3NOHA

Crystal structure of a putative peptide binding protein (rumgna_00914) from ruminococcus gnavus atcc 29149 at 1.60 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENADYIILDSAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative peptide binding protein (RUMGNA_00914) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Peptide binding protein
molecule keywords putative peptide binding protein
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.210 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3nohA00
3NOHA
chains in the Genus database with same CATH superfamily
4N6DA 1LGBC 1K9ZA 1LBCA 2I58A 1VFEA 3THIA 4YB7A 4LQ2A 1M5CA 4EXKA 2QVVA 2ZZXA 1O64A 3IOVA 4P0GA 2P1SA 3JZJA 1SW1A 4HTGA 5A5XB 1PC3A 3QMFA 1LCFA 3FV1A 1FRPA 5DT6A 3KC0A 5H8SA 1NV5A 1F9BA 2F78A 1PBQA 3GLBA 2OBGA 2FBPA 4POXA 2W7YA 1DOTA 1MXWA 2VPOA 3IOWA 4NTLA 5ICQA 3PPPA 3UK4A 2QFLA 3IORA 4KPTA 3OO6A 3KSJA 2X26A 5JK4A 3PTYA 2F7CA 2FYIA 2L5VA 3VXCA 3K6WA 2NVUB 1FPGA 3FVKA 1P1UA 4OVTA 1ZIUA 4C1TA 5EQAA 3TQWA 1ANFA 2QS3A 3EF7A 4LONB 3IFAA 1RYXA 4P11A 2DQVA 1ATGA 1FPDA 4G68B 4PFWA 2V25A 1MQGA 1TFAA 5TP9B 1NV6A 4DXCA 3UGWA 5I7IA 5ESYA 3CR9A 1FBHA 4KYSA 1EYKA 2V3UA 3RT6B 3C9HA 1PDAA 2DS9A 2DWHA 1AL3A 3MP8A 4GBWA 1IMDA 2WBDA 1SW2A 2ZNUA 1ZJLA 3VVEA 4MMPA 2XWVA 4JVCA 4ZS9A 3KSXA 1EU8A 3O28A 4I40A 3WAFA 1Q1KA 1B3HA 4U1ZA 1DTZA 1DPPA 3H6VA 5I2NA 3KEIA 4MIJA 4PGPA 4GBVA 1M5DA 4Q8RA 2AYSA 4NMYA 3JV9A 4G77A 2THIA 4F29A 2QVRA 2Z8FA 4DCXA 1QUIA 4PF6A 3MUQA 4ZEIA 5DVIA 4F1YA 5H8NA 2UVHA 2RC9A 3D4GA 1D9YA 2H9BA 5I58B 3PPRA 1OQHA 1POY1 1I69A 3K1NA 2VD3A 3B50A 1QKAA 5H8QB 5FBPA 3VXBA 3IO6A 1H43A 2F3DA 1B52A 4MEVA 3V89B 5I58A 3K1MA 3V5AA 5AA2B 4EQ9A 2XXHA 3RPWA 3MVZA 5I2KB 1IIWA 1NV2A 3TKDA 3USDA 3PUWE 1FPBA 2Y7WA 2GQ1A 2CMOA 1P1QA 1B0LA 4KI0E 3ONMA 2REGA 2PMSA 2HFBA 4G61A 3I3VA 3KZGA 2KR0A 1MXZA 3KGCA 3TMGA 4JB7A 4H0WA 4I8CA 2ANJA 4DXBA 1POTA 4G68A 1Z7NE 3PGFA 3HSTA 4LVQA 4LZ5A 2PX1A 1FCKA 3UN6A 1NUZA 1YTVA 1FPJA 1SI1A 3IB1A 2DP8A 2PT1A 1NFTA 4GQOA 5CMKA 4POWA 3VV5A 4H5GA 2O68A 3TCGA 2VD2A 3T93B 1IMCA 5TP9A 3MPLA 2H5YA 5DEXB 5FHNA 3FXQA 3E13X 5IZZA 2I3VA 2Y7RA 2A5SA 1NV3A 5IAIA 4YB5A 4RYAA 2ZMBA 4RA1A 1N76A 4YAHX 3B7DA 3FXBA 4R75A 4U21A 2ZZWA 3OMBA 4MNPA 3G3GA 3T9VA 3TCFA 5F24A 3A09A 3K6UA 1BP5A 2WYPA 4GWZA 1GGGA 2O7IA 5DEXA 4DI3D 5I59A 1MPBA 4UACA 1YZ0A 4ISUA 1TXFA 4H45A 3OOAA 4DLDA 4MX6A 2ONSA 1INPA 3FUZA 3RPLB 1Y1MA 1MM6A 4ELQA 1N3WA 4PDDA 1FTKA 4R6YA 1MY2A 4MHFA 3K01A 1CE2A 3SEVA 5KCJB 3FJ7A 1N04A 1R6ZA 1B5HA 4XKNA 2DYXA 2Z8EA 1PB8A 1J1NA 4F19A 4DZ1A 4QFLA 4R9FA 4AS4A 3L6HA 5ISUA 2PCRA 2NWJA 2CZIA 1D9QA 2B3FA 2XXUA 4FEBA 2GHAA 4YKKA 2QMXA 3TQLA 3UORA 4AQ4A 2QVUA 4OXVA 4QRZA 5TPAA 3O2AA 4QFOA 3FATA 1FBEA 1S50A 3O66A 4G4PA 2CZKA 4GWOA 1EYIA 2RF1A 5AA4A 1Y3PA 4P47A 1B3LA 2DWJA 3EQ1A 3CFZA 3LSFB 4RK9A 4MFIA 3IK6B 4C1UA 1MY3A 3FJMA 4JWOA 2F3BA 1IXIA 3CG1A 1LB9A 3MZ1A 4YMBA 5IKBA 4LUBA 1MM7A 2PT2A 4EQBA 1MY1A 2UXAA 3W9WA 4EF2A 3U94A 3ODBA 1LBYA 1LAFE 1QJMA 1FTAA 3D4CA 1B40A 5L9SA 2A5TA 2Y7PA 5HPQA 4GWSA 5EQ8A 1JW1A 4PE3A 3RYDA 2E1SA 4R2BA 4U2RA 4NF0A 4PCDA 3IOTA 3IJXB 4FATA 2ZZVA 1R9LA 4Z7EA 3TTRA 3KJTA 2O6AA 1R1NA 3IOUA 4JDFA 4IGTA 4JSDA 2BJJX 4N8GA 2OX3A 3KG2A 2VGQA 1FTJA 4EQ7A 1FBCA 3TEPA 5JTYA 2NXOA 3JYRA 3MZ9A 4WEPA 3M3FA 4NGUA 4PFRA 4FE8A 1GTKA 1MXXA 3KBZA 2PFYA 1B32A 3RLFE 4XKQA 1EZ9A 1KWHA 1EZPA 3RGYA 4YZZA 3ZKLA 4N6PA 3TTKA 4OA4A 1ZBMA 5DVFA 3PD9A 4BDOA 1D4NA 2GRVA 3C31A 4AB6A 4OQOA 3VE1B 3OD7A 1FBGA 3CG3A 1TT1A 2F34A 3MVYA 4NE4A 5F7VA 3OENA 3RTFB 1A8FA 1NH8A 1P99A 4YKPA 4KCCA 4XKPA 2DSFA 1H76A 4GLIA 4YU0A 3EHUA 4AB5A 4G68C 4FIMA 3FASA 2H4IA 3SDFA 1G0HA 2I0CA 3PU5A 1M5BA 1FSAA 3ZSFA 2QJEA 1KA1A 5HM4B 1YPNA 1IXGA 2XX9A 3LSXA 2O1MA 3OSQA 1LLSA 5ET8A 5J1DA 1SD3A 1FTOA 4OEVA 4F1VA 5CM6A 5KZTA 1XOCA 4E0WA 4DXUA 1M5FA 2UVJA 4PBQA 1A8EA 3IR1A 5F1QA 5ELVA 2CEYA 1RDYA 1N0TA 4DDDA 4M4GA 3B8BA 1OLAA 3N94A 4EF1A 5ET6A 3T0JA 3C33A 5CMMA 5KDTB 4LA9A 2XHDA 5ET7A 1OIBA 3Q25A 1LBZA 4GL0A 1T0KA 3LC8A 3MVXA 3KBRA 2DOJA 3H6UA 3S9EA 3W9VA 2Q88A 2DXRA 4THIA 4PGNA 4HE0A 4PDHA 5HBCA 4ELPA 1UTBA 2DVCA 5T3JA 2B65A 4QFPA 4O3BA 4GXSB 4OENA 4HE1A 4LP2B 1SI0A 1TFDA 2XXWA 4FJPA 4JXIA 4F3BA 1B6HA 3MSTA 3CIJA 3S9MC 3QXMA 1G0IA 2O1LA 2P3NA 1Y4TA 3E9XA 3IAZA 3OO8A 4H8JA 2V3TA 5ICTA 3N6UA 1WODA 3DP4A 2DDKA 4NEDA 4KYDA 1RDXA 2XXIA 4OTEA 3RQTA 3G3IA 1RKMA 3HO7A 3PV0E 2VOZA 3RN8A 4JVIA 3GBBA 3PUVE 1HSEA 1URSA 3FBPA 2R8TA 3RUMA 2IEEA 4LQ5A 1NUXA 2Z23A 1ZMGA 4Q30B 1H3DA 5CRYA 2QS1A 4ZEKA 4PFBA 4DCYA 1B3EA 4KD5A 1RDZA 1JEVA 4PQJA 5CMCA 4NAPA 1SPIA 3QSLA 1BIYA 4N91A 2KLFA 3K6VA 4RPOA 1A54A 3C35A 4ZDMA 2UYEA 4Z0IA 2GH9A 5H8HA 3F11A 3FVNA 1VR5A 3MQ9A 1O7TA 1MY4A 1B7UA 3PMXA 3G3HA 3ISPA 4X1BA 2VP1A 3TELA 1LAXA 2R9JA 3I6VA 4O7IA 4K3FA 1B51A 4OYVA 1B4HA 4ONYA 2O51A 3OSRA 1QW0A 4DI4B 2OWTA 1MQIA 4DIGA 3L6GA 1Y20A 5I57A 4F2QA 1FPLA 3U92A 3LSWA 3QK6A 2PVUA 4FORA 2XXXA 1HSJA 1N7XA 2V84A 2FIEA 1MDQA 4KCDA 2UVIA 1K9YA 5EHSA 1IXCA 5CBRA 2Y7IA 4UA8A 2NUVA 4O3CA 3UP9A 3ILTB 4OANA 4PTKA 1Z7ME 3PUXE 2PFZA 1MG1A 4QFKA 4HXVA 1B1HA 3R6UA 3RPLA 2XXPA 5IZ3A 1B1XA 1Y1ZA 2F97A 1YXIA 2ONKE 4OHNA 1B9JA 3CRBA 1BKAA 4F22A 1L5TA 3T9UA 3VFJA 4PP0A 4MBPA 4YB6A 4TLLB 3RY3A 1XVXA 2AL4A 4O8MA 4P56A 3CSGA 3O29A 4PAFA 5I59B 1MXYA 1P1WA 2V4CA 3KN3A 4IO3A 2Q74A 1D3KA 2I4CA 3O6HA 4NWDA 3BFUA 4BLAA 1FQBA 1P1OA 3PUYE 3O6GA 2VHAA 3HHFA 1B2HA 4OVSA 3BBRA 1MXVA 4KQPA 5A5LA 3MWBA 3PUZE 2OK2A 4QXDA 2DVZA 3E78A 2ONRA 4O94A 2HEUA 3T9HB 4MAGA 2YJPA 3VVFA 2QSXA 3DM0A 4I3YA 4GOTA 5I57B 2OLBA 3PMVA 1B4ZA 5CMBA 3O97A 3IB0A 1Y3NA 4ELOA 3PPNA 4OESA 4JVDA 1ELJA 2ZYNA 1IZ1A 4R72A 5CC2A 2KQZA 2HCAA 3VVDA 3ZS6A 4XIGQ 3PPOA 4ZEFA 5DVJA 1NNFA 2Q2AA 2F36A 1KA0A 2E0SA 1VE4A 4DE8A 1FQCA 3TAJA 4OZ9A 1MH4A 3T22A 3FXUA 1FQDA 4NN3A 1LEVA 1QUKA 2F6PA 1Y4CA 4MNCA 4LZ8A 4U4XA 3TTNA 5L9OA 4KHZE 3S4UA 3E4RA 3ILUB 4GWWA 1AH5A 1LSTA 2RC7A 3FV2A 3VLWA 4PFIA 4AS5A 1OVBA 1LBVA 1FQAA 4FECA 1EZOA 4X1DA 2JJKA 5AA4B 4ECFA 3CI8A 3Q29A 2Z22A 3TFLA 3EHTA 5CBSA 4NF8A 3SEYA 1EYJA 2HAUA 3LBSA 5TPAB 3PMWA 4OFLA 4BDLA 2G93A 2DE2A 3TUSA 2Q89A 2M8CA 4G2ZA 1SVXB 4GD5A 1FQEA 3CSBA 4NF6A 1NI9A 1IMAA 1IMEA 1UTHB 2V93A 3M8UA 4QSEA 5FTHA 4OFOA 1LFGA 3C4MA 4U23A 5FHOA 1A40A 3S2VA 1BK4A 4OETA 3QAXA 3AXFA 2XXVA 4ND9A 1B7ZA 3CHGA 1PBPA 2P3VA 2ZNSA 4RJZA 1UIUA 4ESWA 1GV8A 4GX6A 3U65A 2X7PA 2H99A 4F1UA 4FEDA 4GF8A 4ELRA 2H98A 3E79A 3SESA 5EYHA 3DELB 1FW0A 2YLNA 3OO9A 3OO7A 1A7LA 1NNPA 2XXQA 4OFJA 1NUYA 1WVJA 2RKMA 3EN3A 1VFDA 3SEUA 3TPAA 4M1VA 4R2FA 1JNFA 2RCAA 3D1RA 4TOZA 4OEUA 2YPNA 3LSLA 3UA8A 3H7MA 1MS7A 3HV1A 1LAHE 4IGRA 4ESXA 3GYYA 5A5XA 4I62A 1XC1A 3KC1A 4IO6A 4X04A 4MH5A 2DXYA 4G8MA 1FJ6A 4F3PA 1IITA 1D9VA 4YKIA 1N3XA 2CZHA 2ZNTA 5B70A 4R6HA 2RINA 2VT5A 2LAOA 4BDNA 5EHMA 1PB7A 2O69A 1FPKA 3E3KA 4BDMA 4N13A 1UTHA 3C36A 4MLQA 2GFEA 3Q27A 4PFTA 4QSCA 4P1LA 4ZZAA 4TQUQ 1II5A 3I5OA 4HE2A 5BUUA 3FZVA 3S9LC 3PD8A 4F2OA 1LFIA 3DLNA 4X8RA 2B3BA 2HZKA 3CFXA 3LUZA 5JTYB 4N17A 4P9KA 2FNCA 2QS4A 4JBZA 2O7UA 1MRPA 3FJGA 1DBZA 2F8DA 4N81A 3T96B 2Q8JA 1MH3A 4XXUA 4XTCQ 2Y5LA 1SW4A 2XD2A 2Q8MA 5EQ7A 4R73A 5AA3A 3DP8A 3A3UA 1HSLA 1NNKA 1OVTA 4RK2A 3TDJA 5H8QA 1B0HA 2F35A 4QFNA 4XF5A 4WXJA 1Y3QA 3M3LA 2ABHA 4IY5A 2OCUA 2XWIA 4H5FA 2R6GE 5I2NB 3HPIA 3SEXA 3T9XB 2OZZA 1LBXA 3G3FA 4ZECA 4JWYA 2QS2A 3U8QA 1LAGE 2XXRA 2I6EA 4I1DA 2Y7KA 5CI5A 3MPKA 4JWXA 2Q2CA 4GX4A 3TODA 3A3CA 2HPGA 1FBDA 1B3GA 5KCJA 4I9DA 1A99A 4BDRA 1P1NA 3IJOB 1IEJA 4WKMA 1FQFA 2XXKA 3H06B 1B46A 4KR5A 1M5EA 4RNSA 1USYH 5AE4A 3SKPA 4I3EA 4MNIA 1GVCA 1JW5A 3ECRA 2DE4A 2FA7A 2XWKA 4PFYA 4XFEA 3R7XA 2WEFA 1SYIA 1N84A 4JSOA 3K2DA 3IX1A 1MPDA 1ZU0A 4LN5A 3QUFA 4GL8A 3CFLA 5EYGA 1RYOA 2BJIA 3EPEA 2WKYA 3OELA 4RPNA 2DE3A 5IZ3B 4YICA 1LBBA 1O63A 2R71A 4HS7A 1QVSA 2REJA 1YAEA 2V3QA 3M3KA 3S9NC 3K6XA 1UIVA 3IFCA 4NG7A 4H1XA 5DTBA 4NWCA 4F3GA 1Q9DA 4R74A 1FTMA 1JEUA 3WAEA 1PB9A 3K4UA 2Y5KA 2I0BA 2G29A 3KN7A 1IUDA 1QGXA 2HZLA 1A55A 3A29A 3QUJA 1USYE 3B6TA 3OXNA 2OWSA 4H65A 2F6GA 2HXRA 1FTLA 3K1PA 5M2VA 1FPIA 1UQWA 4RY1A 1CNQA 3IL1B 1N7WA 4KYEA 4U1OA 2P2AA 4OWDA 5TU0A 5I2KA 1NV1A 1BLFA 4E0XA 3SEWA 2B4MA 5I56A 4GX3A 2XX8A 4TLMB 3U1OA 1SW5A 1QUJA 4GXAA 4QSDA 4PC9A 2O84X 4NQ8A 1SQYA 1NUWA 2HAVA 4O3AA 3KOTA 2XX7A 2VPNA 1GR2A 3MW0A 4ZE9A 4F3SA 3BIHA 2B4LA 1DPEA 4OVQA 4IB2A 4NF6B 3TTLA 3PPQA 2H25A 3FVGA 4NF4A 1XVYA 4EXLA 3K00A 1QKBA 3BIGA 2D21A 3TTMA 4GIZA 4OERA 1Q35A 1JW4A 3MP1A 4NF8B 1H44A 4IO7A 4IO2A 2A5TB 2QPQA 4YKJA 1OLCA 1BTJA 2NOOA 4H46A 2XD3A 4X9TA 1AOVA 1B7HA 4NHBA 3GZGA 5H8NB 1XHYA 1UTBB 4ZE8A 1SYHA 5H8HB 5FTIA 1MQJA 2D3IA 3V83A 4R6KA 4N07A 4WEDA 4QBAA 3LV0A 2RCBA 4C0RA 1R9QA 3FGSA 1YYZA 2PBWA 2FIXA 3VDFA 2ZXTA 1JQFA 5LOMA 4HCWA 1URGA 5KDTA 3MJNA 4G8HA 1JVYA 3LR1A 2UYFA 1DSNA 3G7WA 2PYYA 4P3LA 1ZKBA 2DWIA 1S7YA 1B05A 4LZ7A 2FVZA 2I4BA 4MCOA 1QULA 1OQGA 3C32A 3O6IA 1DCUA 3UIFA 1MQHA 3H3GA 4PFUA 4OVPA 1MDP1 2OJTA 4GWYA 5L8DA 2D5WA 4LATA 4ZEDA 5JEIA 4BDQA 2CZLA 5I5PA 4U4SA 3TYHA 2I48A 4PBHA 3U72A 1XT8A 1ZTYA 3OEKA 2X7QA 4PETA 2CEXA 4KFQA 3T1BA 4QHQA 1NL5A 2HXWA 5EQ9A 1MQDA 3G3JA 2QMWA 3H6TA 2DWAA 1B5IA 3DP6A 3TZAA 3EKIA 3HFUA 4H8IA 3N6TA 2F5XA 1NH7A 1NV7A 3RTWB 4XEQA 1MXUA 1LBWA 3FVOA 4QF9A 5ET5A 1JP4A 3W15C 4GWXA 1DTGA 4YMAA 3R26A 3N26A 5ITPA 3VLUA 3MYUA 2Q9TA 3V8XB 2F7BA 4G8NA 3EHSA 3H03A 4IO5A 3SETA 4MJOA 1IXHA 5I84A 5DYHA 3FXRA 1OMPA 1KZ8A 3RNNA 2WBBA 4PAKA 5H8FB 5L9MA 5IGAA 1CB6A 3K0VA 4NF5B 5BWJA 4ZZEA 3KOSA 3SERA 3MC2A 2UVGA 3KJ7A 5K2XA 2WYKA 1NKXA 4GRKA 4MF3A 1WDNA 1XI6A 1Y9UA 4R9GA 3VLVA 4P0IA 1IMFA 1B5JA 1EH3A 1NV4A 4Q5TA 3HCQA 1S9TA 4MLVA 4N4UA 2FHYA 4IY6A 4EDPA 4PF8A 1DMBA 3B6WA 1AIVA 3LUYA 2GHBA 1MPCA 5EYFA 1FPFA 4NX1A 2QL3A 2RC8A 4F31B 3KN8A 3G3KA 4N15A 3GBAA 1FPEA 3FD3A 3QYTA 3B6QA 2Z8DA 3RT8A 3H4ZA 3KFMA 1NNTA 1IMBA 4H67A 2HQ0A 2OWZA 4OVJA 3SZPA 1DK4A 5DW8A 3T66A 4P8BA 5IZ1A 1AMFA 1VSOA 3O9PA 4O7MA 3H6WA 3IB2A 2XA5A 4EUOA 4Q0CA 2ALUA 3IO4A 5AA2A 2XXTA 3NOHA 5IM2A 4X48A 2XWOA 1NV0A 5J16A 1JVXA 4OVRA 3ZKKA 1XS5A 3BKIB 1H45A 2XXYA 4GFRA 3N5LA 1IQ7A 3OEMA 4FBPA 5B7DA 1FBFA 2IA4A 4ZEBA 2I3WA 2ZYOA 1B3FA 3MAMA 1I6BA 1PEBA 3P7IA 3C34A 5K2YA 4XKRA 1YCJA 1FJ9A 4H6DA 4RXLA 2ESNA 5AA2D 4F39A 1LFHA 1SDXA 1FBPA 1US4A 5FHMA 4OMBA 4FAJA 2I49A 4N8YA 3Q28A 4P1EA 1URDA 4HW8A 2QRYA 2AL5A 1US5A 1LB8A 5LTCA 3BFTA 4PE5B 5ITOA 4IR8A 3U93A 3Q26A 5I3SA 4NF4B 5I56B 4GWUA 3QIMA 1SBPA 4GVOA 1B58A 3MP6A 1I6QA 1AWBA 3MBPA 5LDZA 1TWYA 3K02A 4KXPA 5AA1A 2ZYMA 2ZYKA 4F18A 2HHMA 1MY0A 4U22A 4NF5A 1I6AA 2F7AA 3HN0A 5H8FA 1VDWA 2MKZA 1NMUA 2WX9A 1ZLQA 4N6KA 4PAIA 3TCHA 2Y84A 3ROJA 4IO4A 4UABA 1LCTA 2P0SA 4L17A 3CVGA 3FIRA 3MZBA 2AIXA 1JETA 3GXAA 3HHGA 3MVWA 4HCYA
chains in the Genus database with same CATH topology
5F24A 4N6DA 1DBZA 4I40A 2B4MA 4JVIA 1K9ZA 3FBPA 4PCDA 2R8TA 4XFEA 4N81A 4F1VA 4NN3A 5CM6A 1LEVA 3E79A 3RPLA 2WEFA 5EYHA 4GX3A 5IZ3A 2ZZVA 4P3LA 1NUXA 5IZ3B 2Y5LA 2WYKA 4N6KA 4PAIA 4MNCA 1YXIA 4PBQA 4PFBA 4PC9A 4LN5A 1FJ9A 4F19A 4MIJA 2QVVA 4NQ8A 2ZZXA 1XI6A 4PGPA 1RDZA 4GBVA 2FVZA 1NUWA 2Q8MA 4AS4A 5EQ7A 4MCOA 4NAPA 1SPIA 4N8GA 1IMFA 2CEYA 2OX3A 1NV4A 4GWWA 4N91A 2PCRA 1NUYA 3QMFA 4O8MA 2CZIA 1RDYA 5EYGA 1D9QA 2BJIA 1DCUA 1FBPA 1NUZA 4P56A 2VPNA 1FPJA 4PAFA 1FBCA 2DE3A 3B8BA 3BIHA 2V4CA 4M1VA 1FRPA 4N4UA 2B4LA 4OVPA 2FHYA 2Q74A 3D1RA 3KC0A 4GWYA 2QVRA 4N8YA 1NV5A 4YICA 5ET6A 4AS5A 4PF8A 4P1EA 1LBVA 3T0JA 2V3QA 4OVQA 2QVUA 4XF5A 1IMCA 4NGUA 4PF6A 2FBPA 4PFRA 5ET7A 2JJKA 5IZZA 1FPFA 3IFCA 5I5PA 3KBZA 5LTCA 3GYYA 2PFYA 2VPOA 4NX1A 3KC1A 1FBEA 1NV3A 3ISPA 4OVSA 2XWIA 4PBHA 1LBZA 3BIGA 5A5LA 4NG7A 4IR8A 4X04A 3FXBA 4YZZA 4O7IA 4N15A 1EYJA 5I3SA 2ZZWA 1FPEA 2CZKA 2QFLA 4MNPA 1EYIA 4OA4A 3W9VA 5JK4A 4P47A 3PTYA 4GWUA 4QXDA 1FJ6A 4PETA 2DE2A 2DVZA 2CEXA 1Q9DA 4PFIA 4O94A 4PGNA 3E78A 2L5VA 4HE0A 1LBXA 4PDHA 3B50A 3T1BA 4MAGA 2WYPA 5FBPA 5EQ9A 4GWZA 1FPGA 5T3JA 1FPLA 2F3DA 1IMBA 1AWBA 5LDZA 2CZHA 2QPQA 2OWZA 4MEVA 4OVTA 5EQAA 3SZPA 1FBGA 1DK4A 2Y5KA 4I3YA 4KXPA 1NI9A 5DW8A 1IMAA 4DI3D 3EKIA 4H46A 1IMEA 3HFUA 4HE1A 3IFAA 2F3BA 4GX4A 4P8BA 4X9TA 4F18A 2F5XA 2VT5A 5IZ1A 1YZ0A 2HHMA 1NV7A 4O7MA 1FPKA 1QGXA 3MSTA 4XEQA 2HZLA 1LBWA 5ET5A 1G0IA 2FIEA 4H45A 2XA5A 1FPDA 4DI4B 2HPGA 1K9YA 2P3NA 1JP4A 4P1LA 3A29A 4GWXA 1BK4A 1FBDA 4HE2A 4JVDA 4MX6A 1NV2A 1NV6A 4NHBA 3W9WA 1VDWA 3MYUA 1INPA 2MKZA 2Q9TA 3NOHA 2WX9A 5IM2A 5I7IA 1G0HA 1LBYA 2HXRA 1FPBA 5ESYA 3RPLB 2XXKA 3CHGA 2GQ1A 1FBHA 1FSAA 2XWOA 4MJOA 2P3VA 1FPIA 1FTAA 1NV0A 2DDKA 2KQZA 4PDDA 3ROJA 1EYKA 4MHFA 4UABA 5J16A 1KZ8A 4X8RA 1KA1A 4OVRA 4QBAA 3LV0A 2HZKA 3LUZA 4GX6A 1CNQA 1RDXA 4GWSA 3U65A 4N17A 5EQ8A 2WBBA 4I3EA 4OANA 4P9KA 4PTKA 1YYZA 4F1UA 2FIXA 1KA0A 4PE3A 4MNIA 4PAKA 4FBPA 4GBWA 5ET8A 3RYDA 5J1DA 5IGAA 1IMDA 2WBDA 1FBFA 2PFZA 4G61A 2DE4A 2XWKA 4HXVA 2KR0A 4MMPA 1NV1A 2XWVA 4JVCA 4NF0A 4HCWA 4HCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOH A; 
#chains in the Genus database with same CATH topology
 4N6D A;  1LGB C;  1K9Z A;  1LBC A;  2I58 A;  1VFE A;  3THI A;  4YB7 A;  4LQ2 A;  1M5C A;  4EXK A;  2QVV A;  2ZZX A;  1O64 A;  3IOV A;  4P0G A;  2P1S A;  3JZJ A;  1SW1 A;  4HTG A;  5A5X B;  1PC3 A;  3QMF A;  1LCF A;  3FV1 A;  1FRP A;  5DT6 A;  3KC0 A;  5H8S A;  1NV5 A;  1F9B A;  2F78 A;  1PBQ A;  3GLB A;  2OBG A;  2FBP A;  4POX A;  2W7Y A;  1DOT A;  1MXW A;  2VPO A;  3IOW A;  4NTL A;  5ICQ A;  3PPP A;  3UK4 A;  2QFL A;  3IOR A;  4KPT A;  3OO6 A;  3KSJ A;  2X26 A;  5JK4 A;  3PTY A;  2F7C A;  2FYI A;  2L5V A;  3VXC A;  3K6W A;  2NVU B;  1FPG A;  3FVK A;  1P1U A;  4OVT A;  1ZIU A;  4C1T A;  5EQA A;  3TQW A;  1ANF A;  2QS3 A;  3EF7 A;  4LON B;  3IFA A;  1RYX A;  4P11 A;  2DQV A;  1ATG A;  1FPD A;  4G68 B;  4PFW A;  2V25 A;  1MQG A;  1TFA A;  5TP9 B;  1NV6 A;  4DXC A;  3UGW A;  5I7I A;  5ESY A;  3CR9 A;  1FBH A;  4KYS A;  1EYK A;  2V3U A;  3RT6 B;  3C9H A;  1PDA A;  2DS9 A;  2DWH A;  1AL3 A;  3MP8 A;  4GBW A;  1IMD A;  2WBD A;  1SW2 A;  2ZNU A;  1ZJL A;  3VVE A;  4MMP A;  2XWV A;  4JVC A;  4ZS9 A;  3KSX A;  1EU8 A;  3O28 A;  4I40 A;  3WAF A;  1Q1K A;  1B3H A;  4U1Z A;  1DTZ A;  1DPP A;  3H6V A;  5I2N A;  3KEI A;  4MIJ A;  4PGP A;  4GBV A;  1M5D A;  4Q8R A;  2AYS A;  4NMY A;  3JV9 A;  4G77 A;  2THI A;  4F29 A;  2QVR A;  2Z8F A;  4DCX A;  1QUI A;  4PF6 A;  3MUQ A;  4ZEI A;  5DVI A;  4F1Y A;  5H8N A;  2UVH A;  2RC9 A;  3D4G A;  1D9Y A;  2H9B A;  5I58 B;  3PPR A;  1OQH A;  1POY 1;  1I69 A;  3K1N A;  2VD3 A;  3B50 A;  1QKA A;  5H8Q B;  5FBP A;  3VXB A;  3IO6 A;  1H43 A;  2F3D A;  1B52 A;  4MEV A;  3V89 B;  5I58 A;  3K1M A;  3V5A A;  5AA2 B;  4EQ9 A;  2XXH A;  3RPW A;  3MVZ A;  5I2K B;  1IIW A;  1NV2 A;  3TKD A;  3USD A;  3PUW E;  1FPB A;  2Y7W A;  2GQ1 A;  2CMO A;  1P1Q A;  1B0L A;  4KI0 E;  3ONM A;  2REG A;  2PMS A;  2HFB A;  4G61 A;  3I3V A;  3KZG A;  2KR0 A;  1MXZ A;  3KGC A;  3TMG A;  4JB7 A;  4H0W A;  4I8C A;  2ANJ A;  4DXB A;  1POT A;  4G68 A;  1Z7N E;  3PGF A;  3HST A;  4LVQ A;  4LZ5 A;  2PX1 A;  1FCK A;  3UN6 A;  1NUZ A;  1YTV A;  1FPJ A;  1SI1 A;  3IB1 A;  2DP8 A;  2PT1 A;  1NFT A;  4GQO A;  5CMK A;  4POW A;  3VV5 A;  4H5G A;  2O68 A;  3TCG A;  2VD2 A;  3T93 B;  1IMC A;  5TP9 A;  3MPL A;  2H5Y A;  5DEX B;  5FHN A;  3FXQ A;  3E13 X;  5IZZ A;  2I3V A;  2Y7R A;  2A5S A;  1NV3 A;  5IAI A;  4YB5 A;  4RYA A;  2ZMB A;  4RA1 A;  1N76 A;  4YAH X;  3B7D A;  3FXB A;  4R75 A;  4U21 A;  2ZZW A;  3OMB A;  4MNP A;  3G3G A;  3T9V A;  3TCF A;  5F24 A;  3A09 A;  3K6U A;  1BP5 A;  2WYP A;  4GWZ A;  1GGG A;  2O7I A;  5DEX A;  4DI3 D;  5I59 A;  1MPB A;  4UAC A;  1YZ0 A;  4ISU A;  1TXF A;  4H45 A;  3OOA A;  4DLD A;  4MX6 A;  2ONS A;  1INP A;  3FUZ A;  3RPL B;  1Y1M A;  1MM6 A;  4ELQ A;  1N3W A;  4PDD A;  1FTK A;  4R6Y A;  1MY2 A;  4MHF A;  3K01 A;  1CE2 A;  3SEV A;  5KCJ B;  3FJ7 A;  1N04 A;  1R6Z A;  1B5H A;  4XKN A;  2DYX A;  2Z8E A;  1PB8 A;  1J1N A;  4F19 A;  4DZ1 A;  4QFL A;  4R9F A;  4AS4 A;  3L6H A;  5ISU A;  2PCR A;  2NWJ A;  2CZI A;  1D9Q A;  2B3F A;  2XXU A;  4FEB A;  2GHA A;  4YKK A;  2QMX A;  3TQL A;  3UOR A;  4AQ4 A;  2QVU A;  4OXV A;  4QRZ A;  5TPA A;  3O2A A;  4QFO A;  3FAT A;  1FBE A;  1S50 A;  3O66 A;  4G4P A;  2CZK A;  4GWO A;  1EYI A;  2RF1 A;  5AA4 A;  1Y3P A;  4P47 A;  1B3L A;  2DWJ A;  3EQ1 A;  3CFZ A;  3LSF B;  4RK9 A;  4MFI A;  3IK6 B;  4C1U A;  1MY3 A;  3FJM A;  4JWO A;  2F3B A;  1IXI A;  3CG1 A;  1LB9 A;  3MZ1 A;  4YMB A;  5IKB A;  4LUB A;  1MM7 A;  2PT2 A;  4EQB A;  1MY1 A;  2UXA A;  3W9W A;  4EF2 A;  3U94 A;  3ODB A;  1LBY A;  1LAF E;  1QJM A;  1FTA A;  3D4C A;  1B40 A;  5L9S A;  2A5T A;  2Y7P A;  5HPQ A;  4GWS A;  5EQ8 A;  1JW1 A;  4PE3 A;  3RYD A;  2E1S A;  4R2B A;  4U2R A;  4NF0 A;  4PCD A;  3IOT A;  3IJX B;  4FAT A;  2ZZV A;  1R9L A;  4Z7E A;  3TTR A;  3KJT A;  2O6A A;  1R1N A;  3IOU A;  4JDF A;  4IGT A;  4JSD A;  2BJJ X;  4N8G A;  2OX3 A;  3KG2 A;  2VGQ A;  1FTJ A;  4EQ7 A;  1FBC A;  3TEP A;  5JTY A;  2NXO A;  3JYR A;  3MZ9 A;  4WEP A;  3M3F A;  4NGU A;  4PFR A;  4FE8 A;  1GTK A;  1MXX A;  3KBZ A;  2PFY A;  1B32 A;  3RLF E;  4XKQ A;  1EZ9 A;  1KWH A;  1EZP A;  3RGY A;  4YZZ A;  3ZKL A;  4N6P A;  3TTK A;  4OA4 A;  1ZBM A;  5DVF A;  3PD9 A;  4BDO A;  1D4N A;  2GRV A;  3C31 A;  4AB6 A;  4OQO A;  3VE1 B;  3OD7 A;  1FBG A;  3CG3 A;  1TT1 A;  2F34 A;  3MVY A;  4NE4 A;  5F7V A;  3OEN A;  3RTF B;  1A8F A;  1NH8 A;  1P99 A;  4YKP A;  4KCC A;  4XKP A;  2DSF A;  1H76 A;  4GLI A;  4YU0 A;  3EHU A;  4AB5 A;  4G68 C;  4FIM A;  3FAS A;  2H4I A;  3SDF A;  1G0H A;  2I0C A;  3PU5 A;  1M5B A;  1FSA A;  3ZSF A;  2QJE A;  1KA1 A;  5HM4 B;  1YPN A;  1IXG A;  2XX9 A;  3LSX A;  2O1M A;  3OSQ A;  1LLS A;  5ET8 A;  5J1D A;  1SD3 A;  1FTO A;  4OEV A;  4F1V A;  5CM6 A;  5KZT A;  1XOC A;  4E0W A;  4DXU A;  1M5F A;  2UVJ A;  4PBQ A;  1A8E A;  3IR1 A;  5F1Q A;  5ELV A;  2CEY A;  1RDY A;  1N0T A;  4DDD A;  4M4G A;  3B8B A;  1OLA A;  3N94 A;  4EF1 A;  5ET6 A;  3T0J A;  3C33 A;  5CMM A;  5KDT B;  4LA9 A;  2XHD A;  5ET7 A;  1OIB A;  3Q25 A;  1LBZ A;  4GL0 A;  1T0K A;  3LC8 A;  3MVX A;  3KBR A;  2DOJ A;  3H6U A;  3S9E A;  3W9V A;  2Q88 A;  2DXR A;  4THI A;  4PGN A;  4HE0 A;  4PDH A;  5HBC A;  4ELP A;  1UTB A;  2DVC A;  5T3J A;  2B65 A;  4QFP A;  4O3B A;  4GXS B;  4OEN A;  4HE1 A;  4LP2 B;  1SI0 A;  1TFD A;  2XXW A;  4FJP A;  4JXI A;  4F3B A;  1B6H A;  3MST A;  3CIJ A;  3S9M C;  3QXM A;  1G0I A;  2O1L A;  2P3N A;  1Y4T A;  3E9X A;  3IAZ A;  3OO8 A;  4H8J A;  2V3T A;  5ICT A;  3N6U A;  1WOD A;  3DP4 A;  2DDK A;  4NED A;  4KYD A;  1RDX A;  2XXI A;  4OTE A;  3RQT A;  3G3I A;  1RKM A;  3HO7 A;  3PV0 E;  2VOZ A;  3RN8 A;  4JVI A;  3GBB A;  3PUV E;  1HSE A;  1URS A;  3FBP A;  2R8T A;  3RUM A;  2IEE A;  4LQ5 A;  1NUX A;  2Z23 A;  1ZMG A;  4Q30 B;  1H3D A;  5CRY A;  2QS1 A;  4ZEK A;  4PFB A;  4DCY A;  1B3E A;  4KD5 A;  1RDZ A;  1JEV A;  4PQJ A;  5CMC A;  4NAP A;  1SPI A;  3QSL A;  1BIY A;  4N91 A;  2KLF A;  3K6V A;  4RPO A;  1A54 A;  3C35 A;  4ZDM A;  2UYE A;  4Z0I A;  2GH9 A;  5H8H A;  3F11 A;  3FVN A;  1VR5 A;  3MQ9 A;  1O7T A;  1MY4 A;  1B7U A;  3PMX A;  3G3H A;  3ISP A;  4X1B A;  2VP1 A;  3TEL A;  1LAX A;  2R9J A;  3I6V A;  4O7I A;  4K3F A;  1B51 A;  4OYV A;  1B4H A;  4ONY A;  2O51 A;  3OSR A;  1QW0 A;  4DI4 B;  2OWT A;  1MQI A;  4DIG A;  3L6G A;  1Y20 A;  5I57 A;  4F2Q A;  1FPL A;  3U92 A;  3LSW A;  3QK6 A;  2PVU A;  4FOR A;  2XXX A;  1HSJ A;  1N7X A;  2V84 A;  2FIE A;  1MDQ A;  4KCD A;  2UVI A;  1K9Y A;  5EHS A;  1IXC A;  5CBR A;  2Y7I A;  4UA8 A;  2NUV A;  4O3C A;  3UP9 A;  3ILT B;  4OAN A;  4PTK A;  1Z7M E;  3PUX E;  2PFZ A;  1MG1 A;  4QFK A;  4HXV A;  1B1H A;  3R6U A;  3RPL A;  2XXP A;  5IZ3 A;  1B1X A;  1Y1Z A;  2F97 A;  1YXI A;  2ONK E;  4OHN A;  1B9J A;  3CRB A;  1BKA A;  4F22 A;  1L5T A;  3T9U A;  3VFJ A;  4PP0 A;  4MBP A;  4YB6 A;  4TLL B;  3RY3 A;  1XVX A;  2AL4 A;  4O8M A;  4P56 A;  3CSG A;  3O29 A;  4PAF A;  5I59 B;  1MXY A;  1P1W A;  2V4C A;  3KN3 A;  4IO3 A;  2Q74 A;  1D3K A;  2I4C A;  3O6H A;  4NWD A;  3BFU A;  4BLA A;  1FQB A;  1P1O A;  3PUY E;  3O6G A;  2VHA A;  3HHF A;  1B2H A;  4OVS A;  3BBR A;  1MXV A;  4KQP A;  5A5L A;  3MWB A;  3PUZ E;  2OK2 A;  4QXD A;  2DVZ A;  3E78 A;  2ONR A;  4O94 A;  2HEU A;  3T9H B;  4MAG A;  2YJP A;  3VVF A;  2QSX A;  3DM0 A;  4I3Y A;  4GOT A;  5I57 B;  2OLB A;  3PMV A;  1B4Z A;  5CMB A;  3O97 A;  3IB0 A;  1Y3N A;  4ELO A;  3PPN A;  4OES A;  4JVD A;  1ELJ A;  2ZYN A;  1IZ1 A;  4R72 A;  5CC2 A;  2KQZ A;  2HCA A;  3VVD A;  3ZS6 A;  4XIG Q;  3PPO A;  4ZEF A;  5DVJ A;  1NNF A;  2Q2A A;  2F36 A;  1KA0 A;  2E0S A;  1VE4 A;  4DE8 A;  1FQC A;  3TAJ A;  4OZ9 A;  1MH4 A;  3T22 A;  3FXU A;  1FQD A;  4NN3 A;  1LEV A;  1QUK A;  2F6P A;  1Y4C A;  4MNC A;  4LZ8 A;  4U4X A;  3TTN A;  5L9O A;  4KHZ E;  3S4U A;  3E4R A;  3ILU B;  4GWW A;  1AH5 A;  1LST A;  2RC7 A;  3FV2 A;  3VLW A;  4PFI A;  4AS5 A;  1OVB A;  1LBV A;  1FQA A;  4FEC A;  1EZO A;  4X1D A;  2JJK A;  5AA4 B;  4ECF A;  3CI8 A;  3Q29 A;  2Z22 A;  3TFL A;  3EHT A;  5CBS A;  4NF8 A;  3SEY A;  1EYJ A;  2HAU A;  3LBS A;  5TPA B;  3PMW A;  4OFL A;  4BDL A;  2G93 A;  2DE2 A;  3TUS A;  2Q89 A;  2M8C A;  4G2Z A;  1SVX B;  4GD5 A;  1FQE A;  3CSB A;  4NF6 A;  1NI9 A;  1IMA A;  1IME A;  1UTH B;  2V93 A;  3M8U A;  4QSE A;  5FTH A;  4OFO A;  1LFG A;  3C4M A;  4U23 A;  5FHO A;  1A40 A;  3S2V A;  1BK4 A;  4OET A;  3QAX A;  3AXF A;  2XXV A;  4ND9 A;  1B7Z A;  3CHG A;  1PBP A;  2P3V A;  2ZNS A;  4RJZ A;  1UIU A;  4ESW A;  1GV8 A;  4GX6 A;  3U65 A;  2X7P A;  2H99 A;  4F1U A;  4FED A;  4GF8 A;  4ELR A;  2H98 A;  3E79 A;  3SES A;  5EYH A;  3DEL B;  1FW0 A;  2YLN A;  3OO9 A;  3OO7 A;  1A7L A;  1NNP A;  2XXQ A;  4OFJ A;  1NUY A;  1WVJ A;  2RKM A;  3EN3 A;  1VFD A;  3SEU A;  3TPA A;  4M1V A;  4R2F A;  1JNF A;  2RCA A;  3D1R A;  4TOZ A;  4OEU A;  2YPN A;  3LSL A;  3UA8 A;  3H7M A;  1MS7 A;  3HV1 A;  1LAH E;  4IGR A;  4ESX A;  3GYY A;  5A5X A;  4I62 A;  1XC1 A;  3KC1 A;  4IO6 A;  4X04 A;  4MH5 A;  2DXY A;  4G8M A;  1FJ6 A;  4F3P A;  1IIT A;  1D9V A;  4YKI A;  1N3X A;  2CZH A;  2ZNT A;  5B70 A;  4R6H A;  2RIN A;  2VT5 A;  2LAO A;  4BDN A;  5EHM A;  1PB7 A;  2O69 A;  1FPK A;  3E3K A;  4BDM A;  4N13 A;  1UTH A;  3C36 A;  4MLQ A;  2GFE A;  3Q27 A;  4PFT A;  4QSC A;  4P1L A;  4ZZA A;  4TQU Q;  1II5 A;  3I5O A;  4HE2 A;  5BUU A;  3FZV A;  3S9L C;  3PD8 A;  4F2O A;  1LFI A;  3DLN A;  4X8R A;  2B3B A;  2HZK A;  3CFX A;  3LUZ A;  5JTY B;  4N17 A;  4P9K A;  2FNC A;  2QS4 A;  4JBZ A;  2O7U A;  1MRP A;  3FJG A;  1DBZ A;  2F8D A;  4N81 A;  3T96 B;  2Q8J A;  1MH3 A;  4XXU A;  4XTC Q;  2Y5L A;  1SW4 A;  2XD2 A;  2Q8M A;  5EQ7 A;  4R73 A;  5AA3 A;  3DP8 A;  3A3U A;  1HSL A;  1NNK A;  1OVT A;  4RK2 A;  3TDJ A;  5H8Q A;  1B0H A;  2F35 A;  4QFN A;  4XF5 A;  4WXJ A;  1Y3Q A;  3M3L A;  2ABH A;  4IY5 A;  2OCU A;  2XWI A;  4H5F A;  2R6G E;  5I2N B;  3HPI A;  3SEX A;  3T9X B;  2OZZ A;  1LBX A;  3G3F A;  4ZEC A;  4JWY A;  2QS2 A;  3U8Q A;  1LAG E;  2XXR A;  2I6E A;  4I1D A;  2Y7K A;  5CI5 A;  3MPK A;  4JWX A;  2Q2C A;  4GX4 A;  3TOD A;  3A3C A;  2HPG A;  1FBD A;  1B3G A;  5KCJ A;  4I9D A;  1A99 A;  4BDR A;  1P1N A;  3IJO B;  1IEJ A;  4WKM A;  1FQF A;  2XXK A;  3H06 B;  1B46 A;  4KR5 A;  1M5E A;  4RNS A;  1USY H;  5AE4 A;  3SKP A;  4I3E A;  4MNI A;  1GVC A;  1JW5 A;  3ECR A;  2DE4 A;  2FA7 A;  2XWK A;  4PFY A;  4XFE A;  3R7X A;  2WEF A;  1SYI A;  1N84 A;  4JSO A;  3K2D A;  3IX1 A;  1MPD A;  1ZU0 A;  4LN5 A;  3QUF A;  4GL8 A;  3CFL A;  5EYG A;  1RYO A;  2BJI A;  3EPE A;  2WKY A;  3OEL A;  4RPN A;  2DE3 A;  5IZ3 B;  4YIC A;  1LBB A;  1O63 A;  2R71 A;  4HS7 A;  1QVS A;  2REJ A;  1YAE A;  2V3Q A;  3M3K A;  3S9N C;  3K6X A;  1UIV A;  3IFC A;  4NG7 A;  4H1X A;  5DTB A;  4NWC A;  4F3G A;  1Q9D A;  4R74 A;  1FTM A;  1JEU A;  3WAE A;  1PB9 A;  3K4U A;  2Y5K A;  2I0B A;  2G29 A;  3KN7 A;  1IUD A;  1QGX A;  2HZL A;  1A55 A;  3A29 A;  3QUJ A;  1USY E;  3B6T A;  3OXN A;  2OWS A;  4H65 A;  2F6G A;  2HXR A;  1FTL A;  3K1P A;  5M2V A;  1FPI A;  1UQW A;  4RY1 A;  1CNQ A;  3IL1 B;  1N7W A;  4KYE A;  4U1O A;  2P2A A;  4OWD A;  5TU0 A;  5I2K A;  1NV1 A;  1BLF A;  4E0X A;  3SEW A;  2B4M A;  5I56 A;  4GX3 A;  2XX8 A;  4TLM B;  3U1O A;  1SW5 A;  1QUJ A;  4GXA A;  4QSD A;  4PC9 A;  2O84 X;  4NQ8 A;  1SQY A;  1NUW A;  2HAV A;  4O3A A;  3KOT A;  2XX7 A;  2VPN A;  1GR2 A;  3MW0 A;  4ZE9 A;  4F3S A;  3BIH A;  2B4L A;  1DPE A;  4OVQ A;  4IB2 A;  4NF6 B;  3TTL A;  3PPQ A;  2H25 A;  3FVG A;  4NF4 A;  1XVY A;  4EXL A;  3K00 A;  1QKB A;  3BIG A;  2D21 A;  3TTM A;  4GIZ A;  4OER A;  1Q35 A;  1JW4 A;  3MP1 A;  4NF8 B;  1H44 A;  4IO7 A;  4IO2 A;  2A5T B;  2QPQ A;  4YKJ A;  1OLC A;  1BTJ A;  2NOO A;  4H46 A;  2XD3 A;  4X9T A;  1AOV A;  1B7H A;  4NHB A;  3GZG A;  5H8N B;  1XHY A;  1UTB B;  4ZE8 A;  1SYH A;  5H8H B;  5FTI A;  1MQJ A;  2D3I A;  3V83 A;  4R6K A;  4N07 A;  4WED A;  4QBA A;  3LV0 A;  2RCB A;  4C0R A;  1R9Q A;  3FGS A;  1YYZ A;  2PBW A;  2FIX A;  3VDF A;  2ZXT A;  1JQF A;  5LOM A;  4HCW A;  1URG A;  5KDT A;  3MJN A;  4G8H A;  1JVY A;  3LR1 A;  2UYF A;  1DSN A;  3G7W A;  2PYY A;  4P3L A;  1ZKB A;  2DWI A;  1S7Y A;  1B05 A;  4LZ7 A;  2FVZ A;  2I4B A;  4MCO A;  1QUL A;  1OQG A;  3C32 A;  3O6I A;  1DCU A;  3UIF A;  1MQH A;  3H3G A;  4PFU A;  4OVP A;  1MDP 1;  2OJT A;  4GWY A;  5L8D A;  2D5W A;  4LAT A;  4ZED A;  5JEI A;  4BDQ A;  2CZL A;  5I5P A;  4U4S A;  3TYH A;  2I48 A;  4PBH A;  3U72 A;  1XT8 A;  1ZTY A;  3OEK A;  2X7Q A;  4PET A;  2CEX A;  4KFQ A;  3T1B A;  4QHQ A;  1NL5 A;  2HXW A;  5EQ9 A;  1MQD A;  3G3J A;  2QMW A;  3H6T A;  2DWA A;  1B5I A;  3DP6 A;  3TZA A;  3EKI A;  3HFU A;  4H8I A;  3N6T A;  2F5X A;  1NH7 A;  1NV7 A;  3RTW B;  4XEQ A;  1MXU A;  1LBW A;  3FVO A;  4QF9 A;  5ET5 A;  1JP4 A;  3W15 C;  4GWX A;  1DTG A;  4YMA A;  3R26 A;  3N26 A;  5ITP A;  3VLU A;  3MYU A;  2Q9T A;  3V8X B;  2F7B A;  4G8N A;  3EHS A;  3H03 A;  4IO5 A;  3SET A;  4MJO A;  1IXH A;  5I84 A;  5DYH A;  3FXR A;  1OMP A;  1KZ8 A;  3RNN A;  2WBB A;  4PAK A;  5H8F B;  5L9M A;  5IGA A;  1CB6 A;  3K0V A;  4NF5 B;  5BWJ A;  4ZZE A;  3KOS A;  3SER A;  3MC2 A;  2UVG A;  3KJ7 A;  5K2X A;  2WYK A;  1NKX A;  4GRK A;  4MF3 A;  1WDN A;  1XI6 A;  1Y9U A;  4R9G A;  3VLV A;  4P0I A;  1IMF A;  1B5J A;  1EH3 A;  1NV4 A;  4Q5T A;  3HCQ A;  1S9T A;  4MLV A;  4N4U A;  2FHY A;  4IY6 A;  4EDP A;  4PF8 A;  1DMB A;  3B6W A;  1AIV A;  3LUY A;  2GHB A;  1MPC A;  5EYF A;  1FPF A;  4NX1 A;  2QL3 A;  2RC8 A;  4F31 B;  3KN8 A;  3G3K A;  4N15 A;  3GBA A;  1FPE A;  3FD3 A;  3QYT A;  3B6Q A;  2Z8D A;  3RT8 A;  3H4Z A;  3KFM A;  1NNT A;  1IMB A;  4H67 A;  2HQ0 A;  2OWZ A;  4OVJ A;  3SZP A;  1DK4 A;  5DW8 A;  3T66 A;  4P8B A;  5IZ1 A;  1AMF A;  1VSO A;  3O9P A;  4O7M A;  3H6W A;  3IB2 A;  2XA5 A;  4EUO A;  4Q0C A;  2ALU A;  3IO4 A;  5AA2 A;  2XXT A;  3NOH A;  5IM2 A;  4X48 A;  2XWO A;  1NV0 A;  5J16 A;  1JVX A;  4OVR A;  3ZKK A;  1XS5 A;  3BKI B;  1H45 A;  2XXY A;  4GFR A;  3N5L A;  1IQ7 A;  3OEM A;  4FBP A;  5B7D A;  1FBF A;  2IA4 A;  4ZEB A;  2I3W A;  2ZYO A;  1B3F A;  3MAM A;  1I6B A;  1PEB A;  3P7I A;  3C34 A;  5K2Y A;  4XKR A;  1YCJ A;  1FJ9 A;  4H6D A;  4RXL A;  2ESN A;  5AA2 D;  4F39 A;  1LFH A;  1SDX A;  1FBP A;  1US4 A;  5FHM A;  4OMB A;  4FAJ A;  2I49 A;  4N8Y A;  3Q28 A;  4P1E A;  1URD A;  4HW8 A;  2QRY A;  2AL5 A;  1US5 A;  1LB8 A;  5LTC A;  3BFT A;  4PE5 B;  5ITO A;  4IR8 A;  3U93 A;  3Q26 A;  5I3S A;  4NF4 B;  5I56 B;  4GWU A;  3QIM A;  1SBP A;  4GVO A;  1B58 A;  3MP6 A;  1I6Q A;  1AWB A;  3MBP A;  5LDZ A;  1TWY A;  3K02 A;  4KXP A;  5AA1 A;  2ZYM A;  2ZYK A;  4F18 A;  2HHM A;  1MY0 A;  4U22 A;  4NF5 A;  1I6A A;  2F7A A;  3HN0 A;  5H8F A;  1VDW A;  2MKZ A;  1NMU A;  2WX9 A;  1ZLQ A;  4N6K A;  4PAI A;  3TCH A;  2Y84 A;  3ROJ A;  4IO4 A;  4UAB A;  1LCT A;  2P0S A;  4L17 A;  3CVG A;  3FIR A;  3MZB A;  2AIX A;  1JET A;  3GXA A;  3HHG A;  3MVW A;  4HCY A; 
#chains in the Genus database with same CATH homology
 5F24 A;  4N6D A;  1DBZ A;  4I40 A;  2B4M A;  4JVI A;  1K9Z A;  3FBP A;  4PCD A;  2R8T A;  4XFE A;  4N81 A;  4F1V A;  4NN3 A;  5CM6 A;  1LEV A;  3E79 A;  3RPL A;  2WEF A;  5EYH A;  4GX3 A;  5IZ3 A;  2ZZV A;  4P3L A;  1NUX A;  5IZ3 B;  2Y5L A;  2WYK A;  4N6K A;  4PAI A;  4MNC A;  1YXI A;  4PBQ A;  4PFB A;  4PC9 A;  4LN5 A;  1FJ9 A;  4F19 A;  4MIJ A;  2QVV A;  4NQ8 A;  2ZZX A;  1XI6 A;  4PGP A;  1RDZ A;  4GBV A;  2FVZ A;  1NUW A;  2Q8M A;  4AS4 A;  5EQ7 A;  4MCO A;  4NAP A;  1SPI A;  4N8G A;  1IMF A;  2CEY A;  2OX3 A;  1NV4 A;  4GWW A;  4N91 A;  2PCR A;  1NUY A;  3QMF A;  4O8M A;  2CZI A;  1RDY A;  5EYG A;  1D9Q A;  2BJI A;  1DCU A;  1FBP A;  1NUZ A;  4P56 A;  2VPN A;  1FPJ A;  4PAF A;  1FBC A;  2DE3 A;  3B8B A;  3BIH A;  2V4C A;  4M1V A;  1FRP A;  4N4U A;  2B4L A;  4OVP A;  2FHY A;  2Q74 A;  3D1R A;  3KC0 A;  4GWY A;  2QVR A;  4N8Y A;  1NV5 A;  4YIC A;  5ET6 A;  4AS5 A;  4PF8 A;  4P1E A;  1LBV A;  3T0J A;  2V3Q A;  4OVQ A;  2QVU A;  4XF5 A;  1IMC A;  4NGU A;  4PF6 A;  2FBP A;  4PFR A;  5ET7 A;  2JJK A;  5IZZ A;  1FPF A;  3IFC A;  5I5P A;  3KBZ A;  5LTC A;  3GYY A;  2PFY A;  2VPO A;  4NX1 A;  3KC1 A;  1FBE A;  1NV3 A;  3ISP A;  4OVS A;  2XWI A;  4PBH A;  1LBZ A;  3BIG A;  5A5L A;  4NG7 A;  4IR8 A;  4X04 A;  3FXB A;  4YZZ A;  4O7I A;  4N15 A;  1EYJ A;  5I3S A;  2ZZW A;  1FPE A;  2CZK A;  2QFL A;  4MNP A;  1EYI A;  4OA4 A;  3W9V A;  5JK4 A;  4P47 A;  3PTY A;  4GWU A;  4QXD A;  1FJ6 A;  4PET A;  2DE2 A;  2DVZ A;  2CEX A;  1Q9D A;  4PFI A;  4O94 A;  4PGN A;  3E78 A;  2L5V A;  4HE0 A;  1LBX A;  4PDH A;  3B50 A;  3T1B A;  4MAG A;  2WYP A;  5FBP A;  5EQ9 A;  4GWZ A;  1FPG A;  5T3J A;  1FPL A;  2F3D A;  1IMB A;  1AWB A;  5LDZ A;  2CZH A;  2QPQ A;  2OWZ A;  4MEV A;  4OVT A;  5EQA A;  3SZP A;  1FBG A;  1DK4 A;  2Y5K A;  4I3Y A;  4KXP A;  1NI9 A;  5DW8 A;  1IMA A;  4DI3 D;  3EKI A;  4H46 A;  1IME A;  3HFU A;  4HE1 A;  3IFA A;  2F3B A;  4GX4 A;  4P8B A;  4X9T A;  4F18 A;  2F5X A;  2VT5 A;  5IZ1 A;  1YZ0 A;  2HHM A;  1NV7 A;  4O7M A;  1FPK A;  1QGX A;  3MST A;  4XEQ A;  2HZL A;  1LBW A;  5ET5 A;  1G0I A;  2FIE A;  4H45 A;  2XA5 A;  1FPD A;  4DI4 B;  2HPG A;  1K9Y A;  2P3N A;  1JP4 A;  4P1L A;  3A29 A;  4GWX A;  1BK4 A;  1FBD A;  4HE2 A;  4JVD A;  4MX6 A;  1NV2 A;  1NV6 A;  4NHB A;  3W9W A;  1VDW A;  3MYU A;  1INP A;  2MKZ A;  2Q9T A;  3NOH A;  2WX9 A;  5IM2 A;  5I7I A;  1G0H A;  1LBY A;  2HXR A;  1FPB A;  5ESY A;  3RPL B;  2XXK A;  3CHG A;  2GQ1 A;  1FBH A;  1FSA A;  2XWO A;  4MJO A;  2P3V A;  1FPI A;  1FTA A;  1NV0 A;  2DDK A;  2KQZ A;  4PDD A;  3ROJ A;  1EYK A;  4MHF A;  4UAB A;  5J16 A;  1KZ8 A;  4X8R A;  1KA1 A;  4OVR A;  4QBA A;  3LV0 A;  2HZK A;  3LUZ A;  4GX6 A;  1CNQ A;  1RDX A;  4GWS A;  3U65 A;  4N17 A;  5EQ8 A;  2WBB A;  4I3E A;  4OAN A;  4P9K A;  4PTK A;  1YYZ A;  4F1U A;  2FIX A;  1KA0 A;  4PE3 A;  4MNI A;  4PAK A;  4FBP A;  4GBW A;  5ET8 A;  3RYD A;  5J1D A;  5IGA A;  1IMD A;  2WBD A;  1FBF A;  2PFZ A;  4G61 A;  2DE4 A;  2XWK A;  4HXV A;  2KR0 A;  4MMP A;  1NV1 A;  2XWV A;  4JVC A;  4NF0 A;  4HCW A;  4HCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...