3NOJA

The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
b'NTLIGKTGIVVRNIQRAELDSIDALGRLGVATVHEAQNRKGLLSSKMRPIQQGTSLAGSAVTVLVAPGDNWMFHVAVEQCRPGDVLVVSPSSPCTDGYFGDLLATSLQARGVRALIVDAGVRDTQTLRDMGFAVWARAINAQGTVKETLGSVNLPVICGGQLINPGDIVVADDDGVVVVRRDECESTLVAAAERAGLEEEKRLRLAAGELGLDIYKMRERLEAKGLRYVDNIEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decar
publication title Structural and Kinetic Characterization of 4-Hydroxy-4-methyl-2-oxoglutarate/4-Carboxy-4-hydroxy-2-oxoadipate Aldolase, a Protocatechuate Degradation Enzyme Evolutionarily Convergent with the HpaI and DmpG Pyruvate Aldolases.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 78
structure length 235
sequence length 235
ec nomenclature ec 4.1.1.112: Oxaloacetate decarboxylase.
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3nojA01
1J3LA 1VI4A 3C8OA 3NOJA 2YJVA 1Q5XA 1NXJA 2YJTA 3K4IA 2PCNA
chains in the Genus database with same CATH superfamily
3ICUA 1CX8A 2C6PA 3KRVA 4P4FA 4NGTA 4P44A 1Z8LA 1WVMA 1CE8B 4C9EA 2C5QA 4J0NA 4W9YA 2OOTA 4COGA 4OC0A 1Y9ZA 3D7HA 2HI6A 4C8PA 3K9TA 2PCNA 3TLYA 4TJVA 3S9NA 3I74A 1KC7A 4CDJA 2PVWA 3D7DA 4OMEA 1XF1A 4P45A 3SJXA 2D0PA 4X3RA 4P4BA 4P4JA 3K4IA 4OC3A 2XEGA 4C9RA 3TYXA 4E5SA 4LQGA 3U1BA 3TLAA 3VTAA 2EZAA 3FEEA 4IIXA 4P4DA 4IIYA 1ZRSA 1KBLA 1R61A 4JYWA 3KASA 3C8OA 3EZEA 2XEIA 3TLGA 4OC4A 3TLZA 1DE4C 4OC2A 5ELYA 3S9LA 3EIFA 5K99A 2C6CA 3SJGA 1EZAA 5F1YA 4C84A 3GJZA 2B0AA 3EZBA 3D7GA 4YN3A 2EZBA 4NGNA 2JBKA 5IR2A 3SJFA 4H1HA 3T07A 1BXRB 2EK8A 5D29A 4NGMA 4C9UA 1GGOA 4JVOA 4CDKA 2OR4A 2C6GA 1VBHA 1CS0B 3T5MA 2X0SA 1Q5XA 5JYBA 2AUMA 4C99A 1J3LA 4JZ0A 1T36B 3BHXA 4C85A 5F09A 2AUNA 1C30B 1ZYMA 2CIJA 3FEDA 4MCRA 4NGQA 4NGPA 5FD8A 4TWEA 4C8TA 1V6CA 2HWGA 1JDBC 4C9VA 2YJVA 3IIBA 3BXMA 3S9MA 4C86A 4C8UA 2MP0A 5JVLA 2E28A 4COBA 3TLGB 1VI4A 4OC5A 4P4EA 3TLCA 2EZCA 4OC1A 4C8CA 3I6SA 2D0OA 3SR3A 4C8FA 3D7FA 3IWWA 4MJXA 4NGRA 3SJEA 2PVVA 1C3OB 3FF3A 4MCQA 3T0TA 2XEJA 4MI1A 2JBJA 3G23A 4TJXA 3NOJA 3BI1A 4EYSA 1JDEA 3EZAA 4MCPA 4INJA 1EZBA 3TLBA 2XEFA 2R82A 4C9AA 4P4IA 1A9XB 3RBUA 1NXJA 2YJTA 4KNGE 4C8AA 2OLSA 3FECA 2EK9A 3TLEA 4M8DA 4NGSA 2GP4A 3T05A 1M6VB 1DIKA 5IB9A 4CZ1A 4E94A 2DIKA 4CO9A 1ZL0A 5F5XA 2FM4A 2HROA 3BI0A 4MCSA 1VBGA 5F9MA 1NBWA 1KEEB
chains in the Genus database with same CATH topology
1J3LA 1VI4A 3C8OA 3NOJA 2YJVA 1Q5XA 1NXJA 2YJTA 3K4IA 2PCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3L A;  1VI4 A;  3C8O A;  3NOJ A;  2YJV A;  1Q5X A;  1NXJ A;  2YJT A;  3K4I A;  2PCN A; 
#chains in the Genus database with same CATH topology
 3ICU A;  1CX8 A;  2C6P A;  3KRV A;  4P4F A;  4NGT A;  4P44 A;  1Z8L A;  1WVM A;  1CE8 B;  4C9E A;  2C5Q A;  4J0N A;  4W9Y A;  2OOT A;  4COG A;  4OC0 A;  1Y9Z A;  3D7H A;  2HI6 A;  4C8P A;  3K9T A;  2PCN A;  3TLY A;  4TJV A;  3S9N A;  3I74 A;  1KC7 A;  4CDJ A;  2PVW A;  3D7D A;  4OME A;  1XF1 A;  4P45 A;  3SJX A;  2D0P A;  4X3R A;  4P4B A;  4P4J A;  3K4I A;  4OC3 A;  2XEG A;  4C9R A;  3TYX A;  4E5S A;  4LQG A;  3U1B A;  3TLA A;  3VTA A;  2EZA A;  3FEE A;  4IIX A;  4P4D A;  4IIY A;  1ZRS A;  1KBL A;  1R61 A;  4JYW A;  3KAS A;  3C8O A;  3EZE A;  2XEI A;  3TLG A;  4OC4 A;  3TLZ A;  1DE4 C;  4OC2 A;  5ELY A;  3S9L A;  3EIF A;  5K99 A;  2C6C A;  3SJG A;  1EZA A;  5F1Y A;  4C84 A;  3GJZ A;  2B0A A;  3EZB A;  3D7G A;  4YN3 A;  2EZB A;  4NGN A;  2JBK A;  5IR2 A;  3SJF A;  4H1H A;  3T07 A;  1BXR B;  2EK8 A;  5D29 A;  4NGM A;  4C9U A;  1GGO A;  4JVO A;  4CDK A;  2OR4 A;  2C6G A;  1VBH A;  1CS0 B;  3T5M A;  2X0S A;  1Q5X A;  5JYB A;  2AUM A;  4C99 A;  1J3L A;  4JZ0 A;  1T36 B;  3BHX A;  4C85 A;  5F09 A;  2AUN A;  1C30 B;  1ZYM A;  2CIJ A;  3FED A;  4MCR A;  4NGQ A;  4NGP A;  5FD8 A;  4TWE A;  4C8T A;  1V6C A;  2HWG A;  1JDB C;  4C9V A;  2YJV A;  3IIB A;  3BXM A;  3S9M A;  4C86 A;  4C8U A;  2MP0 A;  5JVL A;  2E28 A;  4COB A;  3TLG B;  1VI4 A;  4OC5 A;  4P4E A;  3TLC A;  2EZC A;  4OC1 A;  4C8C A;  3I6S A;  2D0O A;  3SR3 A;  4C8F A;  3D7F A;  3IWW A;  4MJX A;  4NGR A;  3SJE A;  2PVV A;  1C3O B;  3FF3 A;  4MCQ A;  3T0T A;  2XEJ A;  4MI1 A;  2JBJ A;  3G23 A;  4TJX A;  3NOJ A;  3BI1 A;  4EYS A;  1JDE A;  3EZA A;  4MCP A;  4INJ A;  1EZB A;  3TLB A;  2XEF A;  2R82 A;  4C9A A;  4P4I A;  1A9X B;  3RBU A;  1NXJ A;  2YJT A;  4KNG E;  4C8A A;  2OLS A;  3FEC A;  2EK9 A;  3TLE A;  4M8D A;  4NGS A;  2GP4 A;  3T05 A;  1M6V B;  1DIK A;  5IB9 A;  4CZ1 A;  4E94 A;  2DIK A;  4CO9 A;  1ZL0 A;  5F5X A;  2FM4 A;  2HRO A;  3BI0 A;  4MCS A;  1VBG A;  5F9M A;  1NBW A;  1KEE B; 
#chains in the Genus database with same CATH homology
 1J3L A;  1VI4 A;  3C8O A;  3NOJ A;  2YJV A;  1Q5X A;  1NXJ A;  2YJT A;  3K4I A;  2PCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...