3NP4A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np4A00
2VN3A 2ZWNA 1GS8A 3BVDB 3X2QB 1N68A 3CG8A 1FA4A 2HX7A 3AG3B 1RKRA 3UABA 1ILSA 4AX3A 1ZV2A 2QDWA 4YSUA 1MZYA 2H47C 1NIAA 3MBWB 3IBOA 3ZX1A 3NJNA 1SDDB 1JVLA 3ZIYA 3NJLA 1NPNA 2UXVA 3CZUB 1WS8A 4G70B 2GC4C 4A2FA 3NJMA 1ZPUA 4BXVA 4E9XA 3DIVA 4QLWA 1A4CA 1JVOA 1R1CA 3UAAA 1ET7A 4A66A 5B1JC 4YVUA 2N0MA 2XVBA 4G72B 2R7EB 3S8FB 3WNJA 1OCCB 4A2HA 2AANA 3NSCA 4W1TA 2DYRB 5F7AA 4BWWA 1JZFA 1BYOA 1J9QA 4DPCX 4UAHA 3X1FA 2UX6A 1AZRA 5PAZA 3JT2A 3V9EA 4M4RB 2TSBA 1HAWA 1KDJA 1UATA 4JKNA 3FU8A 2XYBA 4AKOA 2HRGA 2EIKB 3FYEB 2I7OA 3NJJA 4JHUA 3D12B 4BDVB 2IH9A 4YSAA 4TXVB 5I28A 4L0PB 1OOWA 1XB6A 4BWUA 2UX7A 1BXUA 2X88A 1TKWA 1JXGA 2EIMB 2FQGA 1NIDA 4QKTA 1A4AA 2OCCB 2DY2A 2JXMA 1OE2A 3EH5B 2XV2A 1E30A 1E67A 3FQ1A 1AQ8A 3CDZA 1ASQA 3TBCA 3S3DB 1GYCA 1BXVA 3PCYA 3PAZA 5B1KA 3WKQA 3FPXA 3NJGA 2Y1AA 4Q89A 1A3ZA 2PP7A 1B3IA 2LLNA 4KOCA 4UF7C 1AACA 2XU9A 2AZUA 3WKPA 4PAZA 2PCYA 4A68A 3G5WA 3GXUB 1EHKB 4N4YB 4DP0X 1BEXA 1V54B 1GY2A 4DP2X 5I6OA 1AIZA 1ID2A 2CAKA 2IWFA 4NERA 4YSPA 5IY5B 1AOZA 4A2DA 1PZAA 3V9CA 1T5KA 1MG2C 3JTBA 2HLEB 2XWZA 2QT6A 5B1JA 1ZDQA 4KO6A 1IBYA 1DYZA 2A3TA 1NIBA 3WG7B 3AY2A 2IDUA 2FT6A 1F56A 4E9TA 2BWIA 4YSCA 2XV0A 3T6ZA 2BWDA 3MX0B 1J5DA 2Q9OA 2XXGA 4Q8BA 1URIA 1TEFA 3NJIA 4K9JA 2H3XC 4WTQA 5B7FA 3C75A 4DP9X 2PPEA 1V10A 2XUWA 4E9YA 3QJUB 3WNIA 1DZ0A 2CCWA 1ASPA 3IEAA 4AKPA 3QJVB 5FC9A 2HRHA 1MDAA 4HCGA 4HZ1A 2GB2A 1ILUA 2P80A 4YSTA 2BP0A 3FU7B 2J55A 1SJMA 1CC3A 1PLBA 2YQBA 3KW8A 3NT0A 2FT7A 4HHGA 1AZBA 2I85A 2GIMA 3ABGA 4FA7B 2FWLB 3FU7A 3IE9A 2VSKB 4PCYA 3DTUB 5I6LA 3OD3A 4YVNA 1JXFA 1XB8A 3FSVA 3AG1B 1GS7A 4DPAX 1SDDA 5PCYA 1JERA 1ZIAA 2OV0A 3AG2B 1L9OA 2XX1A 4E9VA 3H56A 2GHZA 3S3CB 1M56B 2HX9A 3BQVA 1CURA 3ASOB 2J57A 3QJQB 3UAEA 2FQEA 1CYXA 4GYBA 1WAEA 4E9QA 1JXDA 4ENZA 2FQDA 2R7EA 3FPYA 3QJSB 1GY1A 1QLEB 4P5SA 1SF3A 1PAZA 2I7SA 1TU2A 2XLLA 2IAAC 1JZHA 1J9RA 2VM4A 2FJSA 4KNUA 1NZRA 3H4FA 3NSFA 2PCFA 1WA0X 4HHWA 1AAJA 2QPDB 2YXWA 3OM3B 2YAFA 4G7SB 1PLCA 2TSAA 1E65A 1AS7A 5I26A 1TEGA 4W9ZA 3FSWA 1NIFA 2UXFA 2P80D 1ETJA 4KO9A 4BDVA 1JZIA 1PNCA 4KO5A 2FTAA 1OE1A 2Y69B 1NWOA 3NYKA 2ZONA 2VSMB 1KCWA 3TBBA 1QNIA 1ZDSA 5D4JA 1JZEA 1CYWA 3L45A 3TASA 4YSDA 2BW5A 3EH3B 3ABKB 3FS9A 2XXFA 3X1GA 3QJTB 3NJHA 2IDSA 4YL4A 1IC0A 2YAOA 6PAZA 1NPJA 2FQFA 2AFNA 5AFAA 2HX8A 3T9WA 2FNWA 3GDCA 1ET8A 1BAWA 2YAEA 2YAQA 2FT8A 1RZPA 5D4IA 4RH4A 1XMEB 1JZJA 1FWXA 3OMIB 5TK2A 4DP1X 2CJ3A 3AZUA 5I5MA 4KNTA 5AKRA 2EILB 4KO7A 3IN0A 1KYAA 4AZUA 3ASNB 2BZCA 2YARA 1RZQA 3WI9A 2OJ1A 1OF0A 3FT0A 5B7EA 2B3IA 3GYRA 2AVFA 1NWPA 2AZAA 7PCYA 4HALA 1X9RA 1WA2X 2J5WA 1PCSA 1AR1B 4DP8X 5EHFA 3QPKA 3PXLA 2J56A 5LDUA 3RYMA 1J9TA 1L9QA 1J5CA 2E86A 2HXAA 2JKWA 3X1BA 5E9NA 1PLAA 3FU9A 4HAKA 4P5RA 5I6NA 1J9SA 1L9SA 1NDTA 3ERXA 4E9RA 3KW7A 4EF3A 1KBWA 2YAHA 2VM3A 2MTAA 2IH8A 3FSZA 4NAJA 5I6PA 3U25A 3FSAA 4GP5B 3HEIB 3SQRA 1E5ZA 1JOIA 4CSPA 3T6WA 1W8EA 1X9UA 2CUAA 2XV3A 1MZZA 4E9WA 3CVBA 1I53A 2DWSA 4CSZA 4YSEA 1OCZB 2DV6A 4UANA 1IKOP 1FFTB 2BO0A 1N70A 3NSYA 2HZHA 1KV7A 1KCBA 2UXTA 2VMJA 3PLYA 4BWTA 2Q5BA 2PP9A 1BXAA 3DKHA 1IBZA 1NIEA 5F7BA 3UGEA 4A67A 1AANA 2XX0A 2UXGA 2JFCA 4GXFA 1WS7A 3NJKA 4DP7X 3QQXA 4A2GA 4KOBA 1GS6X 4YSOA 1AZCA 2ZXWB 2GBAA 5AZUA 2NRDA 1M9WA 3CVDA 2VW6A 8PAZA 3H4HA 3UACA 5B3SB 1PZCA 2VW7A 1CUOA 3TA4D 1AG6A 3PAVA 1OE3A 1SF5A 4NB7A 3OQRA 2GI0A 3N2JA 1GR7A 1KBVA 4FAAB 3FQ2A 1XB3A 2BW4A 1HAUA 2EINB 2QPEB 1SHXA 2VW4A 1NICA 1ASOA 1E5YA 1OCRB 2ZOOA 3NP3A 6PCYA 5ANHA 2IDTA 2BZ7A 4GP8B 5D4HA 4F2FA 3TU6A 1L9RA 2PP8A 3IN2A 3S8GB 1EZLA 3EH4B 4N8UA 3T6VA 4YSRA 2CBPA 1SNRA 1BYPA 1ET5A 1SFHA 2BHFA 3ABLB 1A65A 3PAUA 4DPBX 3T71A 2GC7C 4HCIA 2EIJB 4YSQA 1A8ZA 3T6XA 1PZBA 1V55B 1ADWA 2IDFA 3ZBMA 2QDVA 2CALA 3QJRB 2GSMB 1AS8A 4F7KA 4E9SA 1PMYA 3N55A 3CDZB 3FQYA 5B1AB 1W6WA 1NINA 4BK5C 3SBRA 4YSSA 4WKXA 3AW5A 3NP4A 1JZGA 5B1BB 2YAMA 1RCYA 3EHBB 4JHVA 4G71B 1ZIBA 1AS6A 3CVCA 3X1NA 1GW0A 1SHWA 1M57B 9PCYA 2DYSB 2WO2B 2PPFA 2PPCA 4G7QB 2YXVA 1HFUA 2WO3B 5I5IA 3EF4A 1BQ5A 3WIAA 1AZUA 1BQKA 2W88A 4KNSA 4MFHA 1BQRA 1AZNA 2PPDA 4HCFA 4HIPA 4A2EA 2BP8B 2PLTA 4X4KA 1WA1X 2H5UA 3NJFA 2DWTA 5B7MA 1L9PA 4GP4B 1L9TA 4AI7A 3NSDA 3SBQA 5I6KA 3ZDWA 3OMNB 1MG3C 1OCOB 1SFDA 4G7RB 2BP8A 1VLXA 3OMAB 4ZK8A 3S3BB 2PPAA 3UADA 4GY4A 7PAZA 5I5JA 3SBPA 2IWEA 2B08A 2W8CA 3AG4B 4F2EA 3ABMB 2MRYA 3X1EA 1PNDA 4DP4X 4DP6X 4M3HA 2IWKA 1AG0A 5A7EA 3PPSA 1GSKA 1YLBB 4BXSV 1KDIA 5TK4A 2IDQA 1PY0A 2YAPA 1OV8A 3FYIB 1PF3A 1QHQA 1KGYE 5I6MA 1IUZA 1NTDA 2BP0B 1A4BA 2WSDA 4DP5X 2RACA 3HB3B 1W6LA 4AKQA 2X87A
chains in the Genus database with same CATH superfamily
4JPKL 5K9KB 5DURB 3O3BA 3SJVA 3DRQA 2WOBA 1UYWL 3GLDA 2FBOJ 2OW7A 2WP3O 5HY9A 4BZ2H 1CL7I 3QUKB 3PDGA 3W3BA 3T1FB 3RGVC 1E3XA 1RUQL 3O6KL 3HR5B 2NZ9D 1ZVYA 1IJ9A 3I50H 2FWUA 4YFLI 4Y4KD 4POZD 4G70B 3BP7B 1J8HA 2F1EA 3GIVA 1ZANL 1R1CA 4U33A 4KRNA 1ZA3B 3NRQA 3T0EA 3LZLA 4YEEA 1Q9WA 3HZKA 2WB7A 3W0WD 3QUYC 5BRQA 3ZKMC 2R2EB 5EO0A 4IEFA 4UAHA 1PZDA 4PN6A 3S96A 4XCYA 1UVQB 1KDJA 3RFZC 4PW4A 4H8HA 3BAKA 2AJYL 2DQIL 2QKSA 4QI3A 2CIKB 4X2UA 3Q2VA 4FQQA 3ZHNA 5LCVA 3VYOA 2HRGA 1JGEB 2QGCA 1NFDA 4XOAA 3AQZA 5IKCA 3I2CH 1FFOA 3L1EA 4CGTA 3OKYA 4FEMA 1KLUA 3A6BH 5CLWA 3WTTA 1D7BA 4PGDB 4FQJL 5IR1B 1XB6A 2L7JA 4DN4L 1JXGA 2Y9RT 3T65B 4PG9A 5EU6E 1K4CB 1E4JA 1XDTT 4F20A 3DUSB 3A6CL 4RGOH 2EYSB 4XBGB 1E67A 2EDBA 4XNZB 2D9CA 4Y2DC 4D0CA 2QQKH 4WKZA 3NZHH 1FVCA 2R69A 3GNML 2XG5A 5TFSL 4R5VA 5B1CA 5C0BE 3UPCA 3R06B 4YLQT 4OGXH 3GBNH 3S9DB 1U8LA 2G4GA 3CSPA 5H8DA 2DQFA 3VXTA 3IWVA 2AV7A 3UCQA 1TZGH 1U8CA 4NKIH 2OMVA 1PX8A 2NR6C 2ZCLH 5DHVB 1Z5LB 1RZJH 4TSBL 4YC2B 2BIOA 2CDFA 2Z31D 3VFNA 3BD3A 4DGYL 5IJVA 2XA8L 5HHVL 4DP2X 2XZAL 4LIQH 1ID2A 4QHLA 2CAKA 4OJFH 5FYKU 3RWGA 3K0YA 3ZDZB 4AM0B 2FUTA 3ET9F 3BYYA 3DX7B 5KAQF 1AOZA 1U92A 2HVJA 1EAJA 2Z7WA 5EA0H 3SB3A 2OR9L 1XR9A 2H0PA 3VB8A 2QT6A 3BISA 1KCUL 1AJ7H 1JV5B 2ORBH 1TJIL 4P3DA 5E1GA 5M95B 2VT0A 4Y5VB 5EOCJ 1QATA 1UA6H 4N9GB 1W9XA 3H42L 5EU6D 4JO4L 4RMSA 5GGQH 3MV7B 2W0FA 1JF1A 1MFCL 4FMVA 2BWDA 5HI3C 3LQAH 3S5LB 5K39A 4Q74A 5SWSA 1TTRA 2KERA 1OIOA 4AEFA 3S3PA 2PPEA 1UD6A 3FTUA 2VXUL 5C0BD 1II4E 3TO2A 4E9YA 2X0VA 4X4XA 3PIQA 4OLWH 3BQUD 1YNTF 1P84K 3G6JB 4WWOA 4JB9L 3V4PH 4WU5A 4ZQTA 2NYYC 3QUXD 3JYBA 3QQDB 5DR5H 4AKPA 3UTZA 5GGVL 3MGOB 4NP4H 1MCBA 4IKJA 2XZQH 1MJJB 2ZT9C 3MRMA 4C83A 3VX1A 3GMRA 4MQSB 4U0QB 2XIBA 3TZVB 1CGSH 1PKQA 3GZOA 2DLIA 4GNKB 1C9SA 3LKRA 5BXFA 2R56H 1CLOL 1AO7B 4Z7WE 4YC2C 1MI5E 3FB7B 5DD6B 5AYUL 2OQJB 3X13B 1KIQA 1C5DA 2VSKB 4JHAL 1NBYB 5IUCA 3OD3A 3D69A 4MNHB 5MEQB 1XB8A 3ARGD 4NUGL 2G60L 3FAXA 1GS7A 3MR9A 3HR6A 1URLA 3IB4A 4N1EA 1QUPA 1BSIA 1G7QB 1XIWB 2QVKA 2VQ1B 2WXRA 3H56A 3IAPA 3GTTA 3QPXH 5CCKH 2PF6A 2DQJL 5K9QG 1LDPH 1PZSA 2PO6B 1CYXA 1QBAA 1UCBL 1XCTB 4MHHG 3OZ9H 1FNEA 4LOUC 4PJIB 3GSOB 5AW8B 2WBXA 2F61A 4NO5B 1TTBA 3MCLL 1YN7A 3OBAA 1QPKA 5LBSH 1Q0EA 5ID1A 1WF5A 5EFIB 1CFQB 1PAZA 1TU2A 5F72S 4WFEE 1JZHA 3FQTB 1AY1H 1WA0X 4MA3A 3U1QA 1YEJL 4FF9A 4XP1H 4G7SB 5GRJL 3NBNA 4J8RB 4BKTC 2VZUA 4NQDB 5I76A 1O7VA 4PJ7F 3VJ6B 3TJEH 1HEZB 4WTWA 5D96B 1KJ2L 3SOBL 3ESOA 5IT2L 4MJ6A 4XP6L 1MI5D 2UZXA 4JPQA 3M45A 4WO0A 2BSEA 4QRRB 2KI6A 5GRUH 3D0VB 1TTCA 3EGXA 4AV0A 1MF2H 2IDSA 4FA6A 4L9LB 2YUXA 1SVCP 2N1TE 2V5RA 4HT1L 5I0WA 2P7TB 4PP2B 1SY6A 3OGOE 2F6AA 3QC5X 4AIEA 2HTKC 4ZUWA 5HJDA 3S35X 4X99B 3TEUA 3MV8A 5CBEA 5CEXA 2EDNA 3L4UA 5AW0B 5AG8A 2AJVH 3LYRA 3M1BA 3OMIB 2ZICA 2E9BA 2FSDA 2C9RA 2R27A 1XIWC 3BSHA 2WKOF 3HFMH 4WCYH 4KO7A 3VWJA 1A8JH 1KN2L 3TWYA 3NCEB 2BP3A 4APXA 4NN7B 5GJTL 5B7EA 5MEOA 4LE8A 4WFED 5H94A 5C08A 1HS6A 3JV4B 2HH0L 1MQ8A 5IHZB 2CH8A 2AVFA 4QYAA 4FADA 3FCSB 3E38A 4HALA 4DP8X 3D25B 4XXWA 2K3HA 3HZVA 4PJGB 5D7SH 1DBAL 3EOTH 4ONFH 1KCKA 3UDWC 4F33A 3L2LA 3C8KA 4Z7NF 1T21A 3U0PB 5IROD 5A2JH 4KV5E 2YMTA 3QO1B 5T3XE 5HPMA 4YGAB 3QXUA 1RIVH 1U4FA 4G1MB 5E6RB 1SDYA 3I6LE 4Q4IA 5D96C 1KB5B 3U25A 3CSYA 4UNUA 5LNGA 3JUYA 2Q6WB 1ZLEA 1PG7L 5F7MC 2DM4A 5H37H 4HPOH 4KKZA 3Q48A 2YPLB 2R1XB 5BMFL 4XAKE 5EO9B 1KCSL 4L9LC 1JI2A 4Z0XB 1IGIH 4L8CA 5GZOA 5JYLA 3NRFA 1FDLL 2E6PA 1E7VA 2VLJB 3ECUA 4H5SB 1R46A 2ICWJ 3GXTA 4KK6C 3ROLB 4DO5A 4NWTH 4UTBL 3FBKA 3RAJH 1GOFA 1AGDB 4I88A 3QO0B 2QADD 1IBZA 2VDRH 5TE7H 2WLJA 2AI0H 1FZMA 3EJQA 4F3FA 3N42B 1JTOA 1BLNA 2W80C 4NUJA 4PJ5B 5IVZB 4Y9EA 2HN7A 4GXFA 4F58L 2J20A 1A1MA 4JZJB 1HSBA 3ATBA 2ATPB 3NA4A 5KSAD 4PV9B 4K07A 5AOLA 2P5WA 3K2IA 4FN0A 4N24A 1UJ3A 2NRDA 1R5WA 1FNAA 4NN7C 5KVEL 5HP5A 1MHHB 1BJ1H 3HNSL 2VW6A 4RVBA 4FNLH 5EU4B 4PJ9A 5AUMB 5GJSH 3V7AE 5T5NF 3VUAA 4Z7VA 1DVQA 5B3SB 3IGLA 2V5SA 4HWUA 3IXTB 4WWPA 1XH1A 4Q6KA 5T3XD 4O51A 3MZTA 1IT9L 3B5HA 4IRZA 1KELH 3H85A 3TWCL 1RULL 1SLWA 4ZDHB 1A3LH 4OF7A 1HZKA 3I6LD 4GW4B 3V5KA 2ITEA 3VGFA 1UENA 4BKLB 3C9NB 2CIIB 2BWQA 3DROA 5I1AA 5TDPB 4R7NB 3L9RA 2IOOA 1UD4A 2G0LA 5F7NC 5HHOA 4Z3IA 4GKNB 1E9PB 1QFWL 4XAKD 1CTOA 4BELD 3HLKA 1C12A 1A9EA 1JFQH 1N4XH 1ZLSH 4OGAC 4BRJA 4ZNCD 4N2IA 2GSGA 4ELMA 1AP2B 2WK2A 4JPVL 3STLA 4IJTA 1ND0A 2ZXGA 4NQEE 2I27N 3F83A 1IFHH 3BW9B 4MAYD 4U1MB 3ZKQD 4YUEH 1ADWA 4J3OC 3PNWA 2ZP0T 4XPTH 4NYLB 4IGBC 5FB8A 4ANKA 3FQRA 5TPWL 1AR2A 5JXAL 1LYQA 3F5WA 2QMKA 2ZXBA 4GUCA 3UMNA 5IWLA 3QUMH 3EH1A 3MOBH 2CO4A 4FQCH 4CRPA 4DKTA 1ZJBA 2J12B 3L2MA 2WQAA 1HXYA 2VLRE 1INDH 4N2NA 2FEDC 2QEJA 2HG0A 4DZ8B 3IVKA 2C7UA 2NNXA 3MACL 4OFDA 2ED9A 5E0QA 2XTSA 2Q8AL 3VRJB 5LBSA 4JQIH 3B8YA 5HHXL 1LE5B 5FW6A 1HU8A 1EXGA 3CBKB 2VH5L 1QSFE 5A2KH 1JG9A 1LEKA 5IGXL 4LESA 1XGTB 2XN2A 4ADIA 3MA7A 1CDYA 4BZ1H 3QS2A 1FG2B 4HGWA 2PW2A 4NUPA 5DJYB 4AIZB 1KEGL 1E9OA 2WWMC 1WE5A 5J12B 3JVFC 3BUBA 2VC2B 1UM5L 5IHUL 1TQWA 3Q8BA 4JM2F 1CF8H 4X4ZA 2KDGA 3FONA 3L3GB 4NQED 3NSJA 3BEWA 4XMUA 3GPEA 1CF1A 4J8QA 3CDFA 2XV6B 3NJFA 2XCMC 4AI7A 5I18L 4WGKA 1CD0A 4OFPA 1IEAB 5EC1B 2ARJQ 2GIXA 2VLRD 3C5JA 2OYMA 2Z65C 3FFOA 4FQ1H 3QG7L 5D71L 1PD0A 1MQKH 4IRJB 1YY9D 3HS9A 2DJMA 5D9SA 3DRTA 4U4IA 1RPKA 1SYSA 2Y7LA 4F1ZA 2VISA 4XE5B 3FNKA 5C0DB 1A6UL 3BXNA 4A7GF 3FO9B 3HZMA 3EO0B 4XNAA 4LPUA 1ORQA 1QSFD 4Y4FA 3BLBA 2AC0A 3OB0K 1K8IA 4PV8B 1GSKA 1ZTXL 5T3ZL 3VFVB 4QHMA 4RFNB 1XXFC 1XVSA 3W2DH 1QUNB 2MHAA 2O4EA 2YAPA 4A39A 3TT3H 1M2VB 1WBZB 2JKRM 2VDOB 1H3XA 2BCMA 1A4BA 2F7PA 3VACA 2RACA 4XWOD 3EJUA 3DHPA 4AGQA 1IM3D 2JI1A 5I8EA 3JWDC 3RHWF 3WUWB 4GUPA 4WNQA 1XSIA 4IMLA 3RY4A 5L7XH 1FL5A 5CF3A 2HFFB 1OW0C 3ULVC 5D1ZD 4EDWL 3GZPA 3BN9C 3NJLA 4WTXA 1G6RH 4JVUA 5H37A 3TF7C 5J1AA 3NJMA 5CD3B 4XPFL 2R8SL 4WLCA 3P2DA 4IOSD 2OSYA 1QEWA 3GGWB 4GAFB 2P45B 3KYNA 5I16B 1IAIH 2V2XA 3S8FB 4LSRL 4QIRA 3REWA 3WNJA 4RCAA 4DFHA 4BWWA 4X6DF 1OARL 1J88A 3X1FA 2BVPB 2UX6A 1AZRA 4IDLA 5BZWA 1S7UA 4K4KA 4P2OC 4GSXA 4PRNB 4IRJC 5I1EH 2DLHA 2GFBA 3QFJD 1HHKB 2WTRA 2YD2A 1PD6A 5F3FA 3O4OB 2ADFL 2VO5A 3SEPA 1ZVHA 4GRLA 2WB1A 3MRRA 5EZJB 2WUBL 3AQXA 3G6AB 3OR7B 2IH9A 3I6GA 1OO2A 5AVYB 4FQXA 4PR5B 2UX7A 5DQDH 1BXUA 4AQ8C 2O6PA 4RFNC 2CPCA 1JPTH 2OCCB 4DETA 1U91A 3F7PC 1QZ1A 1J5IA 1FNGB 4EN2A 2DTMH 5I1LB 3VFOB 1YUKB 3S3DB 2GG1A 5C0AE 1OP9A 1NCUA 3ZDXB 3LRHA 2YRZA 3NIFE 2Q87A 5CGMA 2D03L 4HD9A 3UC0L 3OKKB 3ZYIA 5FA4B 3LEYH 4YHLL 4B0MM 1A7RL 4FXTA 1P5UC 5I1CL 2X4OB 3CXDL 3Q5TA 5EU7C 2XU9A 5IIEB 8FABB 1PZ3A 3IDXL 4HS3B 4WV1B 5JA8B 3S37L 1G9NL 4J4PA 1MJUH 5E8OA 5JDSA 4XC3L 4D9LH 1UTDA 5DJAA 2O5XL 4NJ9H 4LRIA 1CFBA 3QUZC 4M93B 3CFKB 1VZIA 3PUUA 5DD1L 1LD9B 4O5LL 3G08B 4NZDA 1DCEA 4R7XA 4JO8A 5HGHB 5LGJA 5FKPB 3B34A 4Y4KA 4UT9A 4AH2A 4OAWA 2Z4QB 3MLXL 3CSFA 4M5TA 5BVPL 5B1JA 5DLLA 2WGNB 3PABB 4YLBA 5DFVC 1DYZA 1TSHA 3LSOA 1RJZA 1O6TA 3DETC 4ZUSB 3UG5A 1G9HA 5I0VA 3EDJA 3O4OC 1V05A 4DVRL 4UOW0 3W0WA 2IDUA 4PB0L 1F56A 1HZHH 2FWOB 3QIBA 3ROOA 2DQGL 3LEXA 1J5DA 1EO7A 5T1LB 2OMTB 1T66C 4NO2B 4H8WH 3SQOL 2O5NA 3X14A 4N2HA 4Z95L 3UZQA 4BZ1A 3QJUB 3WNIA 4XNUH 5FO8A 4E0RB 5EBWA 5HSFA 1HYSC 2NDFA 2Q2LA 2B2XH 4HWBH 4FJYA 4XPGH 2YXFA 1QACA 1UEYA 3S0PA 5F3HA 3QJXA 1QLRB 1E6OH 4QHUB 3IFPA 1EXUA 2QGEA 3QCVH 1R3KB 3APFA 4GB9A 4OZIE 2P9RA 1CQYA 3RKDD 3TOPA 3UCRA 4N25A 2J1YA 3GEFA 3KPLA 1ETZB 4AENB 2YQ3A 1G5GA 3CFDA 3IRZA 5IP4A 1D5MA 1QQDA 1TSRA 3MRFA 3UC2A 3VD5A 2BDNH 1ZV5A 3ZT7A 1WD9A 3K1KC 2AK1H 4WV1C 3SDYL 4C4KT 2XZZA 5IMMA 3T0BA 4F37K 1EZVX 2QV4A 3IE9A 3PNRB 3HHSA 5J6SA 1TO4A 1JMZA 4WWNA 5BW7A 4M93C 4L37A 4OTXH 4POUB 4RZCA 2ISDA 1SOXA 3GM0A 4ZJ9A 3WJMA 4QHKI 2LW3A 3JVGC 2BOCB 4KVNL 1INEL 1GGUA 4CC4C 2H26B 2Z31A 1QP1A 1ZWIB 3D4ZA 4ZMOA 3ZMEA 1LO2H 2R7EA 3TT1L 5DA4A 4KKNA 3QNXB 2AV1B 4CC1A 2OL3H 1JRHI 4AIXA 3RI5K 4J6IA 2FJHB 5HHPB 4OCYH 2VNCA 2WQUA 3QDME 2L3BA 1YNLL 2BS9A 1G7JA 4XAWL 1Z6JT 2LQRA 3GLZA 4UT6L 5D7LB 3H4FA 1LO3H 3R4DA 3UTTA 2X1XR 4EI6B 2QPDB 4F91B 1N7MH 1V7NH 1N0XL 2DICA 3DK2A 3CFUA 1S7XA 4DW2H 1V5JA 5I26A 2I60H 5EU6A 2NNAA 1NIFA 1JD9A 4I4WA 2E7HA 5DLMH 1ZHBA 4M8QB 5EB9A 4XVSH 1PNCA 1OE1A 1M7IB 2RH0A 5D4JA 4N2EA 1G6RA 3PV7A 3BE1L 1FNSL 3T2QA 3JT0A 5D7IE 5C0BA 4EVNA 3N44B 2G0KA 5T3XH 4XCEB 3IXAB 3BQUA 5LUMA 1A0QL 1HH9B 2P3YA 5I1DB 4JY6A 4S0HA 2Y7QB 4EKXA 3QUXA 4M7KH 3LIZL 4NT6A 1AGEA 3TYFA 2WXPA 3ZMNA 4B97A 4NM4H 1ET8A 1ONQA 1I1AD 3VI3B 3P2BA 3MXWH 2B14A 3DUUA 3IYLW 2MPAL 4WW2A 2A9DA 3GSVB 3QEHA 4NQXB 2EILB 4Y2OA 3DOSA 4Z7OE 4ZTEA 1JYWA 1LP9B 4IKNA 3TP4A 3TA3B 3QDMD 3DURB 5CJQH 1IAOA 2P49B 4TLTA 2BHZA 4K5MA 4CA4A 4TULH 3GRWH 3ARGA 2ZPKL 2ZNXA 1IVTA 4BGLA 1S46A 3ALWA 1TJXA 2XWTA 3EFDH 1QZNA 4I8DA 3KWWB 4LB8A 2J56A 3CDGA 3K72A 5TF1H 3FO1A 3O0RH 4FHJA 3LRSB 3GSNL 2CLZA 4UM8A 3KJ6L 5JIHA 4X5WA 2WGXA 3QEGL 4RZKA 4HEME 1OP5H 1KCVL 4RFOH 4JPWL 2QSCL 5J6GA 1G84A 2IH8A 2XTLA 2R2BB 4M7LL 4XPHL 1Y07A 3TCLB 1N59A 3MBED 3MJ7B 4M7ZB 4POYA 1X9UA 1V3JA 3MLZH 4CSZA 4ZZFA 3RZCD 4RMVA 1U2YA 2AXWA 1B4JL 4KRPD 1N10A 5FO2A 5C3LD 1KG0B 1UURA 5FR3A 4OFQA 4UIKH 1J1XH 4CW1A 4E5XB 1QRNA 1I8MB 4OZ4B 2LOEA 2LAGB 4Z7WA 1PZ5A 1H8SA 2WYZA 1MI5A 4KJWC 4M3KB 4S1QH 3V6FB 1CMOA 2XXMB 5FOBA 2UZYB 1JNNL 5IV2B 3TBYB 2JFCA 1JIBA 3QQXA 2C34A 2XT1B 3MREA 1GS6X 5JORB 2HKFH 4GMSL 1XQ4A 1E8ZA 2AJXL 1WISA 3OHXA 2ZWYA 5D6CB 3MODH 3P3RA 2QFRA 1WTLA 2UWEE 4A7SA 5F9JA 3CQFA 2R0WL 3VTTA 3CLFH 4Z6AT 3WIHH 5GS0H 1X7SA 4Z78B 1B0WA 4F92B 1OE3A 4ZFGH 2KHAA 1BFOA 2BSTB 4HXAH 1MUJA 4U0RB 2VZTA 4GG6B 5E94B 1P7KA 2DTSA 3RKPA 4B9KC 4HWBA 3OPUA 4K3JH 2VW4A 1IC5H 4Y88A 1CR9L 4XHJD 2C1PA 3LZPA 5CLXA 1A1OB 5L8JB 1O9WA 1RLBA 1I4FA 5JQIB 1XD0A 4EUPB 5SWZB 1WAAE 4MRBA 1VESA 3H9YA 4ES9A 5L0QB 5KUMA 1T6BX 4C56E 2CQVA 1IEHA 1CFNB 1SFHA 2V3FA 5IROA 4J3TA 3ZKSD 3FXIC 4Q6IB 4YDNA 3H9ZA 4M7ZC 4LPVA 5AG9A 2OTUA 4H4NA 2VL4A 5B4MD 1KGCE 3INOA 4PRDA 4DGVL 3B3IB 5JO5B 1J87A 1VPOH 3H0TB 5EIQA 1YEWA 1PKOA 1Z3GH 4IKKA 1FQ9C 4URTB 4KVCL 4M6MH 2OJEA 1D6VL 5I1IL 1HH6B 3AT8A 1JZ6A 3BRFA 5FLUA 4PRIB 1A6AA 1AS8A 1WZKA 4HPYL 3TYGH 4IBWA 1M7DA 1XO8A 4IKLA 4WUUB 2YK1L 1WHOA 3BZ4B 3TESA 1JWUA 4MTMA 1SPDA 2Y72A 1U0QA 3DV6B 4UYQA 2OL3A 3VGBA 2VXVH 3B9VA 3CD4A 3E2HB 2XWBA 4ESKA 5HJ3B 3N42F 2RGSA 4N28A 4GO6B 2Z0BA 1F97A 4NEHB 2EDYA 3VSQA 2Y3AA 4I3GA 1Y6NR 2R1YA 1CZ8L 4PJXE 4H8QA 4PRPB 2IF7A 3T09A 2X10A 2P24B 3GHBL 1G9EA 2N01B 5IB2A 4D7BA 4EI0A 4U0RC 3AY4C 3BHBB 2CR3A 3L95B 4PJBF 1UH4A 4FLRA 2OCJA 4MB3A 4FLOA 4PLJC 4OVUA 4C56D 2EDRA 5FECB 2CO6A 1Q9LB 2XNAB 3BT2L 4LP4A 5TGBA 4Q9RH 4OLUH 4ABWA 1ICTA 2ZYHA 4RMBA 5JPMB 4JNXA 1VCBC 4V1DB 2HWZH 1J1PL 2W88A 1KGCD 1MRCH 3GI8L 3QHZL 4TNEA 4PY8I 4PJAE 4YPGB 3MFFB 3TLRA 1MAML 2H32B 1G1YA 3KPRE 3CGTA 3SBQA 2VXQA 4Q6IC 1OCOB 5HVGB 4E41B 1HQ4A 1ZXQA 4A38A 1SHMA 3QDJB 3RURA 1U8MB 3AGVA 5AW3B 1S5IH 2BNRE 1KGJA 4NNPH 4WFGE 5IW1A 1CFMA 5IVOA 5GS1A 2DF3A 2EO7A 2VZVA 4UTCA 1QASA 4WK2B 1JCKA 4H25B 4XVUD 5CZRA 5J3HD 3L6FA 1PNDA 4JPKH 4WNSA 4AEIL 3IMSA 1UYWH 2EDHA 3PL6D 4DWHA 5A7EA 3NCCB 4GPVA 4S1SH 4V2BA 1NEZB 1CE1L 2WMPA 4Q9BA 2IDQA 3E2HC 4NO0B 1RUQH 5CLYA 4JN2A 3QQ9D 5E8EB 5E95B 4N6QA 5JNYA 2R4SH 3VH8B 4OCRL 4TQPA 2F2HA 3VI4E 5KBKA 2X87A 4HIXL 4F5CE 3EZJB 1ZANH 2GEQA 3Q13A 2VDMH 4LQFL 4I7ZC 3WJJA 1YQVL 1MCEA 3WHE1 4F7PB 1MHEA 1AXTH 2WANA 1TCRB 1DLHA 4UZUA 1VFBB 1H3TA 5H37G 4KTGA 4YSUA 4TUJA 1RUAL 2Q3XA 2VXTL 5TF0A 3SPVA 1MRFH 4DZBB 5I30L 3A0OA 3KPRD 2BFVL 3FRUB 4OR1A 5JPMC 4K7PX 3KPSB 4GKZB 1ZTXE 5CJXA 1FYTE 3GF8A 2YUWA 5T3ZE 2Q10A 3BZFA 2ZE0A 4MASA 4WI0B 1JVOA 3OC5A 2JWYA 2BNRD 3GMLB 2AK4B 4WFGD 2DIJA 1EDYA 3DI2B 2YEZA 3AACA 3BPNB 1YY8A 4JMXA 3RIFF 1U3NA 2A74A 3VXSE 4NBZB 4XXCA 2R51A 3US1A 5ETUA 4P05A 4OU3A 5PAZA 4J39A 3HJ0A 3MLUH 4DN4H 4QO1A 2JB5L 4FXGB 4NQEA 1B90A 3SCMB 1F6LL 1CCZA 2NUTA 2NY1D 2FYYA 3GBEA 4OM0L 4R5TA 5D72H 5HHQB 1MLBA 1ZT4A 3A6CH 5CFAA 2Y1VA 4G8EB 3NCBB 4P8QA 4PS8A 4PTUA 4WJ5B 4AKOA 3MLTA 3Q2CA 3MNMA 3A47A 3OKNB 5DS2A 1OHQA 2VN7A 4PD4J 2QZ5A 3GNMH 4L29A 2PABA 4RNRB 2Z1PA 2VLRA 3BLPX 1AQDA 3L7FA 2YD1A 4KTEL 3WIHA 1CD9B 1TZIB 3ZTCC 1ZHNA 1AGBA 1A6TB 2FQGA 2SEBB 2WLIA 3D1MC 3VFWA 4AYDC 1KYOJ 5F88A 5CZVH 3OSVA 3LHPH 1AQ8A 3KLQA 5ACLA 1BZDA 3Q2LA 4HEPA 4ZAKC 1QSFA 4U6VL 4YFLF 3U36B 2E9IA 3TTYA 4D0BA 3Q6FA 4UUJA 4DGYH 4G6FB 1RZFH 2ZUQB 4TV3A 1OP3H 1FYTD 3N5AA 2R2CA 4EXPX 5BS0E 5HHVH 5T3ZD 1QKZL 2XZAH 5DEGA 2K8QA 25C8L 5CXPA 2BSCA 1M53A 4LCUA 1SM3H 4GW1A 3U46B 5B3JE 3PV6B 4HK0A 3VXOB 3IDGB 5E6UB 5ITFA 3FW6A 2ITCB 1UJ3C 2C3VA 2OR9H 2XOTA 4M02A 1IEBB 4M1CD 5DJCB 1IM3A 1T0PB 5C3TA 2AAVA 1V27A 5TH2A 2XBDA 3VXSD 4PJ9C 4I5BB 2GCYA 2BVYA 2I25N 5HDLA 1JWSA 1V54B 2OLDA 4JO4H 2IAMD 4OIIL 1KXTA 3BPNC 3C5ZA 1CDJA 3LH8A 3QZWA 2BOLA 4GW5A 5D1ZA 4F8PA 4HAFA 4OZGE 1UH3A 4U1SB 1HHIB 3HAEH 3PWUA 3U4EA 1AQMA 4EZJA 5I1GL 3BP6B 4OZFH 1MIML 2GUOB 1RI8A 4IOSA 5DJ8A 3MV9B 1TETL 4WTZA 3GFUA 3KYKL 4P9HH 3D3VD 4XNYL 3TM6A 4CSSA 1AGFA 1GJUA 3AM8A 3QE5A 4AMKL 4ZMXA 1J48A 3GXIA 5AYQA 4JQVA 5GGRB 1VFAA 1R0AH 1RURL 1QI5A 1Y0LB 1WLHA 4NHCL 3GXPA 5CEYB 1EHAA 1ZLWK 1TZHA 5BS0D 3SD2A 4Z0BL 2WUCL 3QFJA 1YEIL 3ZZLA 4AGPA 3KBEA 3C60D 4IIZA 3VGAB 3A67H 4UIMA 1CLOH 4GRMB 4ODVH 5EUOB 2DYPD 4GXUM 3MYJA 2EDMA 4Z7UB 4MZ3A 1ERNA 4JHAH 1NMBL 3DNKA 1TF4A 3LXAA 2ZUQC 4N86A 2OM5A 4NUGH 2G60H 1BQSA 1ZHLB 2HT4C 5CMAB 2Q8BL 3TH3T 2FH6A 3P4LA 4Z3EA 2X3BA 5DO2C 4OJYA 1CC3A 3V0HA 3LKSA 3ZL1A 1E40A 1BVLB 5TQ0H 4NOBA 4I0CC 1J05A 2DLFL 3FZUD 4FHKA 4PS4L 4DOHB 2CXKA 4W9GC 2XKUA 4Z7AA 2DH2A 3MCLH 4HX1B 1KC5L 3BGMB 3AG1B 4MJ5B 2H6PA 5I8KL 1XH2A 4PJCE 3Q8CA 3AG2B 3ME0B 2D2OA 1BOGA 4P5TB 5CHNA 3JV6B 1KB3A 3T77B 3UXFA 2DW5A 4HKJB 1AD9A 3L4ZA 4YZFE 5J9PB 2XVGA 2PNDA 4RSVA 4WHCA 2Q86B 3U0TA 4E9QA 5I71B 4MB5A 2FO8A 5BOJA 2X89D 4W9JC 1SYVB 4WI7A 1FVEB 4ZFOL 2RAMA 1RZKL 5BUGA 4EZKA 1NCAH 3RRQA 4XP6H 5BRZB 2VLKE 2A6IB 3V7MA 4FKEA 4TQHA 4H0IA 3U1PA 1BZ8A 1MH5B 3CCHA 1PLCA 4BSWA 3KYOB 1T6VN 5EN3A 4DN3L 3KAAA 1OXYA 2JKIS 3VGAC 3MJ9L 4NCC2 3WELA 5K9QI 3CHRA 3A24A 4UU9B 3K4AA 1HEJC 3NYKA 2ZONA 2VSMB 5IW6A 3WEXA 4I1PA 4K23L 4MD0A 1EAPB 5CR1A 5KEZA 3HE7B 2MOVA 4F8QA 4FJZA 4PJHE 1THCA 1U8QB 5T8IA 4MJIB 2LV4A 2MNUA 2E7BA 4MZ2A 1AD0B 1KN2H 3VD1A 5E23A 4TL4A 5HJGA 2BM3A 3SY0B 3K80A 4PCTA 5FYJU 3T4AC 3T9WA 2FO4B 2Y5TB 3M1OA 3DO7B 3OSKA 3GB7A 2FT8A 3MRPA 1B4RA 5DHYB 3AAZB 3REVB 5KYNA 5T1DH 2UVEA 3GSXB 5DZ9A 4OUOA 1CPUA 2WLHA 2AQ1A 3FQNB 3CUPA 2OW6A 4P5TC 3LMJH 2Z64C 3CBJB 3MROA 3QH3B 4XO9A 3FRPG 4CKVX 1UM6L 1EX0A 3EGDA 3T1WA 2VLKD 5I71C 1XTLA 3BVUA 3WTSA 7PCYA 3BH9A 4YQXH 4KXCA 3NZ8B 5FM5O 1RV6X 1S7TA 1WCBB 2X0UA 1PG7H 1NAMB 1LLAA 3N85L 4E42A 2DD8L 1GAFL 4YFDB 1KPVB 4R9HA 2XZCH 4GBXC 5F7LB 3QZLA 2WO4A 4Y5YC 3WBDA 4MJHA 1MJ8H 1KCSH 2OP4H 3OAZH 3OKOA 3IDMB 5MEPB 1IC7H 3P3TA 2PMZA 1SUHA 4FGMA 1UB6A 2HAZA 2ZAGA 3QNFA 1SJEA 4IJ3B 4UTBH 1CFTB 3EYQC 4X6BA 5D2LB 2NXYC 3IFNL 3HE7C 1VEMA 3D07A 2OZ4L 1MZZA 1I53A 3B5TA 4FQXC 4F58H 1Z9NA 2VDKB 4OZIA 4OV5B 4HIIB 3CFTA 5MENE 1F3JB 3GMPB 2R2HA 3F12A 1K2DB 3KZ8A 1GCFA 4F57L 2YBRB 5IVXB 1ZK9A 1A4KB 1UFUA 4GKOA 4QRQA 4QTFA 3RP1A 4M6OH 4ZX5A 2H0EA 3GQFA 4LO9A 3HAEA 1N18A 2ZAHA 4OZFA 2YPVL 1IT9H 1CICB 1AANA 2ADIA 3PWJA 4WEUD 1NGYA 3UO1H 1RULH 1I7RA 4Z77B 4DFIA 1LE9A 2BIHA 3OB8A 4PGBB 5DS8B 3BAIA 4A2GA 2VDNB 1QW8A 2XTJE 4KUCD 3QHFL 5BPPA 4XMLH 1WIUA 3CVDA 4AC4A 1P5VB 1I1AA 2BS8A 3G5YB 2RTTA 4JCMA 2ZKWA 4ZRGA 1QFWH 6CGTA 1HDMB 2DMCA 4F9LC 5BJTB 2GY5A 5C0FA 1JF5A 5FS5A 3QDMA 1JPSL 4W4NA 1NICA 4OD1L 3MJ6A 3FUFA 4JPVH 1JGUL 1F11B 4POZC 1H3WM 2EH8L 5C7XL 4YBQC 3D0LB 3V79C 2ITFA 1FHNA 2VZ1A 4Y4HD 1JE6A 3WKNA 4BBWA 5TPWH 4L4TE 5SX5H 3C5SA 1E28B 4PBVC 1UEMA 2PP8A 2ZX8A 3S8GB 4IJ3C 4XXDA 4N8UA 5MEND 1AKPA 3UERA 4HULB 1GYAA 3VFUB 1UACL 4PWEA 1ET5A 1WFJA 2VIRB 4JREB 1R5VA 3BH4A 1U93B 3WTYA 5LBGA 4R97B 3HG1B 3JYCA 2CKBH 3MACH 2JB6B 4MQXC 5D7IA 2ARWA 1V55B 5HHXH 3V52H 1M6UA 2EACA 4LNVA 5AOIA 5CM1A 4IM8A 2VH5H 2XTJD 1W15A 3O2WH 3MBEA 1FP5A 3E9TA 1BZ7B 3EAKA 3GSUA 5B1AB 1CICC 1M3JA 1NBZA 3FN0L 1NM9A 3QXAB 3RZCA 4JM0A 4XBEL 1CXKA 4LLVB 4GLRI 3AB0B 4PYHA 4HWZA 4YR6A 1KJ2A 3QQ3B 3NTCL 5IHUH 1IFRA 2EXWC 4Y2LA 3BRGC 1OCWL 5HGDB 5IG7A 4JFEA 5TDOA 1J5HA 4Y9BA 2WINB 4R26L 2NW3B 5MERB 1IKNA 5F8QC 1DEDA 4QOKE 4X7FC 4L4TD 4D0DB 2IALB 3KBPA 5HD8C 3S37X 1UWGL 5I18H 1YZZA 4OZHE 4ALAH 3LH2L 3R0MA 3FF7A 4N2LA 2FGWL 4IHOB 3QG7H 3RLSA 3NESA 2EEAA 5D71H 2Z31C 4Y89A 4OGZA 3AS3A 5FO9A 1LTXA 3CFEA 2BJML 2E9GA 4HEMA 4XGZA 4U7MA 4LASL 4JY5H 5G2NA 3N40P 4Q14A 3EJZD 2E8YA 5AW6B 1V8HA 2NT1A 2BP8B 3QI9B 1Q38A 2D0HA 1YDPB 4P06A 1QA9A 1XGYL 1AXIB 4JREC 4OT1L 2DMBA 1MG3C 4JDZA 4R97C 2JQZA 2ZG2A 1N64L 5T3ZH 2C9UA 3CC5B 3VXNA 1ZE3C 2I5YH 3PGDB 1H6FA 4XBPA 3FOMA 3H7LA 4U6HB 3N50A 4M03A 3B9KD 2MRYA 3WJLC 3X1EA 4QXTB 3VD0A 4I1NB 3Q1EA 4BH8B 3SE9L 2IWKA 1AG0A 3PPSA 3WXVL 1AGCA 3EDEA 3V7AG 4CC0A 1ZLDA 4QOKD 4U1KB 4U7SA 1H0DB 3VQLA 1OAKH 3QUXC 3VFPA 1G7MB 4XMZA 2V8MA 2UWEA 5HDBE 4DP5X 4FE9A 4XMKL 1W6LA 2R1WA 3AU0A 2LU5A 4XPFH 5D5MB 4LVNB 4LNRB 3ZVVA 2J1WA 4M61A 2D7PA 3I6KB 2B9AA 1AHWC 3H9SB 3MNZA 3UABA 2H3NB 4ZUVB 4ZOBA 3SYQA 2FSEB 2O6CA 2ICWB 5IB3A 3DSNB 4UTBA 3DTXA 3FQUA 3S36L 3JBG7 3N1GC 5B38B 3L81A 2F54E 3ZKND 3VYPA 3ARGC 1UOWA 5HYIA 3WAKA 3F7KA 3HKFA 3KPNB 4JR9L 5J11B 1JVKA 4Z8FL 3HI5L 3QPQD 4C56A 4ELKA 4I2XA 4HS6B 4NN5B 3BVTA 2IJ0C 3KGUA 1GGBL 2H9GA 2Q20A 3CZFB 1HHGA 4MAZA 1HN1A 4F9PA 1DFBL 4O2CA 3BO8A 1HWWA 4J1UA 3JZYA 1QO3B 2A6JB 2HJFA 4HUXA 3ZYZA 5EZLA 3U6XA 2QTEA 3FHEA 3PU7A 4AXWA 4G42A 4CVXB 4NQVB 4FFVD 3LN4B 2PYEB 3DOHA 3QIUB 2YRBA 2XN1A 2Z7UA 3P11L 4G43B 3VA6A 2OMWB 3QORB 1EANA 1ZGLB 2FIRT 3ORJA 5T1KD 1J18A 1M1XB 5EF3A 4XWGL 4F7MA 3O9WB 4JKPL 3HB3D 3IDXH 4LLUA 2ZUWA 1G9NH 1VACB 2YJLA 3D30A 3E1F1 4XC3H 4B3EA 3C2SA 5B8CA 4LVNC 3P1VA 1EQWA 3PL6A 5JW5B 5DK2B 1AOHA 4PRBB 4PJXA 4KKLD 3FPXA 2F54D 5DD1H 1OAYL 4O5LH 2FHFA 1S9WB 3OF6A 4U1GB 1DDHA 3C6LB 1TJGH 4Y16B 1ZS8A 5E6SB 4UF7C 2NX5B 5EU5A 4CADA 3FU6A 1LNUB 3BWUC 3NFPB 5F1KC 4I3SL 5BVPH 1Q90A 2VERN 1JK8A 4L8BB 4PSRA 2Z35A 3QZWG 4KY2A 3DMMD 4H8WC 1EHKB 3EFFA 4LLQB 1JZ8A 1ZKAA 4WJG3 4PVLA 4DVRH 2QQLH 5EV7A 1C5CL 3GBDA 4PJAA 3O8XB 2Y06L 5HHME 1M2OA 1ROCA 4WTZG 3CX5J 4AQ1B 3KPPB 4KKAC 1CGWA 1KIRA 5C1MB 4UQDA 1RAMA 3FMGL 3JTBA 5DMGC 1DE4A 4MD4A 3MJWA 2WIIB 4RQQA 1NGZA 3HMWL 2M2DA 3RNKA 5FGBA 1AIFA 1EDHA 1VEOA 3BDXA 3NACH 2JI3A 4HHAB 4RAVA 3BKJL 3M6DA 5GSVA 5A1AA 3OXRA 5F6HI 4LSQL 4KI5F 5FHBH 2BNQB 4YSCA 4FL4B 3ENEA 3NCWA 5IROC 4W9EC 3QIUC 5KVFL 3EOBB 4L1HA 5HGAB 3AXHA 4HKXA 4KC3B 1JPEA 1XSKA 1U8NB 2MPVA 4XB8A 3O9WC 3PGFL 2I07B 2OZNA 1HYRC 5DD0H 4PJ7E 4ODXB 3CC1A 3AWFA 4MCMA 3GSRA 1EJ8A 4AVIA 4F5CA 1FI8C 1HL5A 1K8DA 5E8PA 3RNQB 2GJ6B 4WO4D 4U1GC 4RRPA 3OQ3B 5FDWB 12E8L 3C6LC 1NCIA 4QMEA 4Y16C 3WTXA 1UH2A 1U4EA 1VDGA 1FJ1A 3CNKA 2W95A 3VXME 2AEPH 2FT7A 4KVNH 4MSWB 4NHUB 5HHMD 1XGPB 2JVUA 4UQ3A 2PTTA 3NCYS 2YA0A 2QADC 4L3EB 1I7ZA 1OGTA 4B9FA 2KPWA 3LD8C 2BNUA 4YVNA 3VM7A 1T1XA 2E4FA 1BQHA 2FUQA 4Y9GA 4X0KB 3O8XC 3EJCA 4XAWH 1ZIAA 5CIPB 5ISZE 5AB2A 3RWEA 1MKFA 3IF1B 2C9VA 3VXSA 3ASOB 5IQLA 4HIQA 1BREA 5KSVB 3RG1C 5DMKA 3BI9X 2JKTM 5FAAA 1FRGH 4ERSL 4JDVB 4ENZA 2FQDA 4QCIB 4K8RH 2IAMA 3FPYA 4G8GB 3QULB 3QJSB 1HXMB 4KK8D 4YDKL 3S35H 4FL4C 1HZLA 2ADGA 5F9OL 4NQSB 3TBWA 1JFHA 1J11A 2FR4A 1XR8B 2ED7A 4FC3E 4IU2B 4R7DB 2E47A 1A0QH 2ZOKA 5MI0B 3D3VA 4LCWE 5FK9B 2R0ZL 3LH9A 4Y5XB 2OXHA 3QUHA 4NM8H 1T7VA 1X5JA 1BIIA 3GJEB 1SBSL 3ULUE 1FVDB 3VXMD 2E56A 3BZEA 3VD2A 1CVRA 1YPZB 3K81A 3KDPB 4U7KA 2P26A 3MRCB 3QXVA 2UUDK 4OCWH 1DQKA 4MAYC 3HC0A 2CM6A 2VLME 3B2VL 1HTYA 4IMKA 3X1GA 3QJTB 4BA8A 2XY1A 1AXSB 3C60A 3AITA 1W72B 5AVRB 2N59A 2XIDA 3RY6A 2DYPA 4WU7B 3KVDD 2OXGA 4JKWA 3GKWL 1TYRA 5ISZD 5F1IA 1V3KA 1VEPA 2FNWA 3S98A 4K7FA 3UH8A 2YAEA 2YAQA 1EFXB 3FB6A 3S5YA 4FKHA 2FJFA 2KUTA 2VAAB 3ZZ1A 1FFQA 3UTSB 3NQIA 5DF0A 3UG4A 2AJ3B 2YPKB 3HRZB 3LNHA 3P69A 5SV3A 4HJGA 3ASNB 4HOWA 1JWMB 1LO5A 3MGTB 4GRWB 1RU9L 5DJ2B 4H26B 4BCXA 4F15B 4OZGA 3UJTH 1XFPA 2ZG1A 3KJ6H 4EN3B 1RP9A 3BDYH 4TNGA 3KLAB 4X80L 1FGVL 1FL3B 4ZO7A 1MY5A 1SJHA 3MRIB 5ESQA 2DLGA 5EWIH 4OKVA 5HI4D 4PRHE 2QSCH 4JFFE 5HHNB 4M7LH 3HC2A 2UY7A 2C3GA 4LCWD 4X98B 4XPHH 3EG9A 2BRQA 2BRRH 3PXLA 4HV8A 4NENA 4I0PD 1KTKE 3DO3A 3ULUD 4D7PA 5ID0A 2PWDA 1TITA 1P7HL 3SKMA 5MI0C 1J9SA 3T3ME 4E9RA 2VLMD 3KBHE 1PW3A 1OGAE 4QHNB 2ZCHH 3OKLA 5DQJB 3BWZA 4S1RL 3OWEA 5D70L 4PCKA 1NLDH 4KY1L 2IXQB 1HILA 2XV3A 1ZVSA 5GS0C 4P2CG 5F7HA 4FMFA 4YDMA 1YY9C 4K3DL 5EG6C 3HAEG 3I3EA 4GMSH 5HGBB 4OZFG 3S88H 3B7YA 4ZFFB 4G8FB 1E4XL 5D93B 3QR2A 4AJ0A 4EMZA 1J8KA 3APCA 1TT6A 4WWID 4MBOA 3PLYA 1FE8H 4L4VA 2R0LH 4YXHL 1MN4A 3EJSA 4N2MA 1YEKL 4ATWA 1HOEA 4UQIM 2H1PH 3EF7A 4AZ8B 6FABL 1XGUA 5HYJB 2VITB 4QUOA 4CU7A 4PRHD 4JFFD 2XKNA 5AL8A 2AGJL 4X8XA 4JVPA 4F15C 2R23A 1Z32X 3RDTA 3EJPA 1MREL 3IJEB 1MWAH 5C07E 3LZNA 1WGOA 2VZOA 3UACA 3NZUA 3UTQA 1CUOA 4OUUB 2F5AH 5GRWA 1AG6A 5I9QB 2CLRA 1NUFA 3UYRH 4R4ND 5HDRA 3QB7C 5GGSA 1OAQH 3FQ2A 2BW4A 4IOFD 4L3AA 1OGAD 3CU7A 4I18B 3L13A 3W9EB 5IMLB 3WIFA 3VWKB 5FCSH 2VLKA 3CMOL 4DGVH 3Q9QA 3JWOH 2XJKA 4JCWA 3PE9A 3UPAA 1MVUA 5A2BA 4KVCH 2VR9A 3FDWA 4F2FA 1S3RA 1U8KB 1UA3A 5CEZE 1D6VH 4DJMA 5I1IH 4NRYB 5K59E 3T6VA 4HPYH 1BYPA 4GO9A 3IKCA 4JQVC 1ODUA 1V3LA 4BD4A 3GBML 3SKNA 4FQIL 2JLLA 2YK1H 1BBJA 4KKCD 3TFKD 2A6KA 2EKSA 2NXZD 1ZT7B 3IU4H 4PJHA 2X05A 5LXGL 1G0XA 3LRKA 2CHDA 1E5CA 5KZCD 2WWOA 1PJWA 2HP4A 1TJHL 3RUGE 4AL8C 4UT6A 4UILL 2CALA 1SLVA 3BFOA 4L1TA 5FM8A 4PJFE 3JWDL 4GAGH 4JG1L 4LKXB 4JO3L 2GBVA 1NC2D 3GHBH 5C07D 5JW4M 1VADA 2X9XA 4WDIB 1KLGA 5C0AB 5F1OB 3O41B 5IVXF 4I0KA 5IOPB 1U3JA 2KPNA 3F65A 4WKXA 3NP4A 5A2FA 1FZOA 3C6EA 3MRBA 3ULVL 3BT2H 4X9BA 4WZ9A 4K5NA 3FT4A 5HJBA 4N22A 5BQ7A 2YA2A 3LY6A 4ODUB 4JZOB 2BC4B 3VGHA 3WTVA 5I9QC 4JFOB 4S1DC 4LCCA 4I3RL 2N0KA 2O6FA 1SHWA 2DBLH 2DQDH 3GI8H 3MRDB 5F44A 5JHDE 3TBSB 4KQ3H 5KBNC 1MAMH 1L3NA 3P0GB 5DZOA 4G6KL 1DUYA 2P43B 2QR0B 2QVTA 3M86A 5CEZD 2IQ9H 2HMIC 4FFYL 4ZS7L 2WO3B 2CSPA 5LQBL 3K4DA 2NY0D 2B39A 2PYFA 2XI9A 3MVSA 4FG6D 1BMWA 2X4QB 3FT2A 1FV1A 3SDDD 5ERWA 1BQ5A 2IH3A 3PWPB 2ENJA 2X6AA 3ARBB 5AVVB 2C9XA 2IANE 1Q72L 1R3JA 4XO4A 2CBTA 2GJZB 1WA1X 2WSKA 1DN2A 3BAWA 3F7VB 4ZS6C 1I8IA 4XMWA 1GL4B 2OSLA 3G3LA 3US0A 1JHKH 1LMIA 3ARRA 3ZUNC 1E4WL 3BUIA 4Y4HA 2VXSL 2HG5A 1CE1H 2OSXA 2YKLH 2ZWKA 3VA2C 5MENA 3PY9A 1QSEB 2EXYD 1MJ7L 1P7BA 1G7PB 4GI8A 1F90L 1XXDC 5FHAL 1MEXH 2KKQA 4LQFH 3GM8A 3BVWA 1MW1A 2Q7YB 4C4BA 1EMTL 4KK5D 4DEWA 3U9UB 1KUMA 1CJYA 3HE6D 1RUAH 1S5HB 2VXTH 3QDGE 5I30H 1ZOXA 1HIML 1PF3A 2BFVH 2DB8A 5JMOC 2NZIA 2VQ4A 4PJEA 5DMYA 1ED3A 4NKMB 3WXWL 3DYPA 1RP8A 3QS3A 3ZL4L 1W0VB 1NCWH 4R3SA 4CGUB 3RGVD 4KZEH 2BOBA 4HUWB 4L2YA 2HSIA 2IAND 2L04A 3QFDA 3WMPA 2JTDA 3LRLA 3BRDA 3MBWB 2K0RA 3IBOA 3T0DA 3KPMA 3CN0A 3QCUL 3V6OC 4OI8A 4ZQKA 1NPNA 5E4IA 2JB5H 5FA3B 4R0LA 1WS8A 5B3NA 5KVDH 4OM0H 4BXVA 1H5BA 2A9NL 3ARBC 2EO1A 4N87A 4YVUA 4AUJA 2XKSA 1KBBA 5DD3H 3QUYD 2HFEB 4I77L 1QWUA 3T2NL 3VMPA 4ZX6A 4FULA 1IAIM 3VD9A 2P46B 4KTEH 3V4VH 5AZEL 1T1ZB 1UOKA 1WT5A 3ULSA 2WAHA 3W9DA 4ONHA 1QFOA 1UATA 4IBSA 4JKNA 5CP7B 4WW1B 4B9JA 3FU8A 2WBKA 4P4KB 4B95C 1NKGA 1ULVA 2BY0A 3CLEH 1G7IB 4MAUL 5IEKB 2I9TA 5C70A 3QDGD 3SKUD 3WFEH 1JMXA 1SOKA 1SXNA 1UXMA 1QNZH 3PP4L 1QKZH 1A6WH 3AWGA 3FUNA 25C8H 3MLVH 2W60A 3HCVA 4BUQA 3MAWA 2APTA 2DWXA 5ILTH 1DCLA 1N5YL 4P49A 1S7WB 2DKMA 4Y2DD 4ODHL 1L6ZA 1LK3H 3B9KA 1E30A 4TNVK 4JJ5A 1WGVA 4ORGA 5GSRB 5DURD 1JN6A 4JQXA 2VDQL 3QZMA 3PCYA 3PAZA 4M5ZH 4CVWA 2E76C 3KDMA 1WCQA 3DC0A 2V17L 4P99A 1ZAGA 4QOKA 5IB4A 4P9HC 4TUUA 2NR6D 2QQNH 4BFGA 1I9JH 2CDFB 2NY7L 3BEVB 1U8OB 4HJ1A 4OZHA 2R4RH 5HGGS 1WBXA 4IOIB 4YOKA 1MNNA 1MIMH 5EEUA 2EICA 3CZJA 3CFMA 4QHLB 3UG3A 1TYEB 4LQ1A 3L3KB 4N4YB 2R29L 1BEXA 4M43L 4AMKH 1NFKA 4HG4K 5EEWA 5IFAH 3FQXB 1E7UA 1GHFL 3QRFM 1A3RL 1XR9B 3CZKA 4LLDB 4H7VA 3HVDA 3B3BA 1XSOA 4UOW1 3WS6A 5EC2B 3GPSA 3AU1A 4HLZH 5IY5B 3A4FA 3BMWA 3V9CA 2A77L 3F6LA 2FX7L 2HLEB 1ZDQA 2WUCH 4BSVA 2PWEA 3ZDZE 1WIOA 3HJEA 5DI8B 4P4KC 4PI0A 3VGEA 1OT4A 2Z91B 1FORL 5K39B 3GS4A 4BGDA 2EUWA 1O0VA 2OK0L 5HI3D 1T3FB 2GW5A 2XV0A 1NMBH 3ARWA 4DUXA 3KWTA 4X4XB 3VXUB 3MRLB 4WTQA 4UINL 4KNQA 5EO1A 2Q8BH 3DX8A 2BZDA 5FM5M 1V10A 3MV7E 1T5XA 2WXOA 1YRKA 2MQGA 4OFYD 1NFIA 2C9SA 4PS4H 1RUML 4RRPG 1H15A 4J6RH 1ASPA 4N8PA 4C83B 3OKEB 4XMTA 1B0GA 2QHRH 3G6JE 2HRHA 2HUHA 1L7IL 3QAZB 4HUMB 4MDJA 1G1KA 4HCGA 5T1KA 5BXFB 5I8KH 5DWUL 2VM9A 4W4OC 3N9GL 3AUWB 3BX7C 3HMXL 4IBQA 4KRPC 4M62L 5J5EA 2F19L 1KIQB 4PPTA 3ULUH 1BQHG 2XXCB 3D69B 3MNWA 5KVFE 1FLTX 1QI3A 3ESVF 4BUGA 3RWCA 1TIUA 3EJRA 4AWJC 2X28A 1MLCA 2F54A 5ENWA 2EDLA 15C8H 3DO4A 5L4JA 1EPFA 3QG6B 1RZKH 1AO7E 3BUTA 3L3OB 3T8MA 1ZLUH 3DJ9A 3BQVA 3FT3B 4LOUD 4J3BA 4HQQL 4KQ4L 4N0CC 3DMMA 4W68A 4JFVA 5ID1B 3NFNB 5A6MA 1NL0H 5GGRY 3MV7D 5INCB 4P5SA 2B1OA 4G6AC 4JRYA 3CN3A 4PJIE 2VZ3A 5G5DA 4L8DA 4K23H 2DWDB 1QYGL 4UI2A 3KMDA 4CN6A 1JS4A 3HG5A 4PCSA 3UJJL 2FL5A 2MH4A 1XL6A 4W6XB 5IVNA 3O3AA 3O4LB 4N85A 1JNLL 3QDAA 1U9KA 1TEGA 3L1FA 2UZXB 5K1NA 3MKKA 3IJ9A 3AS0A 1VSCA 2HVBA 1NWOA 1HSAB 1JNHB 2JH2A 3R8QA 1UZ8B 3DX6A 4Q58C 5B4MC 1TTAA 1XF4B 2GI7A 1WFUA 2BW5A 3K46A 4NQDE 3TZVD 3KGTA 1IE4A 5IB5B 4NRXB 3UBFA 3L54A 2VRKA 3GMMB 2HUEA 3NOIA 3WN5A 1AO7D 4A2MA 4N0FA 2O61A 1EO5A 3D2UB 3GSQB 4QRRE 2DQ6A 3M1BB 4NDMA 1XF2A 3GDCA 2BLFA 4IRSB 1DSFH 3BPCA 4WO4A 1K6QL 4R4BA 1XIWD 4MMXA 3IDYB 5EIIA 3L3OC 4M8RA 1NC4B 2QVFB 2CRZA 2JQAA 3G5VA 3BPOC 2PO6D 3IFLL 5EZOH 4W9KC 1UWEL 3CXHK 4AOFA 1NEUA 3HZVB 4QYOA 4KZCA 3FOLA 3FO2B 2CKBB 2DPKA 4ETQB 4XVJH 2B5IB 4X7DC 1AR1B 5IJCC 1FIEA 3DHJA 3SKJH 3GMOB 3HBPA 3L5IA 1KWKA 4CMHB 1LEGA 4CBPA 2OJZL 4G3YH 1CD1A 2OZ4H 2MIZA 2O5YL 2J25A 1J5CA 5C0CB 3LS4L 4RSYA 3VNZA 4GSQA 2E6JA 1JGIA 2ROYA 4PJGE 4AYEC 1S2EA 3QISA 3CSYB 2O6DA 4NQDD 2A9MH 4QRTA 5DO8A 3KW7A 1A1NA 1QWNA 2YAHA 4G8IA 5FGRA 3ZZSA 4UDTA 5KS9A 3P9LA 5G4NA 5B39G 1IKFH 1OM3L 2COQA 4WEMB 3EDKA 1UD5A 2AQQA 4QRRD 2YPVH 2C4FU 1JOIA 2RQEA 2CUAA 3GKZA 4RMQA 1C5BH 2DWSA 2VDPB 1WWAX 2QPUA 5DSCB 5CEZH 2Z34A 3U2SB 3BH8A 4OVVA 3NFSL 2TRHA 4KK6D 1LEIB 2HZHA 1FZMB 1KCRL 3VRIB 3W39B 4F3FB 2H2PD 3D4YA 3VXMA 1AYRA 1H3PL 2DWEA 2YPLE 35C8L 4KWUA 5G4MA 4IRSC 2PP9A 4GEJA 4BWTA 1KYFA 5B8CC 3BKYL 1T0MA 4CBZA 4WI3A 4NI6A 5DHMC 2EDQA 2VLJE 3H3KA 3IDYC 4CMMA 2YZ8A 3O6FB 2P8PA 3V55A 1JPSH 3EJTA 1JGLL 4OD1H 1T4KA 3DVIA 5IBTL 5ISZA 5TTRA 3I9PA 3WFCL 1MCWW 3ZW3A 2EH8H 4PJ5E 4O51B 2LVEA 2K4AA 1WWCA 1IBDA 4AGLA 1KFAL 3CH1A 3PAVA 3GUTA 3L4YA 2Z3FA 2AXFB 4GRWF 1AR1C 4X5QA 4AQOA 2ZXQA 1UACH 5DJXA 4AJYV 2JCCB 5KJ4A 1HEHC 1T2JA 3L9RB 4CMHC 5HHOB 4QY8B 1ASOA 4WHDA 1I1FA 2C1OA 2X70A 5L8LB 2PW1A 4YE4H 1UASA 1YYLH 5JR1L 5KVMC 4BZ2L 2JKNA 4KVPA 2BFGA 7TAAA 2OMUA 4LCWA 4JLRA 1M7XA 1GVIA 3TNMB 3V0DA 3MUHL 3VD7A 5KYYB 3CZLA 5E6IB 1ND0B 4RMRA 4EPSA 4DPBX 3HS0A 2IFGA 2EIDA 3I50L 2EUXA 3FUKA 2YPLD 3FN0H 4JM4H 2NY4B 3LZFH 4XBEH 3F5WB 4PTTB 4J3OD 5CJ5A 1XL4A 4ABUA 4ZFOA 2VLJD 3SDAB 3G6DH 1RJYA 1FFPB 1HXYB 1NQBA 4YNYA 5DFTA 1L6XA 4U1IB 1OCWH 3DX1A 2C7UB 2WLMA 1F86A 2JXMB 2NTFB 2PCPB 2VERA 3GI9H 2FEDD 4ALAC 3AMKA 2ZD0A 4WWKB 1F1AA 1PMYA 4L8SB 4PJ5D 1QTYT 1KENH 3N43F 3FN3A 5C0EA 1YUHA 2AXGB 3BOVA 1NINA 1I8UA 1SUJA 2NZ1A 1MCQA 3LAFA 3OJMB 3WY4A 3MJ9A 3O6FC 4HJ0C 1UWGH 3WTUA 3LH2H 3I9AA 3ZGIA 3ARDA 1WFNA 3I2CL 1RCYA 3SE3C 2NSMA 1WEJH 3K2MC 4JHVA 4G71B 3NH7L 1CYGA 1RUKH 1PEWA 1ZTMA 3RVVD 4LASH 1FO0H 3WY2A 4PRHA 3CH8A 4JFFA 4JY4A 1YG9A 4JFQB 2WWMD 2ZXCA 3AGWA 3IM1A 3TURA 4RGOL 1HFUA 1P69B 3PGCA 4R8WH 4M1CC 3NA9H 2QQKL 5HDOA 4PGEA 1N64H 1I7TA 2HJLA 3O81A 3MUGB 1DANT 1O75A 3N1FC 5J6HA 3ZDYF 3T0AA 3J2PA 1IRAY 4OGXL 3IJHB 1YJDH 3CVHH 3PDDA 3V8CA 1T80A 3I3DA 3ULVE 4AW4A 4OJDH 2H0FA 3N91A 2MFNA 4TOYL 1I9IH 1E50A 1OGAA 2FAUA 2JK5A 4TS6A 2XPGA 4GP4B 1Z9MA 1RK1B 1H6UA 3OLGA 3ZDWA 4Z76B 3VU1A 1S9VB 2NY4C 1WIPA 2P8LB 1W91A 4JFWA 1YEHL 1GZQA 5DVOA 5DRXA 3B6SB 1Q9KA 3O11A 4LIQL 3UADA 4ZMVA 4HKZA 4OJFL 5AWNH 4A7TA 4K7PH 4P5MB 3TNNA 3PREA 2ZOTA 5KYXA 1K8IB 3LJ3A 2F7QA 4XMKH 5D2NB 3SGEH 4X4YA 2B15A 2ZNWA 3QA3A 4MJ2A 4UQAA 1EK3A 1QHPA 4WWKC 3EO1A 5EA0L 2DS4A 3ZUCA 1RJLA 3Q7JA 2QQQA 3L2NA 5IHHA 3HVNA 1UA6L 1IZKA 3GS7A 2F68X 2WN2A 3OKMB 2HVKA 1RZGB 2IPKA 3C60C 5I8EB 5GGQL 3S36H 3RY6C 4GUPB 2H3KA 2ATAA 4JDEA 4JO2H 1QLFB 3W5NA 2OZ4A 5C07A 3TJHD 4TUOA 4KHXH 3FSOA 4ZMWA 4JR9H 3ZSSA 1D7FA 4Z8FH 3RWFB 5HYSA 3HI5H 2WZ0A 3V4PL 3HFFA 2D3VA 3ULVD 3ZK0A 1BX2B 5EPMB 4K5OA 5J1AB 5HBBA 4PJCB 3L9EA 5DR5L 1GGBH 2JJTC 2VTFA 5F7FA 1NH6A 2YPVA 4PRAA 3LB6C 5AZ2H 3DBXA 3LN5B 5F1NA 1ZPUA 4AYID 4JKLA 3PP3K 1M7UA 3SPCA 2X9YA 4X6CF 3V0VA 4PW3A 4G72B 1EJFA 1XCXA 4OQTH 2DLEA 1Y6KR 4EI5B 2CZNA 3SDDA 3QEQB 2BVQB 2DQUL 3THMH 5KWYC 1GTFA 2OR7A 4IRJD 1PZ2A 1WDAA 3UBXB 4Y1TA 1HAWA 4XWGH 4ZPTA 5DHVH 7CGTA 1F58H 5AOMA 3ILPB 1KY7A 1X6LA 2GAZB 3JUZA 4NC1C 3RUGA 5D2NC 5EF2A 1RPUA 3P3YA 2VLLA 1TVHA 4IIQB 3D9AL 4PJFA 4C55A 1LDPL 4JGMA 4L0PB 1TOXA 2XN9B 3I02B 3WFHB 1TKWA 1S9XA 2EIMB 2Y24A 1QHOA 5KOVC 1YSOA 3LKQB 1NMAL 2W65A 2XV2A 4LAJH 4YIQB 4MB1A 4UAOB 4ZTOH 3FTZA 3D8MA 4O2FB 4I3SH 4ZNEE 2Y7SA 4A6YB 3ZQ9A 1ASQA 2NUPB 1I1CA 3A4EA 1A47A 1IILE 5LKNA 4XC1H 2V7HB 3P77A 4HW6A 3WTWA 4AQEA 5EBGA 3BP4A 3N3EA 3G7TA 3HE6A 2OA9A 5AVUB 2Y06H 5C0JA 2DJSA 4NCC1 1CLYL 3GJFB 4XCCL 2FLMA 1EEZB 3ZDXE 4LL9A 1PVHA 4LSTH 5CJ8A 3OTTA 2A7BA 1IJNA 1CDCA 4XOCA 4ZUTB 5GRUL 4I9WE 4LZKA 3RGVA 1MF2L 4LSQH 5F7DA 2IANA 5AB9A 1AIZA 4F24A 1CDGA 4JJOA 2IWFA 5EU3A 1TEYA 4NXSA 3CPLB 5F6IB 5KVFH 2HTLC 4JFXA 5D4QA 4H0LC 3ULAB 2AAAA 1F5WA 1MG2C 1S4IA 3CPUA 5DFVD 1JGDB 3KJ4B 3QIBB 3DETD 3UAFA 4ZW8A 3PGFH 2DMHA 3AUVA 2PUQT 1WFTA 3HFML 4WCYL 3QUYA 3RE0A 4E36A 3SDCB 2BVEA 5C71A 4HIJA 1NFDF 5D1ZI 4IIQC 1T66D 4P4RA 2BSBA 2Q9OA 2XXGA 2VJ0A 1UKSA 3RFZA 3WUZA 2D73A 1OAUL 1UXSA 3IDUA 4DP9X 5SX4I 3CFIC 2OI9B 1A2YA 3RPKA 1E42A 1FO0A 2X12A 3LVTA 5F3BA 5DEZA 3IFPB 1EZUA 4UAOC 1T20B 3L3DA 3QDGA 2OMXA 3N40F 4ONFL 5D7SL 1WPCA 4CNIA 2GHWB 4ZFQA 3WEAA 3RILA 2FJGB 1YCSA 2X2YA 3DIFA 3MCKB 3ARFB 1D9KB 2QBWA 4MD5B 4HZ1A 3ZE1B 2GB2A 1IZJA 1E8XA 2JIXB 2DMGA 4I9WD 4K8RC 4D9QE 1KNOB 1MCFA 2LFEA 4U1LB 5CILH 4AV4A 4Y2DA 2J55A 2B77A 3HHSB 3Q3GA 1CFSA 1GYVA 5K9KA 1AZBA 2EIBA 2D4FA 3KEDA 4ERSH 5D1QB 3QUKA 3W38A 1Q94B 3QCTH 3DTUB 4YHZL 3WJMB 4P2AA 5DVKA 4XNQB 4YDKH 5I1HH 3H3BC 4NIKB 4C8XA 1IGIL 2NR6A 3HR5A 1I8LA 5AL0A 2WQ8A 2WVVB 1R17A 1L9OA 2XX1A 5F6IC 4NWTL 2VR7A 3RAJL 5C0GB 3ZO9A 3TONA 4TN9A 1F4XH 4PM1A 5C7ZA 5TE7L 3T2LA 3GD1C 3MNVB 5E2VH 2EDDA 1JD7A 1HI6B 2GTZB 2R0ZH 4BCZA 2YZ1A 4ZMNA 1GMEA 4NP9A 2PXYB 1QLEB 1S7RA 4QDGA 2R2EA 4GSUA 3SDCC 4CDHA 4HZAA 4RFEB 1QVOB 3UTTB 1SF3A 5T1LD 5KG9A 3BZ5A 1A6VH 1UVQA 4FNLL 4KNUA 1UUSA 2FJSA 1PYWB 2CIKA 2BY2A 2LFGA 4Y4HC 5E7FA 1P6FA 4ZBJA 1JGEA 5AYTA 3RB7A 3U9WA 4D9QD 3CSTA 3DX9B 3IKKA 5D7LE 1W2KT 1OEZW 1A3LL 4NO3B 1BGXL 4PGDA 1XBDA 3ZR5A 5IR1A 3C12A 2CJTA 3ABZA 2XBTA 1IGMH 4UYPA 3T65A 3VFSB 1D9KC 4HOXA 2Z93B 1K4CA 2IV8A 3RVTC 4ZXBB 3DUSA 4XBGA 1PD1A 2EYSA 3NN8B 1ECYA 2FWSA 1ECZA 4WI2A 4OFYA 3OAWA 1I3GH 1N4XL 4X80H 3R06A 2IBZX 4TQIA 5EIIG 3QZBA 3RIAK 1FGNL 5CKAA 1X5MA 5D1QC 4MJ4A 3WSQL 4I48B 1BAWA 1NKRA 1SEQL 4Y2OB 4XI5C 3MLSL 1R24B 3CZSA 4UV4H 3WFZA 1GGTA 1CGXA 1IFHL 1PY9A 2EVJA 3V0EA 5BNXD 1KB5H 4XPTL 5TK2A 1Z5LA 2CMRH 1NAML 3IN0A 1P84J 4GSDH 3VI3E 3QUML 4FQCL 4YHOH 4YHYB 1INDL 1S7QB 5JHMA 4J3OH 4XOEA 4AM0A 2BXZA 1TFHA 3IRCA 1IQDB 3TV3H 1LP9E 3B2PA 2PXYC 3MHZA 3DX7A 4RDBA 1PCXA 4JQIL 5A2IH 5IQ9A 4HIHB 1J9CT 2M26A 5D7LD 3K8MA 5J0BA 5D70H 2I9LB 2Y22A 5DQ9A 1JV5A 2QFPA 5J6GB 2HXAA 4Y5VA 4K3DH 4N9GA 4NQCB 3DJZA 5JYMA 3MV7A 3WEOA 3EJZC 1E4XH 2VM3A 1ANUA 1XGRB 3S5LA 5I6PA 3V0JA 2IQAB 2Z6FA 2WLYA 3FSAA 1DVYA 4U31A 3UBHA 3HEIB 5C6WH 1E5ZA 4HSAC 1A64A 3ZKXB 4B9PA 1LL1A 4PH8A 2W9EL 3G6JA 1CF8L 2VMFA 4P46B 4HLZG 4NZRL 1QRNB 1VFOA 3CFCH 4J12A 2VDNL 3S6CA 4W93A 1OP3K 1UWXH 1E27B 1J10A 3QQDA 1VERA 2E7MA 1FF5A 2DKSA 3MGOA 3IS1X 1OALA 4JQXC 4NFDA 2E8ZA 2B20A 5CU9A 2FHCA 1FSKB 1U2CA 4MKTA 5F7BA 3OHXB 3JWOC 1MQKL 2F7OA 2WJ7A 2MQ3A 4I13B 3TA3D 1AO7A 2EE9A 4KOBA 5DD6A 2OQJA 3X13A 1N8OE 4QD2E 4EEEA 1YEGH 1M9WA 4X7TB 4XN7A 1NBYA 3DGCR 3BSZL 1BFOB 5MEQA 5CO1A 4FQHA 2ERJB 1P7KB 2D7MA 5MP6H 3T3PF 1GJWA 1XIWA 1YEDB 1NBVL 3W2DL 2VQ1A 2C1PB 3T8XB 1KB9K 1CXLA 1QFWM 3TT3L 3BWAB 3VXRB 3U4BH 2PO6A 2QPEB 3GBMH 4HLEA 4PJIA 3U0WH 6PCYA 5I8CA 2QSTA 3H2QA 4NO5A 4GG6E 1QFPA 1M42A 3OG4B 3ZKNC 5LXGH 2XC8A 1C16B 4M7LT 5L7XL 2KZ1B 5IW3A 5EFIA 1JYVA 3IDIB 4CUCA 2R39A 4QF1B 1KT2B 3JWDH 4JG1H 4JO3H 1IBHA 1S8DB 2WLKA 3ZKXC 5SWZE 4ZO6A 4RA0C 3BVXA 5T1MB 3KHQA 2FB4L 3WE6B 1KGWA 1FBIH 1X5GA 4P46C 4LOFA 4RWYL 4NQDA 2A73A 3VJ6A 3ZTNL 1JAEA 4B7LA 2VC2H 1HESA 1IAIL 1YNTB 3LNGA 2FVNA 3RX7A 4MXVF 1FSKC 1ZHKB 3D0VA 3RL1B 4N1CA 3N55A 5AVZB 4L9LA 4B50A 5E00B 5I1EL 2FLBT 3ZXAC 1I8AA 4PRIE 4FFYH 4ZS7H 4X6EA 2P7TA 4PP2A 1T2QH 2QV2A 3ALXA 2YSTA 4HUUB 1ZV9A 4X99A 5ECGA 3QJFB 4WUUE 3WEBA 3IU3B 2ERJC 1I82A 1OSEA 1ZIBA 2KS0A 4HK3J 3RJDA 4KKLC 4Z7VF 3V4VB 3QDHA 5DQDL 4W9IC 1Q72H 3SE8H 5ELIA 1JPTL 2WXHA 3U83A 4D8PB 4EQ2A 3CIAA 1CL7H 3CDCA 4PLJD 3P4OB 2P42B 4WF7A 2DTML 4FG4A 3II3A 3JV4A 4PRPE 4MDRA 1N0LB 4LXFA 2B0SL 5IHZA 3FCSA 1E4WH 5SWZD 2FH8A 5DC0A 1KOAA 1RD6A 3D25A 2I24N 4PJGA 1RFDL 2VDOH 2OBGA 3P40A 1KYDA 4Z7QF 4PHZA 3U0PA 2PLTA 4N90E 2A1WH 3FCBA 4RRPM 4TPRH 2WLZA 5GQBA 3DXAB 2IPUG 4XH2B 3NIDB 4ELMF 4S0SD 4FNQA 4D9LL 5JUEH 4G1MA 4NJ9L 1N26A 5LO7A 5DA0B 4Q6YA 2APSA 4S2SB 1KB5A 1QBLH 1K3IA 1L0QA 3LQZB 4PRID 5TDNA 5I5JA 4E41E 5ANMB 5JXEC 1MFBH 2DEYX 3QDJE 1J0IA 3HHMA 3QVAA 2YPLA 4WUUD 4PBXA 1QEXA 2R1XA 3WXWH 4UTAH 5EO9A 4ZMQA 3NQKA 3NCFB 3RBGA 4Z0XA 5JNYB 4BFNA 4H5SA 3ROLA 2Z92B 1NBQA 5BZDB 3RA7L 1AGDA 3QCUH 1OV8A 3QO0A 1HZHL 3I9IA 1EEQA 1XAUA 5HYSG 2A99A 2K3TA 1T7WA 4PRPD 2ZKYA 4PJ5A 5IVZA 5D7KE 5FX3A 1PEZA 3UYPB 4H0HB 4PJ6A 5ABZA 4H8WL 3BVDB 2OR8A 5C9JB 3OG6B 2ATPA 3OL2A 3KM2A 4PV9A 3CG8A 2YQGA 4XNUL 1VIWA 3HI1A 5FXCH 4AUUA 4LL4A 4I77H 3JTSA 3ZOAA 5EU4A 3B7RL 2F1BA 5DJDB 4N90D 1SHSA 3LPWA 1E6OL 1R3HB 1SDDB 1X5HA 1D2PA 4V1DD 5AZEH 2X2UA 2J3SA 1T1WB 3VYNA 3CZUB 2VABB 1A4CA 4ZDHA 2AEOA 1HOCB 5DC9B 4EDXB 5JW4R 4X42A 2FBJH 1QABA 4BKLA 1HINH 3OAZK 3C9NA 2CIIA 3KPSE 1EGJH 1B6DA 4KU1A 3WE1A 2BP5M 2AANA 3X11B 4R7NA 4N5UA 1Q9OB 4E41D 2AK1L 4K2UL 3VTAA 3ETTA 3QDJD 1MLBB 4GKNA 3NSXA 3AS1A 1E9PA 1DVZA 4Z7NB 4CU6A 2AK4E 4M4RB 1INQA 3MLTB 4PU2A 1AHMA 3U6RB 1N5YH 3NCYP 1FFRA 1C7TA 4U1NB 3QQ4B 2XWJB 3IMWA 3R0NA 1Y1DA 1AP2A 1AQDB 1ZHNB 2RFXB 3BW9A 4I9XA 4U1MA 4OGYH 3VFWB 4BDVB 5D7KD 1UFGA 4FTDA 4JCLA 2ZP9A 4NYLA 1ES0B 1LO2L 1U3ZA 3GHEH 4NO0D 2X88A 4KRMB 1U58A 4XPAH 4ZW6A 4NGHL 3D2TA 3MSPA 3V4LA 4OCYL 1BVKB 4ZAKD 3K6IA 3SKOB 4DZ8A 4LCUB 2GPZA 4LPYA 2CO7B 4GW1B 1N7ML 1IFGA 1V7NL 4HK0B 3VRJA 1B2WH 1LE5A 1SXAA 3UAJD 4DW2L 1MFMA 1QFWI 1QAWA 1EUUA 5DLML 2GCYB 4KXZH 3KPSD 4NKOB 5GIRB 3UPRB 2FX7H 4Q0XL 4A04A 5KSBA 1FG2A 3C5ZB 1F4YL 1Z0MA 3G5WA 4IS6B 5DJYA 2VL5B 5GS2D 2AK4D 2D7QA 1FORH 3SYCA 4DK3A 3SDXA 4DKEL 4NERA 1BZEA 5GHWL 5SX5K 5F7EH 5BZZA 4UINH 4NM4L 3L3GA 3SCMD 3MXWL 4KFMA 5IBLC 2H0JA 2ZUVA 5J7CC 4FFYA 3D85B 1KWGA 1TZHB 5EC1A 4I0PC 3ULUC 4TSAL 5CJQL 3MV9E 3B9AA 4P2OA 3TJPA 4B53A 4IRJA 1YYCA 2LABA 3C75A 1BV8A 3EYOB 3CK0H 3GRWL 4TULL 4UIMB 3N9GH 5H35B 3HMXH 1IB5A 5C0DA 5IMOB 3EFDL 3FO9A 3KGRA 3EO0A 1DZ0A 2PWGA 3VXPB 5IEHB 1BW8A 3WHXB 3O0RL 4LAQH 5JW4N 3AQDA 1DSYA 3GMNB 5L9DH 2CCWA 4G6FD 4PV8A 2WBJB 3WY1A 3VFVA 3CFQA 4QRSB 4FQ2H 1QUNA 3GDBA 1IM9B 4RFOL 5DO2D 1M2VA 1WBZA 4GAAA 4YSTA 4ZOCA 4Z7UE 5LHDA 2UZPA 3KYMB 2BCKB 1IC1A 1KSRA 2QLVB 2XIIA 3WUWA 5FWQA 1FL6B 1VCAA 2O30A 3D52A 3AXIA 5I0YA 3MOAL 4AW7A 1HHHB 1VFMA 2G5RA 2HFFA 4IU3B 4NPYA 1ZRUA 5HYQB 5JPNB 2A6DB 2YMXH 4DOHE 3GK8H 2HT3C 3PYCA 2MCG1 1XGQA 3TL5A 1TLMA 5KANG 4K71B 3O45B 3SYAA 5CD3A 1QYGH 4O2EB 2YGNA 5LAPA 3MV9D 3QUZA 4MVBD 3GGWA 5I16A 1SXBA 1QW9A 2B7DT 1PQZB 1IGJB 4JM2B 4OV6F 2WD0A 4R4NC 4OLXL 3OPZH 4W9CC 1S3KH