3NP1A

Crystal structure of the complex of nitrophorin 1 from rhodnius prolixus with cyanide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
184
structure length
184
Chain Sequence
b'KCTKNALAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQEESPGKYTANFKKVEKNGNVKVDVTSGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDTNAGDKVKGAVTAASLKFSDFISTKDNKCEYDNVSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROPHORIN 1
publication title Crystal structures of a nitric oxide transport protein from a blood-sucking insect.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Nitric oxide transport
total genus 45
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3np1A00
4OS8A 4TNNA 1KT7A 3NADA 1GT1A 1N0SA 3BDRA 4PSQA 1BWYA 4WBKA 1D2UA 5FAZA 1IKEA 3RZYA 3NQ3A 3WJEA 3TGCA 1QG5A 3UEUA 3WJGA 1JJXA 2X46A 1U0XA 1BJ7A 4OMXA 4GNYA 4AZRA 5HTDA 4Y0SA 1Z24A 5F6BA 1QFTA 1EW3A 2R56A 1MUPA 1LICA 5HZQA 3FR5A 4AZMA 1ADLA 3EBWA 4ZR2A 2R74A 4HFOA 4ORUA 2OVDA 1VYFA 3PPTA 5L8NA 4A8ZA 3ZQ3A 1UZ2X 3B2HA 4YGHA 4ZHCA 5HZ6A 2OVAA 3BRNA 3WJFA 5HBSA 4HPBA 1IFCA 2POAA 1BBPA 5HZ9A 1YWCA 3MBTA 3CBCA 1EPAA 5EDCA 3O2YA 1X8OA 4OS0A 2LBVA 1DZJA 1QFVA 1YWDA 3TF6A 4XMCA 1CJ5A 1ICMA 3FW4A 1ZNKA 3P6CA 1NP1A 4HPCA 5IO7A 1SY2A 3C76X 3VG3A 4TQ2A 1A18A 4LZUA 3FA9A 3STNA 5IO6A 1LFOA 3FELA 1E00A 5DPQA 1QABE 1KT5A 2Q4NA 1GX9A 1DFVA 1IW2A 3G7XA 4TKJA 4A60A 2PY1A 1GXAA 1OBPA 1CBIA 3TGBA 1PM1X 1S44A 1SXYA 1GT3A 5EEEA 4ZHFA 5K06A 1MDCA 4GRJA 2ANSA 1ZNDA 2CM9A 5CE4A 1EPBA 4D6AA 1FTPA 2E4JA 4GKCA 4ZCBA 1LIEA 1DF3A 1HQPA 5HCDC 2FS7A 1X8NA 3F8AA 2L9CA 2OFMX 3HWGA 3VG6A 3WJBA 3BU9A 3Q6LA 4YFQA 5BVQA 3IA8A 4Y0PA 3APWA 4I9RA 3O22A 1GX8A 1YWAA 1MVGA 1OBQA 1XCAA 4QZTA 4RUNA 5D45A 5KHPA 4BQUA 4I3BA 1FELA 1IFBA 1S7DA 1G85A 4WFVA 2A2UA 1SXUA 4DQ3A 3VG2A 1E06A 1GKAA 2FLJA 2QM9A 4GETA 1R0UA 1S2PA 1LF7A 5L8IA 4EFGA 3KFFA 1LNMA 4OS3A 5C0NA 2GC9A 2LBAA 5HA1A 1QY2A 4XMFA 3KQ0A 2QOSC 5EDBA 2L67A 2AT8X 3U03A 5B29A 2WEWA 3APVA 5LKFA 2WWPA 2MJIA 2AKQA 4QYPA 1OEEA 3TZSA 1E02A 4YMYA 1B0OA 2CBRA 1YUPA 4QGWA 4IAWA 1ZNLA 2W2BA 5EZ2A 3FEPA 1X89A 1KGLA 2WSJA 1I06A 4YKMA 1TW4A 1YIVA 3KFGA 3NP1A 3P6DA 4XMDA 1E5PA 1PEEA 1ZRYA 2ACPX 3PP6A 3C78X 4LKTA 3HWFA 1HMSA 4YBUA 3OJYC 3FA8A 4TLJA 2HMBA 2CBSA 4AW8A 1EALA 1A57A 3HK1A 2WQ9A 1U17A 5F1EA 5B27A 3KZAA 4LZVA 2ACOA 5HAEA 3F9DA 4NLIA 4XMHA 1PMPA 2X45A 2FR3A 4ALBA 1I04A 1UREA 1A2DA 4ZH9A 5HCEC 3I17A 4IBAA 2HZQA 2WUTA 2AT5X 5LJHA 3FR4A 3CR6A 4NLJA 2A2GA 2GJ5A 3I0AA 3CMPA 3STKA 3APXA 5LJBA 3APUA 2LKKA 3UEVA 4UU2A 2A13A 4I3CA 4ODDA 3STMX 1AQBA 2R73A 3T1DA 3VG5A 3IFBA 1KXOA 3P6EA 1BSQA 4UU3A 2WQAE 1CBQA 3BSZE 1ML7A 1I05A 3D96A 5HWZA 5DG4A 4GNWA 3PEDA 4HPDA 1ACDA 4AZPA 1JZUA 5HZ5A 3CBSA 4ZHGA 1OBUA 4ORXA 3NQ9A 5LKEA 1B8EA 3BS2A 4YBPA 1FEMA 1L6MA 3P6HA 4N7CA 4QAEA 1TXLA 1JYJA 3EMMA 4ZHHA 4AZOA 3AKNA 1IIUA 5EPQA 4ALOA 2L5PA 2W2FA 2AT3X 3O19A 1BRPA 1EIOA 1RLBE 1X8UA 3BLGA 1GT5A 3PH5A 4AZNA 4NNTA 1X8PA 1P6PA 4ZFXA 4ARHA 2JOZA 2FT9A 1YP7A 3WJCA 4QGVA 4OMWA 4CK4A 1VPRA 3FW5A 4YGZA 2F73A 2G79A 3HWEA 3D95A 2GTFX 2ASNX 2EU7X 4YFPA 4EDEA 3NR3A 4XMGA 4NP1A 2MO5A 2P8GA 1LIBA 1AVGI 5LJDA 3B2JA 4I9SA 3WBGA 2W2AA 2FWVA 1JBHA 2K23A 2BLGA 3DTQA 5FFHA 1IKJA 3S26A 1OPBA 5LJKA 2WR6A 3K3LA 4GE1A 3TGAA 1HMTA 2JU8A 4Y0QA 4O9SA 3BY0A 2DM5A 3WJDA 4ES7A 4IMNA 1CBSA 2FTBA 4ZH6A 4ZHDA 3ELXA 2KTDA 3U9PC 1B4MA 4MVKA 4EEJA 1FDQA 4IB8A 4M7MA 2RQ0A 2HLVA 4YH0A 4QZUA 4MVLA 4TKBA 1KT4A 4AZQA 3RSWA 1DZKA 2HNXA 1KZXA 3EM0A 4NYQA 4MVIA 4Y0RA 5HCCC 4LKPA 2G78A 3EBKA 3NPOA 1BM5A 2CM4A 4ORSA 2HZRA 2OVEA 3FR2A 5D4AA 2IFBA 5F7GA 1KZWA 2KT4B 1EIIA 4IAXA 4IB6A 1KT3A 1KQWA 3SAOA 2HYSA 4R0BA 4IB9A 1MX8A 2MM3A 1T8VA 4KIIA 1AB0A 2NNDA 3B2IA 3FENA 1SY0A 2FS6A 3FMZA 1KQXA 3UEWA 3CQNA 5HA0A 1O8VA 4M6SA 1U18A 4AYHA 1O1UA 2G7BA 3KFHA 4ZJ0A 1SY3A 4YDAA 1ICNA 1LIFA 2ALLX 3BU1A 3HWDA 5FENA 1FENA 5JR8A 2OZQA 1MX7A 2AL0X 5F6ZA 4EXZA 5KIDA 5H8TA 1EXSA 1I4UA 1ZNHA 1ZNGA 1ALBA 1LPJA 1YP6A 3P6FA 4YDBA 2RA6A 2JN3A 1VYGA 1GKAB 1D3SA 1BRQA 2A0AA 3UEXA 3VG7A 4BVMA 3PECA 4K19A 4A1HA 1NP4A 1HBQA 4A1YA 5EEDA 3FEKA 2QO4A 3U0DA 1SY1A 1ERBA 3QKGA 1DZPA 4ORYA 1G5WA 4N7DA 1JJJA 2LB6A 5D8JA 4DQ4A 1FE3A 5HZ8A 1KOIA 1ZNEA 2CZUA 1TOUA 1BLRA 4YCHA 1RBPA 1KT6A 1JV4A 2AT6X 4WFUA 3CWKA 2AT0X 3GAQA 1SA8A 5H9NA 5BVTA 5LJCA 2RCQA 2OFRX 4RUUA 5LJEA 2FR2A 5LJGA 2AH7X 1LIDA 4NNSA 1T0VA 1SXWA 2A3FX 3WVMA 3DSZA 3B2LA 2Q2PA 3BX8A 3PH6A 4IMOA 1AELA 2QO5A 1OEKA 2NNEA 1CRBA 4GH7A 3JSQA 2YG2A 4IB7A 3P6GA 3C77X 2AMMX 3FIQA 1G74A 1EUOA 5KICA 1O1VA 1DC9A 5H9KA 1TOWA 4QGXA 2XSTA 3JS1A 5BVSA 1TVQA 2Q9SA 1QWDA 2RD7C 1XKIA 2CZTA 2JU7A 1HBPA 1GT4A 1CBRA 3NX1A 3FA7A 1DV9A 3FLLA 1JYDA 3KFIA 2O62A 4ZGUA 1ERXA 3EYCA 1YWBA 4NYRA 1QY1A 3FA6A 1H91A 3VG4A 1BEBA 3D97A 3WXQA 1HN2A 4YCEA 5H9LA 1T68X 2QO6A 1SXXA 4YKOA 5F58A 4HPAA 4I3DA 4YGGA 2JU3A 2N93A 3BX7A 3CQRA 1EQDA 4ORWA 3ZUOA 2FRSA 2WEXA 5H9AA 4TJZA 4QYNA 3L4RA 4XMEA 5D47A 1LKEA 4ORRA 3AKMA 1DZMA 4BOEA 1OEJA 1G7NA 2Q2MA 3B2KA 1PBOA 3NX2A 2L68A 5AQ6A 1QY0A 2Q39A 1QQSA 3ELZA 1X71A 1GGLA 1A3YA 1OPAA 2RCTA 1B56A 5HTEA 2XKLA 5D48A 5IO5A 4YFRA 1HMRA 1BSOA 3MVFA 2LFOA 3ZUIA 2NP1A 4D6BA 1X8QA 1NGLA 4TKHA 5L8OA 1GM6A 2NNQA 1BSYA 2K62A
chains in the Genus database with same CATH superfamily
2UYWA 4OS8A 1Y53X 3JQOA 4TNNA 1KT7A 1SWGA 3NADA 3VHHA 1I9HA 4KC8A 1GT1A 1N0SA 3BDRA 4PSQA 2RTRB 1BWYA 4WBKA 1D2UA 2RTBB 1IKEA 4GDZA 4FGIB 5FAZA 3RDXA 1VYOA 3RZYA 3WOVA 3NQ3A 3WJEA 4NW4A 2IZHB 3TGCA 1QG5A 4JO6A 5B10O 3UEUA 3WJGA 1JJXA 1SLEB 2X46A 1U0XA 2C4IA 1BJ7A 4OMXA 2VFBA 4GNYA 4AZRA 5HTDA 4IRWA 4Y0SA 1Z24A 1SRGA 5F6BA 1QFTA 4B55A 1EW3A 2R56A 1MUPA 4KCAA 3RDUA 1LICA 5HZQA 3FR5A 2Z4IA 4AZMA 3RE5A 1ADLA 4GD9A 5AJCA 3EBWA 1NDJA 1SRIA 4ZR2A 4CPHB 1SWTA 2F09A 2R74A 4HFOA 4ORUA 1N43A 2OY5O 2OVDA 3SZIA 1VYFA 2X4MA 3PPTA 5L8NA 4A8ZA 4BX5A 3ZQ3A 1UZ2X 2OVSA 2Z4HA 3B2HA 4YGHA 1AVEA 4ZHCA 5HZ6A 3AUMO 2OVAA 3BRNA 3P24A 3WJFA 1SREA 5HBSA 4HPBA 1SWNA 2RTAA 3ZW1B 1IFCA 2POAA 1BBPA 5HZ9A 1YWCA 3MBTA 2OF8A 2G8CO 3CBCA 1EPAA 5EDCA 3O2YA 1X8OA 4OS0A 2LBVA 1DZJA 2X8SA 1QFVA 1YWDA 1RXHA 3N91A 3MX7A 3HTYA 4XMCA 3TF6A 1CJ5A 2OL7A 1ICMA 3SZHA 2RTMA 2BC3A 3FW4A 2QCBA 1ZNKA 2UZ2A 3P6CA 1Y9TA 1NP1A 4BX7B 4HPCA 2X8FA 5IO7A 1SY2A 2LA7A 3C76X 4O3YA 2GTLM 4OELA 3VG3A 4TQ2A 1A18A 4LZUA 4ES7A 4INNA 3FA9A 3STNA 5IO6A 1VWEB 4C5PA 4GDAA 3ZI8A 1LFOA 1RXJA 2C1QA 2HKDA 1E00A 1VWBB 1QABE 1KT5A 1W4TA 2Q4NA 1GX9A 1DFVA 3FELA 4JHQA 4QRLA 1IW2A 4BX6A 1STPA 3S5VA 3G7XA 2FHLA 1N9MA 1WUBA 4TKJA 4FQBB 2PY1A 4A60A 4WHIA 1SRFA 1GXAA 1OBPA 1CBIA 3TGBA 1VWCB 1PM1X 1S44A 1SXYA 1GT3A 5EEEA 4ZHFA 5IRWA 5K06A 1MDCA 4GRJA 3VE1A 1SWSA 2ANSA 1ZNDA 2CM9A 4QNIA 5CE4A 1EPBA 4D6AA 1FTPA 1NQMA 2E4JA 4GKCA 4ZCBA 1LIEA 1DF3A 1RAVA 1HQPA 5HCDC 2FS7A 1X8NA 3F8AA 2L9CA 1SWOA 2OFMX 3HWGA 4FBVA 3VG6A 1SWFA 2RTLA 3WJBA 2VDFA 3BU9A 3Q6LA 4YFQA 5BVQA 3SLOA 3RY2A 3IA8A 4Y0PA 5CYBA 3WZOA 3APWA 4I9RA 1SWKA 5JD2A 2VFCA 3O22A 1JMXA 1GX8A 1YWAA 1MVGA 1OBQA 2RTCB 3D4RA 2I5ZO 1XCAA 4L3RA 1UYNX 1N7YA 4QZTA 4RUNA 4LQZA 5D45A 5KHPA 4BQUA 4I3BA 2ZSCA 1FELA 1IFBA 1S7DA 1G85A 4WFVA 2A2UA 2C1SA 1SXUA 4DQ3A 4PJ2A 5FQ8E 1E06A 3VG2A 1GKAA 2FLJA 2QM9A 3PDFA 4MIRA 4GETA 1R0UA 1S2PA 4ZGFA 1LF7A 5L8IA 4EFGA 3KFFA 1LNMA 3VHMA 4OS3A 5C0NA 4U8UO 2GC9A 2LBAA 1VWPB 5HA1A 3WZPA 4EKVA 3S60A 3MG5A 1QY2A 4XMFA 3KQ0A 2QOSC 5EDBA 2L67A 2OYBO 2AT8X 4QQ1A 5B29A 3U03A 2WEWA 3APVA 5LKFA 2X8TA 4DCBA 2WWPA 2MJIA 2AKQA 2MF6A 4QYPA 1OEEA 3TZSA 1E02A 4YMYA 1B0OA 1SWDA 4O4OA 2CBRA 1YUPA 3PQSA 4QGWA 4CDDA 4IAWA 1VWLB 4CV7A 1ZNLA 2W2BA 5EZ2A 3FEPA 2X55A 1X89A 1JMZA 1KGLA 2WSJA 1I06A 4YKMA 2Y32A 5IRUA 4FBOA 1TW4A 3E3CA 1YIVA 3KFGA 3NP1A 3P6DA 4XMDA 1E5PA 3WZNA 2YMSA 1UYOX 1PEEA 1ZRYA 2ACPX 1VWJB 2A8GA 3PP6A 3C78X 4LKTA 3HWFA 1GX3A 1HMSA 2DJFA 1VWIB 4YBUA 1SWCA 3OJYC 3FA8A 2MHDA 1SWHA 2HMBA 4TLJA 2CBSA 4NV7A 4AW8A 2RTPB 1EALA 1LCWA 3Q34A 1A57A 3HK1A 2WQ9A 1U17A 3EW2A 5F1EA 5B27A 4CDEA 4GK9A 3KZAA 4LZVA 2ACOA 4BJ8A 4DNEA 5HAEA 3F9DA 4NLIA 4XMHA 1PMPA 2X45A 3T2XA 2FR3A 4ALBA 1I04A 1SRHA 1UREA 1A2DA 5CSEA 4ZH9A 5IXGA 2RN4A 5HCEC 3I17A 4IBAA 2HZQA 2WUTA 2AT5X 5LJHA 3FR4A 3CR6A 2OF9A 4NLJA 2A2GA 1WBIA 2GJ5A 3CMPA 3I0AA 2JMBA 3STKA 3APXA 3ZZVA 4Z6JA 5LJBA 4CPIA 1VWAB 3APUA 2A5CA 2LKKA 4U8UM 3UEVA 4UU2A 2A13A 4I3CA 4ODDA 1SWRA 3RWXA 3STMX 1VWNB 1AQBA 2IZDB 2R73A 3T1DA 3VG5A 3IFBA 1KXOA 2BHVA 3P6EA 1BSQA 1MK5A 5DPQA 4COTA 1W5RA 4I60A 4UU3A 1I78A 2WQAE 1CBQA 1KL5A 3BSZE 1ML7A 1I05A 3D96A 4ON1A 5HWZA 5DG4A 4GNWA 1SWEA 1JJUA 3PEDA 4HPDA 1ACDA 4AZPA 1JZUA 5HZ5A 3CBSA 4ZHGA 1OBUA 3MM0A 4ORXA 2OL6O 3NQ9A 5LKEA 1B8EA 4Y5DA 3RDQA 3BS2A 2RTQB 4YBPA 3HPEA 1FEMA 3OD9A 1L6MA 3P6HA 4N7CA 4QAEA 1TXLA 2Y3FA 1JYJA 3EMMA 4ZHHA 4AZOA 3AKNA 1IIUA 1HXLA 1MEPA 1VWHB 5EPQA 4ALOA 2L5PA 2W2FA 2AT3X 3OBLA 3O19A 4ZJ0A 1BRPA 4ML7B 3RE6A 1EIOA 1RLBE 1SLDB 1X8UA 1K24A 2IZCB 2KTSA 3BLGA 1GT5A 2BSZA 1Y9LA 3PH5A 1MOYA 4AZNA 4NNTA 1X8PA 1P6PA 4ZFXA 3V8UA 2RTIB 4ARHA 2JOZA 3FIDA 5B3MO 2FT9A 4O49A 1YP7A 3RY1A 3VE2A 3WJCA 4OMWA 4QGVA 1LCVA 4CK4A 1VPRA 1VWFB 1NQNA 3FW5A 2F73A 3PQUA 2G79A 4U3QA 4YGZA 4BX5B 3HWEA 3D95A 2GTFX 1LDQA 2ASNX 2JW1A 2EU7X 2AVIA 4YFPA 4EDEA 3NR3A 4XMGA 1Y0GA 4NP1A 2MO5A 2P8GA 1W6FA 1LIBA 1VWQB 1AVGI 5LJDA 3B2JA 2BS6A 4I9SA 3WBGA 5L3YA 2W2AA 1LDOA 2FWVA 1JBHA 1JQPA 2IZEB 2K23A 2BLGA 2OY8A 3DTQA 3PK2A 5FFHA 1IKJA 3S26A 1VWDB 1OPBA 1FJ1E 5LJKA 5FQ6E 1SWPA 2WR6A 3T2WA 1LELA 3K3LA 4GGZA 4GE1A 3TGAA 3VU1A 4FBRA 4Z2OA 4MVEA 1HMTA 2JU8A 1RSUB 4Y0QA 4O9SA 3BY0A 2DM5A 2RTDB 3FYFA 2IZAA 4IMNA 3WJDA 1CBSA 2FTBA 4L1NA 4CPHA 4ZH6A 4ZHDA 2PI3O 1KFFA 2MWHA 1RXKA 3ELXA 2KTDA 3U9PC 5B11O 1B4MA 4MVKA 4EEJA 3LHNA 1FDQA 4IB8A 4KT5A 3CKGA 4M7MA 2RQ0A 1EI5A 2HLVA 3ZW1A 1STRB 2GTLN 4YH0A 1BLRA 4QZUA 4ID2A 4MVLA 5CHKA 4TKBA 1KT4A 4AZQA 3RSWA 1DZKA 2HNXA 1KZXA 4BCSA 3EM0A 4NYQA 4MVIA 4Y0RA 2BT9A 3ZWEA 4LKPA 1STSB 4GGRA 5HCCC 2G78A 3EBKA 3NPOA 1BM5A 2CM4A 4ORSA 2HZRA 2OVEA 4Z28A 3LTWA 3FR2A 5D4AA 2IFBA 5F7GA 1KZWA 2KT4B 3VGWA 3H3IA 1EIIA 2RTNB 4IAXA 4IB6A 1KT3A 1KQWA 2FKGA 2X56A 3SAOA 3OE3A 2HYSA 4R0BA 4IB9A 1MX8A 2MM3A 1T8VA 4KIIA 1AB0A 2NNDA 3B2IA 4BX7A 2X32A 3FENA 2JGSA 4O4SA 4O3ZA 1SY0A 2FS6A 3FMZA 1KQXA 2QMIA 3EC5A 3CQNA 5HA0A 1O8VA 4O4UA 3UEWA 2GTLO 2Y3EA 4M6SA 1SWUA 2CAMA 1U18A 4AYHA 1O1UA 1LUQA 3WYQA 1KL4A 2G7BA 3KFHA 2BS5A 1PBYA 1SY3A 4YDAA 1ICNA 1LIFA 2ALLX 3BU1A 3HWDA 3P02A 2OL8O 4KC7A 4CSBA 5FENA 1FENA 1Y55X 2FGSA 2OZQA 1MX7A 2AL0X 3EW1A 5F6ZA 4EXZA 5H8TA 5JR8A 1EXSA 1HQQA 1I4UA 3KVNA 4NV8A 5KIDA 1ZNHA 3SZJA 2M4LA 2RTKA 3SOTA 4Z2PA 1ZNGA 1N9YA 1ALBA 1LPJA 1YP6A 1PTSA 3P6FA 2RA6A 4YDBA 3HOLA 3WZQA 1VWGB 2JN3A 1VYGA 2GH7A 1GKAB 4HWMA 1D3SA 3UAQA 1BRQA 2A0AA 3UEXA 4I6SA 2ZAGA 4GJVA 3VG7A 3PECA 4BVMA 4Z2VA 4K19A 4A1HA 1NP4A 4GJSA 3VHIA 1HBQA 1VWMB 5EEDA 4A1YA 3CKFA 3GE2A 2KD2A 3FEKA 2QO4A 1SWQA 3U0DA 1SY1A 1LCZA 1ERBA 3ZW0B 3QKGA 1DZPA 1JIWI 4JGLA 2OFBA 4ORYA 1G5WA 4N7DA 4GU8A 5BYPA 2LB6A 5D8JA 4DQ4A 1FE3A 5HZ8A 1JJJA 1KL3A 2IZBA 1HY2A 1KOIA 1ZNEA 1TOUA 2CZUA 2ZAIA 3SLJA 2IZGB 2QOMA 2OY1O 4YCHA 1RBPA 1KT6A 2IZJA 1JV4A 2AT6X 2RTGB 4WFUA 1HXZA 3CWKA 2AT0X 3GAQA 5F2BA 1SA8A 3RDSA 5H9NA 5AJBA 5BVTA 4CPFA 2RCQA 5LJCA 3RKGA 2RTHB 2OFRX 3FDCA 4RUUA 5B5GA 2FR2A 4CDCA 5LJGA 4OEMA 5LJEA 4O4XA 2I5VO 1LIDA 1OSPO 4NNSA 2AH7X 3RBYA 1T0VA 2DJGA 2F01A 1SXWA 2A3FX 3WVMA 3DSZA 4YVBA 3B2LA 2Q2PA 2X34A 3BX8A 3PH6A 4IMOA 1AELA 1RSTB 3NQKA 2QO5A 1OEKA 1SLFB 2NNEA 1CRBA 1VWOB 3SLTA 4GUZA 4GH7A 1SLGB 3JSQA 2RTFB 2YG2A 3P6GA 4IB7A 3T6FA 3C77X 2AMMX 3FIQA 1G74A 1EUOA 1SWLA 5KICA 1O1VA 1DC9A 5H9KA 4O3XB 1TOWA 4QGXA 4U46A 4CDFA 1DF8A 1SMPI 2XSTA 3JS1A 5BVSA 1TVQA 2G5LA 2Q9SA 1QWDA 4MEEA 2RD7C 1SWAA 1XKIA 2CZTA 2JU7A 1HBPA 2A5BA 1GT4A 4KH8A 1CBRA 3NX1A 3FA7A 4EQAC 4BBOA 1DV9A 3FLLA 1JYDA 3KFIA 2O62A 4Y59A 4JNJA 4ZGUA 3RDMA 2FKJA 1ERXA 3EYCA 5B2AO 1YWBA 2OFAA 4NYRA 2IZKA 1QY1A 2FHNX 3FA6A 3QQ2A 3RDOA 1H91A 4IABA 4Z27A 5B5FA 1K3BA 3VG4A 5AEOA 3LV4A 1BEBA 1N4JA 3D97A 3F6ZB 5FQ7E 3WXQA 1HN2A 4YCEA 5H9LA 1T68X 4CPEA 2QO6A 1SXXA 4YKOA 4U8UN 5F58A 1AVDA 1NC9A 1NBXA 4HPAA 4I3DA 4YGGA 5K68A 2JU3A 4OKAA 1IJ8A 2N93A 1Y52X 2IZIA 3BX7A 3CQRA 3T6LA 3VPJE 4BGFA 4I95A 1EQDA 3AEHA 3NBXX 4ORWA 3ZUOA 5K67A 2FRSA 1SRJA 2WEXA 5H9AA 4GZVA 1MM9A 4TJZA 4QYNA 3L4RA 4O3WA 4XMEA 5D47A 1LKEA 4ORRA 3AKMA 1DZMA 4BOEA 4BX6B 1VWRB 1OEJA 1G7NA 2Q2MA 4U9CA 3B2KA 2OY7A 3X00A 1PBOA 2IZLB 3NX2A 2L68A 4GGTA 5AQ6A 1QY0A 2Q39A 1QQSA 1SWBA 3D9WA 3ELZA 2RTJA 1X71A 1GGLA 1A3YA 1OPAA 2RCTA 1B56A 2IZFB 5HTEA 2XKLA 5D48A 2WPUA 2RTOB 5IO5A 4YFRA 3HOEA 2AF5A 1HMRA 3ZW2A 1BSOA 3MVFA 4MISA 2LFOA 1VWKB 1E2TA 2NP1A 3ZUIA 1X8QA 3ZW0A 4D6BA 1NGLA 1SWJA 2KW1A 4TKHA 5IRAA 2RTEB 5L8OA 1GM6A 2NNQA 3WYPA 3S5XA 1BSYA 2K62A
chains in the Genus database with same CATH topology
4OS8A 3JQOA 4TNNA 1KT7A 3NADA 4KC8A 1GT1A 1N0SA 3BDRA 4PSQA 1BWYA 4WBKA 1D2UA 4GDZA 1IKEA 5FAZA 4FGIB 3RZYA 3WOVA 3NQ3A 3WJEA 4NW4A 3TGCA 1QG5A 3UEUA 3WJGA 1JJXA 2X46A 1U0XA 1BJ7A 4OMXA 4GNYA 4AZRA 5HTDA 4Y0SA 1Z24A 5F6BA 1QFTA 1EW3A 2R56A 1MUPA 4KCAA 1LICA 5HZQA 3FR5A 2Z4IA 4AZMA 1ADLA 5AJCA 3EBWA 4ZR2A 2F09A 2R74A 4HFOA 4ORUA 2OVDA 1VYFA 3PPTA 5L8NA 4A8ZA 3ZQ3A 1UZ2X 2OVSA 2Z4HA 3B2HA 4YGHA 4ZHCA 5HZ6A 2OVAA 3BRNA 3P24A 3WJFA 5HBSA 4HPBA 3ZW1B 1IFCA 2POAA 1BBPA 5HZ9A 1YWCA 3MBTA 3CBCA 1EPAA 5EDCA 3O2YA 1X8OA 4OS0A 2LBVA 1DZJA 2X8SA 1QFVA 1YWDA 3N91A 3MX7A 3HTYA 4XMCA 3TF6A 1CJ5A 1ICMA 3FW4A 1ZNKA 3P6CA 1Y9TA 1NP1A 4HPCA 2X8FA 5IO7A 1SY2A 2LA7A 3C76X 4O3YA 2GTLM 3VG3A 4TQ2A 1A18A 4LZUA 4INNA 3FA9A 3STNA 5IO6A 3ZI8A 1LFOA 3FELA 1E00A 4QRLA 1QABE 1KT5A 2Q4NA 5DPQA 1GX9A 1DFVA 1IW2A 3S5VA 3G7XA 4TKJA 4FQBB 2PY1A 4A60A 4WHIA 1GXAA 1OBPA 1CBIA 3TGBA 1PM1X 1S44A 1SXYA 1GT3A 5EEEA 4ZHFA 5K06A 1MDCA 4GRJA 3VE1A 2ANSA 1ZNDA 2CM9A 4QNIA 5CE4A 1EPBA 4D6AA 1FTPA 2E4JA 4GKCA 4ZCBA 1LIEA 1DF3A 1HQPA 5HCDC 2FS7A 1X8NA 3F8AA 2L9CA 2OFMX 3HWGA 4FBVA 3VG6A 3WJBA 3BU9A 3Q6LA 4YFQA 5BVQA 3IA8A 4Y0PA 5CYBA 3APWA 4I9RA 3O22A 1GX8A 1YWAA 1MVGA 1OBQA 3D4RA 1XCAA 4L3RA 4QZTA 4RUNA 4LQZA 5D45A 5KHPA 4BQUA 4I3BA 1FELA 1IFBA 1S7DA 1G85A 4WFVA 2A2UA 1SXUA 4DQ3A 4PJ2A 5FQ8E 1E06A 3VG2A 1GKAA 2FLJA 2QM9A 4MIRA 4GETA 1R0UA 1S2PA 4ZGFA 1LF7A 5L8IA 4EFGA 3KFFA 1LNMA 4OS3A 5C0NA 4U8UO 2GC9A 2LBAA 5HA1A 3S60A 1QY2A 4XMFA 3KQ0A 2QOSC 5EDBA 2L67A 2AT8X 4QQ1A 5B29A 3U03A 2WEWA 3APVA 5LKFA 2X8TA 2WWPA 2MJIA 2AKQA 4QYPA 1OEEA 3TZSA 1E02A 4YMYA 1B0OA 4O4OA 2CBRA 1YUPA 3PQSA 4QGWA 4IAWA 4CV7A 1ZNLA 2W2BA 5EZ2A 3FEPA 1X89A 1KGLA 2WSJA 1I06A 4YKMA 4FBOA 1TW4A 3E3CA 1YIVA 3KFGA 3NP1A 3P6DA 4XMDA 1E5PA 2YMSA 1PEEA 1ZRYA 2ACPX 3PP6A 3C78X 4LKTA 3HWFA 1HMSA 4YBUA 3OJYC 3FA8A 2MHDA 4TLJA 2HMBA 2CBSA 4AW8A 1EALA 1A57A 3HK1A 2WQ9A 1U17A 5F1EA 5B27A 4GK9A 3KZAA 4LZVA 2ACOA 5HAEA 3F9DA 4NLIA 4XMHA 1PMPA 2X45A 2FR3A 4ALBA 1I04A 1UREA 1A2DA 4ZH9A 2RN4A 5HCEC 3I17A 4IBAA 2HZQA 2WUTA 2AT5X 5LJHA 3FR4A 3CR6A 4NLJA 2A2GA 2GJ5A 3I0AA 3CMPA 3STKA 2JMBA 3APXA 3ZZVA 5LJBA 3APUA 2LKKA 4U8UM 3UEVA 4UU2A 2A13A 4I3CA 4ODDA 3RWXA 3STMX 1AQBA 2R73A 3T1DA 3VG5A 3IFBA 1KXOA 2BHVA 3P6EA 1BSQA 4COTA 4UU3A 2WQAE 1CBQA 3BSZE 1ML7A 1I05A 3D96A 4ON1A 5HWZA 5DG4A 4GNWA 3PEDA 4HPDA 1ACDA 4AZPA 1JZUA 5HZ5A 3CBSA 4ZHGA 1OBUA 4ORXA 3NQ9A 5LKEA 1B8EA 3BS2A 4YBPA 1FEMA 3OD9A 1L6MA 3P6HA 4N7CA 4QAEA 1TXLA 1JYJA 3EMMA 4ZHHA 4AZOA 3AKNA 1IIUA 5EPQA 4ALOA 2L5PA 2W2FA 2AT3X 3OBLA 3O19A 1BRPA 4ML7B 1EIOA 1RLBE 1X8UA 2KTSA 3BLGA 1GT5A 3PH5A 1Y9LA 4AZNA 4NNTA 1X8PA 1P6PA 4ZFXA 3V8UA 4ARHA 2JOZA 2FT9A 4O49A 1YP7A 3WJCA 3VE2A 4QGVA 4OMWA 4CK4A 1VPRA 4U3QA 3FW5A 4YGZA 2F73A 3PQUA 2G79A 3HWEA 3D95A 2GTFX 2ASNX 2JW1A 2EU7X 4YFPA 4EDEA 3NR3A 4XMGA 4NP1A 2MO5A 2P8GA 1LIBA 1AVGI 5LJDA 3B2JA 2BS6A 4I9SA 3WBGA 2W2AA 2FWVA 1JBHA 2K23A 2BLGA 3DTQA 5FFHA 1IKJA 3S26A 1OPBA 5LJKA 5FQ6E 2WR6A 3K3LA 4GE1A 3TGAA 3VU1A 4FBRA 4MVEA 1HMTA 2JU8A 4Y0QA 4O9SA 3BY0A 2DM5A 3WJDA 3FYFA 4ES7A 4IMNA 1CBSA 2FTBA 4L1NA 4ZH6A 4ZHDA 2MWHA 3ELXA 2KTDA 3U9PC 1B4MA 4MVKA 4EEJA 3LHNA 1FDQA 4IB8A 4KT5A 4M7MA 2RQ0A 1EI5A 2HLVA 3ZW1A 2GTLN 4YH0A 4QZUA 4ID2A 4MVLA 4TKBA 1KT4A 4AZQA 3RSWA 1DZKA 2HNXA 1KZXA 3EM0A 4NYQA 4MVIA 4Y0RA 2BT9A 3ZWEA 4LKPA 5HCCC 2G78A 3EBKA 3NPOA 1BM5A 2CM4A 4ORSA 2HZRA 2OVEA 3FR2A 5D4AA 2IFBA 5F7GA 1KZWA 2KT4B 1EIIA 3H3IA 4IAXA 4IB6A 1KT3A 1KQWA 3SAOA 3OE3A 2HYSA 4R0BA 4IB9A 1MX8A 2MM3A 1T8VA 4KIIA 1AB0A 2NNDA 3B2IA 3FENA 4O4SA 4O3ZA 1SY0A 2FS6A 3FMZA 1KQXA 2QMIA 3UEWA 3CQNA 5HA0A 1O8VA 4O4UA 2GTLO 4M6SA 1U18A 4AYHA 1O1UA 2G7BA 3KFHA 2BS5A 4ZJ0A 1SY3A 4YDAA 1ICNA 1LIFA 2ALLX 3BU1A 3HWDA 3P02A 4KC7A 4CSBA 5FENA 1FENA 5JR8A 2OZQA 1MX7A 2AL0X 5F6ZA 4EXZA 5KIDA 5H8TA 1EXSA 1I4UA 1ZNHA 2M4LA 3SOTA 1ZNGA 1ALBA 1LPJA 1YP6A 3P6FA 4YDBA 2RA6A 3HOLA 2JN3A 1VYGA 1GKAB 4HWMA 1D3SA 3UAQA 1BRQA 2A0AA 3UEXA 4I6SA 2ZAGA 3VG7A 4BVMA 3PECA 4K19A 4A1HA 1NP4A 1HBQA 4A1YA 5EEDA 3GE2A 2KD2A 3FEKA 2QO4A 3U0DA 1SY1A 1ERBA 3ZW0B 3QKGA 1DZPA 1JIWI 4JGLA 4ORYA 1G5WA 4N7DA 4GU8A 5BYPA 2LB6A 5D8JA 4DQ4A 1FE3A 5HZ8A 1JJJA 2ZAIA 1KOIA 1ZNEA 2CZUA 1TOUA 1BLRA 4YCHA 1RBPA 1KT6A 1JV4A 2AT6X 4WFUA 3CWKA 2AT0X 3GAQA 1SA8A 5H9NA 5AJBA 5BVTA 5LJCA 2RCQA 3RKGA 2OFRX 4RUUA 5LJEA 2FR2A 5LJGA 4O4XA 2AH7X 1LIDA 3RBYA 4NNSA 1T0VA 1SXWA 2A3FX 3WVMA 3DSZA 3B2LA 2Q2PA 3BX8A 3PH6A 4IMOA 1AELA 3NQKA 2QO5A 1OEKA 2NNEA 1CRBA 4GH7A 3JSQA 2YG2A 4IB7A 3P6GA 3C77X 2AMMX 3FIQA 1G74A 1EUOA 5KICA 1O1VA 1DC9A 5H9KA 4O3XB 1TOWA 4QGXA 1SMPI 2XSTA 3JS1A 5BVSA 1TVQA 2Q9SA 1QWDA 2RD7C 1XKIA 2CZTA 2JU7A 1HBPA 1GT4A 4KH8A 1CBRA 3NX1A 3FA7A 4EQAC 1DV9A 3FLLA 1JYDA 3KFIA 2O62A 4ZGUA 1ERXA 3EYCA 1YWBA 4NYRA 1QY1A 3FA6A 1H91A 4IABA 3VG4A 5AEOA 3LV4A 1BEBA 3D97A 3F6ZB 5FQ7E 3WXQA 1HN2A 4YCEA 5H9LA 1T68X 2QO6A 1SXXA 4YKOA 4U8UN 5F58A 4HPAA 4I3DA 4YGGA 2JU3A 2N93A 3BX7A 3CQRA 3VPJE 4I95A 1EQDA 4ORWA 3NBXX 3ZUOA 2FRSA 2WEXA 5H9AA 4GZVA 4TJZA 4QYNA 3L4RA 4O3WA 4XMEA 5D47A 1LKEA 4ORRA 3AKMA 1DZMA 4BOEA 1OEJA 1G7NA 2Q2MA 4U9CA 3B2KA 1PBOA 3NX2A 2L68A 5AQ6A 1QY0A 2Q39A 1QQSA 3ELZA 1X71A 1GGLA 1A3YA 1OPAA 2RCTA 1B56A 5HTEA 2XKLA 5D48A 5IO5A 4YFRA 3HOEA 3ZW2A 1HMRA 1BSOA 3MVFA 4MISA 2LFOA 3ZUIA 2NP1A 3ZW0A 1X8QA 4D6BA 1NGLA 2KW1A 4TKHA 5L8OA 1GM6A 2NNQA 3S5XA 1BSYA 2K62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OS8 A;  4TNN A;  1KT7 A;  3NAD A;  1GT1 A;  1N0S A;  3BDR A;  4PSQ A;  1BWY A;  4WBK A;  1D2U A;  5FAZ A;  1IKE A;  3RZY A;  3NQ3 A;  3WJE A;  3TGC A;  1QG5 A;  3UEU A;  3WJG A;  1JJX A;  2X46 A;  1U0X A;  1BJ7 A;  4OMX A;  4GNY A;  4AZR A;  5HTD A;  4Y0S A;  1Z24 A;  5F6B A;  1QFT A;  1EW3 A;  2R56 A;  1MUP A;  1LIC A;  5HZQ A;  3FR5 A;  4AZM A;  1ADL A;  3EBW A;  4ZR2 A;  2R74 A;  4HFO A;  4ORU A;  2OVD A;  1VYF A;  3PPT A;  5L8N A;  4A8Z A;  3ZQ3 A;  1UZ2 X;  3B2H A;  4YGH A;  4ZHC A;  5HZ6 A;  2OVA A;  3BRN A;  3WJF A;  5HBS A;  4HPB A;  1IFC A;  2POA A;  1BBP A;  5HZ9 A;  1YWC A;  3MBT A;  3CBC A;  1EPA A;  5EDC A;  3O2Y A;  1X8O A;  4OS0 A;  2LBV A;  1DZJ A;  1QFV A;  1YWD A;  3TF6 A;  4XMC A;  1CJ5 A;  1ICM A;  3FW4 A;  1ZNK A;  3P6C A;  1NP1 A;  4HPC A;  5IO7 A;  1SY2 A;  3C76 X;  3VG3 A;  4TQ2 A;  1A18 A;  4LZU A;  3FA9 A;  3STN A;  5IO6 A;  1LFO A;  3FEL A;  1E00 A;  5DPQ A;  1QAB E;  1KT5 A;  2Q4N A;  1GX9 A;  1DFV A;  1IW2 A;  3G7X A;  4TKJ A;  4A60 A;  2PY1 A;  1GXA A;  1OBP A;  1CBI A;  3TGB A;  1PM1 X;  1S44 A;  1SXY A;  1GT3 A;  5EEE A;  4ZHF A;  5K06 A;  1MDC A;  4GRJ A;  2ANS A;  1ZND A;  2CM9 A;  5CE4 A;  1EPB A;  4D6A A;  1FTP A;  2E4J A;  4GKC A;  4ZCB A;  1LIE A;  1DF3 A;  1HQP A;  5HCD C;  2FS7 A;  1X8N A;  3F8A A;  2L9C A;  2OFM X;  3HWG A;  3VG6 A;  3WJB A;  3BU9 A;  3Q6L A;  4YFQ A;  5BVQ A;  3IA8 A;  4Y0P A;  3APW A;  4I9R A;  3O22 A;  1GX8 A;  1YWA A;  1MVG A;  1OBQ A;  1XCA A;  4QZT A;  4RUN A;  5D45 A;  5KHP A;  4BQU A;  4I3B A;  1FEL A;  1IFB A;  1S7D A;  1G85 A;  4WFV A;  2A2U A;  1SXU A;  4DQ3 A;  3VG2 A;  1E06 A;  1GKA A;  2FLJ A;  2QM9 A;  4GET A;  1R0U A;  1S2P A;  1LF7 A;  5L8I A;  4EFG A;  3KFF A;  1LNM A;  4OS3 A;  5C0N A;  2GC9 A;  2LBA A;  5HA1 A;  1QY2 A;  4XMF A;  3KQ0 A;  2QOS C;  5EDB A;  2L67 A;  2AT8 X;  3U03 A;  5B29 A;  2WEW A;  3APV A;  5LKF A;  2WWP A;  2MJI A;  2AKQ A;  4QYP A;  1OEE A;  3TZS A;  1E02 A;  4YMY A;  1B0O A;  2CBR A;  1YUP A;  4QGW A;  4IAW A;  1ZNL A;  2W2B A;  5EZ2 A;  3FEP A;  1X89 A;  1KGL A;  2WSJ A;  1I06 A;  4YKM A;  1TW4 A;  1YIV A;  3KFG A;  3NP1 A;  3P6D A;  4XMD A;  1E5P A;  1PEE A;  1ZRY A;  2ACP X;  3PP6 A;  3C78 X;  4LKT A;  3HWF A;  1HMS A;  4YBU A;  3OJY C;  3FA8 A;  4TLJ A;  2HMB A;  2CBS A;  4AW8 A;  1EAL A;  1A57 A;  3HK1 A;  2WQ9 A;  1U17 A;  5F1E A;  5B27 A;  3KZA A;  4LZV A;  2ACO A;  5HAE A;  3F9D A;  4NLI A;  4XMH A;  1PMP A;  2X45 A;  2FR3 A;  4ALB A;  1I04 A;  1URE A;  1A2D A;  4ZH9 A;  5HCE C;  3I17 A;  4IBA A;  2HZQ A;  2WUT A;  2AT5 X;  5LJH A;  3FR4 A;  3CR6 A;  4NLJ A;  2A2G A;  2GJ5 A;  3I0A A;  3CMP A;  3STK A;  3APX A;  5LJB A;  3APU A;  2LKK A;  3UEV A;  4UU2 A;  2A13 A;  4I3C A;  4ODD A;  3STM X;  1AQB A;  2R73 A;  3T1D A;  3VG5 A;  3IFB A;  1KXO A;  3P6E A;  1BSQ A;  4UU3 A;  2WQA E;  1CBQ A;  3BSZ E;  1ML7 A;  1I05 A;  3D96 A;  5HWZ A;  5DG4 A;  4GNW A;  3PED A;  4HPD A;  1ACD A;  4AZP A;  1JZU A;  5HZ5 A;  3CBS A;  4ZHG A;  1OBU A;  4ORX A;  3NQ9 A;  5LKE A;  1B8E A;  3BS2 A;  4YBP A;  1FEM A;  1L6M A;  3P6H A;  4N7C A;  4QAE A;  1TXL A;  1JYJ A;  3EMM A;  4ZHH A;  4AZO A;  3AKN A;  1IIU A;  5EPQ A;  4ALO A;  2L5P A;  2W2F A;  2AT3 X;  3O19 A;  1BRP A;  1EIO A;  1RLB E;  1X8U A;  3BLG A;  1GT5 A;  3PH5 A;  4AZN A;  4NNT A;  1X8P A;  1P6P A;  4ZFX A;  4ARH A;  2JOZ A;  2FT9 A;  1YP7 A;  3WJC A;  4QGV A;  4OMW A;  4CK4 A;  1VPR A;  3FW5 A;  4YGZ A;  2F73 A;  2G79 A;  3HWE A;  3D95 A;  2GTF X;  2ASN X;  2EU7 X;  4YFP A;  4EDE A;  3NR3 A;  4XMG A;  4NP1 A;  2MO5 A;  2P8G A;  1LIB A;  1AVG I;  5LJD A;  3B2J A;  4I9S A;  3WBG A;  2W2A A;  2FWV A;  1JBH A;  2K23 A;  2BLG A;  3DTQ A;  5FFH A;  1IKJ A;  3S26 A;  1OPB A;  5LJK A;  2WR6 A;  3K3L A;  4GE1 A;  3TGA A;  1HMT A;  2JU8 A;  4Y0Q A;  4O9S A;  3BY0 A;  2DM5 A;  3WJD A;  4ES7 A;  4IMN A;  1CBS A;  2FTB A;  4ZH6 A;  4ZHD A;  3ELX A;  2KTD A;  3U9P C;  1B4M A;  4MVK A;  4EEJ A;  1FDQ A;  4IB8 A;  4M7M A;  2RQ0 A;  2HLV A;  4YH0 A;  4QZU A;  4MVL A;  4TKB A;  1KT4 A;  4AZQ A;  3RSW A;  1DZK A;  2HNX A;  1KZX A;  3EM0 A;  4NYQ A;  4MVI A;  4Y0R A;  5HCC C;  4LKP A;  2G78 A;  3EBK A;  3NPO A;  1BM5 A;  2CM4 A;  4ORS A;  2HZR A;  2OVE A;  3FR2 A;  5D4A A;  2IFB A;  5F7G A;  1KZW A;  2KT4 B;  1EII A;  4IAX A;  4IB6 A;  1KT3 A;  1KQW A;  3SAO A;  2HYS A;  4R0B A;  4IB9 A;  1MX8 A;  2MM3 A;  1T8V A;  4KII A;  1AB0 A;  2NND A;  3B2I A;  3FEN A;  1SY0 A;  2FS6 A;  3FMZ A;  1KQX A;  3UEW A;  3CQN A;  5HA0 A;  1O8V A;  4M6S A;  1U18 A;  4AYH A;  1O1U A;  2G7B A;  3KFH A;  4ZJ0 A;  1SY3 A;  4YDA A;  1ICN A;  1LIF A;  2ALL X;  3BU1 A;  3HWD A;  5FEN A;  1FEN A;  5JR8 A;  2OZQ A;  1MX7 A;  2AL0 X;  5F6Z A;  4EXZ A;  5KID A;  5H8T A;  1EXS A;  1I4U A;  1ZNH A;  1ZNG A;  1ALB A;  1LPJ A;  1YP6 A;  3P6F A;  4YDB A;  2RA6 A;  2JN3 A;  1VYG A;  1GKA B;  1D3S A;  1BRQ A;  2A0A A;  3UEX A;  3VG7 A;  4BVM A;  3PEC A;  4K19 A;  4A1H A;  1NP4 A;  1HBQ A;  4A1Y A;  5EED A;  3FEK A;  2QO4 A;  3U0D A;  1SY1 A;  1ERB A;  3QKG A;  1DZP A;  4ORY A;  1G5W A;  4N7D A;  1JJJ A;  2LB6 A;  5D8J A;  4DQ4 A;  1FE3 A;  5HZ8 A;  1KOI A;  1ZNE A;  2CZU A;  1TOU A;  1BLR A;  4YCH A;  1RBP A;  1KT6 A;  1JV4 A;  2AT6 X;  4WFU A;  3CWK A;  2AT0 X;  3GAQ A;  1SA8 A;  5H9N A;  5BVT A;  5LJC A;  2RCQ A;  2OFR X;  4RUU A;  5LJE A;  2FR2 A;  5LJG A;  2AH7 X;  1LID A;  4NNS A;  1T0V A;  1SXW A;  2A3F X;  3WVM A;  3DSZ A;  3B2L A;  2Q2P A;  3BX8 A;  3PH6 A;  4IMO A;  1AEL A;  2QO5 A;  1OEK A;  2NNE A;  1CRB A;  4GH7 A;  3JSQ A;  2YG2 A;  4IB7 A;  3P6G A;  3C77 X;  2AMM X;  3FIQ A;  1G74 A;  1EUO A;  5KIC A;  1O1V A;  1DC9 A;  5H9K A;  1TOW A;  4QGX A;  2XST A;  3JS1 A;  5BVS A;  1TVQ A;  2Q9S A;  1QWD A;  2RD7 C;  1XKI A;  2CZT A;  2JU7 A;  1HBP A;  1GT4 A;  1CBR A;  3NX1 A;  3FA7 A;  1DV9 A;  3FLL A;  1JYD A;  3KFI A;  2O62 A;  4ZGU A;  1ERX A;  3EYC A;  1YWB A;  4NYR A;  1QY1 A;  3FA6 A;  1H91 A;  3VG4 A;  1BEB A;  3D97 A;  3WXQ A;  1HN2 A;  4YCE A;  5H9L A;  1T68 X;  2QO6 A;  1SXX A;  4YKO A;  5F58 A;  4HPA A;  4I3D A;  4YGG A;  2JU3 A;  2N93 A;  3BX7 A;  3CQR A;  1EQD A;  4ORW A;  3ZUO A;  2FRS A;  2WEX A;  5H9A A;  4TJZ A;  4QYN A;  3L4R A;  4XME A;  5D47 A;  1LKE A;  4ORR A;  3AKM A;  1DZM A;  4BOE A;  1OEJ A;  1G7N A;  2Q2M A;  3B2K A;  1PBO A;  3NX2 A;  2L68 A;  5AQ6 A;  1QY0 A;  2Q39 A;  1QQS A;  3ELZ A;  1X71 A;  1GGL A;  1A3Y A;  1OPA A;  2RCT A;  1B56 A;  5HTE A;  2XKL A;  5D48 A;  5IO5 A;  4YFR A;  1HMR A;  1BSO A;  3MVF A;  2LFO A;  3ZUI A;  2NP1 A;  4D6B A;  1X8Q A;  1NGL A;  4TKH A;  5L8O A;  1GM6 A;  2NNQ A;  1BSY A;  2K62 A; 
#chains in the Genus database with same CATH topology
 2UYW A;  4OS8 A;  1Y53 X;  3JQO A;  4TNN A;  1KT7 A;  1SWG A;  3NAD A;  3VHH A;  1I9H A;  4KC8 A;  1GT1 A;  1N0S A;  3BDR A;  4PSQ A;  2RTR B;  1BWY A;  4WBK A;  1D2U A;  2RTB B;  1IKE A;  4GDZ A;  4FGI B;  5FAZ A;  3RDX A;  1VYO A;  3RZY A;  3WOV A;  3NQ3 A;  3WJE A;  4NW4 A;  2IZH B;  3TGC A;  1QG5 A;  4JO6 A;  5B10 O;  3UEU A;  3WJG A;  1JJX A;  1SLE B;  2X46 A;  1U0X A;  2C4I A;  1BJ7 A;  4OMX A;  2VFB A;  4GNY A;  4AZR A;  5HTD A;  4IRW A;  4Y0S A;  1Z24 A;  1SRG A;  5F6B A;  1QFT A;  4B55 A;  1EW3 A;  2R56 A;  1MUP A;  4KCA A;  3RDU A;  1LIC A;  5HZQ A;  3FR5 A;  2Z4I A;  4AZM A;  3RE5 A;  1ADL A;  4GD9 A;  5AJC A;  3EBW A;  1NDJ A;  1SRI A;  4ZR2 A;  4CPH B;  1SWT A;  2F09 A;  2R74 A;  4HFO A;  4ORU A;  1N43 A;  2OY5 O;  2OVD A;  3SZI A;  1VYF A;  2X4M A;  3PPT A;  5L8N A;  4A8Z A;  4BX5 A;  3ZQ3 A;  1UZ2 X;  2OVS A;  2Z4H A;  3B2H A;  4YGH A;  1AVE A;  4ZHC A;  5HZ6 A;  3AUM O;  2OVA A;  3BRN A;  3P24 A;  3WJF A;  1SRE A;  5HBS A;  4HPB A;  1SWN A;  2RTA A;  3ZW1 B;  1IFC A;  2POA A;  1BBP A;  5HZ9 A;  1YWC A;  3MBT A;  2OF8 A;  2G8C O;  3CBC A;  1EPA A;  5EDC A;  3O2Y A;  1X8O A;  4OS0 A;  2LBV A;  1DZJ A;  2X8S A;  1QFV A;  1YWD A;  1RXH A;  3N91 A;  3MX7 A;  3HTY A;  4XMC A;  3TF6 A;  1CJ5 A;  2OL7 A;  1ICM A;  3SZH A;  2RTM A;  2BC3 A;  3FW4 A;  2QCB A;  1ZNK A;  2UZ2 A;  3P6C A;  1Y9T A;  1NP1 A;  4BX7 B;  4HPC A;  2X8F A;  5IO7 A;  1SY2 A;  2LA7 A;  3C76 X;  4O3Y A;  2GTL M;  4OEL A;  3VG3 A;  4TQ2 A;  1A18 A;  4LZU A;  4ES7 A;  4INN A;  3FA9 A;  3STN A;  5IO6 A;  1VWE B;  4C5P A;  4GDA A;  3ZI8 A;  1LFO A;  1RXJ A;  2C1Q A;  2HKD A;  1E00 A;  1VWB B;  1QAB E;  1KT5 A;  1W4T A;  2Q4N A;  1GX9 A;  1DFV A;  3FEL A;  4JHQ A;  4QRL A;  1IW2 A;  4BX6 A;  1STP A;  3S5V A;  3G7X A;  2FHL A;  1N9M A;  1WUB A;  4TKJ A;  4FQB B;  2PY1 A;  4A60 A;  4WHI A;  1SRF A;  1GXA A;  1OBP A;  1CBI A;  3TGB A;  1VWC B;  1PM1 X;  1S44 A;  1SXY A;  1GT3 A;  5EEE A;  4ZHF A;  5IRW A;  5K06 A;  1MDC A;  4GRJ A;  3VE1 A;  1SWS A;  2ANS A;  1ZND A;  2CM9 A;  4QNI A;  5CE4 A;  1EPB A;  4D6A A;  1FTP A;  1NQM A;  2E4J A;  4GKC A;  4ZCB A;  1LIE A;  1DF3 A;  1RAV A;  1HQP A;  5HCD C;  2FS7 A;  1X8N A;  3F8A A;  2L9C A;  1SWO A;  2OFM X;  3HWG A;  4FBV A;  3VG6 A;  1SWF A;  2RTL A;  3WJB A;  2VDF A;  3BU9 A;  3Q6L A;  4YFQ A;  5BVQ A;  3SLO A;  3RY2 A;  3IA8 A;  4Y0P A;  5CYB A;  3WZO A;  3APW A;  4I9R A;  1SWK A;  5JD2 A;  2VFC A;  3O22 A;  1JMX A;  1GX8 A;  1YWA A;  1MVG A;  1OBQ A;  2RTC B;  3D4R A;  2I5Z O;  1XCA A;  4L3R A;  1UYN X;  1N7Y A;  4QZT A;  4RUN A;  4LQZ A;  5D45 A;  5KHP A;  4BQU A;  4I3B A;  2ZSC A;  1FEL A;  1IFB A;  1S7D A;  1G85 A;  4WFV A;  2A2U A;  2C1S A;  1SXU A;  4DQ3 A;  4PJ2 A;  5FQ8 E;  1E06 A;  3VG2 A;  1GKA A;  2FLJ A;  2QM9 A;  3PDF A;  4MIR A;  4GET A;  1R0U A;  1S2P A;  4ZGF A;  1LF7 A;  5L8I A;  4EFG A;  3KFF A;  1LNM A;  3VHM A;  4OS3 A;  5C0N A;  4U8U O;  2GC9 A;  2LBA A;  1VWP B;  5HA1 A;  3WZP A;  4EKV A;  3S60 A;  3MG5 A;  1QY2 A;  4XMF A;  3KQ0 A;  2QOS C;  5EDB A;  2L67 A;  2OYB O;  2AT8 X;  4QQ1 A;  5B29 A;  3U03 A;  2WEW A;  3APV A;  5LKF A;  2X8T A;  4DCB A;  2WWP A;  2MJI A;  2AKQ A;  2MF6 A;  4QYP A;  1OEE A;  3TZS A;  1E02 A;  4YMY A;  1B0O A;  1SWD A;  4O4O A;  2CBR A;  1YUP A;  3PQS A;  4QGW A;  4CDD A;  4IAW A;  1VWL B;  4CV7 A;  1ZNL A;  2W2B A;  5EZ2 A;  3FEP A;  2X55 A;  1X89 A;  1JMZ A;  1KGL A;  2WSJ A;  1I06 A;  4YKM A;  2Y32 A;  5IRU A;  4FBO A;  1TW4 A;  3E3C A;  1YIV A;  3KFG A;  3NP1 A;  3P6D A;  4XMD A;  1E5P A;  3WZN A;  2YMS A;  1UYO X;  1PEE A;  1ZRY A;  2ACP X;  1VWJ B;  2A8G A;  3PP6 A;  3C78 X;  4LKT A;  3HWF A;  1GX3 A;  1HMS A;  2DJF A;  1VWI B;  4YBU A;  1SWC A;  3OJY C;  3FA8 A;  2MHD A;  1SWH A;  2HMB A;  4TLJ A;  2CBS A;  4NV7 A;  4AW8 A;  2RTP B;  1EAL A;  1LCW A;  3Q34 A;  1A57 A;  3HK1 A;  2WQ9 A;  1U17 A;  3EW2 A;  5F1E A;  5B27 A;  4CDE A;  4GK9 A;  3KZA A;  4LZV A;  2ACO A;  4BJ8 A;  4DNE A;  5HAE A;  3F9D A;  4NLI A;  4XMH A;  1PMP A;  2X45 A;  3T2X A;  2FR3 A;  4ALB A;  1I04 A;  1SRH A;  1URE A;  1A2D A;  5CSE A;  4ZH9 A;  5IXG A;  2RN4 A;  5HCE C;  3I17 A;  4IBA A;  2HZQ A;  2WUT A;  2AT5 X;  5LJH A;  3FR4 A;  3CR6 A;  2OF9 A;  4NLJ A;  2A2G A;  1WBI A;  2GJ5 A;  3CMP A;  3I0A A;  2JMB A;  3STK A;  3APX A;  3ZZV A;  4Z6J A;  5LJB A;  4CPI A;  1VWA B;  3APU A;  2A5C A;  2LKK A;  4U8U M;  3UEV A;  4UU2 A;  2A13 A;  4I3C A;  4ODD A;  1SWR A;  3RWX A;  3STM X;  1VWN B;  1AQB A;  2IZD B;  2R73 A;  3T1D A;  3VG5 A;  3IFB A;  1KXO A;  2BHV A;  3P6E A;  1BSQ A;  1MK5 A;  5DPQ A;  4COT A;  1W5R A;  4I60 A;  4UU3 A;  1I78 A;  2WQA E;  1CBQ A;  1KL5 A;  3BSZ E;  1ML7 A;  1I05 A;  3D96 A;  4ON1 A;  5HWZ A;  5DG4 A;  4GNW A;  1SWE A;  1JJU A;  3PED A;  4HPD A;  1ACD A;  4AZP A;  1JZU A;  5HZ5 A;  3CBS A;  4ZHG A;  1OBU A;  3MM0 A;  4ORX A;  2OL6 O;  3NQ9 A;  5LKE A;  1B8E A;  4Y5D A;  3RDQ A;  3BS2 A;  2RTQ B;  4YBP A;  3HPE A;  1FEM A;  3OD9 A;  1L6M A;  3P6H A;  4N7C A;  4QAE A;  1TXL A;  2Y3F A;  1JYJ A;  3EMM A;  4ZHH A;  4AZO A;  3AKN A;  1IIU A;  1HXL A;  1MEP A;  1VWH B;  5EPQ A;  4ALO A;  2L5P A;  2W2F A;  2AT3 X;  3OBL A;  3O19 A;  4ZJ0 A;  1BRP A;  4ML7 B;  3RE6 A;  1EIO A;  1RLB E;  1SLD B;  1X8U A;  1K24 A;  2IZC B;  2KTS A;  3BLG A;  1GT5 A;  2BSZ A;  1Y9L A;  3PH5 A;  1MOY A;  4AZN A;  4NNT A;  1X8P A;  1P6P A;  4ZFX A;  3V8U A;  2RTI B;  4ARH A;  2JOZ A;  3FID A;  5B3M O;  2FT9 A;  4O49 A;  1YP7 A;  3RY1 A;  3VE2 A;  3WJC A;  4OMW A;  4QGV A;  1LCV A;  4CK4 A;  1VPR A;  1VWF B;  1NQN A;  3FW5 A;  2F73 A;  3PQU A;  2G79 A;  4U3Q A;  4YGZ A;  4BX5 B;  3HWE A;  3D95 A;  2GTF X;  1LDQ A;  2ASN X;  2JW1 A;  2EU7 X;  2AVI A;  4YFP A;  4EDE A;  3NR3 A;  4XMG A;  1Y0G A;  4NP1 A;  2MO5 A;  2P8G A;  1W6F A;  1LIB A;  1VWQ B;  1AVG I;  5LJD A;  3B2J A;  2BS6 A;  4I9S A;  3WBG A;  5L3Y A;  2W2A A;  1LDO A;  2FWV A;  1JBH A;  1JQP A;  2IZE B;  2K23 A;  2BLG A;  2OY8 A;  3DTQ A;  3PK2 A;  5FFH A;  1IKJ A;  3S26 A;  1VWD B;  1OPB A;  1FJ1 E;  5LJK A;  5FQ6 E;  1SWP A;  2WR6 A;  3T2W A;  1LEL A;  3K3L A;  4GGZ A;  4GE1 A;  3TGA A;  3VU1 A;  4FBR A;  4Z2O A;  4MVE A;  1HMT A;  2JU8 A;  1RSU B;  4Y0Q A;  4O9S A;  3BY0 A;  2DM5 A;  2RTD B;  3FYF A;  2IZA A;  4IMN A;  3WJD A;  1CBS A;  2FTB A;  4L1N A;  4CPH A;  4ZH6 A;  4ZHD A;  2PI3 O;  1KFF A;  2MWH A;  1RXK A;  3ELX A;  2KTD A;  3U9P C;  5B11 O;  1B4M A;  4MVK A;  4EEJ A;  3LHN A;  1FDQ A;  4IB8 A;  4KT5 A;  3CKG A;  4M7M A;  2RQ0 A;  1EI5 A;  2HLV A;  3ZW1 A;  1STR B;  2GTL N;  4YH0 A;  1BLR A;  4QZU A;  4ID2 A;  4MVL A;  5CHK A;  4TKB A;  1KT4 A;  4AZQ A;  3RSW A;  1DZK A;  2HNX A;  1KZX A;  4BCS A;  3EM0 A;  4NYQ A;  4MVI A;  4Y0R A;  2BT9 A;  3ZWE A;  4LKP A;  1STS B;  4GGR A;  5HCC C;  2G78 A;  3EBK A;  3NPO A;  1BM5 A;  2CM4 A;  4ORS A;  2HZR A;  2OVE A;  4Z28 A;  3LTW A;  3FR2 A;  5D4A A;  2IFB A;  5F7G A;  1KZW A;  2KT4 B;  3VGW A;  3H3I A;  1EII A;  2RTN B;  4IAX A;  4IB6 A;  1KT3 A;  1KQW A;  2FKG A;  2X56 A;  3SAO A;  3OE3 A;  2HYS A;  4R0B A;  4IB9 A;  1MX8 A;  2MM3 A;  1T8V A;  4KII A;  1AB0 A;  2NND A;  3B2I A;  4BX7 A;  2X32 A;  3FEN A;  2JGS A;  4O4S A;  4O3Z A;  1SY0 A;  2FS6 A;  3FMZ A;  1KQX A;  2QMI A;  3EC5 A;  3CQN A;  5HA0 A;  1O8V A;  4O4U A;  3UEW A;  2GTL O;  2Y3E A;  4M6S A;  1SWU A;  2CAM A;  1U18 A;  4AYH A;  1O1U A;  1LUQ A;  3WYQ A;  1KL4 A;  2G7B A;  3KFH A;  2BS5 A;  1PBY A;  1SY3 A;  4YDA A;  1ICN A;  1LIF A;  2ALL X;  3BU1 A;  3HWD A;  3P02 A;  2OL8 O;  4KC7 A;  4CSB A;  5FEN A;  1FEN A;  1Y55 X;  2FGS A;  2OZQ A;  1MX7 A;  2AL0 X;  3EW1 A;  5F6Z A;  4EXZ A;  5H8T A;  5JR8 A;  1EXS A;  1HQQ A;  1I4U A;  3KVN A;  4NV8 A;  5KID A;  1ZNH A;  3SZJ A;  2M4L A;  2RTK A;  3SOT A;  4Z2P A;  1ZNG A;  1N9Y A;  1ALB A;  1LPJ A;  1YP6 A;  1PTS A;  3P6F A;  2RA6 A;  4YDB A;  3HOL A;  3WZQ A;  1VWG B;  2JN3 A;  1VYG A;  2GH7 A;  1GKA B;  4HWM A;  1D3S A;  3UAQ A;  1BRQ A;  2A0A A;  3UEX A;  4I6S A;  2ZAG A;  4GJV A;  3VG7 A;  3PEC A;  4BVM A;  4Z2V A;  4K19 A;  4A1H A;  1NP4 A;  4GJS A;  3VHI A;  1HBQ A;  1VWM B;  5EED A;  4A1Y A;  3CKF A;  3GE2 A;  2KD2 A;  3FEK A;  2QO4 A;  1SWQ A;  3U0D A;  1SY1 A;  1LCZ A;  1ERB A;  3ZW0 B;  3QKG A;  1DZP A;  1JIW I;  4JGL A;  2OFB A;  4ORY A;  1G5W A;  4N7D A;  4GU8 A;  5BYP A;  2LB6 A;  5D8J A;  4DQ4 A;  1FE3 A;  5HZ8 A;  1JJJ A;  1KL3 A;  2IZB A;  1HY2 A;  1KOI A;  1ZNE A;  1TOU A;  2CZU A;  2ZAI A;  3SLJ A;  2IZG B;  2QOM A;  2OY1 O;  4YCH A;  1RBP A;  1KT6 A;  2IZJ A;  1JV4 A;  2AT6 X;  2RTG B;  4WFU A;  1HXZ A;  3CWK A;  2AT0 X;  3GAQ A;  5F2B A;  1SA8 A;  3RDS A;  5H9N A;  5AJB A;  5BVT A;  4CPF A;  2RCQ A;  5LJC A;  3RKG A;  2RTH B;  2OFR X;  3FDC A;  4RUU A;  5B5G A;  2FR2 A;  4CDC A;  5LJG A;  4OEM A;  5LJE A;  4O4X A;  2I5V O;  1LID A;  1OSP O;  4NNS A;  2AH7 X;  3RBY A;  1T0V A;  2DJG A;  2F01 A;  1SXW A;  2A3F X;  3WVM A;  3DSZ A;  4YVB A;  3B2L A;  2Q2P A;  2X34 A;  3BX8 A;  3PH6 A;  4IMO A;  1AEL A;  1RST B;  3NQK A;  2QO5 A;  1OEK A;  1SLF B;  2NNE A;  1CRB A;  1VWO B;  3SLT A;  4GUZ A;  4GH7 A;  1SLG B;  3JSQ A;  2RTF B;  2YG2 A;  3P6G A;  4IB7 A;  3T6F A;  3C77 X;  2AMM X;  3FIQ A;  1G74 A;  1EUO A;  1SWL A;  5KIC A;  1O1V A;  1DC9 A;  5H9K A;  4O3X B;  1TOW A;  4QGX A;  4U46 A;  4CDF A;  1DF8 A;  1SMP I;  2XST A;  3JS1 A;  5BVS A;  1TVQ A;  2G5L A;  2Q9S A;  1QWD A;  4MEE A;  2RD7 C;  1SWA A;  1XKI A;  2CZT A;  2JU7 A;  1HBP A;  2A5B A;  1GT4 A;  4KH8 A;  1CBR A;  3NX1 A;  3FA7 A;  4EQA C;  4BBO A;  1DV9 A;  3FLL A;  1JYD A;  3KFI A;  2O62 A;  4Y59 A;  4JNJ A;  4ZGU A;  3RDM A;  2FKJ A;  1ERX A;  3EYC A;  5B2A O;  1YWB A;  2OFA A;  4NYR A;  2IZK A;  1QY1 A;  2FHN X;  3FA6 A;  3QQ2 A;  3RDO A;  1H91 A;  4IAB A;  4Z27 A;  5B5F A;  1K3B A;  3VG4 A;  5AEO A;  3LV4 A;  1BEB A;  1N4J A;  3D97 A;  3F6Z B;  5FQ7 E;  3WXQ A;  1HN2 A;  4YCE A;  5H9L A;  1T68 X;  4CPE A;  2QO6 A;  1SXX A;  4YKO A;  4U8U N;  5F58 A;  1AVD A;  1NC9 A;  1NBX A;  4HPA A;  4I3D A;  4YGG A;  5K68 A;  2JU3 A;  4OKA A;  1IJ8 A;  2N93 A;  1Y52 X;  2IZI A;  3BX7 A;  3CQR A;  3T6L A;  3VPJ E;  4BGF A;  4I95 A;  1EQD A;  3AEH A;  3NBX X;  4ORW A;  3ZUO A;  5K67 A;  2FRS A;  1SRJ A;  2WEX A;  5H9A A;  4GZV A;  1MM9 A;  4TJZ A;  4QYN A;  3L4R A;  4O3W A;  4XME A;  5D47 A;  1LKE A;  4ORR A;  3AKM A;  1DZM A;  4BOE A;  4BX6 B;  1VWR B;  1OEJ A;  1G7N A;  2Q2M A;  4U9C A;  3B2K A;  2OY7 A;  3X00 A;  1PBO A;  2IZL B;  3NX2 A;  2L68 A;  4GGT A;  5AQ6 A;  1QY0 A;  2Q39 A;  1QQS A;  1SWB A;  3D9W A;  3ELZ A;  2RTJ A;  1X71 A;  1GGL A;  1A3Y A;  1OPA A;  2RCT A;  1B56 A;  2IZF B;  5HTE A;  2XKL A;  5D48 A;  2WPU A;  2RTO B;  5IO5 A;  4YFR A;  3HOE A;  2AF5 A;  1HMR A;  3ZW2 A;  1BSO A;  3MVF A;  4MIS A;  2LFO A;  1VWK B;  1E2T A;  2NP1 A;  3ZUI A;  1X8Q A;  3ZW0 A;  4D6B A;  1NGL A;  1SWJ A;  2KW1 A;  4TKH A;  5IRA A;  2RTE B;  5L8O A;  1GM6 A;  2NNQ A;  3WYP A;  3S5X A;  1BSY A;  2K62 A; 
#chains in the Genus database with same CATH homology
 4OS8 A;  3JQO A;  4TNN A;  1KT7 A;  3NAD A;  4KC8 A;  1GT1 A;  1N0S A;  3BDR A;  4PSQ A;  1BWY A;  4WBK A;  1D2U A;  4GDZ A;  1IKE A;  5FAZ A;  4FGI B;  3RZY A;  3WOV A;  3NQ3 A;  3WJE A;  4NW4 A;  3TGC A;  1QG5 A;  3UEU A;  3WJG A;  1JJX A;  2X46 A;  1U0X A;  1BJ7 A;  4OMX A;  4GNY A;  4AZR A;  5HTD A;  4Y0S A;  1Z24 A;  5F6B A;  1QFT A;  1EW3 A;  2R56 A;  1MUP A;  4KCA A;  1LIC A;  5HZQ A;  3FR5 A;  2Z4I A;  4AZM A;  1ADL A;  5AJC A;  3EBW A;  4ZR2 A;  2F09 A;  2R74 A;  4HFO A;  4ORU A;  2OVD A;  1VYF A;  3PPT A;  5L8N A;  4A8Z A;  3ZQ3 A;  1UZ2 X;  2OVS A;  2Z4H A;  3B2H A;  4YGH A;  4ZHC A;  5HZ6 A;  2OVA A;  3BRN A;  3P24 A;  3WJF A;  5HBS A;  4HPB A;  3ZW1 B;  1IFC A;  2POA A;  1BBP A;  5HZ9 A;  1YWC A;  3MBT A;  3CBC A;  1EPA A;  5EDC A;  3O2Y A;  1X8O A;  4OS0 A;  2LBV A;  1DZJ A;  2X8S A;  1QFV A;  1YWD A;  3N91 A;  3MX7 A;  3HTY A;  4XMC A;  3TF6 A;  1CJ5 A;  1ICM A;  3FW4 A;  1ZNK A;  3P6C A;  1Y9T A;  1NP1 A;  4HPC A;  2X8F A;  5IO7 A;  1SY2 A;  2LA7 A;  3C76 X;  4O3Y A;  2GTL M;  3VG3 A;  4TQ2 A;  1A18 A;  4LZU A;  4INN A;  3FA9 A;  3STN A;  5IO6 A;  3ZI8 A;  1LFO A;  3FEL A;  1E00 A;  4QRL A;  1QAB E;  1KT5 A;  2Q4N A;  5DPQ A;  1GX9 A;  1DFV A;  1IW2 A;  3S5V A;  3G7X A;  4TKJ A;  4FQB B;  2PY1 A;  4A60 A;  4WHI A;  1GXA A;  1OBP A;  1CBI A;  3TGB A;  1PM1 X;  1S44 A;  1SXY A;  1GT3 A;  5EEE A;  4ZHF A;  5K06 A;  1MDC A;  4GRJ A;  3VE1 A;  2ANS A;  1ZND A;  2CM9 A;  4QNI A;  5CE4 A;  1EPB A;  4D6A A;  1FTP A;  2E4J A;  4GKC A;  4ZCB A;  1LIE A;  1DF3 A;  1HQP A;  5HCD C;  2FS7 A;  1X8N A;  3F8A A;  2L9C A;  2OFM X;  3HWG A;  4FBV A;  3VG6 A;  3WJB A;  3BU9 A;  3Q6L A;  4YFQ A;  5BVQ A;  3IA8 A;  4Y0P A;  5CYB A;  3APW A;  4I9R A;  3O22 A;  1GX8 A;  1YWA A;  1MVG A;  1OBQ A;  3D4R A;  1XCA A;  4L3R A;  4QZT A;  4RUN A;  4LQZ A;  5D45 A;  5KHP A;  4BQU A;  4I3B A;  1FEL A;  1IFB A;  1S7D A;  1G85 A;  4WFV A;  2A2U A;  1SXU A;  4DQ3 A;  4PJ2 A;  5FQ8 E;  1E06 A;  3VG2 A;  1GKA A;  2FLJ A;  2QM9 A;  4MIR A;  4GET A;  1R0U A;  1S2P A;  4ZGF A;  1LF7 A;  5L8I A;  4EFG A;  3KFF A;  1LNM A;  4OS3 A;  5C0N A;  4U8U O;  2GC9 A;  2LBA A;  5HA1 A;  3S60 A;  1QY2 A;  4XMF A;  3KQ0 A;  2QOS C;  5EDB A;  2L67 A;  2AT8 X;  4QQ1 A;  5B29 A;  3U03 A;  2WEW A;  3APV A;  5LKF A;  2X8T A;  2WWP A;  2MJI A;  2AKQ A;  4QYP A;  1OEE A;  3TZS A;  1E02 A;  4YMY A;  1B0O A;  4O4O A;  2CBR A;  1YUP A;  3PQS A;  4QGW A;  4IAW A;  4CV7 A;  1ZNL A;  2W2B A;  5EZ2 A;  3FEP A;  1X89 A;  1KGL A;  2WSJ A;  1I06 A;  4YKM A;  4FBO A;  1TW4 A;  3E3C A;  1YIV A;  3KFG A;  3NP1 A;  3P6D A;  4XMD A;  1E5P A;  2YMS A;  1PEE A;  1ZRY A;  2ACP X;  3PP6 A;  3C78 X;  4LKT A;  3HWF A;  1HMS A;  4YBU A;  3OJY C;  3FA8 A;  2MHD A;  4TLJ A;  2HMB A;  2CBS A;  4AW8 A;  1EAL A;  1A57 A;  3HK1 A;  2WQ9 A;  1U17 A;  5F1E A;  5B27 A;  4GK9 A;  3KZA A;  4LZV A;  2ACO A;  5HAE A;  3F9D A;  4NLI A;  4XMH A;  1PMP A;  2X45 A;  2FR3 A;  4ALB A;  1I04 A;  1URE A;  1A2D A;  4ZH9 A;  2RN4 A;  5HCE C;  3I17 A;  4IBA A;  2HZQ A;  2WUT A;  2AT5 X;  5LJH A;  3FR4 A;  3CR6 A;  4NLJ A;  2A2G A;  2GJ5 A;  3I0A A;  3CMP A;  3STK A;  2JMB A;  3APX A;  3ZZV A;  5LJB A;  3APU A;  2LKK A;  4U8U M;  3UEV A;  4UU2 A;  2A13 A;  4I3C A;  4ODD A;  3RWX A;  3STM X;  1AQB A;  2R73 A;  3T1D A;  3VG5 A;  3IFB A;  1KXO A;  2BHV A;  3P6E A;  1BSQ A;  4COT A;  4UU3 A;  2WQA E;  1CBQ A;  3BSZ E;  1ML7 A;  1I05 A;  3D96 A;  4ON1 A;  5HWZ A;  5DG4 A;  4GNW A;  3PED A;  4HPD A;  1ACD A;  4AZP A;  1JZU A;  5HZ5 A;  3CBS A;  4ZHG A;  1OBU A;  4ORX A;  3NQ9 A;  5LKE A;  1B8E A;  3BS2 A;  4YBP A;  1FEM A;  3OD9 A;  1L6M A;  3P6H A;  4N7C A;  4QAE A;  1TXL A;  1JYJ A;  3EMM A;  4ZHH A;  4AZO A;  3AKN A;  1IIU A;  5EPQ A;  4ALO A;  2L5P A;  2W2F A;  2AT3 X;  3OBL A;  3O19 A;  1BRP A;  4ML7 B;  1EIO A;  1RLB E;  1X8U A;  2KTS A;  3BLG A;  1GT5 A;  3PH5 A;  1Y9L A;  4AZN A;  4NNT A;  1X8P A;  1P6P A;  4ZFX A;  3V8U A;  4ARH A;  2JOZ A;  2FT9 A;  4O49 A;  1YP7 A;  3WJC A;  3VE2 A;  4QGV A;  4OMW A;  4CK4 A;  1VPR A;  4U3Q A;  3FW5 A;  4YGZ A;  2F73 A;  3PQU A;  2G79 A;  3HWE A;  3D95 A;  2GTF X;  2ASN X;  2JW1 A;  2EU7 X;  4YFP A;  4EDE A;  3NR3 A;  4XMG A;  4NP1 A;  2MO5 A;  2P8G A;  1LIB A;  1AVG I;  5LJD A;  3B2J A;  2BS6 A;  4I9S A;  3WBG A;  2W2A A;  2FWV A;  1JBH A;  2K23 A;  2BLG A;  3DTQ A;  5FFH A;  1IKJ A;  3S26 A;  1OPB A;  5LJK A;  5FQ6 E;  2WR6 A;  3K3L A;  4GE1 A;  3TGA A;  3VU1 A;  4FBR A;  4MVE A;  1HMT A;  2JU8 A;  4Y0Q A;  4O9S A;  3BY0 A;  2DM5 A;  3WJD A;  3FYF A;  4ES7 A;  4IMN A;  1CBS A;  2FTB A;  4L1N A;  4ZH6 A;  4ZHD A;  2MWH A;  3ELX A;  2KTD A;  3U9P C;  1B4M A;  4MVK A;  4EEJ A;  3LHN A;  1FDQ A;  4IB8 A;  4KT5 A;  4M7M A;  2RQ0 A;  1EI5 A;  2HLV A;  3ZW1 A;  2GTL N;  4YH0 A;  4QZU A;  4ID2 A;  4MVL A;  4TKB A;  1KT4 A;  4AZQ A;  3RSW A;  1DZK A;  2HNX A;  1KZX A;  3EM0 A;  4NYQ A;  4MVI A;  4Y0R A;  2BT9 A;  3ZWE A;  4LKP A;  5HCC C;  2G78 A;  3EBK A;  3NPO A;  1BM5 A;  2CM4 A;  4ORS A;  2HZR A;  2OVE A;  3FR2 A;  5D4A A;  2IFB A;  5F7G A;  1KZW A;  2KT4 B;  1EII A;  3H3I A;  4IAX A;  4IB6 A;  1KT3 A;  1KQW A;  3SAO A;  3OE3 A;  2HYS A;  4R0B A;  4IB9 A;  1MX8 A;  2MM3 A;  1T8V A;  4KII A;  1AB0 A;  2NND A;  3B2I A;  3FEN A;  4O4S A;  4O3Z A;  1SY0 A;  2FS6 A;  3FMZ A;  1KQX A;  2QMI A;  3UEW A;  3CQN A;  5HA0 A;  1O8V A;  4O4U A;  2GTL O;  4M6S A;  1U18 A;  4AYH A;  1O1U A;  2G7B A;  3KFH A;  2BS5 A;  4ZJ0 A;  1SY3 A;  4YDA A;  1ICN A;  1LIF A;  2ALL X;  3BU1 A;  3HWD A;  3P02 A;  4KC7 A;  4CSB A;  5FEN A;  1FEN A;  5JR8 A;  2OZQ A;  1MX7 A;  2AL0 X;  5F6Z A;  4EXZ A;  5KID A;  5H8T A;  1EXS A;  1I4U A;  1ZNH A;  2M4L A;  3SOT A;  1ZNG A;  1ALB A;  1LPJ A;  1YP6 A;  3P6F A;  4YDB A;  2RA6 A;  3HOL A;  2JN3 A;  1VYG A;  1GKA B;  4HWM A;  1D3S A;  3UAQ A;  1BRQ A;  2A0A A;  3UEX A;  4I6S A;  2ZAG A;  3VG7 A;  4BVM A;  3PEC A;  4K19 A;  4A1H A;  1NP4 A;  1HBQ A;  4A1Y A;  5EED A;  3GE2 A;  2KD2 A;  3FEK A;  2QO4 A;  3U0D A;  1SY1 A;  1ERB A;  3ZW0 B;  3QKG A;  1DZP A;  1JIW I;  4JGL A;  4ORY A;  1G5W A;  4N7D A;  4GU8 A;  5BYP A;  2LB6 A;  5D8J A;  4DQ4 A;  1FE3 A;  5HZ8 A;  1JJJ A;  2ZAI A;  1KOI A;  1ZNE A;  2CZU A;  1TOU A;  1BLR A;  4YCH A;  1RBP A;  1KT6 A;  1JV4 A;  2AT6 X;  4WFU A;  3CWK A;  2AT0 X;  3GAQ A;  1SA8 A;  5H9N A;  5AJB A;  5BVT A;  5LJC A;  2RCQ A;  3RKG A;  2OFR X;  4RUU A;  5LJE A;  2FR2 A;  5LJG A;  4O4X A;  2AH7 X;  1LID A;  3RBY A;  4NNS A;  1T0V A;  1SXW A;  2A3F X;  3WVM A;  3DSZ A;  3B2L A;  2Q2P A;  3BX8 A;  3PH6 A;  4IMO A;  1AEL A;  3NQK A;  2QO5 A;  1OEK A;  2NNE A;  1CRB A;  4GH7 A;  3JSQ A;  2YG2 A;  4IB7 A;  3P6G A;  3C77 X;  2AMM X;  3FIQ A;  1G74 A;  1EUO A;  5KIC A;  1O1V A;  1DC9 A;  5H9K A;  4O3X B;  1TOW A;  4QGX A;  1SMP I;  2XST A;  3JS1 A;  5BVS A;  1TVQ A;  2Q9S A;  1QWD A;  2RD7 C;  1XKI A;  2CZT A;  2JU7 A;  1HBP A;  1GT4 A;  4KH8 A;  1CBR A;  3NX1 A;  3FA7 A;  4EQA C;  1DV9 A;  3FLL A;  1JYD A;  3KFI A;  2O62 A;  4ZGU A;  1ERX A;  3EYC A;  1YWB A;  4NYR A;  1QY1 A;  3FA6 A;  1H91 A;  4IAB A;  3VG4 A;  5AEO A;  3LV4 A;  1BEB A;  3D97 A;  3F6Z B;  5FQ7 E;  3WXQ A;  1HN2 A;  4YCE A;  5H9L A;  1T68 X;  2QO6 A;  1SXX A;  4YKO A;  4U8U N;  5F58 A;  4HPA A;  4I3D A;  4YGG A;  2JU3 A;  2N93 A;  3BX7 A;  3CQR A;  3VPJ E;  4I95 A;  1EQD A;  4ORW A;  3NBX X;  3ZUO A;  2FRS A;  2WEX A;  5H9A A;  4GZV A;  4TJZ A;  4QYN A;  3L4R A;  4O3W A;  4XME A;  5D47 A;  1LKE A;  4ORR A;  3AKM A;  1DZM A;  4BOE A;  1OEJ A;  1G7N A;  2Q2M A;  4U9C A;  3B2K A;  1PBO A;  3NX2 A;  2L68 A;  5AQ6 A;  1QY0 A;  2Q39 A;  1QQS A;  3ELZ A;  1X71 A;  1GGL A;  1A3Y A;  1OPA A;  2RCT A;  1B56 A;  5HTE A;  2XKL A;  5D48 A;  5IO5 A;  4YFR A;  3HOE A;  3ZW2 A;  1HMR A;  1BSO A;  3MVF A;  4MIS A;  2LFO A;  3ZUI A;  2NP1 A;  3ZW0 A;  1X8Q A;  4D6B A;  1NGL A;  2KW1 A;  4TKH A;  5L8O A;  1GM6 A;  2NNQ A;  3S5X A;  1BSY A;  2K62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...