3NOHA

Crystal structure of a putative peptide binding protein (rumgna_00914) from ruminococcus gnavus atcc 29149 at 1.60 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SAQLEGSYIFCMNPLLDKLSDEDIREQLKAFVTGKTDSIRTDTELSFDIYVSETDYALIRYADSLCERLNDAGADVQIKQYSGTMLRSRAVSGKYEAFLSESDLVSTDALENADYIILDSAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptide binding protein
publication title Crystal structure of a putative peptide binding protein (RUMGNA_00914) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Peptide binding protein
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.210 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3nohA00
3NOHA
chains in the Genus database with same CATH superfamily
1MY4A 4I9DA 4KQPA 3OO9A 1MXVA 4P47A 3VDFA 4H0WA 2RCAA 4PCDA 3U65A 1KA0A 1Y3QA 3G3KA 4RA1A 3TQWA 4IGTA 2WYPA 3QK6A 1FQFA 3AXFA 4GX4A 1QULA 2Z8FA 3PUYE 5H8HA 3QUJA 1B9JA 1SW2A 3G3IA 1SBPA 4GWWA 4ELOA 2Z8EA 4IO6A 4POWA 3KN7A 1UIUA 2CEYA 4N91A 2PT1A 2CZLA 4LATA 3VXBA 1URGA 2A5TB 2DWIA 1Y4CA 2WX9A 1JP4A 4I62A 5AA2B 2XXYA 4N6KA 2WEFA 3IX1A 3U1OA 3D4GA 1MXXA 5ELVA 1MY3A 1NNTA 4IB2A 3N6TA 1VFDA 2WYKA 1MXZA 5EYGA 2DWAA 4PFUA 2QFLA 1JW1A 1AOVA 5IGAA 2P3NA 4PDDA 2X7PA 1M5DA 2HEUA 4MNPA 1PC3A 1P1QA 1G0HA 5IZ3A 1NUWA 1XS5A 1GGGA 4NE4A 2ZYKA 2ZYMA 2IEEA 3CSGA 4RY1A 4KXPA 1S7YA 4H5FA 1XVXA 3FASA 4H8IA 4P0GA 5AA4A 4NF4B 4GVOA 1B5JA 2XXQA 4R6HA 2PFZA 4XXUA 3PUXE 2OZZA 4ELQA 2ONRA 1URSA 3H4ZA 1N3XA 1NUZA 4NN3A 3UGWA 3KZGA 2Y84A 1II5A 3V83A 3G3HA 3IL1B 4G68C 1NNKA 1MQGA 5I56B 2VPOA 1AIVA 2O7UA 3SZPA 4YMAA 4BDRA 4HCWA 2DE4A 1INPA 2E1SA 3TCHA 3C33A 3CHGA 4F29A 1D3KA 2I6EA 4GWZA 2QRYA 2ZZVA 1WODA 3R6UA 3ZKLA 2UVGA 5FBPA 4H67A 2YJPA 4OVTA 1D9VA 3M3FA 2QMWA 1POTA 4YU0A 3GZGA 2I0BA 4PAIA 5EYFA 3LV0A 4GIZA 3TTMA 1XVYA 4FORA 1PBPA 4OXVA 2G93A 4GBVA 4P0IA 1LBBA 4XKRA 2VHAA 3L6GA 2MKZA 4MNIA 4G2ZA 2Z22A 1LB8A 4N8YA 3F11A 3VFJA 1FBGA 1P1UA 1FPIA 4NF8A 1N7WA 3HHGA 3O97A 2DOJA 4F2OA 4BDNA 1H3DA 2HZLA 2RC9A 1KZ8A 3JYRA 1MM7A 2PFYA 4O3AA 4UABA 1GV8A 3T93B 4N81A 3MUQA 2Q88A 1S9TA 3Q26A 2OWSA 3FXBA 1FW0A 1H44A 1MQDA 1YYZA 4H65A 3HFUA 2HXRA 4RJZA 1MQJA 3CFLA 4C1TA 2E0SA 4QXDA 4LVQA 3IORA 5DVFA 2XXVA 4KD5A 1B7HA 1IMFA 1SI0A 1FPGA 5ESYA 4PF6A 4MJOA 4ZZAA 5IZ1A 1QGXA 1LAXA 4MF3A 1HSLA 4H6DA 1NUXA 3G3JA 4EXLA 5AA3A 1Y3NA 1TFAA 4QFPA 4LZ5A 2QPQA 1FTMA 4YB5A 1UTBB 2ALUA 1N84A 2F3BA 2VGQA 1NKXA 4Z7EA 5DYHA 3SEWA 1XT8A 3KJTA 5L9OA 1A7LA 1VR5A 2OK2A 1MXUA 1POY1 2XXUA 3ROJA 4ZS9A 3T66A 1EYKA 3RN8A 3E13X 4FEBA 1P1NA 5AE4A 5H8QA 5L8DA 3FD3A 2ZNSA 2HZKA 5I2NB 3BKIB 2D3IA 2Y5LA 3EF7A 2A5SA 4GFRA 2F36A 4LA9A 5EQ8A 4U21A 1B2HA 5I56A 4I8CA 4OHNA 3E79A 1FCKA 2HHMA 4XFEA 3IB1A 2Y7RA 3EKIA 3C31A 1QJMA 5CMBA 5ICQA 4UACA 4Q8RA 1K9ZA 4JBZA 3PMVA 2H98A 1QW0A 4WEPA 1IXHA 4XIGQ 3TZAA 4DXBA 1VSOA 3IOVA 4QHQA 1HSEA 2FIEA 4IY5A 1MM6A 3G7WA 3DP8A 4OVRA 5I84A 3CSBA 4OQOA 3H7MA 3PD9A 1USYH 2I48A 5H8NA 3MBPA 4N6PA 4HXVA 3PU5A 2Y7PA 5K2XA 3OMBA 1ZU0A 1MY1A 3TCFA 2F8DA 5CM6A 4F3SA 3RTFB 3FVGA 1MH4A 3OO6A 4OERA 4FATA 4N4UA 5ITPA 1FPBA 2H4IA 4EXKA 1IITA 2DXYA 1SI1A 1R9QA 1NV2A 2DSFA 3CFZA 3OO8A 2HAVA 4QF9A 4N07A 4IY6A 1MH3A 1NV4A 3IOUA 5BWJA 4PAKA 4YAHX 4HTGA 5DEXA 2NOOA 4R6KA 3U72A 2ZNUA 4ZEKA 5AA1A 3TODA 4R72A 3E3KA 4FIMA 4GRKA 4JB7A 3GBAA 2F6GA 3K6XA 4ZDMA 1M5EA 1DCUA 3CIJA 3FVOA 4U4XA 1US5A 3KG2A 1USYE 4NAPA 2I3VA 4U4SA 3K00A 3UK4A 2VT5A 1R1NA 4O3BA 4GD5A 1K9YA 3FVKA 3PUZE 4X48A 4JXIA 4QSEA 4L17A 3FJMA 1FBPA 3FJ7A 1NMUA 3FJGA 3K1PA 2P3VA 4JVDA 1NV1A 1I6QA 1B05A 4MEVA 4DI3D 1B4ZA 1NH8A 4PGPA 1QKBA 4POXA 3MPKA 3UA8A 5I2NA 1N3WA 2CEXA 4ZEFA 3TKDA 3LSLA 3OELA 4GBWA 3TEPA 1UTHA 1YPNA 3OSQA 1MXWA 1SD3A 1DSNA 4ZEBA 3KC1A 3S9EA 5EQAA 4DDDA 2Q74A 1LB9A 2FBPA 1AH5A 5I7IA 2O84X 4F18A 3IB0A 1B1HA 1DBZA 1SYHA 4GXSB 1MY2A 3MW0A 3TTRA 5I58B 1SQYA 3V5AA 4F22A 4P1EA 4NF8B 2QVUA 2XD2A 2DDKA 2FIXA 4XKNA 1B5HA 3H6WA 4OVPA 3N5LA 3KEIA 1FQBA 2UVHA 4F3GA 4QSDA 4NF5A 2P0SA 4NWDA 4YKKA 4PQJA 4GQOA 1ANFA 4F39A 5EYHA 3ISPA 3MC2A 4F1YA 3IB2A 2O51A 1FSAA 2HFBA 4BLAA 1B3LA 3CR9A 3C4MA 1SW4A 3HV1A 3VVDA 3FVNA 5TU0A 1NV0A 3SERA 1WVJA 4PE3A 4DXUA 2I4BA 3TTLA 4BDMA 2XWOA 3B6TA 2L5VA 4KHZE 4PP0A 3T9XB 4OTEA 5ET8A 4P56A 2F35A 4GWUA 4H45A 4YZZA 2D5WA 4JWOA 1BP5A 4O3CA 2ZYNA 2D21A 4LZ8A 1DK4A 3QUFA 3LBSA 3MP1A 2XX8A 4LQ2A 3VVFA 2FVZA 4AB5A 2V4CA 1I6BA 1FTJA 4GLIA 3B8BA 4WEDA 5FHMA 4EF1A 2V3QA 4Q5TA 3S9MC 3VE1B 1LEVA 3KJ7A 3CRBA 4BDOA 1EZ9A 2ZNTA 4GX6A 3G3FA 3FBPA 3IFCA 4IO5A 4OVQA 4DZ1A 3W9VA 3S9LC 4EUOA 2PMSA 2Q89A 5H8QB 3ILTB 1N7XA 3EHTA 2B3FA 1MPCA 1J1NA 1BLFA 1OQHA 2CMOA 2DXRA 1MQHA 1ZKBA 3QSLA 1IEJA 1UQWA 1Y1ZA 4Q0CA 1B7UA 2XXHA 3Q27A 1QVSA 3M8UA 1BK4A 2O6AA 2FYIA 4I3YA 3UORA 2HAUA 4I40A 3TCGA 2B65A 4G61A 4NTLA 4YKPA 2YLNA 2Q2CA 3WAFA 1SYIA 1JVYA 4RNSA 3VLVA 3K4UA 1B51A 3EHUA 4PF8A 1EYJA 5TPAA 3K6VA 4OEUA 3PPOA 3S2VA 4PBHA 3T0JA 3B6QA 1JEVA 3I5OA 2KR0A 3FXQA 1RDYA 3HSTA 3U93A 4PFIA 4F3BA 4MLVA 1IXCA 3O6IA 4N13A 3VLWA 4QFNA 4R2FA 2HQ0A 2UVJA 1LFGA 2R8TA 3H3GA 1B4HA 3RT8A 1FPKA 5H8NB 3CVGA 4JWYA 5I58A 1ZIUA 3SEXA 1G0IA 4FE8A 1N0TA 3PMWA 4MFIA 2OCUA 2F7AA 3DP4A 2UYEA 1WDNA 2ANJA 1VFEA 1P1WA 3BIGA 3KSXA 1B3HA 4DLDA 5JK4A 1CB6A 2UVIA 1B46A 5HBCA 2UYFA 2NWJA 3V8XB 4G4PA 3U94A 1FBFA 2O7IA 4O7MA 3CG1A 4IO4A 4JSOA 3IOWA 2G29A 3Q25A 3QAXA 3THIA 2QS4A 2XA5A 1OVBA 5EHMA 4BDQA 2DWJA 3C35A 2WBDA 1OMPA 4H46A 2IA4A 5DT6A 2XXKA 1IIWA 4EQ9A 1XOCA 3B7DA 1A40A 1FQDA 4KR5A 2DVCA 4PFRA 3BBRA 5DEXB 1N76A 2M8CA 1LCFA 4X1DA 4MIJA 2VD3A 3GYYA 3MJNA 1M5CA 4RK9A 2B4LA 4HE2A 3SEYA 3QMFA 4R6YA 4I3EA 3N94A 4PFYA 1ZJLA 2QVVA 4H5GA 3CFXA 3USDA 1FPLA 3T22A 3U92A 5I2KB 4KI0E 1LAHE 4U22A 3OENA 4FEDA 4QFOA 3KFMA 3IAZA 1LFHA 5IAIA 1IXGA 2UXAA 3LSXA 4R73A 2H99A 1EYIA 5I57A 1SW1A 1IMDA 1RYOA 4U1OA 1FBEA 2XHDA 1NV5A 1FTOA 1LBZA 3B50A 1UTHB 4DCYA 4R75A 3R26A 2NVUB 4R2BA 4NX1A 1LBXA 2OWZA 2DS9A 4P8BA 4NF6B 2YPNA 1GTKA 1B52A 4DIGA 3V89B 3MZ9A 3PTYA 4AS5A 3EN3A 3MAMA 2CZKA 2ZXTA 5T3JA 1Y1MA 4KCCA 1RDXA 1FTLA 4QFLA 2GHBA 2OJTA 2V84A 3SEUA 4M4GA 1B40A 2BJJX 5JTYA 1SDXA 3ILUB 4OYVA 4ESXA 2DVZA 5I59A 4DXCA 1A55A 2DE3A 4PAFA 4F1VA 4LZ7A 4P9KA 1JETA 1Z7ME 4NF5B 4GL8A 1FTAA 4TLLB 5M2VA 2PBWA 3T9UA 2HXWA 3VLUA 5IKBA 5BUUA 5LOMA 4OFOA 2RCBA 3KSJA 4QFKA 1O7TA 4IO7A 5ET6A 3T9VA 1NL5A 1FPFA 2KQZA 4MBPA 3FV1A 4Q30B 4LONB 4KYSA 3LUZA 3UP9A 2Y7IA 4OANA 1R9LA 1BTJA 1ZMGA 5HM4B 1JW4A 1B6HA 4JVCA 4ELPA 3EHSA 4AQ4A 2H9BA 5I5PA 1OIBA 2PYYA 5CBSA 4PGNA 4G68A 4UA8A 1LBWA 2XWVA 4EQBA 3D4CA 4GOTA 4WKMA 1EZOA 2OBGA 2F97A 1L5TA 2H5YA 2GRVA 2XX9A 5FTHA 5ISUA 1HSJA 1IXIA 1FBHA 3ZSFA 4OENA 4M1VA 3B6WA 4OEVA 4P1LA 3MYUA 5KCJA 2Q8MA 4YKJA 4ZZEA 4OVSA 1M5BA 2I0CA 3FATA 4IO3A 3MWBA 1PBQA 1TFDA 3RPLB 4U2RA 4O7IA 5H8FA 1ZBMA 5I2KA 5F24A 1FQEA 2PX1A 4MMPA 3CI8A 3RUMA 3OEKA 3D1RA 1EH3A 3O6HA 5EQ7A 4MCOA 4PETA 1TWYA 1A8EA 3PMXA 5EHSA 2REJA 1EZPA 4NMYA 3MVXA 3KC0A 4XTCQ 1B1XA 2XWKA 3K1NA 5FHOA 3HN0A 5I3SA 5LDZA 5DW8A 4KFQA 2THIA 2XXIA 3E78A 3IJXB 3H6VA 4PBQA 4HCYA 4RK2A 4OA4A 5TPAB 2ESNA 3TTKA 3PPRA 2JJKA 3OXNA 1DTZA 5ET5A 4MLQA 4NF6A 5B7DA 1D9YA 3TMGA 1H43A 1Y3PA 4ONYA 5CRYA 4JSDA 4OETA 3K01A 4C0RA 3DP6A 3FGSA 1UIVA 4LN5A 1EU8A 3TPAA 3BIHA 3UN6A 1NH7A 3A3CA 2REGA 5DVJA 1P99A 4JVIA 3K1MA 2QJEA 3H6UA 4HW8A 4NGUA 3TUSA 4G8HA 5DVIA 2B4MA 4U23A 4F2QA 2GH9A 3HCQA 1RDZA 4G77A 5J1DA 2WKYA 3MQ9A 4OWDA 2CZHA 1NNFA 4P11A 3TELA 4ECFA 5L9MA 5TP9A 4F3PA 3TYHA 2V3TA 1B3FA 2I49A 4YB6A 1FBDA 2F3DA 1SW5A 3T96B 3N26A 2QS2A 4O8MA 4OMBA 3U8QA 4KYEA 2X26A 3TDJA 1PB7A 2ZYOA 2QL3A 3BFTA 2F5XA 5F7VA 1AL3A 2XXTA 3TAJA 2V3UA 4MNCA 4NG7A 1PB8A 3KBZA 1FPDA 4GWSA 4X04A 4F19A 1YZ0A 1VE4A 4JWXA 3RGYA 4YMBA 2BJIA 3MPLA 1FTKA 3C32A 1NFTA 1I6AA 2X7QA 4WXJA 5HPQA 1PB9A 1FQAA 3RPLA 4TOZA 1FJ9A 4X9TA 5AA2D 3WAEA 1D4NA 5I57B 4KPTA 1R6ZA 3T9HB 5ET7A 1MS7A 2P2AA 3PD8A 5CC2A 5H8SA 4GX3A 4IR8A 2RC8A 4X8RA 2GQ1A 1IZ1A 4QRZA 1B3GA 4QSCA 5FHNA 2FA7A 1NNPA 2DP8A 2I4CA 4MH5A 2OWTA 2HPGA 3H03A 3Q28A 1LCTA 4H1XA 3IFAA 3EPEA 1Q1KA 5F1QA 1TXFA 1MDP1 5A5XA 4I1DA 5JTYB 3A3UA 5I59B 4EQ7A 3L6HA 3OSRA 4PFWA 4LQ5A 2PCRA 2W7YA 1TT1A 4GL0A 4E0XA 1CNQA 4EDPA 3NOHA 2DYXA 5CMCA 2FHYA 3MVYA 4ZEIA 3C36A 1KA1A 4P3LA 3SESA 2HCAA 1OLAA 4GWXA 1IMEA 5KDTA 2AL4A 2I58A 1IQ7A 3MP8A 1D9QA 3CG3A 4GF8A 4N15A 3IR1A 1I69A 1JW5A 1DMBA 1A8FA 1MG1A 4ISUA 3VXCA 1GVCA 1DOTA 1LAGE 1Y9UA 3N6UA 1XHYA 2NUVA 3RYDA 3I3VA 4OFLA 3R7XA 1T0KA 3KOSA 5FTIA 1LBVA 2XXPA 4OVJA 1H76A 3JZJA 3TTNA 3QIMA 1KWHA 1MPDA 4G68B 3MP6A 5KZTA 3PV0E 1O63A 3TQLA 4HE1A 4O94A 3MVZA 3OD7A 2Y7KA 4MHFA 3RY3A 1B7ZA 3ECRA 4GWOA 4R9GA 3IK6B 2QS3A 2ZZWA 3O28A 1GR2A 4ZE9A 2O1LA 1PDAA 1QUJA 4XEQA 4AB6A 5KCJB 3GBBA 2F34A 4NQ8A 3M3KA 4PTKA 2A5TA 3W15C 2ONSA 4U1ZA 4TQUQ 4ZE8A 5AA2A 5CBRA 2DWHA 3I6VA 1NI9A 5H8FB 3DLNA 3MZBA 1B0LA 3VV5A 4RYAA 3K6UA 1A54A 2VOZA 3MZ1A 3BFUA 3LUYA 3HO7A 3A29A 3ZS6A 4F31B 4GWYA 4FECA 2XX7A 3LSFB 3Q29A 1MY0A 2QMXA 3IO6A 3HPIA 1IUDA 4ZECA 1JNFA 1MXYA 2Z8DA 4RPNA 1Q9DA 4KCDA 3DM0A 4LUBA 3H06B 2B3BA 4X1BA 2ZMBA 1URDA 5J16A 2KLFA 3E9XA 1YXIA 3LR1A 3EQ1A 3RPWA 3FXRA 3OO7A 4DI4B 1QUKA 1MQIA 3LSWA 1SPIA 2XWIA 1QUIA 2Q9TA 4PC9A 4NF4A 2GHAA 3FV2A 3PUWE 2ZZXA 2OX3A 1FRPA 2RC7A 3QXMA 1IMAA 4BDLA 1B58A 1JEUA 4PE5B 2RINA 3O29A 1F9BA 1XC1A 1ZLQA 2RKMA 3O66A 2V25A 1Y4TA 1YCJA 3S4UA 3KN3A 4XF5A 4F1UA 1B5IA 2Q8JA 3ODBA 3H6TA 4N17A 5LTCA 2O68A 4DE8A 1A99A 2FNCA 4PFTA 4OFJA 2QSXA 1LFIA 3DELB 4R9FA 4YKIA 5IZZA 1O64A 4YICA 2F6PA 3K0VA 2XXWA 3JV9A 5B70A 1ZTYA 2DQVA 2NXOA 1DTGA 5K2YA 1YAEA 3C34A 4N8GA 2AYSA 4YB7A 4HE0A 1Y20A 1US4A 3K02A 3FZVA 2R71A 4DCXA 2XD3A 4PDHA 2Z23A 1FJ6A 4XKQA 4RXLA 4OZ9A 1AMFA 4NEDA 5EQ9A 2WBBA 4G8NA 3RT6B 1IMBA 5TP9B 3GLBA 3IJOB 2XXRA 3P7IA 5IM2A 3W9WA 5CMKA 1NV3A 4HS7A 1OVTA 5H8HB 3SDFA 1LBCA 3OEMA 1BKAA 3OOAA 2XXXA 3IO4A 5CI5A 3GXAA 3KOTA 4E0WA 1YTVA 3VVEA 5L9SA 1LLSA 3G3GA 1IMCA 1MDQA 2AIXA 4Z0IA 3UIFA 1CE2A 3TFLA 2V93A 1PEBA 1JQFA 2CZIA 3RLFE 1RKMA 2VP1A 2ONKE 3PPQA 2F7CA 2P1SA 1B3EA 3RNNA 4MAGA 4ZEDA 3PUVE 1AWBA 4ND9A 1FPEA 1OQGA 1FQCA 4JDFA 3PPNA 2H25A 3RQTA 1NV7A 1NUYA 3O6GA 4G8MA 2PT2A 3O9PA 4H8JA 2PVUA 3KBRA 5IZ3B 3HHFA 1ELJA 4C1UA 3IOTA 4OESA 1Z7NE 4NWCA 1LGBC 2QVRA 1MRPA 3K2DA 4PFBA 3FUZA 1B32A 2LAOA 2R9JA 3PPPA 1NV6A 4FAJA 2I3WA 3QYTA 4NHBA 2AL5A 5ITOA 3MVWA 4ELRA 1BIYA 1JVXA 3KN8A 3PGFA 2F7BA 3KGCA 5AA4B 1LBYA 4IO2A 1ATGA 1UTBA 3ONMA 3S9NC 1N04A 3E4RA 2Y7WA 2R6GE 3RTWB 4MX6A 2GFEA 4AS4A 2Q2AA 2DE2A 4IGRA 4TLMB 3MSTA 1QKAA 4R74A 1MPBA 2ABHA 4ESWA 3SETA 3C9HA 1OLCA 3SEVA 1XI6A 2O1MA 3K6WA 2Y5KA 4NF0A 1LAFE 4FBPA 3FXUA 4LP2B 1Q35A 2VPNA 3LC8A 1DPPA 4GXAA 5A5XB 1VDWA 5JEIA 2VD2A 1M5FA 2O69A 2F78A 3ZKKA 5A5LA 3M3LA 5DTBA 3SKPA 3T1BA 4THIA 5ICTA 4RPOA 1P1OA 4N6DA 1LSTA 4FJPA 1FPJA 1B0HA 4XKPA 3O2AA 1SVXB 4QBAA 3A09A 4K3FA 5CMMA 2RF1A 5KDTB 2QS1A 1DPEA 1S50A 4EF2A 3FIRA 2OLBA 1RYXA 1FBCA 4KYDA 1H45A
chains in the Genus database with same CATH topology
1FPLA 1FPBA 2HPGA 4P47A 3IFAA 1NV2A 4PCDA 1NV4A 3U65A 1KA0A 2PCRA 4PAKA 2WYPA 1EYIA 1CNQA 4GX4A 1IMDA 3NOHA 2FHYA 1FBEA 1NV5A 1LBZA 4GWWA 1KA1A 4P3LA 3B50A 4GWXA 2CEYA 4N91A 1IMEA 1DCUA 4NX1A 1LBXA 2OWZA 1D9QA 4P8BA 4N15A 4NAPA 2WX9A 1JP4A 2VT5A 1K9YA 4N6KA 3PTYA 2WEFA 4AS5A 2CZKA 3RYDA 5T3JA 1RDXA 1LBVA 1FBPA 2WYKA 5EYGA 2P3VA 4JVDA 2QFLA 1NV1A 2DVZA 4MEVA 4DI3D 4PGPA 5IGAA 2P3NA 4PDDA 2DE3A 4HE1A 4MNPA 4O94A 4PAFA 4F1VA 1G0HA 5IZ3A 4P9KA 4MHFA 1NUWA 2CEXA 1FTAA 2ZZWA 4KXPA 4GBWA 4XEQA 4NQ8A 4PTKA 3KC1A 5EQAA 5ET6A 2Q74A 2FBPA 1FPFA 2PFZA 5I7IA 2KQZA 3LUZA 4OANA 1NI9A 4F18A 1NUZA 4NN3A 1DBZA 4JVCA 2VPOA 3SZPA 5I5PA 4P1EA 2QVUA 4PGNA 3A29A 4GWYA 1LBWA 2DDKA 2FIXA 4HCWA 2XWVA 2DE4A 1INPA 4OVPA 3CHGA 1Q9DA 1FBHA 4GWZA 4M1VA 2ZZVA 4P1LA 5J16A 1YXIA 5EYHA 5FBPA 3ISPA 3MYUA 4OVTA 2Q8MA 4DI4B 4OVSA 4PAIA 1SPIA 2XWIA 1FSAA 3LV0A 2Q9TA 4PC9A 2ZZXA 2OX3A 3RPLB 1FRPA 4GBVA 1IMAA 4O7IA 1NV0A 2MKZA 4MNIA 5F24A 4PE3A 4MMPA 4XF5A 4F1UA 4N8YA 2XWOA 1FBGA 3D1RA 2L5VA 1FPIA 5EQ7A 4MCOA 4PETA 4N17A 5ET8A 5LTCA 4P56A 5IZZA 4GWUA 4H45A 2HZLA 4YICA 4YZZA 1KZ8A 2PFYA 3KC0A 4UABA 1DK4A 4N81A 2XWKA 2FVZA 3FXBA 5I3SA 2V4CA 5LDZA 4N8GA 5DW8A 1YYZA 4HE0A 3HFUA 3E78A 2HXRA 3B8BA 4PBQA 4HCYA 4OA4A 2V3QA 4QXDA 1LEVA 4PDHA 4GX6A 3FBPA 1FJ6A 3IFCA 2JJKA 5ET5A 4OVQA 3W9VA 1IMFA 1FPGA 5EQ9A 2WBBA 5ESYA 4PF6A 1IMBA 4MJOA 5IM2A 3W9WA 1NV3A 5IZ1A 1QGXA 1NUXA 4LN5A 3BIHA 1BK4A 2QPQA 4I3YA 4I40A 1IMCA 4JVIA 4G61A 2F3BA 4NGUA 2CZIA 2B4MA 4PF8A 4MAGA 1EYJA 1RDZA 1AWBA 4PBHA 3T0JA 1FPEA 5J1DA 3ROJA 2KR0A 1RDYA 1EYKA 2CZHA 1NV7A 1NUYA 4PFIA 5IZ3B 2HZKA 2Y5LA 2QVRA 2R8TA 4PFBA 1FBDA 1FPKA 2F3DA 5EQ8A 1NV6A 1G0IA 4O8MA 3E79A 4NHBA 2HHMA 4XFEA 3BIGA 1LBYA 3EKIA 5JK4A 2F5XA 1K9ZA 4MX6A 4MNCA 4NG7A 4AS4A 1FBFA 3KBZA 1FPDA 2DE2A 4GWSA 4O7MA 3MSTA 4X04A 4F19A 1XI6A 1YZ0A 2Y5KA 4NF0A 2XA5A 2BJIA 2FIEA 4FBPA 2WBDA 2VPNA 4H46A 1VDWA 4OVRA 2XXKA 3RPLA 1FJ9A 4X9TA 4PFRA 5A5LA 3T1BA 4MIJA 4N6DA 3GYYA 4HXVA 1FPJA 5ET7A 2B4LA 4QBAA 4HE2A 5CM6A 4GX3A 4IR8A 3QMFA 4I3EA 4X8RA 2GQ1A 2QVVA 1FBCA 4N4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOH A; 
#chains in the Genus database with same CATH topology
 1MY4 A;  4I9D A;  4KQP A;  3OO9 A;  1MXV A;  4P47 A;  3VDF A;  4H0W A;  2RCA A;  4PCD A;  3U65 A;  1KA0 A;  1Y3Q A;  3G3K A;  4RA1 A;  3TQW A;  4IGT A;  2WYP A;  3QK6 A;  1FQF A;  3AXF A;  4GX4 A;  1QUL A;  2Z8F A;  3PUY E;  5H8H A;  3QUJ A;  1B9J A;  1SW2 A;  3G3I A;  1SBP A;  4GWW A;  4ELO A;  2Z8E A;  4IO6 A;  4POW A;  3KN7 A;  1UIU A;  2CEY A;  4N91 A;  2PT1 A;  2CZL A;  4LAT A;  3VXB A;  1URG A;  2A5T B;  2DWI A;  1Y4C A;  2WX9 A;  1JP4 A;  4I62 A;  5AA2 B;  2XXY A;  4N6K A;  2WEF A;  3IX1 A;  3U1O A;  3D4G A;  1MXX A;  5ELV A;  1MY3 A;  1NNT A;  4IB2 A;  3N6T A;  1VFD A;  2WYK A;  1MXZ A;  5EYG A;  2DWA A;  4PFU A;  2QFL A;  1JW1 A;  1AOV A;  5IGA A;  2P3N A;  4PDD A;  2X7P A;  1M5D A;  2HEU A;  4MNP A;  1PC3 A;  1P1Q A;  1G0H A;  5IZ3 A;  1NUW A;  1XS5 A;  1GGG A;  4NE4 A;  2ZYK A;  2ZYM A;  2IEE A;  3CSG A;  4RY1 A;  4KXP A;  1S7Y A;  4H5F A;  1XVX A;  3FAS A;  4H8I A;  4P0G A;  5AA4 A;  4NF4 B;  4GVO A;  1B5J A;  2XXQ A;  4R6H A;  2PFZ A;  4XXU A;  3PUX E;  2OZZ A;  4ELQ A;  2ONR A;  1URS A;  3H4Z A;  1N3X A;  1NUZ A;  4NN3 A;  3UGW A;  3KZG A;  2Y84 A;  1II5 A;  3V83 A;  3G3H A;  3IL1 B;  4G68 C;  1NNK A;  1MQG A;  5I56 B;  2VPO A;  1AIV A;  2O7U A;  3SZP A;  4YMA A;  4BDR A;  4HCW A;  2DE4 A;  1INP A;  2E1S A;  3TCH A;  3C33 A;  3CHG A;  4F29 A;  1D3K A;  2I6E A;  4GWZ A;  2QRY A;  2ZZV A;  1WOD A;  3R6U A;  3ZKL A;  2UVG A;  5FBP A;  4H67 A;  2YJP A;  4OVT A;  1D9V A;  3M3F A;  2QMW A;  1POT A;  4YU0 A;  3GZG A;  2I0B A;  4PAI A;  5EYF A;  3LV0 A;  4GIZ A;  3TTM A;  1XVY A;  4FOR A;  1PBP A;  4OXV A;  2G93 A;  4GBV A;  4P0I A;  1LBB A;  4XKR A;  2VHA A;  3L6G A;  2MKZ A;  4MNI A;  4G2Z A;  2Z22 A;  1LB8 A;  4N8Y A;  3F11 A;  3VFJ A;  1FBG A;  1P1U A;  1FPI A;  4NF8 A;  1N7W A;  3HHG A;  3O97 A;  2DOJ A;  4F2O A;  4BDN A;  1H3D A;  2HZL A;  2RC9 A;  1KZ8 A;  3JYR A;  1MM7 A;  2PFY A;  4O3A A;  4UAB A;  1GV8 A;  3T93 B;  4N81 A;  3MUQ A;  2Q88 A;  1S9T A;  3Q26 A;  2OWS A;  3FXB A;  1FW0 A;  1H44 A;  1MQD A;  1YYZ A;  4H65 A;  3HFU A;  2HXR A;  4RJZ A;  1MQJ A;  3CFL A;  4C1T A;  2E0S A;  4QXD A;  4LVQ A;  3IOR A;  5DVF A;  2XXV A;  4KD5 A;  1B7H A;  1IMF A;  1SI0 A;  1FPG A;  5ESY A;  4PF6 A;  4MJO A;  4ZZA A;  5IZ1 A;  1QGX A;  1LAX A;  4MF3 A;  1HSL A;  4H6D A;  1NUX A;  3G3J A;  4EXL A;  5AA3 A;  1Y3N A;  1TFA A;  4QFP A;  4LZ5 A;  2QPQ A;  1FTM A;  4YB5 A;  1UTB B;  2ALU A;  1N84 A;  2F3B A;  2VGQ A;  1NKX A;  4Z7E A;  5DYH A;  3SEW A;  1XT8 A;  3KJT A;  5L9O A;  1A7L A;  1VR5 A;  2OK2 A;  1MXU A;  1POY 1;  2XXU A;  3ROJ A;  4ZS9 A;  3T66 A;  1EYK A;  3RN8 A;  3E13 X;  4FEB A;  1P1N A;  5AE4 A;  5H8Q A;  5L8D A;  3FD3 A;  2ZNS A;  2HZK A;  5I2N B;  3BKI B;  2D3I A;  2Y5L A;  3EF7 A;  2A5S A;  4GFR A;  2F36 A;  4LA9 A;  5EQ8 A;  4U21 A;  1B2H A;  5I56 A;  4I8C A;  4OHN A;  3E79 A;  1FCK A;  2HHM A;  4XFE A;  3IB1 A;  2Y7R A;  3EKI A;  3C31 A;  1QJM A;  5CMB A;  5ICQ A;  4UAC A;  4Q8R A;  1K9Z A;  4JBZ A;  3PMV A;  2H98 A;  1QW0 A;  4WEP A;  1IXH A;  4XIG Q;  3TZA A;  4DXB A;  1VSO A;  3IOV A;  4QHQ A;  1HSE A;  2FIE A;  4IY5 A;  1MM6 A;  3G7W A;  3DP8 A;  4OVR A;  5I84 A;  3CSB A;  4OQO A;  3H7M A;  3PD9 A;  1USY H;  2I48 A;  5H8N A;  3MBP A;  4N6P A;  4HXV A;  3PU5 A;  2Y7P A;  5K2X A;  3OMB A;  1ZU0 A;  1MY1 A;  3TCF A;  2F8D A;  5CM6 A;  4F3S A;  3RTF B;  3FVG A;  1MH4 A;  3OO6 A;  4OER A;  4FAT A;  4N4U A;  5ITP A;  1FPB A;  2H4I A;  4EXK A;  1IIT A;  2DXY A;  1SI1 A;  1R9Q A;  1NV2 A;  2DSF A;  3CFZ A;  3OO8 A;  2HAV A;  4QF9 A;  4N07 A;  4IY6 A;  1MH3 A;  1NV4 A;  3IOU A;  5BWJ A;  4PAK A;  4YAH X;  4HTG A;  5DEX A;  2NOO A;  4R6K A;  3U72 A;  2ZNU A;  4ZEK A;  5AA1 A;  3TOD A;  4R72 A;  3E3K A;  4FIM A;  4GRK A;  4JB7 A;  3GBA A;  2F6G A;  3K6X A;  4ZDM A;  1M5E A;  1DCU A;  3CIJ A;  3FVO A;  4U4X A;  1US5 A;  3KG2 A;  1USY E;  4NAP A;  2I3V A;  4U4S A;  3K00 A;  3UK4 A;  2VT5 A;  1R1N A;  4O3B A;  4GD5 A;  1K9Y A;  3FVK A;  3PUZ E;  4X48 A;  4JXI A;  4QSE A;  4L17 A;  3FJM A;  1FBP A;  3FJ7 A;  1NMU A;  3FJG A;  3K1P A;  2P3V A;  4JVD A;  1NV1 A;  1I6Q A;  1B05 A;  4MEV A;  4DI3 D;  1B4Z A;  1NH8 A;  4PGP A;  1QKB A;  4POX A;  3MPK A;  3UA8 A;  5I2N A;  1N3W A;  2CEX A;  4ZEF A;  3TKD A;  3LSL A;  3OEL A;  4GBW A;  3TEP A;  1UTH A;  1YPN A;  3OSQ A;  1MXW A;  1SD3 A;  1DSN A;  4ZEB A;  3KC1 A;  3S9E A;  5EQA A;  4DDD A;  2Q74 A;  1LB9 A;  2FBP A;  1AH5 A;  5I7I A;  2O84 X;  4F18 A;  3IB0 A;  1B1H A;  1DBZ A;  1SYH A;  4GXS B;  1MY2 A;  3MW0 A;  3TTR A;  5I58 B;  1SQY A;  3V5A A;  4F22 A;  4P1E A;  4NF8 B;  2QVU A;  2XD2 A;  2DDK A;  2FIX A;  4XKN A;  1B5H A;  3H6W A;  4OVP A;  3N5L A;  3KEI A;  1FQB A;  2UVH A;  4F3G A;  4QSD A;  4NF5 A;  2P0S A;  4NWD A;  4YKK A;  4PQJ A;  4GQO A;  1ANF A;  4F39 A;  5EYH A;  3ISP A;  3MC2 A;  4F1Y A;  3IB2 A;  2O51 A;  1FSA A;  2HFB A;  4BLA A;  1B3L A;  3CR9 A;  3C4M A;  1SW4 A;  3HV1 A;  3VVD A;  3FVN A;  5TU0 A;  1NV0 A;  3SER A;  1WVJ A;  4PE3 A;  4DXU A;  2I4B A;  3TTL A;  4BDM A;  2XWO A;  3B6T A;  2L5V A;  4KHZ E;  4PP0 A;  3T9X B;  4OTE A;  5ET8 A;  4P56 A;  2F35 A;  4GWU A;  4H45 A;  4YZZ A;  2D5W A;  4JWO A;  1BP5 A;  4O3C A;  2ZYN A;  2D21 A;  4LZ8 A;  1DK4 A;  3QUF A;  3LBS A;  3MP1 A;  2XX8 A;  4LQ2 A;  3VVF A;  2FVZ A;  4AB5 A;  2V4C A;  1I6B A;  1FTJ A;  4GLI A;  3B8B A;  4WED A;  5FHM A;  4EF1 A;  2V3Q A;  4Q5T A;  3S9M C;  3VE1 B;  1LEV A;  3KJ7 A;  3CRB A;  4BDO A;  1EZ9 A;  2ZNT A;  4GX6 A;  3G3F A;  3FBP A;  3IFC A;  4IO5 A;  4OVQ A;  4DZ1 A;  3W9V A;  3S9L C;  4EUO A;  2PMS A;  2Q89 A;  5H8Q B;  3ILT B;  1N7X A;  3EHT A;  2B3F A;  1MPC A;  1J1N A;  1BLF A;  1OQH A;  2CMO A;  2DXR A;  1MQH A;  1ZKB A;  3QSL A;  1IEJ A;  1UQW A;  1Y1Z A;  4Q0C A;  1B7U A;  2XXH A;  3Q27 A;  1QVS A;  3M8U A;  1BK4 A;  2O6A A;  2FYI A;  4I3Y A;  3UOR A;  2HAU A;  4I40 A;  3TCG A;  2B65 A;  4G61 A;  4NTL A;  4YKP A;  2YLN A;  2Q2C A;  3WAF A;  1SYI A;  1JVY A;  4RNS A;  3VLV A;  3K4U A;  1B51 A;  3EHU A;  4PF8 A;  1EYJ A;  5TPA A;  3K6V A;  4OEU A;  3PPO A;  3S2V A;  4PBH A;  3T0J A;  3B6Q A;  1JEV A;  3I5O A;  2KR0 A;  3FXQ A;  1RDY A;  3HST A;  3U93 A;  4PFI A;  4F3B A;  4MLV A;  1IXC A;  3O6I A;  4N13 A;  3VLW A;  4QFN A;  4R2F A;  2HQ0 A;  2UVJ A;  1LFG A;  2R8T A;  3H3G A;  1B4H A;  3RT8 A;  1FPK A;  5H8N B;  3CVG A;  4JWY A;  5I58 A;  1ZIU A;  3SEX A;  1G0I A;  4FE8 A;  1N0T A;  3PMW A;  4MFI A;  2OCU A;  2F7A A;  3DP4 A;  2UYE A;  1WDN A;  2ANJ A;  1VFE A;  1P1W A;  3BIG A;  3KSX A;  1B3H A;  4DLD A;  5JK4 A;  1CB6 A;  2UVI A;  1B46 A;  5HBC A;  2UYF A;  2NWJ A;  3V8X B;  4G4P A;  3U94 A;  1FBF A;  2O7I A;  4O7M A;  3CG1 A;  4IO4 A;  4JSO A;  3IOW A;  2G29 A;  3Q25 A;  3QAX A;  3THI A;  2QS4 A;  2XA5 A;  1OVB A;  5EHM A;  4BDQ A;  2DWJ A;  3C35 A;  2WBD A;  1OMP A;  4H46 A;  2IA4 A;  5DT6 A;  2XXK A;  1IIW A;  4EQ9 A;  1XOC A;  3B7D A;  1A40 A;  1FQD A;  4KR5 A;  2DVC A;  4PFR A;  3BBR A;  5DEX B;  1N76 A;  2M8C A;  1LCF A;  4X1D A;  4MIJ A;  2VD3 A;  3GYY A;  3MJN A;  1M5C A;  4RK9 A;  2B4L A;  4HE2 A;  3SEY A;  3QMF A;  4R6Y A;  4I3E A;  3N94 A;  4PFY A;  1ZJL A;  2QVV A;  4H5G A;  3CFX A;  3USD A;  1FPL A;  3T22 A;  3U92 A;  5I2K B;  4KI0 E;  1LAH E;  4U22 A;  3OEN A;  4FED A;  4QFO A;  3KFM A;  3IAZ A;  1LFH A;  5IAI A;  1IXG A;  2UXA A;  3LSX A;  4R73 A;  2H99 A;  1EYI A;  5I57 A;  1SW1 A;  1IMD A;  1RYO A;  4U1O A;  1FBE A;  2XHD A;  1NV5 A;  1FTO A;  1LBZ A;  3B50 A;  1UTH B;  4DCY A;  4R75 A;  3R26 A;  2NVU B;  4R2B A;  4NX1 A;  1LBX A;  2OWZ A;  2DS9 A;  4P8B A;  4NF6 B;  2YPN A;  1GTK A;  1B52 A;  4DIG A;  3V89 B;  3MZ9 A;  3PTY A;  4AS5 A;  3EN3 A;  3MAM A;  2CZK A;  2ZXT A;  5T3J A;  1Y1M A;  4KCC A;  1RDX A;  1FTL A;  4QFL A;  2GHB A;  2OJT A;  2V84 A;  3SEU A;  4M4G A;  1B40 A;  2BJJ X;  5JTY A;  1SDX A;  3ILU B;  4OYV A;  4ESX A;  2DVZ A;  5I59 A;  4DXC A;  1A55 A;  2DE3 A;  4PAF A;  4F1V A;  4LZ7 A;  4P9K A;  1JET A;  1Z7M E;  4NF5 B;  4GL8 A;  1FTA A;  4TLL B;  5M2V A;  2PBW A;  3T9U A;  2HXW A;  3VLU A;  5IKB A;  5BUU A;  5LOM A;  4OFO A;  2RCB A;  3KSJ A;  4QFK A;  1O7T A;  4IO7 A;  5ET6 A;  3T9V A;  1NL5 A;  1FPF A;  2KQZ A;  4MBP A;  3FV1 A;  4Q30 B;  4LON B;  4KYS A;  3LUZ A;  3UP9 A;  2Y7I A;  4OAN A;  1R9L A;  1BTJ A;  1ZMG A;  5HM4 B;  1JW4 A;  1B6H A;  4JVC A;  4ELP A;  3EHS A;  4AQ4 A;  2H9B A;  5I5P A;  1OIB A;  2PYY A;  5CBS A;  4PGN A;  4G68 A;  4UA8 A;  1LBW A;  2XWV A;  4EQB A;  3D4C A;  4GOT A;  4WKM A;  1EZO A;  2OBG A;  2F97 A;  1L5T A;  2H5Y A;  2GRV A;  2XX9 A;  5FTH A;  5ISU A;  1HSJ A;  1IXI A;  1FBH A;  3ZSF A;  4OEN A;  4M1V A;  3B6W A;  4OEV A;  4P1L A;  3MYU A;  5KCJ A;  2Q8M A;  4YKJ A;  4ZZE A;  4OVS A;  1M5B A;  2I0C A;  3FAT A;  4IO3 A;  3MWB A;  1PBQ A;  1TFD A;  3RPL B;  4U2R A;  4O7I A;  5H8F A;  1ZBM A;  5I2K A;  5F24 A;  1FQE A;  2PX1 A;  4MMP A;  3CI8 A;  3RUM A;  3OEK A;  3D1R A;  1EH3 A;  3O6H A;  5EQ7 A;  4MCO A;  4PET A;  1TWY A;  1A8E A;  3PMX A;  5EHS A;  2REJ A;  1EZP A;  4NMY A;  3MVX A;  3KC0 A;  4XTC Q;  1B1X A;  2XWK A;  3K1N A;  5FHO A;  3HN0 A;  5I3S A;  5LDZ A;  5DW8 A;  4KFQ A;  2THI A;  2XXI A;  3E78 A;  3IJX B;  3H6V A;  4PBQ A;  4HCY A;  4RK2 A;  4OA4 A;  5TPA B;  2ESN A;  3TTK A;  3PPR A;  2JJK A;  3OXN A;  1DTZ A;  5ET5 A;  4MLQ A;  4NF6 A;  5B7D A;  1D9Y A;  3TMG A;  1H43 A;  1Y3P A;  4ONY A;  5CRY A;  4JSD A;  4OET A;  3K01 A;  4C0R A;  3DP6 A;  3FGS A;  1UIV A;  4LN5 A;  1EU8 A;  3TPA A;  3BIH A;  3UN6 A;  1NH7 A;  3A3C A;  2REG A;  5DVJ A;  1P99 A;  4JVI A;  3K1M A;  2QJE A;  3H6U A;  4HW8 A;  4NGU A;  3TUS A;  4G8H A;  5DVI A;  2B4M A;  4U23 A;  4F2Q A;  2GH9 A;  3HCQ A;  1RDZ A;  4G77 A;  5J1D A;  2WKY A;  3MQ9 A;  4OWD A;  2CZH A;  1NNF A;  4P11 A;  3TEL A;  4ECF A;  5L9M A;  5TP9 A;  4F3P A;  3TYH A;  2V3T A;  1B3F A;  2I49 A;  4YB6 A;  1FBD A;  2F3D A;  1SW5 A;  3T96 B;  3N26 A;  2QS2 A;  4O8M A;  4OMB A;  3U8Q A;  4KYE A;  2X26 A;  3TDJ A;  1PB7 A;  2ZYO A;  2QL3 A;  3BFT A;  2F5X A;  5F7V A;  1AL3 A;  2XXT A;  3TAJ A;  2V3U A;  4MNC A;  4NG7 A;  1PB8 A;  3KBZ A;  1FPD A;  4GWS A;  4X04 A;  4F19 A;  1YZ0 A;  1VE4 A;  4JWX A;  3RGY A;  4YMB A;  2BJI A;  3MPL A;  1FTK A;  3C32 A;  1NFT A;  1I6A A;  2X7Q A;  4WXJ A;  5HPQ A;  1PB9 A;  1FQA A;  3RPL A;  4TOZ A;  1FJ9 A;  4X9T A;  5AA2 D;  3WAE A;  1D4N A;  5I57 B;  4KPT A;  1R6Z A;  3T9H B;  5ET7 A;  1MS7 A;  2P2A A;  3PD8 A;  5CC2 A;  5H8S A;  4GX3 A;  4IR8 A;  2RC8 A;  4X8R A;  2GQ1 A;  1IZ1 A;  4QRZ A;  1B3G A;  4QSC A;  5FHN A;  2FA7 A;  1NNP A;  2DP8 A;  2I4C A;  4MH5 A;  2OWT A;  2HPG A;  3H03 A;  3Q28 A;  1LCT A;  4H1X A;  3IFA A;  3EPE A;  1Q1K A;  5F1Q A;  1TXF A;  1MDP 1;  5A5X A;  4I1D A;  5JTY B;  3A3U A;  5I59 B;  4EQ7 A;  3L6H A;  3OSR A;  4PFW A;  4LQ5 A;  2PCR A;  2W7Y A;  1TT1 A;  4GL0 A;  4E0X A;  1CNQ A;  4EDP A;  3NOH A;  2DYX A;  5CMC A;  2FHY A;  3MVY A;  4ZEI A;  3C36 A;  1KA1 A;  4P3L A;  3SES A;  2HCA A;  1OLA A;  4GWX A;  1IME A;  5KDT A;  2AL4 A;  2I58 A;  1IQ7 A;  3MP8 A;  1D9Q A;  3CG3 A;  4GF8 A;  4N15 A;  3IR1 A;  1I69 A;  1JW5 A;  1DMB A;  1A8F A;  1MG1 A;  4ISU A;  3VXC A;  1GVC A;  1DOT A;  1LAG E;  1Y9U A;  3N6U A;  1XHY A;  2NUV A;  3RYD A;  3I3V A;  4OFL A;  3R7X A;  1T0K A;  3KOS A;  5FTI A;  1LBV A;  2XXP A;  4OVJ A;  1H76 A;  3JZJ A;  3TTN A;  3QIM A;  1KWH A;  1MPD A;  4G68 B;  3MP6 A;  5KZT A;  3PV0 E;  1O63 A;  3TQL A;  4HE1 A;  4O94 A;  3MVZ A;  3OD7 A;  2Y7K A;  4MHF A;  3RY3 A;  1B7Z A;  3ECR A;  4GWO A;  4R9G A;  3IK6 B;  2QS3 A;  2ZZW A;  3O28 A;  1GR2 A;  4ZE9 A;  2O1L A;  1PDA A;  1QUJ A;  4XEQ A;  4AB6 A;  5KCJ B;  3GBB A;  2F34 A;  4NQ8 A;  3M3K A;  4PTK A;  2A5T A;  3W15 C;  2ONS A;  4U1Z A;  4TQU Q;  4ZE8 A;  5AA2 A;  5CBR A;  2DWH A;  3I6V A;  1NI9 A;  5H8F B;  3DLN A;  3MZB A;  1B0L A;  3VV5 A;  4RYA A;  3K6U A;  1A54 A;  2VOZ A;  3MZ1 A;  3BFU A;  3LUY A;  3HO7 A;  3A29 A;  3ZS6 A;  4F31 B;  4GWY A;  4FEC A;  2XX7 A;  3LSF B;  3Q29 A;  1MY0 A;  2QMX A;  3IO6 A;  3HPI A;  1IUD A;  4ZEC A;  1JNF A;  1MXY A;  2Z8D A;  4RPN A;  1Q9D A;  4KCD A;  3DM0 A;  4LUB A;  3H06 B;  2B3B A;  4X1B A;  2ZMB A;  1URD A;  5J16 A;  2KLF A;  3E9X A;  1YXI A;  3LR1 A;  3EQ1 A;  3RPW A;  3FXR A;  3OO7 A;  4DI4 B;  1QUK A;  1MQI A;  3LSW A;  1SPI A;  2XWI A;  1QUI A;  2Q9T A;  4PC9 A;  4NF4 A;  2GHA A;  3FV2 A;  3PUW E;  2ZZX A;  2OX3 A;  1FRP A;  2RC7 A;  3QXM A;  1IMA A;  4BDL A;  1B58 A;  1JEU A;  4PE5 B;  2RIN A;  3O29 A;  1F9B A;  1XC1 A;  1ZLQ A;  2RKM A;  3O66 A;  2V25 A;  1Y4T A;  1YCJ A;  3S4U A;  3KN3 A;  4XF5 A;  4F1U A;  1B5I A;  2Q8J A;  3ODB A;  3H6T A;  4N17 A;  5LTC A;  2O68 A;  4DE8 A;  1A99 A;  2FNC A;  4PFT A;  4OFJ A;  2QSX A;  1LFI A;  3DEL B;  4R9F A;  4YKI A;  5IZZ A;  1O64 A;  4YIC A;  2F6P A;  3K0V A;  2XXW A;  3JV9 A;  5B70 A;  1ZTY A;  2DQV A;  2NXO A;  1DTG A;  5K2Y A;  1YAE A;  3C34 A;  4N8G A;  2AYS A;  4YB7 A;  4HE0 A;  1Y20 A;  1US4 A;  3K02 A;  3FZV A;  2R71 A;  4DCX A;  2XD3 A;  4PDH A;  2Z23 A;  1FJ6 A;  4XKQ A;  4RXL A;  4OZ9 A;  1AMF A;  4NED A;  5EQ9 A;  2WBB A;  4G8N A;  3RT6 B;  1IMB A;  5TP9 B;  3GLB A;  3IJO B;  2XXR A;  3P7I A;  5IM2 A;  3W9W A;  5CMK A;  1NV3 A;  4HS7 A;  1OVT A;  5H8H B;  3SDF A;  1LBC A;  3OEM A;  1BKA A;  3OOA A;  2XXX A;  3IO4 A;  5CI5 A;  3GXA A;  3KOT A;  4E0W A;  1YTV A;  3VVE A;  5L9S A;  1LLS A;  3G3G A;  1IMC A;  1MDQ A;  2AIX A;  4Z0I A;  3UIF A;  1CE2 A;  3TFL A;  2V93 A;  1PEB A;  1JQF A;  2CZI A;  3RLF E;  1RKM A;  2VP1 A;  2ONK E;  3PPQ A;  2F7C A;  2P1S A;  1B3E A;  3RNN A;  4MAG A;  4ZED A;  3PUV E;  1AWB A;  4ND9 A;  1FPE A;  1OQG A;  1FQC A;  4JDF A;  3PPN A;  2H25 A;  3RQT A;  1NV7 A;  1NUY A;  3O6G A;  4G8M A;  2PT2 A;  3O9P A;  4H8J A;  2PVU A;  3KBR A;  5IZ3 B;  3HHF A;  1ELJ A;  4C1U A;  3IOT A;  4OES A;  1Z7N E;  4NWC A;  1LGB C;  2QVR A;  1MRP A;  3K2D A;  4PFB A;  3FUZ A;  1B32 A;  2LAO A;  2R9J A;  3PPP A;  1NV6 A;  4FAJ A;  2I3W A;  3QYT A;  4NHB A;  2AL5 A;  5ITO A;  3MVW A;  4ELR A;  1BIY A;  1JVX A;  3KN8 A;  3PGF A;  2F7B A;  3KGC A;  5AA4 B;  1LBY A;  4IO2 A;  1ATG A;  1UTB A;  3ONM A;  3S9N C;  1N04 A;  3E4R A;  2Y7W A;  2R6G E;  3RTW B;  4MX6 A;  2GFE A;  4AS4 A;  2Q2A A;  2DE2 A;  4IGR A;  4TLM B;  3MST A;  1QKA A;  4R74 A;  1MPB A;  2ABH A;  4ESW A;  3SET A;  3C9H A;  1OLC A;  3SEV A;  1XI6 A;  2O1M A;  3K6W A;  2Y5K A;  4NF0 A;  1LAF E;  4FBP A;  3FXU A;  4LP2 B;  1Q35 A;  2VPN A;  3LC8 A;  1DPP A;  4GXA A;  5A5X B;  1VDW A;  5JEI A;  2VD2 A;  1M5F A;  2O69 A;  2F78 A;  3ZKK A;  5A5L A;  3M3L A;  5DTB A;  3SKP A;  3T1B A;  4THI A;  5ICT A;  4RPO A;  1P1O A;  4N6D A;  1LST A;  4FJP A;  1FPJ A;  1B0H A;  4XKP A;  3O2A A;  1SVX B;  4QBA A;  3A09 A;  4K3F A;  5CMM A;  2RF1 A;  5KDT B;  2QS1 A;  1DPE A;  1S50 A;  4EF2 A;  3FIR A;  2OLB A;  1RYX A;  1FBC A;  4KYD A;  1H45 A; 
#chains in the Genus database with same CATH homology
 1FPL A;  1FPB A;  2HPG A;  4P47 A;  3IFA A;  1NV2 A;  4PCD A;  1NV4 A;  3U65 A;  1KA0 A;  2PCR A;  4PAK A;  2WYP A;  1EYI A;  1CNQ A;  4GX4 A;  1IMD A;  3NOH A;  2FHY A;  1FBE A;  1NV5 A;  1LBZ A;  4GWW A;  1KA1 A;  4P3L A;  3B50 A;  4GWX A;  2CEY A;  4N91 A;  1IME A;  1DCU A;  4NX1 A;  1LBX A;  2OWZ A;  1D9Q A;  4P8B A;  4N15 A;  4NAP A;  2WX9 A;  1JP4 A;  2VT5 A;  1K9Y A;  4N6K A;  3PTY A;  2WEF A;  4AS5 A;  2CZK A;  3RYD A;  5T3J A;  1RDX A;  1LBV A;  1FBP A;  2WYK A;  5EYG A;  2P3V A;  4JVD A;  2QFL A;  1NV1 A;  2DVZ A;  4MEV A;  4DI3 D;  4PGP A;  5IGA A;  2P3N A;  4PDD A;  2DE3 A;  4HE1 A;  4MNP A;  4O94 A;  4PAF A;  4F1V A;  1G0H A;  5IZ3 A;  4P9K A;  4MHF A;  1NUW A;  2CEX A;  1FTA A;  2ZZW A;  4KXP A;  4GBW A;  4XEQ A;  4NQ8 A;  4PTK A;  3KC1 A;  5EQA A;  5ET6 A;  2Q74 A;  2FBP A;  1FPF A;  2PFZ A;  5I7I A;  2KQZ A;  3LUZ A;  4OAN A;  1NI9 A;  4F18 A;  1NUZ A;  4NN3 A;  1DBZ A;  4JVC A;  2VPO A;  3SZP A;  5I5P A;  4P1E A;  2QVU A;  4PGN A;  3A29 A;  4GWY A;  1LBW A;  2DDK A;  2FIX A;  4HCW A;  2XWV A;  2DE4 A;  1INP A;  4OVP A;  3CHG A;  1Q9D A;  1FBH A;  4GWZ A;  4M1V A;  2ZZV A;  4P1L A;  5J16 A;  1YXI A;  5EYH A;  5FBP A;  3ISP A;  3MYU A;  4OVT A;  2Q8M A;  4DI4 B;  4OVS A;  4PAI A;  1SPI A;  2XWI A;  1FSA A;  3LV0 A;  2Q9T A;  4PC9 A;  2ZZX A;  2OX3 A;  3RPL B;  1FRP A;  4GBV A;  1IMA A;  4O7I A;  1NV0 A;  2MKZ A;  4MNI A;  5F24 A;  4PE3 A;  4MMP A;  4XF5 A;  4F1U A;  4N8Y A;  2XWO A;  1FBG A;  3D1R A;  2L5V A;  1FPI A;  5EQ7 A;  4MCO A;  4PET A;  4N17 A;  5ET8 A;  5LTC A;  4P56 A;  5IZZ A;  4GWU A;  4H45 A;  2HZL A;  4YIC A;  4YZZ A;  1KZ8 A;  2PFY A;  3KC0 A;  4UAB A;  1DK4 A;  4N81 A;  2XWK A;  2FVZ A;  3FXB A;  5I3S A;  2V4C A;  5LDZ A;  4N8G A;  5DW8 A;  1YYZ A;  4HE0 A;  3HFU A;  3E78 A;  2HXR A;  3B8B A;  4PBQ A;  4HCY A;  4OA4 A;  2V3Q A;  4QXD A;  1LEV A;  4PDH A;  4GX6 A;  3FBP A;  1FJ6 A;  3IFC A;  2JJK A;  5ET5 A;  4OVQ A;  3W9V A;  1IMF A;  1FPG A;  5EQ9 A;  2WBB A;  5ESY A;  4PF6 A;  1IMB A;  4MJO A;  5IM2 A;  3W9W A;  1NV3 A;  5IZ1 A;  1QGX A;  1NUX A;  4LN5 A;  3BIH A;  1BK4 A;  2QPQ A;  4I3Y A;  4I40 A;  1IMC A;  4JVI A;  4G61 A;  2F3B A;  4NGU A;  2CZI A;  2B4M A;  4PF8 A;  4MAG A;  1EYJ A;  1RDZ A;  1AWB A;  4PBH A;  3T0J A;  1FPE A;  5J1D A;  3ROJ A;  2KR0 A;  1RDY A;  1EYK A;  2CZH A;  1NV7 A;  1NUY A;  4PFI A;  5IZ3 B;  2HZK A;  2Y5L A;  2QVR A;  2R8T A;  4PFB A;  1FBD A;  1FPK A;  2F3D A;  5EQ8 A;  1NV6 A;  1G0I A;  4O8M A;  3E79 A;  4NHB A;  2HHM A;  4XFE A;  3BIG A;  1LBY A;  3EKI A;  5JK4 A;  2F5X A;  1K9Z A;  4MX6 A;  4MNC A;  4NG7 A;  4AS4 A;  1FBF A;  3KBZ A;  1FPD A;  2DE2 A;  4GWS A;  4O7M A;  3MST A;  4X04 A;  4F19 A;  1XI6 A;  1YZ0 A;  2Y5K A;  4NF0 A;  2XA5 A;  2BJI A;  2FIE A;  4FBP A;  2WBD A;  2VPN A;  4H46 A;  1VDW A;  4OVR A;  2XXK A;  3RPL A;  1FJ9 A;  4X9T A;  4PFR A;  5A5L A;  3T1B A;  4MIJ A;  4N6D A;  3GYY A;  4HXV A;  1FPJ A;  5ET7 A;  2B4L A;  4QBA A;  4HE2 A;  5CM6 A;  4GX3 A;  4IR8 A;  3QMF A;  4I3E A;  4X8R A;  2GQ1 A;  2QVV A;  1FBC A;  4N4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...