKA 2QS1A 3B6TA 1YXIA 3JZJA 3QSLA 2F3BA 3GBBA 1IMCA 2Z8FA 1FW0A 3VLVA 3U92A 3ECRA 1Y1ZA 1BP5A 1NFTA 1Y3PA 1NV2A 3S9LC 4XTCQ 3ZSFA 4MEVA 5A5LA 3FZVA 2XX8A 5CMCA 3O6IA 3TTMA 2H99A 4GWOA 4KCDA 2V3UA 4PFUA 1A99A 5IZ3A 3ROJA 2HFBA 1Y3QA 4HS7A 3TELA 4ZS9A 2PMSA 2PT2A 4LZ8A 4NTLA 3FIRA 4KPTA 3IO6A 2V3TA 3IB2A 4QF9A 2A5TB 2B65A 1YYZA 5IZZA 3O66A 1JNFA 2FBPA 4MLQA 4BDNA 4HE2A 3C33A 1IMAA 1FQBA 5CRYA 3UA8A 3K1PA 4EUOA 5ELVA 3HCQA 4THIA 4NN3A 4BDRA 3ILUB 4PFBA 1B0HA 2YLNA 5I7IA 2GHBA 2PFYA 1D4NA 4U4SA 2XXPA 4H45A 2ANJA 3KN3A 3CFXA 4X9TA 2RC9A 4NMYA 5ET6A 3CSBA 5JK4A 2XXXA 1MH4A 4PC9A 4OVPA 4O3AA 3TFLA 1B3LA 3IR1A 4C0RA 4EXLA 5TPAB 4TOZA 2D3IA 4P9KA 1NV4A 2VT5A 1TFAA 1US5A 3UGWA 3TZAA 2XXUA 2ZXTA 3EF7A 5TU0A 4NF4A 4GIZA 2F36A 4X48A 3SEUA 1FBPA 1LB9A 1SVXB 4G2ZA 4OHNA 3K00A 3SKPA 4F1UA 3TUSA 3R6UA 2IEEA 4MH5A 1AWBA 1LEVA 4GVOA 3MZ1A 3AXFA 1N7WA 5H8FB 1SBPA 1SW2A 1WVJA 3PMVA 4U23A 3N26A 4YAHX 5FBPA 1P1NA 2B3BA 3I6VA 2HXRA 1AOVA 1FPEA 1UQWA 1S9TA 4MCOA 3VFJA 5I59B 1RYOA 3A09A 4YMAA 4DDDA 1FTKA 1B3HA 3RN8A 3ILTB 2XXHA 4GWXA 5DEXB 2XXQA 3KZGA 1IXGA 3IOWA 4NF8B 5LTCA 2VOZA 4ZECA 1EYIA 2ZYOA 2LAOA 2W7YA 1B32A 3WAEA 4RJZA 4HE1A 2AL4A 4GBVA 4JVCA 1MM7A 5ITOA 4Q5TA 2Y7KA 3MJNA 4ECFA 4OVRA 4OEUA 4QBAA 4O3BA 3C36A 1MQJA 1Y3NA 1MQIA 5HM4B 2X26A 4QSEA 3EHUA 3RTWB 4ELQA 2CEYA 4EF1A 1FQCA 4N4UA 3H6VA 1B40A 2Q8MA 5DVFA 3K1MA 1FQFA 1O63A 3K1NA 4H6DA 1FPBA 3LSWA 1FSAA 4OZ9A 3IOUA 3TQWA 1URDA 3BIGA 1IXHA 3T66A 1L5TA 3MPLA 2I0BA 5K2YA 5TP9A 2E1SA 3RTFB 1QUIA 1GVCA 1FTAA 1OIBA 3T22A 2HZLA 2HQ0A 4OVSA 1EZ9A 1URSA 1I6AA 1LBXA 2CZIA 4PF8A 2E0SA 2XXYA 4NAPA 3KN8A 3LV0A 1A54A 1LBCA 1YAEA 3O29A 2DE4A 1HSEA 3VLUA 3BFUA 2R6GE 1NUYA 1MPCA 4IY5A 2PYYA 3S9NC 1NI9A 2M8CA 2P1SA 3V5AA 4R74A 4ZEKA 4R2BA 4G4PA 4P3LA 4ND9A 4LA9A 1H76A 2QS4A 2FYIA 4DI3D 3OEMA 5I2KA 3CVGA 3VXCA 3BIHA 4OWDA 1B05A 4ISUA 1OMPA 2Q9TA 4KXPA 1XC1A 1NV5A 4KFQA 1PBPA 1FPLA 2GH9A 2O68A 4EQ7A 2OBGA 1MQGA 2OWTA 5I59A 3E79A 1PEBA 3K02A 3PMWA 3O6HA 2B3FA 3IO4A 2VD2A 4IO2A 1N04A 3W9WA 5B7DA 3FXBA 1BLFA 3VVEA 1J1NA 1KZ8A 1A55A 4LQ5A 2CZHA 4I3YA 5ET5A 1YTVA 1JP4A 5JTYA 4JXIA 5L9MA 3FV1A 4LZ7A 1Y4TA 5H8SA 2QVVA 4DIGA 1FTJA 3EKIA 4O7IA 2DP8A 4N8YA 3C9HA 5H8NB 5DW8A 1IMBA 4GL8A 4L17A 3PV0E 3SESA 4NF6A 2I0CA 1IMFA 3RYDA 3S9EA 2VHAA 1R1NA 3TCHA 3O9PA 4F29A 4GRKA 3FVKA 3PPRA 4IGTA 4PGNA 2FIEA 2F7AA 3R7XA 4OVJA 4GQOA 4POWA 2R8TA 1M5BA 1Y1MA 2BJIA 3T9UA 4ZEFA 2Z8EA 4I9DA 3EPEA 5DVJA 1US4A 1FRPA 3LSLA 4MBPA 1PBQA 4PP0A 1MG1A 3EN3A 4ESXA 1LFHA 2OK2A 4F3SA 3LSXA 1M5FA 3IOTA 4OTEA 2VPNA 2XXWA 1P1OA 1P1UA 2HAUA 3CR9A 4MNPA 4G77A 4PBQA 3T1BA 1IXCA 3ZKLA 3TKDA 1YCJA 5AA4A 3O97A 4G68C 4PAIA 2DXRA 4HTGA 4TQUQ 4F3BA 3USDA 4XKQA 3EHTA 3KEIA 3U93A 3KBRA 3FV2A 1LAHE 2CZLA 1EYKA 2DWAA 3A29A 2CEXA 3N6UA 3U8QA 4KCCA 4POXA 2UXAA 3K0VA 4XXUA 4N6KA 1DTGA 4KYSA 3PD9A 4JVDA 5EQ7A 1WDNA 4OEVA 3IL1B 3B6WA 2Y7PA 4FATA 5DEXA 3PPOA 1N76A 3T9HB 1NNTA 4OA4A 1G0HA 4H67A 3MVZA 4N15A 3KJTA 5ESYA 3ISPA 1LBYA 1ZTYA 3RT6B 2KR0A 2V4CA 3E9XA 4FE8A 4R6HA 3VXBA 3MUQA 1DCUA 4F39A 4GWWA 4NEDA 5CC2A 5KDTB 1I69A 1PB9A 1NNPA 3T0JA 5LDZA 3TTKA 3RQTA 3D4GA 1M5CA 4WEPA 1UIVA 2F6PA 2UYEA 1BK4A 3IX1A 5KCJA 1NV3A 2OX3A 4JDFA 4JWOA 1ZKBA 5AE4A 4ONYA 3DM0A 2H25A 3M3FA 3THIA 5IGAA 4F22A 3KC1A 1Q35A 5EQ8A 1QW0A 4BDMA 4MMPA 2RKMA 2QMWA 4NF4B 1S50A 2MKZA 2PBWA 4UA8A 4YKIA 3DP6A 1USYH 5A5XB 4QSCA 2WKYA 4RPOA 1MY1A 5I2NB 1OVTA 1SW4A 5ET7A 4ELRA 1LBWA 1BTJA 1FPDA 2RC7A 2D5WA 5FHMA 1QVSA 3B7DA 4F31B 3S4UA 1NMUA 1B3GA 1B7UA 1FQDA 4G61A 1PC3A 4P1LA 1YPNA 4KD5A 4H0WA 1Q1KA 2DE2A 1CB6A 3GXAA 3K6VA 3I3VA 1B51A 2KLFA 4H8JA 4XKPA 1A7LA 1INPA 4DZ1A 4F2QA 4PAKA 4AQ4A 4N07A 2NUVA 3SEXA 5EQ9A 2OWSA 3RY3A 1B5JA 2QVUA 3PTYA 4LZ5A 1MDP1 4MNCA 3IOVA 4I3EA 1VFEA 1VSOA 4DCYA 1MY0A 1JVXA 1VE4A 4RY1A 3CFZA 4YB7A 5FTHA 1ZU0A 5HBCA 3L6HA 3CSGA 3KSJA 4RPNA 1GR2A 2PFZA 1B0LA 1JW4A 3LR1A 1EYJA 3MQ9A 1DPEA 1RYXA 1ZBMA 2DS9A 1MXUA 4YICA 3DLNA 1FPJA 4WKMA 3V89B 5FHOA 3K01A 3T93B 2NXOA 2P2AA 1MDQA 4WXJA 4IO6A 4FORA 3G3GA 4AB6A 2REGA 2WBDA 3VLWA 4QFLA 4RK2A 5IM2A 2F3DA 2UYFA 1MY4A 2O7IA 1Y20A 2JJKA 1B3EA 3RT8A 4RK9A 1HSJA 1NL5A 5EHMA 4MJOA 4DXBA 2ZZXA 1LBBA 2FHYA 3P7IA 1CE2A 3I5OA 5AA3A 1RKMA 3B6QA 2R9JA 4YU0A 3SEWA 3O28A 3N94A 4PETA 1FBHA 3IB0A 1EZOA 3VDFA 2CMOA 2V25A 1FBDA 3UIFA 4JWYA 3T96B 1I6QA 3HO7A 4IO4A 5I5PA 3LSFB 2XXTA 4P11A 1A8EA 1R6ZA 2I49A 2AYSA 2THIA 3MP8A 4ZEBA 3QUJA 2XWVA 4GWSA 1P1WA 3VVFA 1O64A 1GV8A 3B50A 1LFGA 4DXUA 3HPIA 3LBSA 4I62A 3K4UA 3E78A 4LQ2A 5CBSA 2REJA 4DI4B 4U1OA 4YZZA 2Y5LA 4IO7A 3KOSA 4KYEA 4N81A 2WX9A 5AA2A 1JEUA 5AA1A 5F1QA 1DTZA 2UVJA 3OXNA 2NWJA 1AL3A 5I57A 1FJ6A 1MRPA 1QKBA 4ZDMA 4YMBA 1FJ9A 3VVDA 3MVYA 5DTBA 1XOCA 2OJTA 1FBEA 1QGXA 2XXKA 3PUZE 4F1VA 4MNIA 4ZEIA 2NVUB 1SW1A 4ZE8A 1P99A 5L9SA 2OCUA 1KWHA 2ABHA 3FVGA 1FPKA 2V3QA 4MAGA 1N3XA 2QFLA 4GWUA 3IK6B 4H8IA 4UABA 1FPGA 1K9ZA 1B52A 3CI8A 1SQYA 3ODBA 3H6UA 1NV1A 2KQZA 3RPWA 1POTA 3VE1B 4MHFA 4G8MA 3KSXA 1FBCA 4OENA 2O51A 4NF8A 1BIYA 1IIWA 2FVZA 3FVOA 3BFTA 1OVBA 1OLCA 1IEJA 3S9MC 3OO8A 4MIJA 4NWDA 1B3FA 5IZ3B 4GD5A 3PUWE 4GWZA 3IFCA 4HCYA 1GGGA 1DSNA 3W15C 3MBPA 2UVHA 3OEKA 4EDPA 3RNNA 4NE4A 3G3KA 4WEDA 2GFEA 4PAFA 4GLIA 3W9VA 2V93A 1MXXA 5CI5A 3DP8A 3RPLA 1JETA 3E4RA 3MVWA 1D9QA 2DDKA 2ZYNA 4C1TA 1LBVA 1NUWA 5ICQA 1FBFA 3GZGA 3TCFA 1MXVA 1M5EA 2CZKA 1R9QA 1JW1A 5I58B 1I6BA 2PT1A 2GRVA 1B2HA 3IB1A 4G68A 3M8UA 1XHYA 2PCRA 3H06B 1SD3A 5ET8A 5AA2B 3R26A 4PDHA 5CMMA 1LBZA 2O1MA 4RA1A 4OETA 2Y84A 3CHGA 4NF0A 3FXRA 2O69A 3OMBA 2XD3A 2P0SA 3CG3A 2WYPA 3OO9A 1UTHB 2VP1A 2F97A 2ONKE 4EF2A 2UVGA 2B4MA 4YB6A 3Q29A 1PDAA 1USYE 4N91A 4DLDA 3UP9A 2WBBA 4JWXA 5B70A 1LAFE 4F19A 4H5FA 1LAXA 3G7WA 1P1QA 3TMGA 2XXVA 5I2NA 3TTRA 4OVQA 2PX1A 4QSDA 2GHAA 4QFOA 3WAFA 4PFYA 3TQLA 2Q2AA 1URGA 5EYGA 2QJEA 1D9YA 4OQOA 3MYUA 4N6PA 3MP1A 4PDDA 4Z0IA 3E13X 5BWJA 4R9FA 3FXUA 3D4CA 4LATA 2XXIA 3PUYE 3HSTA 1H3DA 2HAVA 4RXLA 2H9BA 3K6UA 1NH7A 1B1XA 4OANA 4PF6A 2Y7RA 2ZNSA 1B46A 2O1LA 1PB8A 5DVIA 4QFNA 3PMXA 3QUFA 1B4ZA 2ALUA 4EXKA 5IZ1A 2FIXA 1SI0A 2XX9A 4X04A 2RC8A 3EHSA 1UTBA 4MF3A 2ONRA 4XKNA 1TWYA 4UACA 5IKBA 4JSDA 1FQEA 3SEYA 4KR5A 1IUDA 1IXIA 3V83A 1TXFA 4KQPA 1B58A 1ATGA 1MM6A 4EQBA 1NUXA 4U4XA 4U21A 1RDZA 1XS5A 3S2VA 4QRZA 2RF1A 4BDLA 1NV7A 5DT6A 2DWIA 2OWZA 2DOJA 3U1OA 4QFKA 1LB8A 3NOHA 3TODA 3PPQA 3UN6A 1B5HA 1FCKA 2X7QA 2X7PA 2A5TA 4O94A 3FJMA 1H43A 3A3CA 4DE8A 5L8DA 3F11A 4YKPA 4JB7A 4QHQA 4GF8A 3FUZA 1NV6A 4BDOA 1R9LA 4OYVA 2QSXA 3TYHA 3SETA 2GQ1A 3HHFA 2VPOA 5KCJB 1SYIA 4H46A 3MAMA 1AH5A 3O6GA 3PPPA 3LUYA 5I58A 4I8CA 2RCBA 2H98A 2BJJX 4PFTA 1MQDA 4NWCA 4ZZAA 2XWOA 3MVXA 4GWYA 5LOMA 4R72A 4PBHA 1NNFA 3O2AA 1TFDA 4R2FA 1B7HA 2Q88A 4NG7A 4MX6A 3LUZA 2Z23A 2ZMBA 2F7CA 1NKXA 5EHSA 2O7UA 1IMDA 3ONMA 1LSTA 1KA0A 1H45A 4GXAA 3LC8A 2R71A 3RUMA 1D3KA 2A5SA 2HCAA 5EQAA 3IAZA 5T3JA 1B6HA 4RYAA 4IO5A 4P56A 1ZLQA 2XA5A 3L6GA 2Q8JA 4PFRA 1QUJA 2F7BA 1FPFA 3N5LA 3U65A 3SERA 4IO3A 2ZZVA 3T9VA 5JTYB 4F1YA 4OFLA 2AIXA 4IY6A 2OLBA 3SEVA 3H7MA 5H8NA 3FASA 1S7YA 4OFOA 2OZZA 1LCTA 5L9OA 2RCAA 2ZYKA 1EH3A 4FBPA 3K6WA 1EZPA 1B4HA 4F18A 3G3JA 3PUXE 4N6DA 4R6YA 2XHDA 1ZMGA 1DMBA 3U72A 3IJOB 2QL3A 4R6KA 3D1RA 1SPIA 4P0GA 4Q30B 2Z8DA 1IZ1A 4LUBA 4ELPA 1NUZA 2I4BA 5CM6A 3QXMA 3GYYA 1ANFA 3KOTA 1CNQA 1DPPA 1UIUA 1FPIA 4N17A 3T9XB 4F2OA 3MP6A 3TDJA 4YKJA 4XF5A 4AS5A 3CG1A 5BUUA 1FTLA 3N6TA 1MXZA 3HN0A 4MFIA 3FVNA 2Y5KA 4Z7EA 4M4GA 3EQ1A 1WODA 3B8BA 1M5DA 3Q27A 1B5IA 5AA2D 3GBAA 4G8NA 3PD8A 4Q8RA 1G0IA 3FJGA 4I40A 5I3SA 4FEBA 2DSFA 2P3NA 1Q9DA 2DXYA 3TAJA 1MPDA 3KG2A 1XI6A 4E0WA 1JVYA 2HHMA 3M3KA 2ZZWA 4K3FA 5I57B 2L5VA 1T0KA 3RLFE 5FTIA 3MC2A 1NH8A 2HXWA 5J16A 2HEUA 3K2DA 1SW5A 2B4LA 5DYHA 4LN5A 2F8DA 4R9GA 2P3VA 3PPNA 3Q26A 1K9YA 4JBZA 5I56A 2Q89A 2DQVA 4TLLB 1N3WA 2QVRA 1MY3A 3DP4A 3QMFA 5ICTA 1ZJLA 1LFIA 1A40A 4X8RA 1DOTA 2QS2A 4IR8A 1MPBA 1Z7ME 2QMXA 4P8BA 5HPQA 1VR5A 1RDXA 2VGQA 4AS4A 1Y4CA 5I84A 1FQAA 4OESA 3OSRA 4OERA 2WYKA 4PCDA 5M2VA 4YB5A 2FA7A 5H8FA 3CIJA 4OMBA 3C32A 5F7VA 3VV5A 4FJPA 4U22A 2FNCA 3Q28A 4JVIA 2ZNTA 1JQFA 2I6EA 4O8MA 3FGSA 4FEDA 1XT8A 2XXRA 2QS3A 3QIMA 1QUKA 4PFWA 1DK4A 2G29A 2Y7IA 4N13A 4NF6B 4GXSB 3C34A 3IORA 3MSTA 2XWKA 4BDQA 5ITPA 4PFIA 1B7ZA 3FXQA 1NNKA 1MY2A 1O7TA 2HPGA 1IITA 2ONSA 1NV0A 4F3PA 2H4IA 3G3HA 2O84X 3SDFA 5KDTA 1F9BA 5CMBA 3PUVE 1MXYA 1OQHA 2HZKA 3TTLA 1HSLA 4LVQA 2F78A 5IAIA 4LP2B 1SDXA 4PGPA 1B9JA 5TP9B 2DWJA 3MWBA 3KC0A 4IGRA 4O3CA 2IA4A 3QAXA 4KHZE 4NGUA 3PGFA 4P1EA 3H3GA 3PU5A 2O6AA 3CFLA 4H65A 2XX7A 4HXVA 3UORA 3JV9A 1POY1 1JEVA 4DXCA 3BBRA 3V8XB 1Y9UA 3MPKA 1LAGE 1Z7NE 1SYHA 3E3KA 2DVCA 2H5YA 1BKAA 4HCWA 3OD7A 2QPQA 4ZZEA 5EYFA 3QK6A 1N84A 3Q25A 3OSQA 1IQ7A 5ISUA 4AB5A 2VD3A 5H8HA 2I4CA 3MW0A 4NHBA 5AA4B 4GFRA 3FJ7A 4R75A 1ZIUA 5CBRA 1QULA 5I2KB 4F3GA 3FD3A 4OXVA 4XEQA 5H8QA 4ESWA 1OLAA 5I56B 2UVIA 4U1ZA 3DELB 1B1HA 1A8FA 1DBZA 3K6XA 1D9VA 4I1DA 4EQ9A 1VDWA 2ZNUA 3OENA 5EYHA 1IMEA 5H8QB 5CMKA 4JSOA 3RGYA 1SI1A 2QRYA 2XD2A 1QKAA 3KN7A
chains in the Genus database with same CATH topology
4PBQA 2CZHA 1XI6A 4I3YA 1KA1A 5EYGA 2HHMA 5ET5A 2ZZWA 1FTAA 3T1BA 5IGAA 4OVTA 2HZLA 2PFZA 2L5VA 3KC1A 3MYUA 4MIJA 1JP4A 4O7MA 1NV6A 4DI4B 5FBPA 1EYJA 4OVSA 5EQ8A 4MMPA 2HZKA 4PDDA 2Y5LA 4YZZA 5IZ3B 4N81A 4GWZA 3IFCA 4HCYA 2WX9A 4FBPA 2HXRA 1YYZA 2QVVA 4YICA 2GQ1A 5A5LA 1LBXA 2CZIA 2VPOA 3EKIA 1FPJA 3HFUA 4O7IA 4PAIA 1FPEA 2FBPA 4N8YA 4PF8A 4F18A 2MKZA 4GX3A 4H46A 4GBWA 1FBGA 4PGPA 4NAPA 4N6DA 2B4LA 3LV0A 4LN5A 4MCOA 4PAFA 5DW8A 4HE2A 3KC0A 3W9VA 4PTKA 1IMAA 1IMBA 2DE4A 4NGUA 3RPLA 1FJ6A 2P3VA 2Q74A 2WBDA 4P1EA 1EYKA 1K9YA 4NN3A 1D9QA 2DDKA 3A29A 4PFBA 1FJ9A 5I7IA 1LBVA 1NUWA 4GWXA 1IMFA 2PFYA 5ET7A 1FBFA 2CEXA 2F3DA 4H45A 4HE0A 4OANA 4PF6A 1LBWA 1NUYA 3RYDA 5LTCA 1FPDA 2JJKA 3D1RA 1SPIA 2QVRA 2XWOA 4XFEA 1EYIA 1NI9A 4GWYA 1FBEA 3QMFA 4MJOA 5IM2A 4P47A 1QGXA 2XXKA 4PBHA 4F1VA 2ZZXA 4X9TA 4M1VA 4HE1A 4GBVA 2FHYA 4JVCA 1NUZA 4MNIA 2CZKA 4N8GA 5CM6A 4X8RA 4N6KA 4IR8A 5ET6A 2XWIA 4P3LA 4HXVA 4OVRA 4JVDA 4NQ8A 4GX4A 4NG7A 4PGNA 1RDYA 2FIEA 5EQ7A 3SZPA 5IZ1A 2FIXA 3GYYA 4MX6A 4QBAA 4X04A 4P8BA 3LUZA 4DI3D 1CNQA 1RDXA 4G61A 4PETA 1FBHA 1FPIA 2DE3A 2PCRA 4P1LA 4AS4A 4NX1A 4N17A 3FBPA 4PC9A 5ET8A 3BIHA 4OA4A 4HCWA 4OVPA 4PDHA 1G0HA 1LBZA 1IMDA 2QPQA 3CHGA 3KBZA 2WYKA 4KXPA 2Q9TA 4PCDA 1FBDA 1FPKA 2V3QA 4N15A 1KA0A 4NF0A 2DE2A 5ESYA 4MAGA 2R8TA 3ISPA 1LBYA 1NV5A 2WYPA 2BJIA 4P9KA 1NV4A 2VT5A 2KR0A 2QFLA 5J16A 3RPLB 4XF5A 1YXIA 4NHBA 4AS5A 2V4CA 4GWUA 1FPLA 2CEYA 1INPA 2B4MA 1NUXA 2F3BA 5I5PA 2DVZA 4PAKA 4UABA 1FPGA 1K9ZA 1IMCA 1RDZA 4N4UA 4JVIA 5IZZA 5EQAA 4XEQA 5EQ9A 5T3JA 4N91A 4QXDA 1FRPA 2Q8MA 4O8MA 1DCUA 1FBPA 4P56A 2XA5A 2QVUA 3PTYA 3E79A 1NV2A 4PE3A 4PFRA 1NV1A 2WBBA 4GWWA 2KQZA 2Y5KA 1FPBA 1NV7A 4MEVA 4I3EA 1DK4A 2F5XA 4MNCA 4F19A 1DBZA 2OWZA 3B8BA 1FSAA 1FPFA 4MHFA 3U65A 4GX6A 3IFAA 4F1UA 3MSTA 3T0JA 5LDZA 2ZZVA 2XWKA 3NOHA 2XWVA 2VPNA 4PFIA 4OVQA 5IZ3A 1VDWA 1FBCA 4GWSA 1G0IA 3ROJA 5EYHA 1IMEA 2HPGA 5F24A 3B50A 3BIGA 1AWBA 5J1DA 1BK4A 1LEVA 1NV0A 4I40A 5I3SA 5JK4A 2P3NA 2WEFA 3W9WA 3FXBA 1YZ0A 1NV3A 2FVZA 2OX3A 1KZ8A 4O94A 4MNPA 1Q9DA 3E78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOH A; 
#chains in the Genus database with same CATH topology
 2D21 A;  3UK4 A;  4NF5 A;  1KA1 A;  2NOO A;  4R73 A;  4OVT A;  3HV1 A;  2V84 A;  1MH3 A;  3OO6 A;  4KI0 E;  4X1D A;  3HFU A;  2DYX A;  2RIN A;  3FAT A;  1FBG A;  3OOA A;  4LON B;  4PTK A;  4PQJ A;  1MXW A;  4XIG Q;  2G93 A;  3M3L A;  3GLB A;  1FTO A;  1LGB C;  4KYD A;  4X1B A;  2YPN A;  3BKI B;  1GTK A;  2YJP A;  1LCF A;  4HE0 A;  1UTB B;  1XVX A;  3G3I A;  2I58 A;  1II5 A;  3CRB A;  4M1V A;  1MS7 A;  4YKK A;  1N7X A;  4FEC A;  4TLM B;  2F35 A;  3HHG A;  4NQ8 A;  4GX4 A;  3SZP A;  2Y7W A;  2Q2C A;  2PVU A;  4IB2 A;  4QFP A;  2DE3 A;  3TEP A;  1XVY A;  5K2X A;  2DWH A;  2Z22 A;  4NF5 B;  4E0X A;  3TCG A;  2F34 A;  4FIM A;  3RPL B;  4FAJ A;  4C1U A;  1VFD A;  1PB7 A;  2DVZ A;  4Q0C A;  4QXD A;  1TT1 A;  3KFM A;  4PE3 A;  5TPA A;  3C35 A;  2F5X A;  4DCX A;  2ESN A;  4GL0 A;  4GX6 A;  3IFA A;  3OO7 A;  4G8H A;  4RNS A;  1OQG A;  2I3V A;  5F24 A;  5J1D A;  2WEF A;  1YZ0 A;  1JW5 A;  2ZYM A;  3MZ9 A;  1H44 A;  5KZT A;  3IJX B;  3H6W A;  1LLS A;  4O7M A;  4U2R A;  5A5X A;  3H6T A;  1UTH A;  1FTM A;  3H03 A;  3MZB A;  4G68 B;  1ELJ A;  4ZED A;  3TTN A;  4H1X A;  4GX3 A;  4GBW A;  4HW8 A;  4GOT A;  3C4M A;  5JEI A;  1EU8 A;  5H8H B;  1AMF A;  2Q74 A;  2F6G A;  3A3U A;  3H4Z A;  4ELO A;  3TPA A;  4PE5 B;  3G3F A;  3ZS6 A;  1AIV A;  4XFE A;  4OFJ A;  4ZE9 A;  3QYT A;  1MQH A;  4P47 A;  2I48 A;  3KGC A;  4XKR A;  2I3W A;  4N8G A;  3U94 A;  1QJM A;  2XWI A;  4P0I A;  1RDY A;  3KJ7 A;  5FHN A;  3OEL A;  4MLV A;  4NX1 A;  3FBP A;  3JYR A;  1N0T A;  3KBZ A;  4H5G A;  4BLA A;  3C31 A;  2AL5 A;  3ZKK A;  2QS1 A;  3B6T A;  1YXI A;  3JZJ A;  3QSL A;  2F3B A;  3GBB A;  1IMC A;  2Z8F A;  1FW0 A;  3VLV A;  3U92 A;  3ECR A;  1Y1Z A;  1BP5 A;  1NFT A;  1Y3P A;  1NV2 A;  3S9L C;  4XTC Q;  3ZSF A;  4MEV A;  5A5L A;  3FZV A;  2XX8 A;  5CMC A;  3O6I A;  3TTM A;  2H99 A;  4GWO A;  4KCD A;  2V3U A;  4PFU A;  1A99 A;  5IZ3 A;  3ROJ A;  2HFB A;  1Y3Q A;  4HS7 A;  3TEL A;  4ZS9 A;  2PMS A;  2PT2 A;  4LZ8 A;  4NTL A;  3FIR A;  4KPT A;  3IO6 A;  2V3T A;  3IB2 A;  4QF9 A;  2A5T B;  2B65 A;  1YYZ A;  5IZZ A;  3O66 A;  1JNF A;  2FBP A;  4MLQ A;  4BDN A;  4HE2 A;  3C33 A;  1IMA A;  1FQB A;  5CRY A;  3UA8 A;  3K1P A;  4EUO A;  5ELV A;  3HCQ A;  4THI A;  4NN3 A;  4BDR A;  3ILU B;  4PFB A;  1B0H A;  2YLN A;  5I7I A;  2GHB A;  2PFY A;  1D4N A;  4U4S A;  2XXP A;  4H45 A;  2ANJ A;  3KN3 A;  3CFX A;  4X9T A;  2RC9 A;  4NMY A;  5ET6 A;  3CSB A;  5JK4 A;  2XXX A;  1MH4 A;  4PC9 A;  4OVP A;  4O3A A;  3TFL A;  1B3L A;  3IR1 A;  4C0R A;  4EXL A;  5TPA B;  4TOZ A;  2D3I A;  4P9K A;  1NV4 A;  2VT5 A;  1TFA A;  1US5 A;  3UGW A;  3TZA A;  2XXU A;  2ZXT A;  3EF7 A;  5TU0 A;  4NF4 A;  4GIZ A;  2F36 A;  4X48 A;  3SEU A;  1FBP A;  1LB9 A;  1SVX B;  4G2Z A;  4OHN A;  3K00 A;  3SKP A;  4F1U A;  3TUS A;  3R6U A;  2IEE A;  4MH5 A;  1AWB A;  1LEV A;  4GVO A;  3MZ1 A;  3AXF A;  1N7W A;  5H8F B;  1SBP A;  1SW2 A;  1WVJ A;  3PMV A;  4U23 A;  3N26 A;  4YAH X;  5FBP A;  1P1N A;  2B3B A;  3I6V A;  2HXR A;  1AOV A;  1FPE A;  1UQW A;  1S9T A;  4MCO A;  3VFJ A;  5I59 B;  1RYO A;  3A09 A;  4YMA A;  4DDD A;  1FTK A;  1B3H A;  3RN8 A;  3ILT B;  2XXH A;  4GWX A;  5DEX B;  2XXQ A;  3KZG A;  1IXG A;  3IOW A;  4NF8 B;  5LTC A;  2VOZ A;  4ZEC A;  1EYI A;  2ZYO A;  2LAO A;  2W7Y A;  1B32 A;  3WAE A;  4RJZ A;  4HE1 A;  2AL4 A;  4GBV A;  4JVC A;  1MM7 A;  5ITO A;  4Q5T A;  2Y7K A;  3MJN A;  4ECF A;  4OVR A;  4OEU A;  4QBA A;  4O3B A;  3C36 A;  1MQJ A;  1Y3N A;  1MQI A;  5HM4 B;  2X26 A;  4QSE A;  3EHU A;  3RTW B;  4ELQ A;  2CEY A;  4EF1 A;  1FQC A;  4N4U A;  3H6V A;  1B40 A;  2Q8M A;  5DVF A;  3K1M A;  1FQF A;  1O63 A;  3K1N A;  4H6D A;  1FPB A;  3LSW A;  1FSA A;  4OZ9 A;  3IOU A;  3TQW A;  1URD A;  3BIG A;  1IXH A;  3T66 A;  1L5T A;  3MPL A;  2I0B A;  5K2Y A;  5TP9 A;  2E1S A;  3RTF B;  1QUI A;  1GVC A;  1FTA A;  1OIB A;  3T22 A;  2HZL A;  2HQ0 A;  4OVS A;  1EZ9 A;  1URS A;  1I6A A;  1LBX A;  2CZI A;  4PF8 A;  2E0S A;  2XXY A;  4NAP A;  3KN8 A;  3LV0 A;  1A54 A;  1LBC A;  1YAE A;  3O29 A;  2DE4 A;  1HSE A;  3VLU A;  3BFU A;  2R6G E;  1NUY A;  1MPC A;  4IY5 A;  2PYY A;  3S9N C;  1NI9 A;  2M8C A;  2P1S A;  3V5A A;  4R74 A;  4ZEK A;  4R2B A;  4G4P A;  4P3L A;  4ND9 A;  4LA9 A;  1H76 A;  2QS4 A;  2FYI A;  4DI3 D;  3OEM A;  5I2K A;  3CVG A;  3VXC A;  3BIH A;  4OWD A;  1B05 A;  4ISU A;  1OMP A;  2Q9T A;  4KXP A;  1XC1 A;  1NV5 A;  4KFQ A;  1PBP A;  1FPL A;  2GH9 A;  2O68 A;  4EQ7 A;  2OBG A;  1MQG A;  2OWT A;  5I59 A;  3E79 A;  1PEB A;  3K02 A;  3PMW A;  3O6H A;  2B3F A;  3IO4 A;  2VD2 A;  4IO2 A;  1N04 A;  3W9W A;  5B7D A;  3FXB A;  1BLF A;  3VVE A;  1J1N A;  1KZ8 A;  1A55 A;  4LQ5 A;  2CZH A;  4I3Y A;  5ET5 A;  1YTV A;  1JP4 A;  5JTY A;  4JXI A;  5L9M A;  3FV1 A;  4LZ7 A;  1Y4T A;  5H8S A;  2QVV A;  4DIG A;  1FTJ A;  3EKI A;  4O7I A;  2DP8 A;  4N8Y A;  3C9H A;  5H8N B;  5DW8 A;  1IMB A;  4GL8 A;  4L17 A;  3PV0 E;  3SES A;  4NF6 A;  2I0C A;  1IMF A;  3RYD A;  3S9E A;  2VHA A;  1R1N A;  3TCH A;  3O9P A;  4F29 A;  4GRK A;  3FVK A;  3PPR A;  4IGT A;  4PGN A;  2FIE A;  2F7A A;  3R7X A;  4OVJ A;  4GQO A;  4POW A;  2R8T A;  1M5B A;  1Y1M A;  2BJI A;  3T9U A;  4ZEF A;  2Z8E A;  4I9D A;  3EPE A;  5DVJ A;  1US4 A;  1FRP A;  3LSL A;  4MBP A;  1PBQ A;  4PP0 A;  1MG1 A;  3EN3 A;  4ESX A;  1LFH A;  2OK2 A;  4F3S A;  3LSX A;  1M5F A;  3IOT A;  4OTE A;  2VPN A;  2XXW A;  1P1O A;  1P1U A;  2HAU A;  3CR9 A;  4MNP A;  4G77 A;  4PBQ A;  3T1B A;  1IXC A;  3ZKL A;  3TKD A;  1YCJ A;  5AA4 A;  3O97 A;  4G68 C;  4PAI A;  2DXR A;  4HTG A;  4TQU Q;  4F3B A;  3USD A;  4XKQ A;  3EHT A;  3KEI A;  3U93 A;  3KBR A;  3FV2 A;  1LAH E;  2CZL A;  1EYK A;  2DWA A;  3A29 A;  2CEX A;  3N6U A;  3U8Q A;  4KCC A;  4POX A;  2UXA A;  3K0V A;  4XXU A;  4N6K A;  1DTG A;  4KYS A;  3PD9 A;  4JVD A;  5EQ7 A;  1WDN A;  4OEV A;  3IL1 B;  3B6W A;  2Y7P A;  4FAT A;  5DEX A;  3PPO A;  1N76 A;  3T9H B;  1NNT A;  4OA4 A;  1G0H A;  4H67 A;  3MVZ A;  4N15 A;  3KJT A;  5ESY A;  3ISP A;  1LBY A;  1ZTY A;  3RT6 B;  2KR0 A;  2V4C A;  3E9X A;  4FE8 A;  4R6H A;  3VXB A;  3MUQ A;  1DCU A;  4F39 A;  4GWW A;  4NED A;  5CC2 A;  5KDT B;  1I69 A;  1PB9 A;  1NNP A;  3T0J A;  5LDZ A;  3TTK A;  3RQT A;  3D4G A;  1M5C A;  4WEP A;  1UIV A;  2F6P A;  2UYE A;  1BK4 A;  3IX1 A;  5KCJ A;  1NV3 A;  2OX3 A;  4JDF A;  4JWO A;  1ZKB A;  5AE4 A;  4ONY A;  3DM0 A;  2H25 A;  3M3F A;  3THI A;  5IGA A;  4F22 A;  3KC1 A;  1Q35 A;  5EQ8 A;  1QW0 A;  4BDM A;  4MMP A;  2RKM A;  2QMW A;  4NF4 B;  1S50 A;  2MKZ A;  2PBW A;  4UA8 A;  4YKI A;  3DP6 A;  1USY H;  5A5X B;  4QSC A;  2WKY A;  4RPO A;  1MY1 A;  5I2N B;  1OVT A;  1SW4 A;  5ET7 A;  4ELR A;  1LBW A;  1BTJ A;  1FPD A;  2RC7 A;  2D5W A;  5FHM A;  1QVS A;  3B7D A;  4F31 B;  3S4U A;  1NMU A;  1B3G A;  1B7U A;  1FQD A;  4G61 A;  1PC3 A;  4P1L A;  1YPN A;  4KD5 A;  4H0W A;  1Q1K A;  2DE2 A;  1CB6 A;  3GXA A;  3K6V A;  3I3V A;  1B51 A;  2KLF A;  4H8J A;  4XKP A;  1A7L A;  1INP A;  4DZ1 A;  4F2Q A;  4PAK A;  4AQ4 A;  4N07 A;  2NUV A;  3SEX A;  5EQ9 A;  2OWS A;  3RY3 A;  1B5J A;  2QVU A;  3PTY A;  4LZ5 A;  1MDP 1;  4MNC A;  3IOV A;  4I3E A;  1VFE A;  1VSO A;  4DCY A;  1MY0 A;  1JVX A;  1VE4 A;  4RY1 A;  3CFZ A;  4YB7 A;  5FTH A;  1ZU0 A;  5HBC A;  3L6H A;  3CSG A;  3KSJ A;  4RPN A;  1GR2 A;  2PFZ A;  1B0L A;  1JW4 A;  3LR1 A;  1EYJ A;  3MQ9 A;  1DPE A;  1RYX A;  1ZBM A;  2DS9 A;  1MXU A;  4YIC A;  3DLN A;  1FPJ A;  4WKM A;  3V89 B;  5FHO A;  3K01 A;  3T93 B;  2NXO A;  2P2A A;  1MDQ A;  4WXJ A;  4IO6 A;  4FOR A;  3G3G A;  4AB6 A;  2REG A;  2WBD A;  3VLW A;  4QFL A;  4RK2 A;  5IM2 A;  2F3D A;  2UYF A;  1MY4 A;  2O7I A;  1Y20 A;  2JJK A;  1B3E A;  3RT8 A;  4RK9 A;  1HSJ A;  1NL5 A;  5EHM A;  4MJO A;  4DXB A;  2ZZX A;  1LBB A;  2FHY A;  3P7I A;  1CE2 A;  3I5O A;  5AA3 A;  1RKM A;  3B6Q A;  2R9J A;  4YU0 A;  3SEW A;  3O28 A;  3N94 A;  4PET A;  1FBH A;  3IB0 A;  1EZO A;  3VDF A;  2CMO A;  2V25 A;  1FBD A;  3UIF A;  4JWY A;  3T96 B;  1I6Q A;  3HO7 A;  4IO4 A;  5I5P A;  3LSF B;  2XXT A;  4P11 A;  1A8E A;  1R6Z A;  2I49 A;  2AYS A;  2THI A;  3MP8 A;  4ZEB A;  3QUJ A;  2XWV A;  4GWS A;  1P1W A;  3VVF A;  1O64 A;  1GV8 A;  3B50 A;  1LFG A;  4DXU A;  3HPI A;  3LBS A;  4I62 A;  3K4U A;  3E78 A;  4LQ2 A;  5CBS A;  2REJ A;  4DI4 B;  4U1O A;  4YZZ A;  2Y5L A;  4IO7 A;  3KOS A;  4KYE A;  4N81 A;  2WX9 A;  5AA2 A;  1JEU A;  5AA1 A;  5F1Q A;  1DTZ A;  2UVJ A;  3OXN A;  2NWJ A;  1AL3 A;  5I57 A;  1FJ6 A;  1MRP A;  1QKB A;  4ZDM A;  4YMB A;  1FJ9 A;  3VVD A;  3MVY A;  5DTB A;  1XOC A;  2OJT A;  1FBE A;  1QGX A;  2XXK A;  3PUZ E;  4F1V A;  4MNI A;  4ZEI A;  2NVU B;  1SW1 A;  4ZE8 A;  1P99 A;  5L9S A;  2OCU A;  1KWH A;  2ABH A;  3FVG A;  1FPK A;  2V3Q A;  4MAG A;  1N3X A;  2QFL A;  4GWU A;  3IK6 B;  4H8I A;  4UAB A;  1FPG A;  1K9Z A;  1B52 A;  3CI8 A;  1SQY A;  3ODB A;  3H6U A;  1NV1 A;  2KQZ A;  3RPW A;  1POT A;  3VE1 B;  4MHF A;  4G8M A;  3KSX A;  1FBC A;  4OEN A;  2O51 A;  4NF8 A;  1BIY A;  1IIW A;  2FVZ A;  3FVO A;  3BFT A;  1OVB A;  1OLC A;  1IEJ A;  3S9M C;  3OO8 A;  4MIJ A;  4NWD A;  1B3F A;  5IZ3 B;  4GD5 A;  3PUW E;  4GWZ A;  3IFC A;  4HCY A;  1GGG A;  1DSN A;  3W15 C;  3MBP A;  2UVH A;  3OEK A;  4EDP A;  3RNN A;  4NE4 A;  3G3K A;  4WED A;  2GFE A;  4PAF A;  4GLI A;  3W9V A;  2V93 A;  1MXX A;  5CI5 A;  3DP8 A;  3RPL A;  1JET A;  3E4R A;  3MVW A;  1D9Q A;  2DDK A;  2ZYN A;  4C1T A;  1LBV A;  1NUW A;  5ICQ A;  1FBF A;  3GZG A;  3TCF A;  1MXV A;  1M5E A;  2CZK A;  1R9Q A;  1JW1 A;  5I58 B;  1I6B A;  2PT1 A;  2GRV A;  1B2H A;  3IB1 A;  4G68 A;  3M8U A;  1XHY A;  2PCR A;  3H06 B;  1SD3 A;  5ET8 A;  5AA2 B;  3R26 A;  4PDH A;  5CMM A;  1LBZ A;  2O1M A;  4RA1 A;  4OET A;  2Y84 A;  3CHG A;  4NF0 A;  3FXR A;  2O69 A;  3OMB A;  2XD3 A;  2P0S A;  3CG3 A;  2WYP A;  3OO9 A;  1UTH B;  2VP1 A;  2F97 A;  2ONK E;  4EF2 A;  2UVG A;  2B4M A;  4YB6 A;  3Q29 A;  1PDA A;  1USY E;  4N91 A;  4DLD A;  3UP9 A;  2WBB A;  4JWX A;  5B70 A;  1LAF E;  4F19 A;  4H5F A;  1LAX A;  3G7W A;  1P1Q A;  3TMG A;  2XXV A;  5I2N A;  3TTR A;  4OVQ A;  2PX1 A;  4QSD A;  2GHA A;  4QFO A;  3WAF A;  4PFY A;  3TQL A;  2Q2A A;  1URG A;  5EYG A;  2QJE A;  1D9Y A;  4OQO A;  3MYU A;  4N6P A;  3MP1 A;  4PDD A;  4Z0I A;  3E13 X;  5BWJ A;  4R9F A;  3FXU A;  3D4C A;  4LAT A;  2XXI A;  3PUY E;  3HST A;  1H3D A;  2HAV A;  4RXL A;  2H9B A;  3K6U A;  1NH7 A;  1B1X A;  4OAN A;  4PF6 A;  2Y7R A;  2ZNS A;  1B46 A;  2O1L A;  1PB8 A;  5DVI A;  4QFN A;  3PMX A;  3QUF A;  1B4Z A;  2ALU A;  4EXK A;  5IZ1 A;  2FIX A;  1SI0 A;  2XX9 A;  4X04 A;  2RC8 A;  3EHS A;  1UTB A;  4MF3 A;  2ONR A;  4XKN A;  1TWY A;  4UAC A;  5IKB A;  4JSD A;  1FQE A;  3SEY A;  4KR5 A;  1IUD A;  1IXI A;  3V83 A;  1TXF A;  4KQP A;  1B58 A;  1ATG A;  1MM6 A;  4EQB A;  1NUX A;  4U4X A;  4U21 A;  1RDZ A;  1XS5 A;  3S2V A;  4QRZ A;  2RF1 A;  4BDL A;  1NV7 A;  5DT6 A;  2DWI A;  2OWZ A;  2DOJ A;  3U1O A;  4QFK A;  1LB8 A;  3NOH A;  3TOD A;  3PPQ A;  3UN6 A;  1B5H A;  1FCK A;  2X7Q A;  2X7P A;  2A5T A;  4O94 A;  3FJM A;  1H43 A;  3A3C A;  4DE8 A;  5L8D A;  3F11 A;  4YKP A;  4JB7 A;  4QHQ A;  4GF8 A;  3FUZ A;  1NV6 A;  4BDO A;  1R9L A;  4OYV A;  2QSX A;  3TYH A;  3SET A;  2GQ1 A;  3HHF A;  2VPO A;  5KCJ B;  1SYI A;  4H46 A;  3MAM A;  1AH5 A;  3O6G A;  3PPP A;  3LUY A;  5I58 A;  4I8C A;  2RCB A;  2H98 A;  2BJJ X;  4PFT A;  1MQD A;  4NWC A;  4ZZA A;  2XWO A;  3MVX A;  4GWY A;  5LOM A;  4R72 A;  4PBH A;  1NNF A;  3O2A A;  1TFD A;  4R2F A;  1B7H A;  2Q88 A;  4NG7 A;  4MX6 A;  3LUZ A;  2Z23 A;  2ZMB A;  2F7C A;  1NKX A;  5EHS A;  2O7U A;  1IMD A;  3ONM A;  1LST A;  1KA0 A;  1H45 A;  4GXA A;  3LC8 A;  2R71 A;  3RUM A;  1D3K A;  2A5S A;  2HCA A;  5EQA A;  3IAZ A;  5T3J A;  1B6H A;  4RYA A;  4IO5 A;  4P56 A;  1ZLQ A;  2XA5 A;  3L6G A;  2Q8J A;  4PFR A;  1QUJ A;  2F7B A;  1FPF A;  3N5L A;  3U65 A;  3SER A;  4IO3 A;  2ZZV A;  3T9V A;  5JTY B;  4F1Y A;  4OFL A;  2AIX A;  4IY6 A;  2OLB A;  3SEV A;  3H7M A;  5H8N A;  3FAS A;  1S7Y A;  4OFO A;  2OZZ A;  1LCT A;  5L9O A;  2RCA A;  2ZYK A;  1EH3 A;  4FBP A;  3K6W A;  1EZP A;  1B4H A;  4F18 A;  3G3J A;  3PUX E;  4N6D A;  4R6Y A;  2XHD A;  1ZMG A;  1DMB A;  3U72 A;  3IJO B;  2QL3 A;  4R6K A;  3D1R A;  1SPI A;  4P0G A;  4Q30 B;  2Z8D A;  1IZ1 A;  4LUB A;  4ELP A;  1NUZ A;  2I4B A;  5CM6 A;  3QXM A;  3GYY A;  1ANF A;  3KOT A;  1CNQ A;  1DPP A;  1UIU A;  1FPI A;  4N17 A;  3T9X B;  4F2O A;  3MP6 A;  3TDJ A;  4YKJ A;  4XF5 A;  4AS5 A;  3CG1 A;  5BUU A;  1FTL A;  3N6T A;  1MXZ A;  3HN0 A;  4MFI A;  3FVN A;  2Y5K A;  4Z7E A;  4M4G A;  3EQ1 A;  1WOD A;  3B8B A;  1M5D A;  3Q27 A;  1B5I A;  5AA2 D;  3GBA A;  4G8N A;  3PD8 A;  4Q8R A;  1G0I A;  3FJG A;  4I40 A;  5I3S A;  4FEB A;  2DSF A;  2P3N A;  1Q9D A;  2DXY A;  3TAJ A;  1MPD A;  3KG2 A;  1XI6 A;  4E0W A;  1JVY A;  2HHM A;  3M3K A;  2ZZW A;  4K3F A;  5I57 B;  2L5V A;  1T0K A;  3RLF E;  5FTI A;  3MC2 A;  1NH8 A;  2HXW A;  5J16 A;  2HEU A;  3K2D A;  1SW5 A;  2B4L A;  5DYH A;  4LN5 A;  2F8D A;  4R9G A;  2P3V A;  3PPN A;  3Q26 A;  1K9Y A;  4JBZ A;  5I56 A;  2Q89 A;  2DQV A;  4TLL B;  1N3W A;  2QVR A;  1MY3 A;  3DP4 A;  3QMF A;  5ICT A;  1ZJL A;  1LFI A;  1A40 A;  4X8R A;  1DOT A;  2QS2 A;  4IR8 A;  1MPB A;  1Z7M E;  2QMX A;  4P8B A;  5HPQ A;  1VR5 A;  1RDX A;  2VGQ A;  4AS4 A;  1Y4C A;  5I84 A;  1FQA A;  4OES A;  3OSR A;  4OER A;  2WYK A;  4PCD A;  5M2V A;  4YB5 A;  2FA7 A;  5H8F A;  3CIJ A;  4OMB A;  3C32 A;  5F7V A;  3VV5 A;  4FJP A;  4U22 A;  2FNC A;  3Q28 A;  4JVI A;  2ZNT A;  1JQF A;  2I6E A;  4O8M A;  3FGS A;  4FED A;  1XT8 A;  2XXR A;  2QS3 A;  3QIM A;  1QUK A;  4PFW A;  1DK4 A;  2G29 A;  2Y7I A;  4N13 A;  4NF6 B;  4GXS B;  3C34 A;  3IOR A;  3MST A;  2XWK A;  4BDQ A;  5ITP A;  4PFI A;  1B7Z A;  3FXQ A;  1NNK A;  1MY2 A;  1O7T A;  2HPG A;  1IIT A;  2ONS A;  1NV0 A;  4F3P A;  2H4I A;  3G3H A;  2O84 X;  3SDF A;  5KDT A;  1F9B A;  5CMB A;  3PUV E;  1MXY A;  1OQH A;  2HZK A;  3TTL A;  1HSL A;  4LVQ A;  2F78 A;  5IAI A;  4LP2 B;  1SDX A;  4PGP A;  1B9J A;  5TP9 B;  2DWJ A;  3MWB A;  3KC0 A;  4IGR A;  4O3C A;  2IA4 A;  3QAX A;  4KHZ E;  4NGU A;  3PGF A;  4P1E A;  3H3G A;  3PU5 A;  2O6A A;  3CFL A;  4H65 A;  2XX7 A;  4HXV A;  3UOR A;  3JV9 A;  1POY 1;  1JEV A;  4DXC A;  3BBR A;  3V8X B;  1Y9U A;  3MPK A;  1LAG E;  1Z7N E;  1SYH A;  3E3K A;  2DVC A;  2H5Y A;  1BKA A;  4HCW A;  3OD7 A;  2QPQ A;  4ZZE A;  5EYF A;  3QK6 A;  1N84 A;  3Q25 A;  3OSQ A;  1IQ7 A;  5ISU A;  4AB5 A;  2VD3 A;  5H8H A;  2I4C A;  3MW0 A;  4NHB A;  5AA4 B;  4GFR A;  3FJ7 A;  4R75 A;  1ZIU A;  5CBR A;  1QUL A;  5I2K B;  4F3G A;  3FD3 A;  4OXV A;  4XEQ A;  5H8Q A;  4ESW A;  1OLA A;  5I56 B;  2UVI A;  4U1Z A;  3DEL B;  1B1H A;  1A8F A;  1DBZ A;  3K6X A;  1D9V A;  4I1D A;  4EQ9 A;  1VDW A;  2ZNU A;  3OEN A;  5EYH A;  1IME A;  5H8Q B;  5CMK A;  4JSO A;  3RGY A;  1SI1 A;  2QRY A;  2XD2 A;  1QKA A;  3KN7 A; 
#chains in the Genus database with same CATH homology
 4PBQ A;  2CZH A;  1XI6 A;  4I3Y A;  1KA1 A;  5EYG A;  2HHM A;  5ET5 A;  2ZZW A;  1FTA A;  3T1B A;  5IGA A;  4OVT A;  2HZL A;  2PFZ A;  2L5V A;  3KC1 A;  3MYU A;  4MIJ A;  1JP4 A;  4O7M A;  1NV6 A;  4DI4 B;  5FBP A;  1EYJ A;  4OVS A;  5EQ8 A;  4MMP A;  2HZK A;  4PDD A;  2Y5L A;  4YZZ A;  5IZ3 B;  4N81 A;  4GWZ A;  3IFC A;  4HCY A;  2WX9 A;  4FBP A;  2HXR A;  1YYZ A;  2QVV A;  4YIC A;  2GQ1 A;  5A5L A;  1LBX A;  2CZI A;  2VPO A;  3EKI A;  1FPJ A;  3HFU A;  4O7I A;  4PAI A;  1FPE A;  2FBP A;  4N8Y A;  4PF8 A;  4F18 A;  2MKZ A;  4GX3 A;  4H46 A;  4GBW A;  1FBG A;  4PGP A;  4NAP A;  4N6D A;  2B4L A;  3LV0 A;  4LN5 A;  4MCO A;  4PAF A;  5DW8 A;  4HE2 A;  3KC0 A;  3W9V A;  4PTK A;  1IMA A;  1IMB A;  2DE4 A;  4NGU A;  3RPL A;  1FJ6 A;  2P3V A;  2Q74 A;  2WBD A;  4P1E A;  1EYK A;  1K9Y A;  4NN3 A;  1D9Q A;  2DDK A;  3A29 A;  4PFB A;  1FJ9 A;  5I7I A;  1LBV A;  1NUW A;  4GWX A;  1IMF A;  2PFY A;  5ET7 A;  1FBF A;  2CEX A;  2F3D A;  4H45 A;  4HE0 A;  4OAN A;  4PF6 A;  1LBW A;  1NUY A;  3RYD A;  5LTC A;  1FPD A;  2JJK A;  3D1R A;  1SPI A;  2QVR A;  2XWO A;  4XFE A;  1EYI A;  1NI9 A;  4GWY A;  1FBE A;  3QMF A;  4MJO A;  5IM2 A;  4P47 A;  1QGX A;  2XXK A;  4PBH A;  4F1V A;  2ZZX A;  4X9T A;  4M1V A;  4HE1 A;  4GBV A;  2FHY A;  4JVC A;  1NUZ A;  4MNI A;  2CZK A;  4N8G A;  5CM6 A;  4X8R A;  4N6K A;  4IR8 A;  5ET6 A;  2XWI A;  4P3L A;  4HXV A;  4OVR A;  4JVD A;  4NQ8 A;  4GX4 A;  4NG7 A;  4PGN A;  1RDY A;  2FIE A;  5EQ7 A;  3SZP A;  5IZ1 A;  2FIX A;  3GYY A;  4MX6 A;  4QBA A;  4X04 A;  4P8B A;  3LUZ A;  4DI3 D;  1CNQ A;  1RDX A;  4G61 A;  4PET A;  1FBH A;  1FPI A;  2DE3 A;  2PCR A;  4P1L A;  4AS4 A;  4NX1 A;  4N17 A;  3FBP A;  4PC9 A;  5ET8 A;  3BIH A;  4OA4 A;  4HCW A;  4OVP A;  4PDH A;  1G0H A;  1LBZ A;  1IMD A;  2QPQ A;  3CHG A;  3KBZ A;  2WYK A;  4KXP A;  2Q9T A;  4PCD A;  1FBD A;  1FPK A;  2V3Q A;  4N15 A;  1KA0 A;  4NF0 A;  2DE2 A;  5ESY A;  4MAG A;  2R8T A;  3ISP A;  1LBY A;  1NV5 A;  2WYP A;  2BJI A;  4P9K A;  1NV4 A;  2VT5 A;  2KR0 A;  2QFL A;  5J16 A;  3RPL B;  4XF5 A;  1YXI A;  4NHB A;  4AS5 A;  2V4C A;  4GWU A;  1FPL A;  2CEY A;  1INP A;  2B4M A;  1NUX A;  2F3B A;  5I5P A;  2DVZ A;  4PAK A;  4UAB A;  1FPG A;  1K9Z A;  1IMC A;  1RDZ A;  4N4U A;  4JVI A;  5IZZ A;  5EQA A;  4XEQ A;  5EQ9 A;  5T3J A;  4N91 A;  4QXD A;  1FRP A;  2Q8M A;  4O8M A;  1DCU A;  1FBP A;  4P56 A;  2XA5 A;  2QVU A;  3PTY A;  3E79 A;  1NV2 A;  4PE3 A;  4PFR A;  1NV1 A;  2WBB A;  4GWW A;  2KQZ A;  2Y5K A;  1FPB A;  1NV7 A;  4MEV A;  4I3E A;  1DK4 A;  2F5X A;  4MNC A;  4F19 A;  1DBZ A;  2OWZ A;  3B8B A;  1FSA A;  1FPF A;  4MHF A;  3U65 A;  4GX6 A;  3IFA A;  4F1U A;  3MST A;  3T0J A;  5LDZ A;  2ZZV A;  2XWK A;  3NOH A;  2XWV A;  2VPN A;  4PFI A;  4OVQ A;  5IZ3 A;  1VDW A;  1FBC A;  4GWS A;  1G0I A;  3ROJ A;  5EYH A;  1IME A;  2HPG A;  5F24 A;  3B50 A;  3BIG A;  1AWB A;  5J1D A;  1BK4 A;  1LEV A;  1NV0 A;  4I40 A;  5I3S A;  5JK4 A;  2P3N A;  2WEF A;  3W9W A;  3FXB A;  1YZ0 A;  1NV3 A;  2FVZ A;  2OX3 A;  1KZ8 A;  4O94 A;  4MNP A;  1Q9D A;  3E78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...