3NOJA

The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
NTLIGKTGIVVRNIQRAELDSIDALGRLGVATVHEAQNRKGLLSSKMRPIQQGTSLAGSAVTVLVAPGDNWMFHVAVEQCRPGDVLVVSPSSPCTDGYFGDLLATSLQARGVRALIVDAGVRDTQTLRDMGFAVWARAINAQGTVKETLGSVNLPVICGGQLINPGDIVVADDDGVVVVRRDECESTLVAAAERAGLEEEKRLRLAAGELGLDIYKMRERLEAKGLRYVDNIEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decar
publication title Structural and Kinetic Characterization of 4-Hydroxy-4-methyl-2-oxoglutarate/4-Carboxy-4-hydroxy-2-oxoadipate Aldolase, a Protocatechuate Degradation Enzyme Evolutionarily Convergent with the HpaI and DmpG Pyruvate Aldolases.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 78
structure length 235
sequence length 235
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3nojA01
2YJVA 2YJTA 3NOJA 1J3LA 2PCNA 1NXJA 1VI4A 1Q5XA 3C8OA 3K4IA
chains in the Genus database with same CATH superfamily
2B0AA 2CIJA 2C6PA 3TLAA 1VBHA 4P4IA 4C8FA 4C99A 3GJZA 4MI1A 4OC4A 1KEEB 5F5XA 5JYBA 1Q5XA 4NGMA 3TLEA 1T36B 2DIKA 3EZEA 3D7HA 4JZ0A 2XEFA 2E28A 1J3LA 2EZBA 2HROA 4NGRA 4MCPA 3EZBA 3IWWA 3TLGB 2D0OA 3BI0A 4JYWA 2YJVA 1CE8B 1M6VB 2JBJA 3NOJA 4C9RA 4COBA 5IB9A 4IIXA 4H1HA 2AUNA 1BXRB 3IIBA 4CO9A 3ICUA 3D7GA 5IR2A 4CDJA 2YJTA 1KC7A 4P4BA 4C85A 4YN3A 1VI4A 4NGNA 4TWEA 3EZAA 5F09A 4C8TA 4C8AA 3S9MA 5F9MA 3D7FA 4OC2A 2FM4A 3KASA 3BI1A 3SJGA 4MCQA 4C9AA 1ZYMA 4C8PA 4MCRA 3FECA 2XEIA 2C5QA 3K9TA 4P4JA 2EK8A 4CZ1A 4E5SA 2OR4A 3I6SA 4C84A 4COGA 3FEDA 4NGQA 3KRVA 1ZL0A 5D29A 2XEGA 3EIFA 4P4FA 1Z8LA 4X3RA 3T0TA 4C9VA 5FD8A 4TJXA 3TLBA 2D0PA 2EK9A 3C8OA 1CS0B 3RBUA 4EYSA 1C30B 3T05A 3BHXA 1NBWA 4OC0A 4JVOA 3BXMA 5F1YA 3TLZA 2R82A 4C8CA 2XEJA 4TJVA 1R61A 3I74A 3FF3A 3SJFA 1C3OB 4INJA 2PCNA 2GP4A 4NGTA 1XF1A 2EZAA 4P4DA 4OMEA 3D7DA 2OLSA 2C6GA 2HWGA 4P44A 3T5MA 3SJXA 4CDKA 3S9NA 4OC3A 3K4IA 1Y9ZA 4LQGA 3TLGA 1V6CA 3TYXA 4C8UA 4OC5A 3G23A 4NGSA 2C6CA 1JDEA 1WVMA 3SR3A 3S9LA 3VTAA 4M8DA 3SJEA 4P45A 1KBLA 4MCSA 1NXJA 4IIYA 2HI6A 4C86A 4W9YA 3U1BA 2EZCA 4P4EA 2MP0A 2OOTA 3T07A 2PVWA 3TLYA 4MJXA 4KNGE 1A9XB 5JVLA 1DIKA 1GGOA 3FEEA 1CX8A 1VBGA 1EZBA 4OC1A 2PVVA 1EZAA 4E94A 4C9UA 1ZRSA 3TLCA 4C9EA 2X0SA 5K99A 4NGPA 2JBKA 4J0NA 1DE4C 2AUMA 1JDBC 5ELYA
chains in the Genus database with same CATH topology
2YJVA 2YJTA 3NOJA 1J3LA 2PCNA 1NXJA 1VI4A 1Q5XA 3C8OA 3K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJV A;  2YJT A;  3NOJ A;  1J3L A;  2PCN A;  1NXJ A;  1VI4 A;  1Q5X A;  3C8O A;  3K4I A; 
#chains in the Genus database with same CATH topology
 2B0A A;  2CIJ A;  2C6P A;  3TLA A;  1VBH A;  4P4I A;  4C8F A;  4C99 A;  3GJZ A;  4MI1 A;  4OC4 A;  1KEE B;  5F5X A;  5JYB A;  1Q5X A;  4NGM A;  3TLE A;  1T36 B;  2DIK A;  3EZE A;  3D7H A;  4JZ0 A;  2XEF A;  2E28 A;  1J3L A;  2EZB A;  2HRO A;  4NGR A;  4MCP A;  3EZB A;  3IWW A;  3TLG B;  2D0O A;  3BI0 A;  4JYW A;  2YJV A;  1CE8 B;  1M6V B;  2JBJ A;  3NOJ A;  4C9R A;  4COB A;  5IB9 A;  4IIX A;  4H1H A;  2AUN A;  1BXR B;  3IIB A;  4CO9 A;  3ICU A;  3D7G A;  5IR2 A;  4CDJ A;  2YJT A;  1KC7 A;  4P4B A;  4C85 A;  4YN3 A;  1VI4 A;  4NGN A;  4TWE A;  3EZA A;  5F09 A;  4C8T A;  4C8A A;  3S9M A;  5F9M A;  3D7F A;  4OC2 A;  2FM4 A;  3KAS A;  3BI1 A;  3SJG A;  4MCQ A;  4C9A A;  1ZYM A;  4C8P A;  4MCR A;  3FEC A;  2XEI A;  2C5Q A;  3K9T A;  4P4J A;  2EK8 A;  4CZ1 A;  4E5S A;  2OR4 A;  3I6S A;  4C84 A;  4COG A;  3FED A;  4NGQ A;  3KRV A;  1ZL0 A;  5D29 A;  2XEG A;  3EIF A;  4P4F A;  1Z8L A;  4X3R A;  3T0T A;  4C9V A;  5FD8 A;  4TJX A;  3TLB A;  2D0P A;  2EK9 A;  3C8O A;  1CS0 B;  3RBU A;  4EYS A;  1C30 B;  3T05 A;  3BHX A;  1NBW A;  4OC0 A;  4JVO A;  3BXM A;  5F1Y A;  3TLZ A;  2R82 A;  4C8C A;  2XEJ A;  4TJV A;  1R61 A;  3I74 A;  3FF3 A;  3SJF A;  1C3O B;  4INJ A;  2PCN A;  2GP4 A;  4NGT A;  1XF1 A;  2EZA A;  4P4D A;  4OME A;  3D7D A;  2OLS A;  2C6G A;  2HWG A;  4P44 A;  3T5M A;  3SJX A;  4CDK A;  3S9N A;  4OC3 A;  3K4I A;  1Y9Z A;  4LQG A;  3TLG A;  1V6C A;  3TYX A;  4C8U A;  4OC5 A;  3G23 A;  4NGS A;  2C6C A;  1JDE A;  1WVM A;  3SR3 A;  3S9L A;  3VTA A;  4M8D A;  3SJE A;  4P45 A;  1KBL A;  4MCS A;  1NXJ A;  4IIY A;  2HI6 A;  4C86 A;  4W9Y A;  3U1B A;  2EZC A;  4P4E A;  2MP0 A;  2OOT A;  3T07 A;  2PVW A;  3TLY A;  4MJX A;  4KNG E;  1A9X B;  5JVL A;  1DIK A;  1GGO A;  3FEE A;  1CX8 A;  1VBG A;  1EZB A;  4OC1 A;  2PVV A;  1EZA A;  4E94 A;  4C9U A;  1ZRS A;  3TLC A;  4C9E A;  2X0S A;  5K99 A;  4NGP A;  2JBK A;  4J0N A;  1DE4 C;  2AUM A;  1JDB C;  5ELY A; 
#chains in the Genus database with same CATH homology
 2YJV A;  2YJT A;  3NOJ A;  1J3L A;  2PCN A;  1NXJ A;  1VI4 A;  1Q5X A;  3C8O A;  3K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...