3NOHA

Crystal structure of a putative peptide binding protein (rumgna_00914) from ruminococcus gnavus atcc 29149 at 1.60 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
b'SAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENADYIILDSAEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptide binding protein
publication title Crystal structure of a putative peptide binding protein (RUMGNA_00914) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Peptide binding protein
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.210 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3nohA00
3NOHA
chains in the Genus database with same CATH superfamily
4MCOA 3MVXA 4GX6A 1A54A 4I3EA 1IIWA 3RPLB 3EQ1A 1GR2A 2O1MA 2VPNA 3BFTA 3MYUA 3GBAA 4N15A 2P3VA 4NAPA 2B3FA 1JNFA 2O51A 3IJXB 4R2BA 2CEYA 4OVQA 1QKBA 2H25A 4Z0IA 4PETA 4OEUA 2O69A 1NNKA 3M8UA 3Q27A 1P1NA 3A3UA 3HHGA 3MW0A 4QSEA 3T9HB 4KCCA 1FTKA 3PTYA 4U21A 4OFJA 4P1LA 2XXYA 3AXFA 3DP4A 1JVYA 3K0VA 4JXIA 3U1OA 4JWXA 4NMYA 4R75A 1FTOA 4R73A 3CG3A 5IZZA 1YPNA 3SERA 5CMKA 1TT1A 1LBCA 2G29A 5IAIA 4FEDA 3OXNA 4OEVA 1QULA 3G3IA 3FVGA 3OO9A 4UACA 3S9MC 1NUYA 3T0JA 1QUJA 2AIXA 3E4RA 1D9YA 5ET5A 5A5XA 2DDKA 3RNNA 4RK2A 4P9KA 3SEUA 3I5OA 1OVTA 4PBHA 4R6HA 3RYDA 4P56A 1AWBA 4OXVA 5IZ3B 4OZ9A 1US5A 4YU0A 3UP9A 4GWYA 4FORA 3B7DA 3RPLA 5TU0A 1B5IA 2O6AA 1QUKA 2P2AA 2XA5A 2HPGA 4FECA 4QHQA 3ODBA 3BKIB 4HE1A 4FE8A 5I3SA 2VHAA 4DI4B 4PDHA 1FTJA 3TYHA 5EYFA 2RC7A 1MXXA 3DELB 1OLAA 4OANA 4OYVA 4NWDA 3C33A 4C1UA 1FCKA 4XXUA 3DP8A 3U8QA 3TEPA 4YB5A 3HO7A 2QRYA 4ZZAA 3W15C 1I69A 1T0KA 5EQ8A 2OCUA 4GWOA 2HFBA 4LZ5A 2HQ0A 5AA2B 4GWUA 4GL0A 4LATA 4IO2A 3B8BA 3CRBA 5CMBA 2OK2A 5DVIA 3GXAA 2Z8DA 3MAMA 1XVYA 1SVXB 4IO3A 1SBPA 4BDOA 3H7MA 5I2NB 1N3XA 4KYSA 1Z7NE 2Y7WA 3JV9A 3BFUA 4G2ZA 3KC0A 4PQJA 1Y1ZA 3GBBA 3HV1A 5JEIA 3O29A 3T1BA 3RPWA 3IORA 1NI9A 3KN3A 5AA1A 1MQJA 2ZYKA 4ISUA 2ZNTA 2I4CA 1A99A 5I57A 2O7IA 2Z22A 1LEVA 1IQ7A 1AIVA 4MHFA 3IOVA 4YB6A 1LB8A 3O6IA 3DP6A 3FVOA 2ZNUA 3FXQA 4PFWA 1VDWA 4XTCQ 3U65A 2PFZA 4PP0A 3PU5A 2ESNA 4U23A 3OO6A 1LFIA 2UVIA 5J16A 1NH8A 4NE4A 5L9OA 2UVJA 1PB8A 2PMSA 1ELJA 4F18A 4QSDA 4EQBA 3IFCA 3H6WA 4IO6A 4OVPA 4DIGA 2XXRA 3USDA 4GXAA 4XKRA 3PPNA 3MSTA 2RCAA 1FBEA 4YKJA 5IM2A 3K00A 4H5FA 4POXA 1WDNA 3FATA 1G0HA 1NL5A 2XX9A 5CMMA 3CIJA 4N8YA 5CC2A 1NNFA 1ANFA 1VFEA 4O7MA 1B3EA 2F7BA 4KD5A 1LCTA 3MP1A 4U1ZA 1GGGA 4X04A 4LZ7A 2NVUB 1FPFA 5B70A 1GV8A 3MC2A 1Z7ME 3EHUA 1Q9DA 4MX6A 5I56B 4R2FA 3ILTB 1OVBA 2XXWA 1MQDA 2H98A 2OLBA 3RLFE 4OVRA 2Z23A 3O97A 2HXRA 5I59B 1B7UA 3H03A 2HAVA 3KSXA 3WAFA 3S4UA 2F97A 4F1YA 5DW8A 2I6EA 4LA9A 3OSQA 1SW4A 1MXVA 4BLAA 4N6PA 2OWTA 2R71A 3T9VA 1NV3A 3QAXA 5IZ1A 3FV1A 1B3HA 5HM4B 4G8HA 1S9TA 1SW5A 1FBPA 3OEMA 1DPPA 3PMVA 4EDPA 3K2DA 5TPAB 2PFYA 1N3WA 3BIGA 4X1DA 1OQHA 2F7CA 1B3FA 1DMBA 1MY1A 4JSOA 1IMEA 4JDFA 5KCJA 4LVQA 1D3KA 3VXCA 1YCJA 1P1WA 3ECRA 3EHTA 4N07A 2L5VA 4RPOA 3E13X 2YLNA 1LBZA 1YXIA 4F3PA 1B3LA 4OETA 3IK6B 3T9UA 1SI1A 3FXUA 3KFMA 4I3YA 5F7VA 4C0RA 1NV1A 4ESXA 2O1LA 4OESA 1LBVA 1BIYA 2FA7A 4KYDA 2DOJA 3FJ7A 2NWJA 2WYPA 3QYTA 3G3FA 1JQFA 3H6VA 1NKXA 5I56A 1NV5A 2REGA 4O3AA 1DK4A 2GH9A 2QVVA 2PX1A 2P3NA 4G68A 4R72A 1B3GA 4MAGA 4G61A 4IO7A 3V8XB 5BWJA 4FJPA 4LN5A 4ELOA 5BUUA 1LLSA 1A40A 4G77A 4I8CA 2B3BA 4FATA 4F3BA 4MMPA 1MQHA 3H3GA 5F24A 2QS1A 1JVXA 4MH5A 4XKQA 2Q8JA 5AA4B 3D4GA 1XT8A 2IEEA 1FQEA 4F1UA 3MPLA 4QFLA 1I6QA 3FZVA 3TTLA 1HSLA 1TFDA 2FIXA 2R6GE 2THIA 5FHNA 3L6HA 3IOUA 2F8DA 5KZTA 1FPJA 3T96B 1LAHE 2Y5KA 1SYIA 1Q1KA 1RYOA 4MLQA 2NOOA 3K6UA 1IMCA 5ICQA 3HPIA 1NV2A 5CRYA 2Q8MA 1CNQA 2VP1A 2Y84A 2ZZVA 1FBHA 1FTMA 3IAZA 5H8HB 4MLVA 3PD9A 3FVNA 1LSTA 1NV0A 4GWZA 3MZBA 3EPEA 1FPLA 4H8IA 4DZ1A 3T66A 4I62A 3IX1A 4MFIA 4ZEDA 4JSDA 4RNSA 3TCFA 4RYAA 3LV0A 1CB6A 1R9QA 3S9EA 2M8CA 4YICA 3EHSA 3IFAA 1ATGA 2UYFA 2JJKA 1UIUA 3VE1B 3UIFA 3HFUA 2ALUA 1MM7A 1FTAA 1VSOA 5L9SA 1B7HA 1PC3A 4GWSA 2UXAA 4GD5A 5AA4A 1A8FA 2HCAA 4KI0E 1INPA 1G0IA 4H1XA 1B32A 3FV2A 1N0TA 4ZDMA 2NXOA 1FQAA 2ZMBA 3ILUB 1Y3QA 3N6TA 3A3CA 4G68C 3RT8A 3K1NA 1BP5A 3QUFA 4HE0A 4F39A 1YYZA 1K9ZA 2I0BA 3BBRA 1IEJA 1MPBA 4NF6B 4GXSB 2CZHA 5ICTA 1ZKBA 4O94A 4ZEKA 2O68A 1B4ZA 1UTBB 4OENA 4NF5B 1USYH 2XXTA 4ESWA 3KZGA 3SDFA 5EHMA 4NF4B 3E3KA 3RTWB 4DXUA 1M5FA 3SEVA 4N4UA 3THIA 1LFGA 3KOSA 4P0IA 1R9LA 4U4SA 4GOTA 3G3KA 1Y20A 3D4CA 3CVGA 5CMCA 1LGBC 4BDQA 1KA0A 2BJIA 4NG7A 4GRKA 3OD7A 4AS4A 3IOTA 2VD2A 5EQ7A 1FW0A 4F29A 1DTZA 5ET7A 2CEXA 2VT5A 1US4A 1FQFA 1JW1A 2XXKA 3G7WA 5AE4A 3MZ1A 3RQTA 3P7IA 4ELRA 2I3VA 1SW1A 5HPQA 3CR9A 5EQ9A 3K02A 5B7DA 4HS7A 5H8NB 1B52A 1MXUA 3OENA 4YZZA 4MNCA 3KEIA 3CFZA 1SD3A 3S2VA 1ZTYA 1MH3A 1SQYA 1B46A 3ONMA 1D9QA 4IB2A 4XEQA 4XIGQ 2P1SA 4MJOA 3K4UA 4KXPA 2AYSA 4GBWA 3RUMA 2XXXA 4JBZA 4BDMA 2ONSA 2DP8A 2FVZA 3L6GA 1H45A 1URDA 5ITPA 4QBAA 4H0WA 4NF6A 3QSLA 1RDYA 3R6UA 1IMAA 2BJJX 4H8JA 3CSGA 1LCFA 2DVZA 1MRPA 3OO8A 2QJEA 4P47A 1FRPA 1NUWA 3DLNA 5I5PA 1JEUA 1EYKA 4OVJA 4ZE8A 3G3HA 4X8RA 2MKZA 3QIMA 3RT6B 2D3IA 2G93A 2FYIA 2QS3A 1BK4A 1JP4A 5FTIA 1PB7A 2I58A 1PBPA 1IITA 4HE2A 5ELVA 5K2YA 1LAGE 2XWKA 2XXIA 2DE3A 5CM6A 2AL5A 1WVJA 4MF3A 4F19A 4ZECA 4NWCA 4ZS9A 3M3LA 2PVUA 4N6DA 3TKDA 4OFLA 2Q2AA 1NUZA 2HAUA 4KQPA 1MXWA 1FPDA 4YKPA 3UORA 4NHBA 3TPAA 4XKPA 5T3JA 1KWHA 4PE5B 4PCDA 2B65A 4ELQA 3MVZA 3VLUA 1AMFA 2V84A 3WAEA 2D5WA 1II5A 4XF5A 4R6YA 1URSA 3FXBA 4PTKA 1MG1A 2DWJA 4PE3A 4OFOA 4TQUQ 3TFLA 1D9VA 5L8DA 5IZ3A 4YMAA 1EZOA 4RJZA 2QSXA 2DXYA 1H43A 1RDXA 2ZXTA 4GWWA 2ANJA 3CSBA 5DTBA 2I3WA 4P0GA 3IOWA 1Y3NA 2HHMA 3SKPA 1EZPA 3ZS6A 2DWAA 1LBWA 4U22A 1XHYA 1M5BA 5KDTB 3TELA 4DCXA 3KG2A 1QUIA 3VLWA 4ZEBA 4HCWA 5DVFA 2P0SA 3OMBA 2FBPA 4NTLA 4L17A 3U93A 4PAFA 3VVEA 5ET8A 3PV0E 3R26A 1FPBA 5AA2A 2PCRA 1L5TA 2WEFA 1JW5A 1IXIA 3FIRA 3N6UA 1MDQA 1FPEA 2OWSA 1QKAA 2QL3A 1B5HA 4XKNA 1J1NA 2QPQA 2GHBA 3MUQA 4LQ2A 5LOMA 1B1XA 5I2NA 2HZKA 1UTHB 3VDFA 1SW2A 1O7TA 4UABA 4TLLB 1EYIA 1HSEA 3NOHA 2XXHA 1DPEA 1FBGA 5TP9B 3TUSA 3K1MA 4C1TA 2AL4A 1Y9UA 4PF6A 3FBPA 3C9HA 3TQWA 4F2QA 3B6TA 2Y7PA 2VPOA 3CG1A 5CBSA 1P1UA 3O2AA 2VD3A 2R8TA 2V3QA 1NNPA 1I6BA 1LBXA 4NF8B 4DCYA 4THIA 3FD3A 3E9XA 3LR1A 3SEWA 3S9LC 5AA2D 1OLCA 1P99A 4YB7A 4UA8A 1SDXA 2V3TA 1FQDA 1UIVA 2OBGA 5CBRA 4X48A 4IO5A 4JVCA 5J1DA 1DTGA 3JYRA 4HXVA 1A55A 1YZ0A 3KN8A 3VV5A 3O6GA 1B51A 3CFXA 1O64A 5ESYA 1MS7A 2F35A 2H4IA 3G3JA 1P1QA 4EUOA 5HBCA 3LSFB 1MY0A 2PYYA 2X26A 4P1EA 4PFIA 4U1OA 1FBDA 2A5TB 5I2KB 1LAXA 4K3FA 1ZIUA 1A8EA 1YTVA 2WBBA 1LBBA 2XX8A 2Y7IA 5I59A 2YJPA 5FHOA 4GFRA 4PFTA 4OTEA 3RN8A 5I84A 3I6VA 4H67A 1MQIA 4DLDA 3TTRA 4KHZE 3JZJA 5I58B 2REJA 4EF1A 3ZKLA 1MH4A 4OERA 4KR5A 4QFKA 3H6TA 4EXKA 1FQBA 5H8SA 3A29A 4PAIA 2H5YA 4F31B 3T9XB 5TPAA 3TMGA 2V93A 2RC8A 1SPIA 2R9JA 1A7LA 5DEXB 3HCQA 1B40A 1VE4A 1MXYA 1MY4A 1S50A 1QW0A 3H6UA 5JTYB 4GL8A 2CZIA 4TLMB 3TTNA 2I49A 4OHNA 1DCUA 3VVFA 4DE8A 4EQ7A 3K1PA 4O3BA 4HW8A 2XXUA 3PUWE 5H8QB 1FQCA 4N8GA 1IUDA 2DWHA 4PC9A 2GQ1A 1WODA 4G8MA 3SEXA 1RKMA 3PUXE 1B58A 3O9PA 1IZ1A 3RTFB 3EKIA 3PPPA 4ND9A 2V4CA 3OELA 3FVKA 3ISPA 3U94A 5I7IA 1Y3PA 2UVHA 3DM0A 4LQ5A 4P11A 2E0SA 3IO4A 1RDZA 3LSWA 4I1DA 2I48A 4FAJA 4EXLA 3TTMA 4LP2B 3TAJA 3TODA 4Q0CA 2PT1A 1B4HA 3LC8A 2HEUA 1FBFA 1PEBA 3HN0A 1RYXA 3QMFA 1AL3A 1XVXA 3KJ7A 3IO6A 2ZYOA 4GF8A 4H5GA 2GHAA 3FXRA 4PAKA 2FNCA 3RY3A 1Y4TA 4BDNA 4NEDA 1FPGA 1JEVA 3IB2A 3KC1A 4E0WA 4WKMA 3V5AA 1F9BA 1P1OA 4QSCA 3LSLA 4TOZA 5A5XB 3IB1A 4PFUA 4DI3D 2KR0A 1MDP1 4N13A 4ECFA 2RKMA 2QVUA 3KGCA 4OVSA 3RGYA 3VXBA 2XXPA 3PMXA 4YMBA 1FSAA 1POY1 4RPNA 2XWOA 3M3FA 4G4PA 1B2HA 1K9YA 2H9BA 1ZLQA 1MM6A 3TQLA 5H8HA 4RXLA 4H46A 2Q89A 3MPKA 3PUYE 1ZMGA 1GVCA 4MNIA 1EYJA 4R9FA 1MPCA 2QFLA 1B5JA 1B0HA 2ONKE 4P8BA 3CI8A 1SYHA 2Y7KA 3QUJA 4X1BA 4DDDA 5IKBA 4XFEA 4PFRA 4YKIA 4LONB 4PF8A 3MWBA 5M2VA 4PBQA 5DVJA 2ZZWA 5FHMA 4JVDA 4R6KA 3N26A 2V3UA 1S7YA 4N81A 1R1NA 2XWVA 3M3KA 4GWXA 2Y7RA 4F1VA 1MY3A 4F22A 1N04A 1URGA 4ZEFA 4ZE9A 2OX3A 4JB7A 3LUZA 2NUVA 4N17A 4QFOA 1Q35A 3FUZA 2ONRA 1B7ZA 1FJ6A 1SI0A 2Q88A 3TCHA 3U72A 3PPOA 3S9NC 3HHFA 4I9DA 1PBQA 2FHYA 4WXJA 3K6VA 3E79A 4DXCA 2Z8FA 1TXFA 1BLFA 5A5LA 2CZLA 5LDZA 4BDLA 1EZ9A 3FJMA 5DT6A 3C34A 1UTBA 4Z7EA 4NF5A 3HSTA 5I57B 2F3DA 4NF4A 5EYHA 1FPKA 3TTKA 1IXGA 2O7UA 3QXMA 2WX9A 1LBYA 4OMBA 3V89B 2WBDA 3PD8A 2ZYMA 4O7IA 3FASA 5ET6A 3TDJA 4MIJA 1M5DA 2OJTA 2Q2CA 3H4ZA 1MY2A 4DXBA 4KYEA 1XC1A 4PDDA 3IB0A 4JWOA 3C36A 4M1VA 2RC9A 2OZZA 3IJOB 1B0LA 5L9MA 2RCBA 2DE2A 1QJMA 4IGTA 5H8NA 4AB6A 1NNTA 4GVOA 1VR5A 2F3BA 3H06B 1BTJA 1FTLA 3MP8A 4Q5TA 1XOCA 3UK4A 4Q30B 3FGSA 1OIBA 2X7QA 3F11A 3O6HA 4RA1A 3PMWA 1FBCA 1PB9A 4OA4A 2FIEA 2YPNA 3GZGA 3B50A 2Q74A 2F7AA 4N91A 3ZSFA 1NH7A 5FBPA 3PUZE 4NX1A 1NV7A 2E1SA 1HSJA 5EHSA 2W7YA 3OO7A 2VOZA 2B4MA 1N7WA 1R6ZA 3SESA 3K01A 3CFLA 2XX7A 4QFNA 3KSJA 2A5SA 2KLFA 1DOTA 1IMFA 3IR1A 3OOAA 4PFBA 3MVWA 1PDAA 4QFPA 4LUBA 2LAOA 1ZJLA 4IGRA 4P3LA 4G8NA 3IL1B 4O3CA 4MNPA 3GYYA 3MP6A 5EYGA 5AA3A 2XXVA 2UYEA 2PT2A 2F6GA 3VLVA 2DS9A 4ZEIA 1USYE 4M4GA 4E0XA 1YAEA 2HXWA 4FBPA 1NMUA 3MQ9A 5KCJB 3QK6A 2V25A 3UN6A 1Y4CA 4ELPA 1B1HA 1TWYA 3KBZA 1JETA 4OQOA 4R9GA 2Y5LA 3I3VA 4LZ8A 1MQGA 3PPRA 3LSXA 4FIMA 4AS5A 1B9JA 3UA8A 4MEVA 4BDRA 4O8MA 2B4LA 5K2XA 2XD3A 4H65A 4NGUA 2I0CA 3EF7A 3O66A 3U92A 3T93B 2X7PA 4FEBA 4KCDA 2GRVA 1LAFE 1Y1MA 1NUXA 1IXHA 1FPIA 4GQOA 1N76A 4G68B 2DE4A 2Z8EA 2DWIA 3MZ9A 5FTHA 5JK4A 4I40A 4ONYA 1EU8A 1LB9A 1IXCA 2F34A 2XHDA 5KDTA 3Q28A 5ITOA 3PUVE 1M5CA 2DSFA 4ZZEA 3ZKKA 1OMPA 2F5XA 4U4XA 1TFAA 3R7XA 4QRZA 3SEYA 2GFEA 3KN7A 2QS2A 1H76A 4U2RA 3Q25A 2I4BA 2D21A 1DBZA 4Q8RA 2XD2A 3A09A 2QMWA 5EQAA 3D1RA 5H8FB 5ISUA 1QVSA 1ZBMA 1MPDA 4WEPA 1KZ8A 1N7XA 3VVDA 3GLBA 1QGXA 3W9VA 3E78A 3PPQA 5DYHA 3B6QA 3CHGA 4IY6A 2DYXA 1B6HA 3FJGA 4KPTA 1UQWA 2H99A 3LUYA 1UTHA 4GX3A 1OQGA 4NQ8A 2WYKA 3C4MA 4POWA 3KBRA 3KJTA 5IGAA 4EF2A 4GLIA 1AH5A 1XI6A 2F78A 5TP9A 1GTKA 2RF1A 1I6AA 4RY1A 4NN3A 4RK9A 2DQVA 2IA4A 1EH3A 3BIHA 4H6DA 1FJ9A 4PFYA 2XXQA 3V83A 4YKKA 2UVGA 2KQZA 3O28A 4NF8A 2ABHA 4H45A 1KA1A 2ZYNA 4QXDA 1XS5A 2CZKA 4AB5A 3C35A 4NF0A 3B6WA 2DVCA 3K6WA 2QS4A 3N5LA 4IR8A 2F6PA 4IO4A 1NFTA 1H3DA 4OVTA 2F36A 2ZNSA 4YAHX 1M5EA 1H44A 3MJNA 4F2OA 3Q26A 4HCYA 5H8FA 4JVIA 2DXRA 3W9WA 2WKYA 3TCGA 4F3SA 4HTGA 2ZZXA 4X9TA 4EQ9A 2A5TA 3SZPA 1MXZA 3N94A 2CMOA 2VGQA 4MBPA 2Q9TA 3Q29A 4R74A 3SETA 1B05A 5I2KA 1VFDA 1POTA 2XWIA 4OWDA 4QF9A 1NV6A 1DSNA 1AOVA 1ZU0A 4N6KA 3K6XA 1N84A 1JW4A 3LBSA 3PGFA 1LFHA 5I58A 1IMBA 3UGWA 3T22A 4PGNA 5LTCA 4F3GA 3OEKA 3TZAA 5CI5A 3VFJA 3OSRA 4PGPA 4WEDA 1D4NA 4IY5A 3ROJA 4GIZA 3C32A 4JWYA 3MBPA 1CE2A 4KFQA 5DEXA 5F1QA 3EN3A 2OWZA 5JTYA 3MVYA 4AQ4A 2HZLA 1BKAA 1IMDA 1O63A 2QMXA 2PBWA 2QVRA 1NV4A 2RINA 4GBVA 2O84X 4GX4A 3KOTA 5H8QA 3C31A 3G3GA
chains in the Genus database with same CATH topology
4MCOA 4MMPA 4GX6A 5F24A 4I3EA 3RPLB 4UABA 4PDDA 1EYIA 2VPNA 4M1VA 3NOHA 4F1UA 1FBGA 3MYUA 2DE2A 2P3VA 4N15A 4NAPA 2FIXA 2F3BA 2CEYA 4OVQA 4PF6A 3FBPA 4PETA 1FPJA 2Y5KA 2VPOA 1FBCA 4OA4A 2FIEA 1IMCA 3B50A 2Q74A 2R8TA 4N91A 1NV2A 2V3QA 2Q8MA 1CNQA 1LBXA 3PTYA 5FBPA 4NX1A 1NV7A 4P1LA 2ZZVA 1FBHA 2B4MA 5IZZA 1NV0A 4GWZA 4JVCA 5J1DA 1FPLA 4HXVA 1IMFA 4PFBA 1YZ0A 5ESYA 4P3LA 1NUYA 3T0JA 3LV0A 4MNPA 3GYYA 5EYGA 4YICA 5ET5A 2DDKA 3IFAA 4P9KA 4P1EA 4PBHA 4PFIA 3RYDA 2JJKA 4P56A 1AWBA 1FBDA 3HFUA 5IZ3B 1FTAA 4FBPA 4GWSA 4GWYA 3RPLA 2WBBA 1INPA 1G0IA 2XA5A 3KBZA 2HPGA 2Y5LA 4HE1A 4HE0A 5I3SA 4DI4B 1YYZA 4PDHA 1K9ZA 4AS5A 4OANA 4MEVA 4O8MA 2B4LA 2CZHA 4O94A 4NGUA 3A29A 4PAIA 5EQ8A 1SPIA 1NUXA 4N4UA 4GWUA 1FPIA 3B8BA 2CZIA 2DE4A 1DCUA 5JK4A 4I40A 1KA0A 2BJIA 4NG7A 4AS4A 4N8GA 4PC9A 2GQ1A 5EQ7A 3KC0A 5ET7A 2CEXA 2VT5A 2XXKA 3EKIA 3T1BA 2F5XA 2V4CA 5EQ9A 3ISPA 1NI9A 5I7IA 4YZZA 4MNCA 1LEVA 4MHFA 1DBZA 1D9QA 1RDZA 4XEQA 5EQAA 3D1RA 4MJOA 4KXPA 1KZ8A 1VDWA 3U65A 2PFZA 4GBWA 1QGXA 3W9VA 3E78A 2FVZA 5J16A 3CHGA 1FBFA 4F18A 3QMFA 3IFCA 4OVPA 4QBAA 4GX3A 4NQ8A 2WYKA 1RDYA 1IMAA 3MSTA 1FBEA 5IGAA 4PAKA 2DVZA 5IM2A 1XI6A 4P47A 1FRPA 1FPGA 1NUWA 1G0HA 5I5PA 3KC1A 1EYKA 4X8RA 2MKZA 4N8YA 4O7MA 4NN3A 1BK4A 1JP4A 4DI3D 4X04A 2KR0A 3BIHA 4HE2A 2QVUA 4OVSA 1FJ9A 2XWKA 2DE3A 1FPFA 5CM6A 1FSAA 2XWOA 2KQZA 1Q9DA 4MX6A 4F19A 4H45A 1KA1A 1K9YA 4QXDA 2CZKA 4N6DA 4NF0A 4OVRA 4H46A 1NUZA 4MNIA 2HXRA 4IR8A 1EYJA 1FPDA 2QFLA 4NHBA 4OVTA 4P8BA 5DW8A 5T3JA 4PCDA 4HCYA 4JVIA 4XFEA 4PFRA 3W9WA 1NV3A 4PF8A 5IZ1A 4PBQA 2ZZXA 2ZZWA 1FBPA 2PFYA 4XF5A 4JVDA 3BIGA 3FXBA 4PTKA 4PE3A 4N81A 4X9TA 2XWVA 5IZ3A 3SZPA 4GWXA 4F1VA 2Q9TA 1IMEA 1RDXA 4GWWA 2OX3A 3LUZA 4N17A 2HHMA 2XWIA 2L5VA 1FJ6A 1NV6A 1LBWA 1LBZA 4N6KA 2FHYA 1YXIA 3E79A 1IMBA 4I3YA 1NV1A 4HCWA 4PGNA 5LTCA 5LDZA 5A5LA 1LBVA 2FBPA 2WYPA 4PGPA 3ROJA 4PAFA 5ET8A 2F3DA 5EYHA 1FPKA 1FPBA 1NV5A 1DK4A 2PCRA 2QVVA 2WEFA 2OWZA 2WX9A 1LBYA 2HZLA 2P3NA 1FPEA 1IMDA 4MAGA 4G61A 2WBDA 2QPQA 2QVRA 4O7IA 1NV4A 5ET6A 4GBVA 4LN5A 4GX4A 4MIJA 2HZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOH A; 
#chains in the Genus database with same CATH topology
 4MCO A;  3MVX A;  4GX6 A;  1A54 A;  4I3E A;  1IIW A;  3RPL B;  3EQ1 A;  1GR2 A;  2O1M A;  2VPN A;  3BFT A;  3MYU A;  3GBA A;  4N15 A;  2P3V A;  4NAP A;  2B3F A;  1JNF A;  2O51 A;  3IJX B;  4R2B A;  2CEY A;  4OVQ A;  1QKB A;  2H25 A;  4Z0I A;  4PET A;  4OEU A;  2O69 A;  1NNK A;  3M8U A;  3Q27 A;  1P1N A;  3A3U A;  3HHG A;  3MW0 A;  4QSE A;  3T9H B;  4KCC A;  1FTK A;  3PTY A;  4U21 A;  4OFJ A;  4P1L A;  2XXY A;  3AXF A;  3DP4 A;  1JVY A;  3K0V A;  4JXI A;  3U1O A;  4JWX A;  4NMY A;  4R75 A;  1FTO A;  4R73 A;  3CG3 A;  5IZZ A;  1YPN A;  3SER A;  5CMK A;  1TT1 A;  1LBC A;  2G29 A;  5IAI A;  4FED A;  3OXN A;  4OEV A;  1QUL A;  3G3I A;  3FVG A;  3OO9 A;  4UAC A;  3S9M C;  1NUY A;  3T0J A;  1QUJ A;  2AIX A;  3E4R A;  1D9Y A;  5ET5 A;  5A5X A;  2DDK A;  3RNN A;  4RK2 A;  4P9K A;  3SEU A;  3I5O A;  1OVT A;  4PBH A;  4R6H A;  3RYD A;  4P56 A;  1AWB A;  4OXV A;  5IZ3 B;  4OZ9 A;  1US5 A;  4YU0 A;  3UP9 A;  4GWY A;  4FOR A;  3B7D A;  3RPL A;  5TU0 A;  1B5I A;  2O6A A;  1QUK A;  2P2A A;  2XA5 A;  2HPG A;  4FEC A;  4QHQ A;  3ODB A;  3BKI B;  4HE1 A;  4FE8 A;  5I3S A;  2VHA A;  4DI4 B;  4PDH A;  1FTJ A;  3TYH A;  5EYF A;  2RC7 A;  1MXX A;  3DEL B;  1OLA A;  4OAN A;  4OYV A;  4NWD A;  3C33 A;  4C1U A;  1FCK A;  4XXU A;  3DP8 A;  3U8Q A;  3TEP A;  4YB5 A;  3HO7 A;  2QRY A;  4ZZA A;  3W15 C;  1I69 A;  1T0K A;  5EQ8 A;  2OCU A;  4GWO A;  2HFB A;  4LZ5 A;  2HQ0 A;  5AA2 B;  4GWU A;  4GL0 A;  4LAT A;  4IO2 A;  3B8B A;  3CRB A;  5CMB A;  2OK2 A;  5DVI A;  3GXA A;  2Z8D A;  3MAM A;  1XVY A;  1SVX B;  4IO3 A;  1SBP A;  4BDO A;  3H7M A;  5I2N B;  1N3X A;  4KYS A;  1Z7N E;  2Y7W A;  3JV9 A;  3BFU A;  4G2Z A;  3KC0 A;  4PQJ A;  1Y1Z A;  3GBB A;  3HV1 A;  5JEI A;  3O29 A;  3T1B A;  3RPW A;  3IOR A;  1NI9 A;  3KN3 A;  5AA1 A;  1MQJ A;  2ZYK A;  4ISU A;  2ZNT A;  2I4C A;  1A99 A;  5I57 A;  2O7I A;  2Z22 A;  1LEV A;  1IQ7 A;  1AIV A;  4MHF A;  3IOV A;  4YB6 A;  1LB8 A;  3O6I A;  3DP6 A;  3FVO A;  2ZNU A;  3FXQ A;  4PFW A;  1VDW A;  4XTC Q;  3U65 A;  2PFZ A;  4PP0 A;  3PU5 A;  2ESN A;  4U23 A;  3OO6 A;  1LFI A;  2UVI A;  5J16 A;  1NH8 A;  4NE4 A;  5L9O A;  2UVJ A;  1PB8 A;  2PMS A;  1ELJ A;  4F18 A;  4QSD A;  4EQB A;  3IFC A;  3H6W A;  4IO6 A;  4OVP A;  4DIG A;  2XXR A;  3USD A;  4GXA A;  4XKR A;  3PPN A;  3MST A;  2RCA A;  1FBE A;  4YKJ A;  5IM2 A;  3K00 A;  4H5F A;  4POX A;  1WDN A;  3FAT A;  1G0H A;  1NL5 A;  2XX9 A;  5CMM A;  3CIJ A;  4N8Y A;  5CC2 A;  1NNF A;  1ANF A;  1VFE A;  4O7M A;  1B3E A;  2F7B A;  4KD5 A;  1LCT A;  3MP1 A;  4U1Z A;  1GGG A;  4X04 A;  4LZ7 A;  2NVU B;  1FPF A;  5B70 A;  1GV8 A;  3MC2 A;  1Z7M E;  3EHU A;  1Q9D A;  4MX6 A;  5I56 B;  4R2F A;  3ILT B;  1OVB A;  2XXW A;  1MQD A;  2H98 A;  2OLB A;  3RLF E;  4OVR A;  2Z23 A;  3O97 A;  2HXR A;  5I59 B;  1B7U A;  3H03 A;  2HAV A;  3KSX A;  3WAF A;  3S4U A;  2F97 A;  4F1Y A;  5DW8 A;  2I6E A;  4LA9 A;  3OSQ A;  1SW4 A;  1MXV A;  4BLA A;  4N6P A;  2OWT A;  2R71 A;  3T9V A;  1NV3 A;  3QAX A;  5IZ1 A;  3FV1 A;  1B3H A;  5HM4 B;  4G8H A;  1S9T A;  1SW5 A;  1FBP A;  3OEM A;  1DPP A;  3PMV A;  4EDP A;  3K2D A;  5TPA B;  2PFY A;  1N3W A;  3BIG A;  4X1D A;  1OQH A;  2F7C A;  1B3F A;  1DMB A;  1MY1 A;  4JSO A;  1IME A;  4JDF A;  5KCJ A;  4LVQ A;  1D3K A;  3VXC A;  1YCJ A;  1P1W A;  3ECR A;  3EHT A;  4N07 A;  2L5V A;  4RPO A;  3E13 X;  2YLN A;  1LBZ A;  1YXI A;  4F3P A;  1B3L A;  4OET A;  3IK6 B;  3T9U A;  1SI1 A;  3FXU A;  3KFM A;  4I3Y A;  5F7V A;  4C0R A;  1NV1 A;  4ESX A;  2O1L A;  4OES A;  1LBV A;  1BIY A;  2FA7 A;  4KYD A;  2DOJ A;  3FJ7 A;  2NWJ A;  2WYP A;  3QYT A;  3G3F A;  1JQF A;  3H6V A;  1NKX A;  5I56 A;  1NV5 A;  2REG A;  4O3A A;  1DK4 A;  2GH9 A;  2QVV A;  2PX1 A;  2P3N A;  4G68 A;  4R72 A;  1B3G A;  4MAG A;  4G61 A;  4IO7 A;  3V8X B;  5BWJ A;  4FJP A;  4LN5 A;  4ELO A;  5BUU A;  1LLS A;  1A40 A;  4G77 A;  4I8C A;  2B3B A;  4FAT A;  4F3B A;  4MMP A;  1MQH A;  3H3G A;  5F24 A;  2QS1 A;  1JVX A;  4MH5 A;  4XKQ A;  2Q8J A;  5AA4 B;  3D4G A;  1XT8 A;  2IEE A;  1FQE A;  4F1U A;  3MPL A;  4QFL A;  1I6Q A;  3FZV A;  3TTL A;  1HSL A;  1TFD A;  2FIX A;  2R6G E;  2THI A;  5FHN A;  3L6H A;  3IOU A;  2F8D A;  5KZT A;  1FPJ A;  3T96 B;  1LAH E;  2Y5K A;  1SYI A;  1Q1K A;  1RYO A;  4MLQ A;  2NOO A;  3K6U A;  1IMC A;  5ICQ A;  3HPI A;  1NV2 A;  5CRY A;  2Q8M A;  1CNQ A;  2VP1 A;  2Y84 A;  2ZZV A;  1FBH A;  1FTM A;  3IAZ A;  5H8H B;  4MLV A;  3PD9 A;  3FVN A;  1LST A;  1NV0 A;  4GWZ A;  3MZB A;  3EPE A;  1FPL A;  4H8I A;  4DZ1 A;  3T66 A;  4I62 A;  3IX1 A;  4MFI A;  4ZED A;  4JSD A;  4RNS A;  3TCF A;  4RYA A;  3LV0 A;  1CB6 A;  1R9Q A;  3S9E A;  2M8C A;  4YIC A;  3EHS A;  3IFA A;  1ATG A;  2UYF A;  2JJK A;  1UIU A;  3VE1 B;  3UIF A;  3HFU A;  2ALU A;  1MM7 A;  1FTA A;  1VSO A;  5L9S A;  1B7H A;  1PC3 A;  4GWS A;  2UXA A;  4GD5 A;  5AA4 A;  1A8F A;  2HCA A;  4KI0 E;  1INP A;  1G0I A;  4H1X A;  1B32 A;  3FV2 A;  1N0T A;  4ZDM A;  2NXO A;  1FQA A;  2ZMB A;  3ILU B;  1Y3Q A;  3N6T A;  3A3C A;  4G68 C;  3RT8 A;  3K1N A;  1BP5 A;  3QUF A;  4HE0 A;  4F39 A;  1YYZ A;  1K9Z A;  2I0B A;  3BBR A;  1IEJ A;  1MPB A;  4NF6 B;  4GXS B;  2CZH A;  5ICT A;  1ZKB A;  4O94 A;  4ZEK A;  2O68 A;  1B4Z A;  1UTB B;  4OEN A;  4NF5 B;  1USY H;  2XXT A;  4ESW A;  3KZG A;  3SDF A;  5EHM A;  4NF4 B;  3E3K A;  3RTW B;  4DXU A;  1M5F A;  3SEV A;  4N4U A;  3THI A;  1LFG A;  3KOS A;  4P0I A;  1R9L A;  4U4S A;  4GOT A;  3G3K A;  1Y20 A;  3D4C A;  3CVG A;  5CMC A;  1LGB C;  4BDQ A;  1KA0 A;  2BJI A;  4NG7 A;  4GRK A;  3OD7 A;  4AS4 A;  3IOT A;  2VD2 A;  5EQ7 A;  1FW0 A;  4F29 A;  1DTZ A;  5ET7 A;  2CEX A;  2VT5 A;  1US4 A;  1FQF A;  1JW1 A;  2XXK A;  3G7W A;  5AE4 A;  3MZ1 A;  3RQT A;  3P7I A;  4ELR A;  2I3V A;  1SW1 A;  5HPQ A;  3CR9 A;  5EQ9 A;  3K02 A;  5B7D A;  4HS7 A;  5H8N B;  1B52 A;  1MXU A;  3OEN A;  4YZZ A;  4MNC A;  3KEI A;  3CFZ A;  1SD3 A;  3S2V A;  1ZTY A;  1MH3 A;  1SQY A;  1B46 A;  3ONM A;  1D9Q A;  4IB2 A;  4XEQ A;  4XIG Q;  2P1S A;  4MJO A;  3K4U A;  4KXP A;  2AYS A;  4GBW A;  3RUM A;  2XXX A;  4JBZ A;  4BDM A;  2ONS A;  2DP8 A;  2FVZ A;  3L6G A;  1H45 A;  1URD A;  5ITP A;  4QBA A;  4H0W A;  4NF6 A;  3QSL A;  1RDY A;  3R6U A;  1IMA A;  2BJJ X;  4H8J A;  3CSG A;  1LCF A;  2DVZ A;  1MRP A;  3OO8 A;  2QJE A;  4P47 A;  1FRP A;  1NUW A;  3DLN A;  5I5P A;  1JEU A;  1EYK A;  4OVJ A;  4ZE8 A;  3G3H A;  4X8R A;  2MKZ A;  3QIM A;  3RT6 B;  2D3I A;  2G93 A;  2FYI A;  2QS3 A;  1BK4 A;  1JP4 A;  5FTI A;  1PB7 A;  2I58 A;  1PBP A;  1IIT A;  4HE2 A;  5ELV A;  5K2Y A;  1LAG E;  2XWK A;  2XXI A;  2DE3 A;  5CM6 A;  2AL5 A;  1WVJ A;  4MF3 A;  4F19 A;  4ZEC A;  4NWC A;  4ZS9 A;  3M3L A;  2PVU A;  4N6D A;  3TKD A;  4OFL A;  2Q2A A;  1NUZ A;  2HAU A;  4KQP A;  1MXW A;  1FPD A;  4YKP A;  3UOR A;  4NHB A;  3TPA A;  4XKP A;  5T3J A;  1KWH A;  4PE5 B;  4PCD A;  2B65 A;  4ELQ A;  3MVZ A;  3VLU A;  1AMF A;  2V84 A;  3WAE A;  2D5W A;  1II5 A;  4XF5 A;  4R6Y A;  1URS A;  3FXB A;  4PTK A;  1MG1 A;  2DWJ A;  4PE3 A;  4OFO A;  4TQU Q;  3TFL A;  1D9V A;  5L8D A;  5IZ3 A;  4YMA A;  1EZO A;  4RJZ A;  2QSX A;  2DXY A;  1H43 A;  1RDX A;  2ZXT A;  4GWW A;  2ANJ A;  3CSB A;  5DTB A;  2I3W A;  4P0G A;  3IOW A;  1Y3N A;  2HHM A;  3SKP A;  1EZP A;  3ZS6 A;  2DWA A;  1LBW A;  4U22 A;  1XHY A;  1M5B A;  5KDT B;  3TEL A;  4DCX A;  3KG2 A;  1QUI A;  3VLW A;  4ZEB A;  4HCW A;  5DVF A;  2P0S A;  3OMB A;  2FBP A;  4NTL A;  4L17 A;  3U93 A;  4PAF A;  3VVE A;  5ET8 A;  3PV0 E;  3R26 A;  1FPB A;  5AA2 A;  2PCR A;  1L5T A;  2WEF A;  1JW5 A;  1IXI A;  3FIR A;  3N6U A;  1MDQ A;  1FPE A;  2OWS A;  1QKA A;  2QL3 A;  1B5H A;  4XKN A;  1J1N A;  2QPQ A;  2GHB A;  3MUQ A;  4LQ2 A;  5LOM A;  1B1X A;  5I2N A;  2HZK A;  1UTH B;  3VDF A;  1SW2 A;  1O7T A;  4UAB A;  4TLL B;  1EYI A;  1HSE A;  3NOH A;  2XXH A;  1DPE A;  1FBG A;  5TP9 B;  3TUS A;  3K1M A;  4C1T A;  2AL4 A;  1Y9U A;  4PF6 A;  3FBP A;  3C9H A;  3TQW A;  4F2Q A;  3B6T A;  2Y7P A;  2VPO A;  3CG1 A;  5CBS A;  1P1U A;  3O2A A;  2VD3 A;  2R8T A;  2V3Q A;  1NNP A;  1I6B A;  1LBX A;  4NF8 B;  4DCY A;  4THI A;  3FD3 A;  3E9X A;  3LR1 A;  3SEW A;  3S9L C;  5AA2 D;  1OLC A;  1P99 A;  4YB7 A;  4UA8 A;  1SDX A;  2V3T A;  1FQD A;  1UIV A;  2OBG A;  5CBR A;  4X48 A;  4IO5 A;  4JVC A;  5J1D A;  1DTG A;  3JYR A;  4HXV A;  1A55 A;  1YZ0 A;  3KN8 A;  3VV5 A;  3O6G A;  1B51 A;  3CFX A;  1O64 A;  5ESY A;  1MS7 A;  2F35 A;  2H4I A;  3G3J A;  1P1Q A;  4EUO A;  5HBC A;  3LSF B;  1MY0 A;  2PYY A;  2X26 A;  4P1E A;  4PFI A;  4U1O A;  1FBD A;  2A5T B;  5I2K B;  1LAX A;  4K3F A;  1ZIU A;  1A8E A;  1YTV A;  2WBB A;  1LBB A;  2XX8 A;  2Y7I A;  5I59 A;  2YJP A;  5FHO A;  4GFR A;  4PFT A;  4OTE A;  3RN8 A;  5I84 A;  3I6V A;  4H67 A;  1MQI A;  4DLD A;  3TTR A;  4KHZ E;  3JZJ A;  5I58 B;  2REJ A;  4EF1 A;  3ZKL A;  1MH4 A;  4OER A;  4KR5 A;  4QFK A;  3H6T A;  4EXK A;  1FQB A;  5H8S A;  3A29 A;  4PAI A;  2H5Y A;  4F31 B;  3T9X B;  5TPA A;  3TMG A;  2V93 A;  2RC8 A;  1SPI A;  2R9J A;  1A7L A;  5DEX B;  3HCQ A;  1B40 A;  1VE4 A;  1MXY A;  1MY4 A;  1S50 A;  1QW0 A;  3H6U A;  5JTY B;  4GL8 A;  2CZI A;  4TLM B;  3TTN A;  2I49 A;  4OHN A;  1DCU A;  3VVF A;  4DE8 A;  4EQ7 A;  3K1P A;  4O3B A;  4HW8 A;  2XXU A;  3PUW E;  5H8Q B;  1FQC A;  4N8G A;  1IUD A;  2DWH A;  4PC9 A;  2GQ1 A;  1WOD A;  4G8M A;  3SEX A;  1RKM A;  3PUX E;  1B58 A;  3O9P A;  1IZ1 A;  3RTF B;  3EKI A;  3PPP A;  4ND9 A;  2V4C A;  3OEL A;  3FVK A;  3ISP A;  3U94 A;  5I7I A;  1Y3P A;  2UVH A;  3DM0 A;  4LQ5 A;  4P11 A;  2E0S A;  3IO4 A;  1RDZ A;  3LSW A;  4I1D A;  2I48 A;  4FAJ A;  4EXL A;  3TTM A;  4LP2 B;  3TAJ A;  3TOD A;  4Q0C A;  2PT1 A;  1B4H A;  3LC8 A;  2HEU A;  1FBF A;  1PEB A;  3HN0 A;  1RYX A;  3QMF A;  1AL3 A;  1XVX A;  3KJ7 A;  3IO6 A;  2ZYO A;  4GF8 A;  4H5G A;  2GHA A;  3FXR A;  4PAK A;  2FNC A;  3RY3 A;  1Y4T A;  4BDN A;  4NED A;  1FPG A;  1JEV A;  3IB2 A;  3KC1 A;  4E0W A;  4WKM A;  3V5A A;  1F9B A;  1P1O A;  4QSC A;  3LSL A;  4TOZ A;  5A5X B;  3IB1 A;  4PFU A;  4DI3 D;  2KR0 A;  1MDP 1;  4N13 A;  4ECF A;  2RKM A;  2QVU A;  3KGC A;  4OVS A;  3RGY A;  3VXB A;  2XXP A;  3PMX A;  4YMB A;  1FSA A;  1POY 1;  4RPN A;  2XWO A;  3M3F A;  4G4P A;  1B2H A;  1K9Y A;  2H9B A;  1ZLQ A;  1MM6 A;  3TQL A;  5H8H A;  4RXL A;  4H46 A;  2Q89 A;  3MPK A;  3PUY E;  1ZMG A;  1GVC A;  4MNI A;  1EYJ A;  4R9F A;  1MPC A;  2QFL A;  1B5J A;  1B0H A;  2ONK E;  4P8B A;  3CI8 A;  1SYH A;  2Y7K A;  3QUJ A;  4X1B A;  4DDD A;  5IKB A;  4XFE A;  4PFR A;  4YKI A;  4LON B;  4PF8 A;  3MWB A;  5M2V A;  4PBQ A;  5DVJ A;  2ZZW A;  5FHM A;  4JVD A;  4R6K A;  3N26 A;  2V3U A;  1S7Y A;  4N81 A;  1R1N A;  2XWV A;  3M3K A;  4GWX A;  2Y7R A;  4F1V A;  1MY3 A;  4F22 A;  1N04 A;  1URG A;  4ZEF A;  4ZE9 A;  2OX3 A;  4JB7 A;  3LUZ A;  2NUV A;  4N17 A;  4QFO A;  1Q35 A;  3FUZ A;  2ONR A;  1B7Z A;  1FJ6 A;  1SI0 A;  2Q88 A;  3TCH A;  3U72 A;  3PPO A;  3S9N C;  3HHF A;  4I9D A;  1PBQ A;  2FHY A;  4WXJ A;  3K6V A;  3E79 A;  4DXC A;  2Z8F A;  1TXF A;  1BLF A;  5A5L A;  2CZL A;  5LDZ A;  4BDL A;  1EZ9 A;  3FJM A;  5DT6 A;  3C34 A;  1UTB A;  4Z7E A;  4NF5 A;  3HST A;  5I57 B;  2F3D A;  4NF4 A;  5EYH A;  1FPK A;  3TTK A;  1IXG A;  2O7U A;  3QXM A;  2WX9 A;  1LBY A;  4OMB A;  3V89 B;  2WBD A;  3PD8 A;  2ZYM A;  4O7I A;  3FAS A;  5ET6 A;  3TDJ A;  4MIJ A;  1M5D A;  2OJT A;  2Q2C A;  3H4Z A;  1MY2 A;  4DXB A;  4KYE A;  1XC1 A;  4PDD A;  3IB0 A;  4JWO A;  3C36 A;  4M1V A;  2RC9 A;  2OZZ A;  3IJO B;  1B0L A;  5L9M A;  2RCB A;  2DE2 A;  1QJM A;  4IGT A;  5H8N A;  4AB6 A;  1NNT A;  4GVO A;  1VR5 A;  2F3B A;  3H06 B;  1BTJ A;  1FTL A;  3MP8 A;  4Q5T A;  1XOC A;  3UK4 A;  4Q30 B;  3FGS A;  1OIB A;  2X7Q A;  3F11 A;  3O6H A;  4RA1 A;  3PMW A;  1FBC A;  1PB9 A;  4OA4 A;  2FIE A;  2YPN A;  3GZG A;  3B50 A;  2Q74 A;  2F7A A;  4N91 A;  3ZSF A;  1NH7 A;  5FBP A;  3PUZ E;  4NX1 A;  1NV7 A;  2E1S A;  1HSJ A;  5EHS A;  2W7Y A;  3OO7 A;  2VOZ A;  2B4M A;  1N7W A;  1R6Z A;  3SES A;  3K01 A;  3CFL A;  2XX7 A;  4QFN A;  3KSJ A;  2A5S A;  2KLF A;  1DOT A;  1IMF A;  3IR1 A;  3OOA A;  4PFB A;  3MVW A;  1PDA A;  4QFP A;  4LUB A;  2LAO A;  1ZJL A;  4IGR A;  4P3L A;  4G8N A;  3IL1 B;  4O3C A;  4MNP A;  3GYY A;  3MP6 A;  5EYG A;  5AA3 A;  2XXV A;  2UYE A;  2PT2 A;  2F6G A;  3VLV A;  2DS9 A;  4ZEI A;  1USY E;  4M4G A;  4E0X A;  1YAE A;  2HXW A;  4FBP A;  1NMU A;  3MQ9 A;  5KCJ B;  3QK6 A;  2V25 A;  3UN6 A;  1Y4C A;  4ELP A;  1B1H A;  1TWY A;  3KBZ A;  1JET A;  4OQO A;  4R9G A;  2Y5L A;  3I3V A;  4LZ8 A;  1MQG A;  3PPR A;  3LSX A;  4FIM A;  4AS5 A;  1B9J A;  3UA8 A;  4MEV A;  4BDR A;  4O8M A;  2B4L A;  5K2X A;  2XD3 A;  4H65 A;  4NGU A;  2I0C A;  3EF7 A;  3O66 A;  3U92 A;  3T93 B;  2X7P A;  4FEB A;  4KCD A;  2GRV A;  1LAF E;  1Y1M A;  1NUX A;  1IXH A;  1FPI A;  4GQO A;  1N76 A;  4G68 B;  2DE4 A;  2Z8E A;  2DWI A;  3MZ9 A;  5FTH A;  5JK4 A;  4I40 A;  4ONY A;  1EU8 A;  1LB9 A;  1IXC A;  2F34 A;  2XHD A;  5KDT A;  3Q28 A;  5ITO A;  3PUV E;  1M5C A;  2DSF A;  4ZZE A;  3ZKK A;  1OMP A;  2F5X A;  4U4X A;  1TFA A;  3R7X A;  4QRZ A;  3SEY A;  2GFE A;  3KN7 A;  2QS2 A;  1H76 A;  4U2R A;  3Q25 A;  2I4B A;  2D21 A;  1DBZ A;  4Q8R A;  2XD2 A;  3A09 A;  2QMW A;  5EQA A;  3D1R A;  5H8F B;  5ISU A;  1QVS A;  1ZBM A;  1MPD A;  4WEP A;  1KZ8 A;  1N7X A;  3VVD A;  3GLB A;  1QGX A;  3W9V A;  3E78 A;  3PPQ A;  5DYH A;  3B6Q A;  3CHG A;  4IY6 A;  2DYX A;  1B6H A;  3FJG A;  4KPT A;  1UQW A;  2H99 A;  3LUY A;  1UTH A;  4GX3 A;  1OQG A;  4NQ8 A;  2WYK A;  3C4M A;  4POW A;  3KBR A;  3KJT A;  5IGA A;  4EF2 A;  4GLI A;  1AH5 A;  1XI6 A;  2F78 A;  5TP9 A;  1GTK A;  2RF1 A;  1I6A A;  4RY1 A;  4NN3 A;  4RK9 A;  2DQV A;  2IA4 A;  1EH3 A;  3BIH A;  4H6D A;  1FJ9 A;  4PFY A;  2XXQ A;  3V83 A;  4YKK A;  2UVG A;  2KQZ A;  3O28 A;  4NF8 A;  2ABH A;  4H45 A;  1KA1 A;  2ZYN A;  4QXD A;  1XS5 A;  2CZK A;  4AB5 A;  3C35 A;  4NF0 A;  3B6W A;  2DVC A;  3K6W A;  2QS4 A;  3N5L A;  4IR8 A;  2F6P A;  4IO4 A;  1NFT A;  1H3D A;  4OVT A;  2F36 A;  2ZNS A;  4YAH X;  1M5E A;  1H44 A;  3MJN A;  4F2O A;  3Q26 A;  4HCY A;  5H8F A;  4JVI A;  2DXR A;  3W9W A;  2WKY A;  3TCG A;  4F3S A;  4HTG A;  2ZZX A;  4X9T A;  4EQ9 A;  2A5T A;  3SZP A;  1MXZ A;  3N94 A;  2CMO A;  2VGQ A;  4MBP A;  2Q9T A;  3Q29 A;  4R74 A;  3SET A;  1B05 A;  5I2K A;  1VFD A;  1POT A;  2XWI A;  4OWD A;  4QF9 A;  1NV6 A;  1DSN A;  1AOV A;  1ZU0 A;  4N6K A;  3K6X A;  1N84 A;  1JW4 A;  3LBS A;  3PGF A;  1LFH A;  5I58 A;  1IMB A;  3UGW A;  3T22 A;  4PGN A;  5LTC A;  4F3G A;  3OEK A;  3TZA A;  5CI5 A;  3VFJ A;  3OSR A;  4PGP A;  4WED A;  1D4N A;  4IY5 A;  3ROJ A;  4GIZ A;  3C32 A;  4JWY A;  3MBP A;  1CE2 A;  4KFQ A;  5DEX A;  5F1Q A;  3EN3 A;  2OWZ A;  5JTY A;  3MVY A;  4AQ4 A;  2HZL A;  1BKA A;  1IMD A;  1O63 A;  2QMX A;  2PBW A;  2QVR A;  1NV4 A;  2RIN A;  4GBV A;  2O84 X;  4GX4 A;  3KOT A;  5H8Q A;  3C31 A;  3G3G A; 
#chains in the Genus database with same CATH homology
 4MCO A;  4MMP A;  4GX6 A;  5F24 A;  4I3E A;  3RPL B;  4UAB A;  4PDD A;  1EYI A;  2VPN A;  4M1V A;  3NOH A;  4F1U A;  1FBG A;  3MYU A;  2DE2 A;  2P3V A;  4N15 A;  4NAP A;  2FIX A;  2F3B A;  2CEY A;  4OVQ A;  4PF6 A;  3FBP A;  4PET A;  1FPJ A;  2Y5K A;  2VPO A;  1FBC A;  4OA4 A;  2FIE A;  1IMC A;  3B50 A;  2Q74 A;  2R8T A;  4N91 A;  1NV2 A;  2V3Q A;  2Q8M A;  1CNQ A;  1LBX A;  3PTY A;  5FBP A;  4NX1 A;  1NV7 A;  4P1L A;  2ZZV A;  1FBH A;  2B4M A;  5IZZ A;  1NV0 A;  4GWZ A;  4JVC A;  5J1D A;  1FPL A;  4HXV A;  1IMF A;  4PFB A;  1YZ0 A;  5ESY A;  4P3L A;  1NUY A;  3T0J A;  3LV0 A;  4MNP A;  3GYY A;  5EYG A;  4YIC A;  5ET5 A;  2DDK A;  3IFA A;  4P9K A;  4P1E A;  4PBH A;  4PFI A;  3RYD A;  2JJK A;  4P56 A;  1AWB A;  1FBD A;  3HFU A;  5IZ3 B;  1FTA A;  4FBP A;  4GWS A;  4GWY A;  3RPL A;  2WBB A;  1INP A;  1G0I A;  2XA5 A;  3KBZ A;  2HPG A;  2Y5L A;  4HE1 A;  4HE0 A;  5I3S A;  4DI4 B;  1YYZ A;  4PDH A;  1K9Z A;  4AS5 A;  4OAN A;  4MEV A;  4O8M A;  2B4L A;  2CZH A;  4O94 A;  4NGU A;  3A29 A;  4PAI A;  5EQ8 A;  1SPI A;  1NUX A;  4N4U A;  4GWU A;  1FPI A;  3B8B A;  2CZI A;  2DE4 A;  1DCU A;  5JK4 A;  4I40 A;  1KA0 A;  2BJI A;  4NG7 A;  4AS4 A;  4N8G A;  4PC9 A;  2GQ1 A;  5EQ7 A;  3KC0 A;  5ET7 A;  2CEX A;  2VT5 A;  2XXK A;  3EKI A;  3T1B A;  2F5X A;  2V4C A;  5EQ9 A;  3ISP A;  1NI9 A;  5I7I A;  4YZZ A;  4MNC A;  1LEV A;  4MHF A;  1DBZ A;  1D9Q A;  1RDZ A;  4XEQ A;  5EQA A;  3D1R A;  4MJO A;  4KXP A;  1KZ8 A;  1VDW A;  3U65 A;  2PFZ A;  4GBW A;  1QGX A;  3W9V A;  3E78 A;  2FVZ A;  5J16 A;  3CHG A;  1FBF A;  4F18 A;  3QMF A;  3IFC A;  4OVP A;  4QBA A;  4GX3 A;  4NQ8 A;  2WYK A;  1RDY A;  1IMA A;  3MST A;  1FBE A;  5IGA A;  4PAK A;  2DVZ A;  5IM2 A;  1XI6 A;  4P47 A;  1FRP A;  1FPG A;  1NUW A;  1G0H A;  5I5P A;  3KC1 A;  1EYK A;  4X8R A;  2MKZ A;  4N8Y A;  4O7M A;  4NN3 A;  1BK4 A;  1JP4 A;  4DI3 D;  4X04 A;  2KR0 A;  3BIH A;  4HE2 A;  2QVU A;  4OVS A;  1FJ9 A;  2XWK A;  2DE3 A;  1FPF A;  5CM6 A;  1FSA A;  2XWO A;  2KQZ A;  1Q9D A;  4MX6 A;  4F19 A;  4H45 A;  1KA1 A;  1K9Y A;  4QXD A;  2CZK A;  4N6D A;  4NF0 A;  4OVR A;  4H46 A;  1NUZ A;  4MNI A;  2HXR A;  4IR8 A;  1EYJ A;  1FPD A;  2QFL A;  4NHB A;  4OVT A;  4P8B A;  5DW8 A;  5T3J A;  4PCD A;  4HCY A;  4JVI A;  4XFE A;  4PFR A;  3W9W A;  1NV3 A;  4PF8 A;  5IZ1 A;  4PBQ A;  2ZZX A;  2ZZW A;  1FBP A;  2PFY A;  4XF5 A;  4JVD A;  3BIG A;  3FXB A;  4PTK A;  4PE3 A;  4N81 A;  4X9T A;  2XWV A;  5IZ3 A;  3SZP A;  4GWX A;  4F1V A;  2Q9T A;  1IME A;  1RDX A;  4GWW A;  2OX3 A;  3LUZ A;  4N17 A;  2HHM A;  2XWI A;  2L5V A;  1FJ6 A;  1NV6 A;  1LBW A;  1LBZ A;  4N6K A;  2FHY A;  1YXI A;  3E79 A;  1IMB A;  4I3Y A;  1NV1 A;  4HCW A;  4PGN A;  5LTC A;  5LDZ A;  5A5L A;  1LBV A;  2FBP A;  2WYP A;  4PGP A;  3ROJ A;  4PAF A;  5ET8 A;  2F3D A;  5EYH A;  1FPK A;  1FPB A;  1NV5 A;  1DK4 A;  2PCR A;  2QVV A;  2WEF A;  2OWZ A;  2WX9 A;  1LBY A;  2HZL A;  2P3N A;  1FPE A;  1IMD A;  4MAG A;  4G61 A;  2WBD A;  2QPQ A;  2QVR A;  4O7I A;  1NV4 A;  5ET6 A;  4GBV A;  4LN5 A;  4GX4 A;  4MIJ A;  2HZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...