3NP4A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np4A00
2IDSA 2PP7A 1OV8A 4YSTA 1NWOA 1OE1A 1BAWA 1SJMA 2XXGA 4JHUA 4KOBA 4E9RA 7PAZA 1ILSA 1WA0X 3AG4B 4G71B 1GS8A 4AKQA 2BZ7A 5I26A 4HCIA 2GHZA 1EZLA 1FFTB 3FSVA 2VN3A 4DP4X 2BP8B 3EHBB 4CSZA 1L9TA 3EH5B 5I28A 4WTQA 1JVOA 4KNTA 3NJIA 4KNSA 2PPEA 3PAVA 2XX0A 2JKWA 4HCFA 4BXVA 3JTBA 1A65A 3UADA 3H56A 3ABMB 1XMEB 5I6LA 1R1CA 2XV0A 2X88A 4YSSA 4KO7A 2EIMB 1SHWA 6PAZA 3C75A 4K9JA 3FU8A 1BQRA 1FA4A 1J9QA 3ASOB 1PF3A 2UX7A 1KDJA 1ZV2A 1CYXA 1NDTA 1ETJA 1PZBA 1ZDSA 1L9PA 4X4KA 4M4RB 1PZCA 3ABLB 3UAEA 5I6OA 4A66A 2UXVA 1TEFA 1ASOA 2DWTA 2W8CA 2IWFA 3BQVA 3QJTB 4DP9X 3T71A 4TXVB 2R7EA 1GW0A 1AIZA 4M3HA 3NP4A 1BQ5A 2GB2A 2HRHA 2ZONA 3UABA 2GSMB 3PXLA 1FWXA 5F7AA 1CURA 4A68A 1GY1A 2IH8A 1ASPA 1CUOA 4DPBX 1CYWA 3QJRB 1SDDB 2W88A 1OCZB 1JZHA 1J9TA 4G7RB 3X1FA 3SQRA 1WA2X 3NSDA 3WNIA 2HX9A 4FA7B 1NIFA 1KBWA 1F56A 3GXUB 4GP5B 4DP8X 1VLXA 4UAHA 4ENZA 1NIEA 4N8UA 2GI0A 3JT2A 7PCYA 2HX7A 1OCRB 4HALA 1ET8A 2FT7A 1M9WA 1ZIAA 3FYIB 4KO5A 3H4FA 1SF3A 4WKXA 3NJNA 2DYRB 1ADWA 2X87A 3S3CB 5B7FA 4YSQA 3T6XA 2FTAA 2HXAA 2FQFA 1KBVA 1AS7A 5B1JA 3X1BA 5D4IA 3TBCA 5AFAA 4YSUA 1MZYA 3ZDWA 4F2EA 3CDZA 9PCYA 1JXDA 1OE2A 5B3SB 3QJSB 2BP0B 3AW5A 3CG8A 4AZUA 3D12B 4A2FA 1AQ8A 1JZGA 3FU7A 1NTDA 2YAEA 2ZXWB 3CVBA 1RZPA 4DPCX 3FQYA 5IY5B 5A7EA 1L9RA 1M57B 1MG2C 4G7QB 4BWUA 2YXVA 4YVUA 2PPDA 1MDAA 2HZHA 4PCYA 1XB6A 2XUWA 5B1BB 1JZFA 1GR7A 3NJFA 4GXFA 1IBYA 4Q89A 1E5YA 2BW5A 2MRYA 1PLAA 1PLBA 1QLEB 2Y69B 4DPAX 1A4AA 2OV0A 5D4JA 4F7KA 1AR1B 3IE9A 2QPEB 2QDWA 2AANA 3CVDA 1E65A 3NSFA 4YSPA 4ZK8A 3NYKA 4BWWA 1KCWA 4F2FA 5AKRA 4BWTA 4HHGA 2JXMA 4YVNA 4AKOA 2FQGA 6PCYA 1ID2A 1X9UA 4BXSV 4A67A 3PLYA 4DP7X 2YAOA 2BWIA 3OD3A 4AKPA 2EILB 2UX6A 1KYAA 1T5KA 5PAZA 1NIAA 1AOZA 2PP9A 5ANHA 1E5ZA 4G72B 5LDUA 1JVLA 2PP8A 1TU2A 4Q8BA 3X2QB 1ET7A 4DP6X 2BP8A 2FJSA 1BXUA 4DP5X 4A2GA 2CUAA 1RKRA 2FT6A 2P80D 3TU6A 1J5CA 4G7SB 3TASA 1SF5A 2VSMB 4KO9A 2VM3A 2AZAA 3EH4B 1IUZA 3PAZA 4YSEA 3HEIB 2YQBA 2PPCA 1J9RA 3ABGA 2CJ3A 2DYSB 3WNJA 1PNDA 4YSAA 1A3ZA 3X1EA 1N70A 2I7SA 3MX0B 3H4HA 4DP0X 5TK4A 4A2EA 1SFHA 2XYBA 4KOCA 1AZRA 2IDUA 3AG3B 2XU9A 3NJGA 2IDTA 2XLLA 2BWDA 2CCWA 2VW4A 1A8ZA 1ZDQA 1PZAA 3UAAA 1AG6A 2FT8A 4HCGA 1GS7A 3OMAB 1PMYA 4PAZA 1NINA 4DP2X 1DYZA 1AZUA 1AZCA 2I85A 2B08A 4JKNA 2PPFA 3N55A 4E9YA 2BO0A 4DP1X 1DZ0A 1J5DA 4MFHA 4BDVB 2HRGA 2Q9OA 5FC9A 5I6KA 2N0MA 5B7EA 1OE3A 3V9EA 3EH3B 1KCBA 2J56A 2WO2B 3CVCA 5I5JA 2FQDA 3QJVB 1IC0A 3NJJA 2VM4A 3NJHA 1HAUA 4E9QA 1SDDA 1PCSA 2HX8A 2UXGA 2XVBA 4UF7C 1PLCA 2I7OA 1WS7A 4QLWA 3S3BB 3WI9A 3ASNB 3G5WA 3S3DB 1GS6X 3WKPA 1URIA 5EHFA 3NSYA 2OCCB 2J55A 2P80A 1ASQA 1XB3A 2Y1AA 1KGYE 4QKTA 5I6NA 2GIMA 2YXWA 4KO6A 3U25A 1SNRA 3WKQA 1IBZA 2B3IA 2OJ1A 3BVDB 3FYEB 4GP8B 3NT0A 1RZQA 3FQ1A 1AZNA 5B1AB 3FPYA 3EF4A 4YL4A 2VW7A 3WG7B 2H47C 1W6LA 3T6WA 3AG2B 1J9SA 3NP3A 3ZIYA 2VMJA 3S8GB 1A4CA 2GBAA 2DV6A 2CAKA 3FT0A 2IH9A 1SHXA 1MZZA 1PAZA 3T9WA 1GY2A 2VSKB 4NAJA 1AS6A 5TK2A 1ZPUA 3X1NA 3PPSA 2BP0A 5I5MA 1WS8A 4GYBA 4YSRA 4A2DA 3RYMA 3ABKB 3QQXA 1N68A 3UGEA 2UXFA 3ERXA 3GDCA 2Q5BA 3OQRA 1QHQA 3PAUA 1BQKA 1A4BA 1PNCA 2AFNA 2RACA 3NJMA 1WA1X 1NZRA 3TBBA 2JFCA 4E9SA 2CBPA 1RCYA 1L9OA 1V55B 1AAJA 1SFDA 2J57A 3QPKA 1E67A 3DIVA 4AI7A 1AG0A 1X9RA 2BW4A 4JHVA 4W9ZA 1KDIA 2QT6A 3HB3B 1EHKB 1V10A 2ZWNA 1L9SA 1ILUA 2EIKB 3FSZA 1JOIA 2XV3A 1JZJA 2AVFA 3FS9A 2QDVA 2HLEB 3FSWA 3WIAA 4E9TA 2NRDA 2H5UA 1JZIA 3KW8A 4KNUA 3QJUB 3SBPA 5D4HA 3SBQA 4NERA 2R7EB 3AG1B 3IN2A 1PY0A 3X1GA 1HAWA 2H3XC 2TSBA 1GYCA 4GY4A 5I6MA 4HHWA 4P5SA 2GC4C 4YSCA 1UATA 4E9VA 1BXAA 2BHFA 3IBOA 1AS8A 3FQ2A 1V54B 5B1KA 1NICA 2TSAA 3AY2A 2J5WA 1YLBB 3T6VA 3NSCA 2A3TA 3V9CA 1MG3C 1QNIA 2WO3B 1BYOA 4YSDA 3TA4D 3FU9A 4HIPA 1ET5A 2FQEA 1NPJA 3UACA 3IN0A 2QPDB 3PCYA 2XXFA 2XV2A 2E86A 2IDFA 1HFUA 4G70B 2EINB 1AZBA 2DY2A 1KV7A 5B7MA 2ZOOA 3SBRA 2LLNA 2PPAA 2YAHA 3FPXA 2CALA 1NIBA 1BYPA 3QJQB 2PCYA 5I5IA 1JXFA 3CZUB 2YAFA 4YSOA 4FAAB 1NIDA 1JXGA 2IWEA 2PLTA 4HAKA 4L0PB 3CDZB 1BXVA 1M56B 2YAPA 3N2JA 3T6ZA 2IWKA 4NB7A 5E9NA 4HZ1A 4P5RA 4E9WA 2DWSA 1IKOP 3NJKA 3ZBMA 2BZCA 1TEGA 1XB8A 1NWPA 1OF0A 3S8FB 1W8EA 3KW7A 3FU7B 1OCCB 1OCOB 2IDQA 3OMNB 1B3IA 2VW6A 4E9XA 1JZEA 3OM3B 1AACA 4BDVA 4UANA 2IAAC 5AZUA 3DTUB 1OOWA 3L45A 2MTAA 1CC3A 1ZIBA 3ZX1A 2PCFA 1WAEA 3DKHA 1W6WA 1E30A 3AZUA 3NJLA 2FNWA 2FWLB 2XWZA 2YARA 4RH4A 2YAQA 2GC7C 3IEAA 4AX3A 1BEXA 1L9QA 1NPNA 2WSDA 2YAMA 2EIJB 5I6PA 3FSAA 4GP4B 5B1JC 4EF3A 2XX1A 4CSPA 4N4YB 5F7BA 3GYRA 3OMIB 1AANA 5PCYA 1I53A 1TKWA 1GSKA 8PAZA 1JERA 3MBWB 2UXTA 4BK5C 4A2HA 4W1TA 2AZUA
chains in the Genus database with same CATH superfamily
2PP7A 5I76B 4BGLA 2FK9A 3WGUB 5F0JB 3FB8B 5DWUL 1J8HB 4L8SA 4C4KT 4XRCA 5AVZB 3KDMA 3BT0A 3O11A 4QRQB 1KN4L 1HCZA 4JFZL 5EZJA 3DURA 2FZ3B 5DFAA 1LWJA 1S9YA 4Y4KD 5AOZA 5EUOA 2QFRA 3EHBB 4HHAA 4JCLA 5FYJU 1BVZA 3UP1A 5FFOA 4WTQA 1IGJA 5EU4B 4C83B 4L29A 3ZDZF 2VUKA 1BV8A 1MJJB 4L1BA 3NACL 2ITFA 2ZSWA 2X70B 5CJXA 1ZLEA 4KX7A 5ICZA 5IVXB 4PLKD 1TVHA 3CFDA 1A65A 1C16A 2XWRA 3H56A 3MNZA 4GKNA 4NAQA 3BAEH 3CLFL 3ILQD 4XMPL 2XIDA 3GI8L 1T0NB 5IVZA 3NOIA 2QGBA 4S1DD 3FQRA 2OXGA 3FU8A 4NRXA 1Q0YH 1A22B 3F8UB 1ZV2A 3QUGA 2NY0C 3MRFB 2ZKMX 3KYAA 3ZW3A 5DYOA 1UCTA 4X4YA 4Z7NE 3EFDH 1CS6A 3BVWA 5AB0A 1ZRUA 2X09A 1IAIL 5CHNA 4A66A 2BDNL 2ZAIA 3LVTA 4P46C 5A3IC 3GKWH 2W8CA 4K5OA 4PJFF 4ZFZA 3WY2A 4A7SA 3X14B 4CN4A 1YNLL 2X4QB 4JR9L 4JRYB 5B38G 3P0YH 4XVTH 3KJ4C 4XX1E 2DQEH 1EJ8A 4PJHF 5F7AA 1BLNA 3CMGA 1T1ZB 5LG1A 1SOKA 5IHBA 2MIZA 4WI6A 5E0FA 3ARED 4YFDB 5D5ME 1HC1A 3SPGA 5I66B 2NY4C 2X6VA 3U36A 4KZEH 4UU9A 3TM6A 1QYGL 3TJHC 4NENB 2XWTA 3QHZH 4GSXA 4Y4HA 1A66A 2QKIC 3W0WA 1WA2X 3NSDA 1DFBL 1DN2A 4XXCA 5D70H 2YSSA 3P4OB 4XXWA 1KBWA 2A0LC 4JM2B 1M7XA 2IAMB 4KKLC 1HX0A 4D8OA 2ZUWA 4GG6E 2EE2A 3TBVB 1A25A 4XOAA 2NQCA 2AABL 1M9WA 3HI6H 4FE9A 2X4PB 1ADWA 3BC9A 1GSMA 4RFOH 4CMHB 5A2BA 3D09A 3EFFA 3WJLC 4ZD3L 3HS8A 4Y9EA 3L81A 5I1HH 3N50A 2X44D 4G6KL 2X2IA 3ETSA 4U1KA 2Y36L 3RWCA 2D9CA 3O8XD 3WE1A 4KMTL 2EDBA 2GY5A 1E7VA 3DTXA 2JB5H 2ZCHH 1D5IH 2AEPL 1B0RB 3AWEA 2H26A 4JCMA 4ZUTA 2ZAHA 4OBSA 3GSNH 4M8VA 2W1NA 3DPBA 3FZUD 3IJEA 3KXFE 4TUJB 2ZCLL 3UTTD 3MZGB 1UZ6F 5BPPA 5F88A 1QAWA 5AKVA 4KQ4H 4LLMB 4S1RL 3VNYA 1V3JA 5KS9A 4RAUB 3MRMB 2XQYA 1UEYA 5TJWK 1UOLA 1TQTA 3KPRB 4ZMLA 1IGJB 4XO9A 4IRJC 3VA6A 1M53A 3BAXA 4ZT1A 4IW4C 2BOBA 1VFAA 2QQNH 2ZSWB 3NN8A 5E8EA 4DPAX 3HPLA 5C7XL 3CFDB 2FEDC 1P4IL 1QNZL 4FN0A 1C16B 4QTIH 3ARFA 4PR5B 4MZRA 5ITBL 1P84K 1FVEA 4KDTC 3LKQA 2A73A 4K3GA 1U4EA 4M9OA 3FQRB 4OZGF 4W70A 1G0XA 2BWIA 1IIKA 2J6EA 1MJUH 4G9DA 2EC9U 1FFOA 2YD8A 2ZD0A 3HN3A 5KWYC 1KJMA 1N19A 3QEHB 4LP8A 5DYOB 3GMLA 4LRNH 5E6IC 4OCLC 1EO7A 3X2QB 1ET7A 2Q20A 4KNQA 3F83A 3BKYH 3WL9A 2PN5A 1VRSA 3FOMA 4ZFZB 3RGVA 4OLYH 4JFQB 2GK0B 5K9QG 3NCYS 4LCWD 5MEQB 4Y1AD 1R0AH 1T2QH 2JKTM 5FGCE 1ORSA 1BLNB 2H9GB 5CGTA 2CK2A 3GRGA 1U3HC 3OKLB 4QOKA 4L9LA 1SXSA 3FUEA 3CDCA 2NNRA 5LBGA 3NEXA 5JIDA 5F71A 5C09D 4ZX5A 2X4TB 3HEIB 4FX5A 3ZDXF 2X5PA 4Y5YA 2ZCZA 1YC7A 5GJSH 4MMXC 2OW6A 2F54B 3MBEA 4UU9B 4M56A 1JHLH 1LK3H 2ITDA 2I7SA 4G8EB 5KBMA 3H4HA 1LE5A 5BS0B 3NZ8A 1U91A 2NDFA 2PW2A 4GJTB 3L8QA 5HD8D 5SV3A 3V4PH 5JO5A 5D1XA 4Q52A 3ZKSD 2WXKA 4PAZA 1RD6A 1NBYB 5LXVA 2CM5A 3M86A 4Y0GA 2FX8L 2I85A 5CJOL 1RZJH 3NEOA 4BUHA 2NCEA 3UTSB 2XWBB 3ZE0E 2KZKA 5HYQB 2FATL 3FH7A 2OK0H 1PPIA 2R1YB 4W68A 2COVD 1DBJH 5F1KC 2B2XL 2Y07H 1PIFA 2PCFB 4G5ZL 1J9CT 2LT9A 4U1KB 4XPGL 5GRJH 4OZIE 2P8MA 5IV2B 1DN0A 1P1ZA 3VD7A 4M7ZB 5CN1A 4EXPX 3BUPA 1PLCA 2DQGL 3GC3A 5I73B 3MRBB 3O6FD 2JJTA 1JZ2A 2WLJA 1IAOB 5DC9B 3VWJA 2V2WA 3GMOB 1XGRB 1PSKL 1Q8MA 3FN0H 3KGTA 4JDEA 3LH2H 4K23H 5B39B 1MIMH 1A3QA 1JGEA 1QUPA 4XMUA 4EIUA 3KCPA 2MCG1 4U0RB 5A2CA 3TT3L 4Z3TA 4X6DB 3I6LD 2PO6A 5GJTH 2R23A 5F88B 4C57C 1KBKA 5FYJH 1LO2H 3QS2A 2CJSA 4NBZB 2R69A 1RZQA 3APFA 1VERA 3DDFA 3LD8B 4YUEH 5KS9B 1J1OH 4I2XB 5ESQA 3ARBC 1OO2A 2VUYA 1VEOA 5IREA 5FB8B 1J9SA 4FQXA 2B1AL 2DV6A 2XIIA 2IH9A 2ZUVA 4CVWA 3HC4H 4NKMA 2BNUA 4HISA 5H94A 4Z7VA 5JQ6L 5E8EB 1QTYT 3DVGA 3DHUA 3QFJA 2IGLA 3AADB 3FRUA 3IRZA 4HOZA 4CC1A 5DJDB 2NX5A 5AOMA 3KPQA 3ZKMC 4L8DA 5FKAA 2VZ3A 5JHDA 3D85A 2VDRB 3OQRA 4YHIA 3LKQB 2A73B 5DRWA 3TBBA 3O6KL 5CUSL 4P57A 4G9DB 2CKNA 1ACZA 1AAJA 1FFOB 3MFFB 2IQ9H 2OMZA 3G6JF 3HI5H 5K59E 4D0DA 3QB7C 5TH2A 2R2HA 5GGQL 1KZQA 1T7YA 1MHPH 2HRLA 4EQ3A 5DRZA 4I9WE 4MNQD 2Z3FA 1ZT4B 3BW9A 3MRPB 4JKPH 4U1NB 5J9PA 1YVLA 3L4TA 2VXVH 3WMPA 4GBXD 3CBKB 5DDHB 5KSAA 2CO1A 3UG3A 3OAUL 4U7KA 4MA8H 2YD7A 3D9AH 1KXVA 1G7PA 2SEBB 3RLSA 4BZYA 3NZHH 3QZPA 4HWBH 3QDGA 4R26H 3L3GA 2ETWA 4UZSA 1UKQA 1TSHA 3MBEB 2F8VA 5DJZA 3FCGA 4KV5F 1JIBA 1U8LB 3V8CA 1NQBA 4L48A 3HE6B 3SDAA 3K1KC 4LSSL 1LE5B 1J7VR 3DIFA 3UPRA 2BMKB 1U91B 2A9ML 4R4BA 2IH3B 3U82B 4MTMA 3H2PA 5KJRH 1U21A 5CU9A 4BA8A 3EAKA 4L8BB 4ZTPL 4QKXB 3W37A 3BPCA 2VM9A 2F68X 4CMMB 3DJSA 3GMRB 4DKFL 4BM7A 3FU9A 1PIGA 4Q6IB 1T7VA 4YC2C 3KGRA 4QWWD 1XCQB 2WP3O 2E86A 4Y2DC 1IAIM 3TF7C 4U1SA 5EU7E 4L8CB 2XY2A 2DLHA 1M2OA 2DI8A 4WDIA 1MRDH 1DO5A 3QZBA 1I8LA 1HDMA 4LL1A 4AV5A 5I1LA 3PWPD 2PCYA 3U46A 1DFXA 3HNVL 1TVBB 1DN0B 5EULV 1HHGA 1OGPA 1P84J 1DEDA 2ZOKB 4JEGB 5C3IA 3KHOA 2IXQA 2VO5A 4HUUA 4GRWH 5F96L 3VSTA 1KYUA 1NJ9B 3HC3H 5IR1A 5T5NF 4UTAA 4JFTA 3TYGL 3CDZB 2M26A 1VFBB 4LEEA 2GJ6A 4O02B 2V2WB 1BZEA 3T6ZA 1S7VB 1S9KC 4UOQA 4OM0L 4JFWA 4NSKB 3VXUA 1NM4A 1UXSB 4XMKH 2JKJA 2WLYA 2XY1A 4MB5A 1EO8L 1PCXA 3KCPB 5KVGL 1KC5H 1FJ1B 1TEGA 3P9LA 1XB8A 4WJG3 2XKNA 1I1AA 5KBLA 4HPYH 3UG4A 3IAQA 3KMDA 1M3JA 1B3IA 2DLGA 2VW6A 3A22A 3S3JA 2CK0H 3L3OC 3C6LC 1V5JA 4W9DC 2KKQA 3Q2VA 4UANA 4PJDF 4Q6YA 5IQ7H 4J3XA 3FUFA 2OM5A 5DEGA 4UB0H 4I3RH 2EVHA 5C0BD 3H55A 5HJDA 2MTAA 3DHJA 1ZIBA 5AW9B 4JKLA 1GIGH 3F6LA 4H5SA 3ZUCA 2J1YA 3OKNA 5IQOA 3Q48A 1S78C 1JWMA 2HVBA 4XPAL 2XCMC 1NCBL 4R7NA 2X4RB 3Q2NA 1QBMH 3QFJB 2R2EB 3TIEA 3TO4D 4CADA 3EF7A 2YJQA 1EAJA 3WO3B 3P11H 5E6ZA 3PGCA 4NKDB 4ELKA 1NPNA 5FKAB 1A7OH 3D85B 1OAZL 4YHIB 2JCCA 3N9GL 2ADIB 2C9XA 3OG6B 2GFBB 2YN5A 3JUYA 5IJVA 3WN5A 5E1AA 2IPTH 2BCMA 3MBWB 1DCEA 1Z0MA 1F2QA 4W1TA 4XVJL 1X9LA 4JRYE 3C08H 4NLAA 4CILA 2KC0A 2Z93A 5DUPH 1MHEA 2EDQA 3FCTB 5GPRA 4ZBJA 2N56A 5E9DB 1MKFA 3P40A 4XP1L 2PYEA 1DBBH 2BZ7A 3VI3F 3BH9A 1EZLA 2ZF8A 1GKEA 3IXTB 3QIWB 4XNAA 1Z0NA 2IBBA 1EHAA 4QRRA 4M4PA 2R59A 3OXRB 4N0UA 4NJ9H 3IJ7A 5EBMB 1JVOA 3IMTA 5SWSE 3RVUD 1FLRL 2WC7A 5JIHA 4EUPH 4QXTA 5SWSD 3FTXA 5F7YC 3CFEA 4WKZA 4Y1TA 3LPWA 4DKDC 2QSCL 2VSCA 4K3EL 1UJ3A 4F92B 4OI8A 3QQ9D 5J6HA 3KWXA 2CA3A 5IEHA 4U1GC 3ABMB 1AI1H 4RGMC 4XMLH 2IV9A 4IK7A 5C07E 2F6AA 2X88A 4H7VA 3SDAB 3DV6A 4KO7A 1M2VA 2VNCA 4JJOA 4B9YA 4IKJA 2EO1A 1SYVB 5AYUL 1N6QH 1BD2E 4R4BB 4NCC2 4H0IA 2UY6A 5JOFA 4M5YL 1ZTXH 5FXCH 4P2OD 5IB4A 5M7QA 4TUUA 3BPCB 4PREA 2WJ7A 2ENYA 1MJ7H 4X4KA 2BPBA 3DVFA 5EDXA 3ABLB 1JZ5A 1AYOA 1J8KA 4MMZB 4MCNA 4N2AA 1K72A 3KYNA 4Q9CA 3RDTB 1QBML 2UXVA 3RIFK 4J23A 1UXWA 4OTXL 3GI9H 4U4IA 2AGJL 5C0IA 4CBZA 5AVTB 4N2IA 5GZNA 3U6RB 4FA8A 3U46B 4PY7A 5J1SC 3BSZH 2E8ZA 3LIUA 3KPSB 1KXTA 3EO9H 4NDMB 4TTDC 4FI7A 4DPBX 2AXFB 4JY5L 1HJBC 3LS4L 3X11B 2BSSB 4X0NA 4JQIA 1QSEB 2J7LA 1JCVA 4XCYB 2DWXA 2VWEE 1Q72L 4HJTA 4R4NC 3LB6C 3P2BA 3TEUA 4YHYC 5I1EH 2J88L 4U3HA 3ME0A 1S7XA 2VE6B 4LLUB 3F58L 4HGWB 5ID0A 5EZLA 4PJGA 1UADC 1N3NB 3NG5A 1PYWA 1XGYL 1R5WA 5EUOE 1Z1WA 4ZS7H 3WFHA 4NO3A 4R5VA 2OTWA 3RZCB 2P8LA 3FN9A 3ATDA 1ZVSA 4HXBL 4ENZA 5IROC 3FCBA 4X80H 2OYMA 2R29H 2WQUA 1OSYA 2R8SL 4YXHL 3U2SB 1Q9OB 4AZ8A 4KO5A 2FT7A 2GABA 4JREB 5DEGB 4AEHL 3NIFF 1A1OA 1G1KA 2YPVA 1I9JL 2G5BB 3QNZA 4ZMPA 3B2VH 1U4FA 4JBSA 1NBVH 4UT6H 2FTAA 3JWNH 1LDSA 3WDJA 4RBPH 5EH1A 1JWMB 5EPMB 5T8IA 5I15L 3D6GA 2DS4A 5AFAA 5H37H 5BO0D 2O5YH 2YA1A 1G7MB 3FO0H 1F4HA 1ZTXL 1ACYH 4OZFG 2AJUL 4Y9FA 3ESUF 4IRZA 3ZHKA 3NMEA 5ECGA 1INDH 5HI4D 5TE7L 2I25N 3HB3D 4MLSA 5DMIH 4KROD 3HZYA 3WUWG 1H3XA 1ZAGA 2DL9A 3O4OC 1MFCH 1XWVA 2Z7WA 3RKPA 4NBYB 5IQMA 3SE8L 5CU5A 4BYHA 1U8KB 2D0HA 1F13A 3O2DH 3I9AA 2FX7H 4WU7A 3W3BA 5J3HC 3DX4A 1L7IL 2WN3A 5F3HA 4QHMA 4ZSOA 4QXWA 3T3ME 1I7TB 1MHEB 1AXSB 5E95B 1HVXA 2ATPA 2Q8AH 3WN6A 5E6YA 4FQIH 3DJTA 3BH9B 2BIPA 3NZUA 5T1LB 3IKCB 1TZIB 4ZOAA 2QFPA 4XCCH 4LZKA 4N0UB 1XB6A 5BRQA 4PYGA 5HDWA 1A4KB 3NCJL 4K5LA 2DWEB 5HJ3B 1IBYA 3ARZA 4PRDA 4Q89A 5MHSE 4QXTB 1E5YA 3W0WE 3CFEB 4WKZB 3KVDD 4N9GB 4Y4HD 3GMQB 4KK6C 1UJ3B 3ZDYE 2EXTA 1AGEB 3W0WD 4G6JL 5I1DA 3D3VD 5IEHB 5MP6L 1IGML 1WTLA 3GS4A 1CJYA 7TAAA 3VXNA 4OLEA 4XC3H 4NNPL 3MMEA 4ZDHB 3N1QC 1RLBA 2UY6B 5H8DA 2OTPA 3SPVB 3BYTA 4XNQB 3KM1A 2DQMA 5JXAH 1MH5A 3WKNA 4A6YA 2X7LA 4TRPH 1XAKA 4BZ1A 2DD8H 2DIJA 2VZVA 1A6ZA 3QEUA 5AKTA 5HHOB 2VR7A 2Y6TE 4XGZA 2L7EA 1M7DA 5ICXA 1P6AB 1O5PA 4ZAKA 5J56B 1AOZA 3B3IB 3JWNC 3BP5A 4FL4C 4PGEB 2JQAA 2W59A 1F90H 1KYFA 1XGPB 1I7RA 2O5YL 4C56A 5IHHA 4WV1A 3FO0L 2A83B 1XX9C 4NQVA 1I9RH 2OL3L 4HUWA 2D3NA 4FCHA 2NMSA 1G7QA 3MRHA 3VGEA 3C5SA 5CP7A 2YZ1A 3B9DA 4PY7B 2Z8SA 2DYPD 5INCB 2DMBA 1J5CA 3MLYH 1SOQA 3DX6A 1P69B 4X9IA 4WWKD 2RQ8A 2OR9L 1YN6A 1KIPA 4RRPA 3FH8A 3WNOA 1LE9B 3D05A 1KTCA 3IDYB 1AC0A 1CE6A 3AUVA 2JCWA 5D7JB 5DVNA 3EZJB 5SWZA 1CK0H 2F2HA 1OPOA 3Q2WA 3VXRB 2OSLA 1KCRH 1RU9H 2G4EA 5EZLB 5KS9E 5I1KL 5T5FL 4PJGB 4QAMB 1PYWB 2FO4B 1YAIA 4RMRA 4MCYA 2CCWA 1GZHC 3DUSA 4OGAD 2XWDA 3UROR 3K91A 2Y06L 5HXMA 1F86A 1AG6A 1H3WM 1QKZL 4FLOA 5DO8A 5L2JA 1K4DA 4LOUD 3P30L 1MFBH 5LAPA 1YUKB 4N0FA 3HRZA 4R3SA 4YDVB 4AZ8B 2NSQA 4J5VA 4RIRA 3RNQA 1A6WH 2QEJA 3N43B 4CRPA 4DP1X 1WP6A 2FH6A 3B9EA 4YR6B 4FNRA 1W0VA 1BF5A 1XEDA 4XH2B 2G2NA 3D5OF 3HG1A 3ARFD 5K39B 3VFPA 1EJOH 43C9B 2FHFA 2D8KA 1GGBL 5KSBF 2FNBA 2WVVA 3NCXA 4KAQH 3LN4A 2VDQB 1FBIL 1D7CA 4HF5H 2YEVB 2GY7B 3UZQA 1U8MB 3RY6A 1TMCB 4L1SA 3ARTA 1CFTA 1L0YA 2AERT 2YC1B 4QLWA 1KZYA 5MEOB 2P24A 2X40A 3GLAA 1RULH 3D1MC 4UUJA 2Z92B 1NMAH 4S1SL 3RGVD 1IKNA 3MLVL 1GGIH 4PGBA 4X6CA 5DK2A 2OJEA 4QKTA 5F3HB 4QHMB 5BW7A 1YNTB 1SNRA 2X1PA 4QOKE 4NNYA 1K8DB 1X3DA 5F6IB 3QZLA 4KUCF 2VZOA 4OGXL 4IS6B 4QOKD 4V2BA 3FPYA 1J5OL 4O4YH 2ATAA 1HH6B 4ODHL 3CSFA 4QRAA 2JH2A 3RVVD 4J3OF 4AXWB 3K80A 4JM2C 1PEWA 1TR7A 4Y88A 1DJSA 2IAMC 2UZPA 3BX7C 4PRDB 5EMYA 3SZ6A 3Q13A 3BE1H 4ODUB 4FXLA 4K3HA 1EFXA 3A3YB 5SX4I 5JIKA 1K2DB 1AS6A 3HE7A 3ZY7A 5I1DB 1OSZA 5D1XE 1EGJL 4CMHC 1KLUA 5I5MA 3VXSA 1XSKA 3V6FA 5D1XD 5FEBA 1RZ7H 2UXFA 2E4TA 1HXKA 3OZLA 4XCNA 2ZSVB 3ECQA 3T8MA 4WNQB 2X4NA 2JFCA 4E9SA 2IADA 4KRLB 4A7GF 5GRYA 1NGZA 5HPOA 1M3IA 1DDTA 3QEUB 4D3CL 1A6ZB 1KLFA 3ZOAA 4XGZB 1F6AB 5ICXB 3EOBB 3IKKA 4UWQB 2H6PA 4D9RD 3MV7B 4AV0A 2FIKB 3NPZB 5DURB 3MV11 3HI1B 4HT1H 2CUHA 4W9ZA 2OCJA 1PFCA 2PETA 4WV1B 4P5KB 1V10A 4KAQL 2ENPA 3DC0A 5IWLA 4HF5L 1NUFA 1L4IA 2ZG1A 3IK2A 2JIXD 1XD0A 2ZOTA 4KI1A 1RVFH 4HUMB 5DJ0B 5AW5B 3SKNB 3RI5K 5I1AA 5JXEC 3C5SB 3ESNA 5CP7B 2VWEC 3G04A 4OQTA 4FJ6A 3VWJD 3VMPA 3QWOA 1TZOA 2EADA 4NERA 4BZ2L 1KIPB 3AG1B 1AO7A 2HA1A 4OLXL 4J8QA 3BH8A 3WNMA 4GAFB 3X3GH 5FDWA 2JK5A 3L1OH 4XC1H 3NFSL 2GQHA 4R9HA 1NLBL 1FDLH 2PO6D 1N5AB 3MLTB 3RPKA 3OC5A 1OP5K 1I1RA 1HCVA 5HYJA 4X8JB 4ANUA 2HKAA 3I3EA 1QABA 3DUSB 4MB1A 3FU5A 1X5ZA 4KX9A 4XE0A 1S7TB 5JYMA 1FYTD 2IWGA 2W60B 1YLBB 3U9PL 1FGVH 2PWFA 4FQXD 4EIBA 4J6RH 4JDZB 1TETH 2C1PB 3WNLA 2DDQH 2W9DL 4KHXL 5E8DL 4N0FB 3VX1A 1DO6A 1KYDA 4R3SB 3CHQA 3QFJE 4LO9A 4RIRB 3WY4A 1VGEL 1NCNA 4LVEA 4N5EC 3MJ9H 4M3JA 3VFGL 1DBKH 3B2UD 2EINB 2VGLM 3L7FB 1QO3B 1X4ZA 2XQYG 5JHDE 2BLFA 2NX5D 4O58H 5F1NA 1P4BL 4YWGH 1JAEA 4AGNA 2ZQKA 4R2GC 4B5EA 4KXBA 3SDXF 4XNBA 3OHXA 4YX2L 3TLRA 1L3WA 2W0FB 2EDXA 4PJHA 5ESVB 4P2QD 2VYRE 1WBYB 2CRMA 1CFTB 3OC8A 3LQAL 5EBGA 1BVOA 1KGXA 1KG0B 2P24B 5ALCH 3H6AA 5F93C 1VFUA 4F7MB 3MNWB 2VCOA 4UUJB 1JGLL 1NFKA 2A9NL 3GHEH 3PP4H 4LCCB 2JQMA 4M8QA 3QORD 1HN1A 2P3YA 2Q76B 5KSAD 1OCOB 2Z35A 5LKNA 4BCXA 4XMTA 2VN6A 4HW6A 3DX7B 2WQ8A 3LNFA 5E2JA 5HI3D 2DOCA 3QDGE 1RIHL 3EJUA 2VDMB 3TTSA 3QDGD 1ZVNA 1LHZA 2ZYHA 4KK8C 1WBZB 2FGWH 2NNFA 4AVKA 4UQCA 3I6KB 1DBML 2R4RL 1FDLL 2VDRH 1FF5A 3FUMA 4OUUB 4UM9A 5BJTB 1OZUA 1QR1B 3SDYL 4IKIA 2OXHA 1FNEA 5F8RC 4UILL 4PJXB 4XPTL 3AZUA 5JA9A 1CG9B 2ORBL 4FMVA 5CN2A 5IJKA 5B3JF 3B9VA 5DJCB 3U30B 2IGFH 3I85A 2G5RA 1EEUA 1Y1UA 5F7BA 4DESA 3GYRA 3OMIB 3WO4B 1N5YH 4LQFH 4M03A 2IADB 4MNGB 1UA7A 3IT8D 2GTWA 1M42A 1B4TA 1TNNA 2QVMA 4ODTL 4R97B 2JXMB 4M7ZC 1KGUA 3NJJA 5DVPA 3FO9B 1BXXA 4NLHA 5I73C 3NFPA 3S2AA 2XXGA 3HKFA 3JSSA 3KLHC 3N41F 2EUXA 3K6IA 4UTBL 2LAGB 2CHDA 2PABA 4P05A 2Y7QA 1WCBA 3O8XB 1FZMB 3N06B 1Z9OA 4QEGA 4DW2L 4GB9A 4U0RC 1ZPLA 3FF7A 1OAYH 4MJ2A 5IFHH 2GJ6D 3QWOB 2GJZA 3NAAL 1OPGH 5FPIA 2WNKA 4E41A 3LD8C 3VFSA 2ZX8A 3HR5A 3S3SA 3VXUD 1SN5A 3BH8B 5K9KA 1X7QA 1AXTL 3GXMA 4Z9KB 5LBVA 1DUZA 2F58L 3TV8A 5DGQA 1JPGB 1SJEA 1A14L 4RISH 1MFMA 1I1AD 2ZXDA 4X6EB 3UTTB 3EKCA 5BRZA 2YMTA 3MO1A 4UQ2A 2YR3A 4HDIB 3K0YA 5CJQH 1HZHH 1X7SA 2VXUH 2R0KL 4Q2ZA 4PP1D 3GPEA 4LARH 3NA9L 1NAKH 3ASOB 5EOQH 3PY9A 4RWHA 3GBNH 4OZGA 2X10A 3II2A 2F8XC 4B53A 4OY9A 1F8TL 5DHEA 4M4RB 4YZWA 4DTGH 4A7QA 4Q4IA 2HH0H 3QRLA 1KENH 4HLZH 3S4SG 2NLJB 3WXWH 4BHUI 4LSUH 2NY5H 2IWFA 2QPUA 5CCKH 3L9EA 1NMCB 5F1NB 2JCCE 3BP4B 4NWUH 2R7EA 3KH3A 4O02H 5GGSA 3IWVA 4KMQA 1OSEA 5E1GA 4AQEA 4JRWA 2GSMB 3O2WH 4LQFL 4OM1H 3JTSA 4L3EA 2OPCA 4J3BA 4JFDD 3P77B 4LE8A 3G6DH 3LNDA 4QRBA 3SE9H 5EEXA 1JPFB 1TCMA 3MPCA 1AD0B 2H2PC 1GGUA 2AQ2A 4AG4H 1J0KA 4OLUL 4ISVB 3PNWA 2NTFA 5J6GB 1RI8A 1SM3H 1E9QB 4NRZA 4A7VA 2PYED 2BFVH 4L4JA 4FABL 4QRRE 4AM0Q 3SODB 2CHNA 1Y6NR 4N0UE 4QRRD 2RFXA 4Y1AB 4YPJA 3DWTA 1EEQA 2J1WA 2Z35B 3FXIC 3GXUB 3HE6C 1VLXA 2VLRD 5D1ZB 3JT2A 5K9OB 1CD0A 4C59B 3PJSA 3SE4C 3HZKA 3BKJL 5C09B 4EPSA 2VDPB 4HXAH 4WO4A 4HBQA 3DXAD 2I9LB 2L7JA 4R5XA 1KJVB 2RQEA 4PB9H 3HC2A 3AM8A 4X99B 1F42A 3JQOB 1PGRB 1YEGH 4GG8A 5K93A 4PV9A 1RY7B 4Q6IC 1U93B 2VJXA 1KLGA 2DWYA 3OLEA 5DQDL 1SEQH 4UDUA 5A2LH 2XZCH 5IHUH 1UVQB 3LKRB 3KPNB 3H85A 5HHOE 5I8EA 5BUGA 4YHLL 1I3RA 4QTHA 5CD3B 2AJXL 3ALWA 2E59A 1BPLB 3VRIA 1JYVA 2WWMC 5E23A 3FH5A 1AQ8A 2E4FA 3NIGB 1W9XA 4ZRGA 3NCMA 4XP4L 2NY5L 2NY5C 5IY5B 2V4LA 3FO2A 5GZND 3ZE2E 1SQ2N 1VADA 4JK0D 2MNUA 2VC2B 3V0AC 5INDA 4WZ9A 4LLAA 2H1XA 1PQZA 1F2XK 4Z18A 2R15A 4DPRA 4PU2A 1UWEH 1XH3B 2A9DA 1BM3H 1V3MA 2BY2A 4MBRA 5F6HI 1XCWA 3U48A 3ARDB 2BSBA 3OSKA 4E41B 4PJGE 3VFSB 1TCRB 5IJDC 1U8CB 2JV6A 5EN3A 2FJHA 1PLBA 1BVKB 2Y69B 1BFOA 5DI8A 4F7KA 2EKJA 1FZOA 5TE6H 4Z7QB 4OFKA 5EF3A 3VXMA 4N8VB 2WTRA 2F15A 2UZXB 3I9IA 1KCWA 3L5JA 1IQWH 5FA4B 2QHRH 1Z9SA 6PCYA 3ROOB 3ESMA 1ORQB 3K81A 2DLFH 1L5GB 3SE3C 1WV7T 3NK3A 1IIIA 4LBAA 1UFUA 5I0XA 4OGQC 5KSVB 4F57H 1E5ZA 1T0PB 1TQWA 3G6JA 4DEPB 1YYMH 3DA0A 4HJ1A 4IQHA 3DO3A 4GIPD 4MJ4A 1DLFH 4XNXH 4NIKB 1BAGA 2BH0A 4AQ8A 4UTAH 2ICCA 1BBDH 5CBEA 3V5DA 4CGTA 5IB1B 4JAMB 5DLML 4LCIH 3SQOL 4FFZA 1RP9A 4LHUD 3HOGA 1SF5A 2FECI 3GMMA 3JTSB 2VXQA 4L3EB 3RX7A 3FOLB 1TXKA 1IUZA 3QIWC 4XZ4A 4ZSOE 4G7YH 1N2RB 3KPPB 4JVWA 4CC4C 3QEQA 3ABGA 4X6BB 4PTTB 1JDCA 4H40A 1Z66A 1YMMB 1HESA 4ANWA 3K6SB 3WFEL 4KY2A 5CFHA 4DKEL 1HXMB 3MV8B 2MNJB 1I7UB 2IDUA 5L88H 2IDTA 4ZJ9A 4IJTA 3WE6B 1R75A 2BCKB 4AH2B 2DTML 3KS0H 3SDAC 1UGKA 4G3YL 4YDIH 4UNVA 3ZZQA 4OLWL 1M9SA 2DICA 1B9ZA 4ZXBB 4ICWA 1P5UA 4Q74A 1YEKH 5AW6B 3T3PB 3GSRB 3UDWC 4APQA 4F7PA 3OKDA 2EICA 3S96A 4JZJC 1HYSD 1YEWA 3DX2A 2DRUA 1J12A 2JI1A 3G5YA 4Z7WF 3OR7A 4MMZC 5LCVA 3RDTC 4ANVA 1RUPL 3CH1A 1OB1A 5I8EB 2XVBA 3HCVB 4PJ9A 43CAA 4FXGC 5E5RB 2JWYA 3WFZA 2YFNA 2NW3A 3EG9B 4PRHA 4ZAKD 4X7SH 3S3BB 1A4JA 5TDPB 3BDYL 1DZBA 4C56E 1NGQH 2YD5A 3JT0A 5K5YA 1YG9A 1JPEA 5ACMA 1DLFL 4C56D 2JLPA 2ITEA 4GW5A 4M7LH 4MB3A 4JPSA 4DGYL 3C8KA 3M45A 5FUOL 1ZT1A 4XWOC 3VW3H 1HL5A 3WLWC 4WW1A 1GXEA 5FUCC 3RWDA 4PM1A 1X5FA 3QDMA 4JB9L 4RNRA 1CD8A 5C0GB 3NJVA 5BV7B 5FHBL 4DIXA 4WTZA 5HYIA 5GRUH 4KVNL 5GGUA 5SWZE 1YY9C 1ITBB 4G7YL 3EJTA 4X4XA 3AG2B 3QCTH 4PJDA 3FB7A 1J1XH 4HS6A 3RZCC 3RWJA 4D0BA 3H1ZA 4N6QA 1AQHA 1SHXA 1L9NA 3G7TA 1KB9J 2E56A 4AL8H 4K3JH 2RA1A 4P5TA 5HJGA 2FJHB 4JREC 4F37K 1JRHL 2OMUA 2OZ4L 1H0DA 1FZOB 3CUPA 4Z95H 1F02I 1WS8A 5G4OA 2VISA 3K0WA 2OMXA 2Q5BA 1FNSL 3E2HB 3MCKA 5FX3A 1I8MA 4BA0A 1R3IH 3IJSA 1XTLA 3MOBH 3MFGB 3H9ZA 4GQ9L 4DZBA 2O61A 2F1AA 4G6MH 1HQRA 1VZIA 4O2FA 5HHXL 1Q0EA 2KZWA 1YEEH 2YMXH 3MLWL 3IFNL 5GSVA 3O9WA 3HG1D 1C08A 3REVB 1Z3GL 1E67A 2BIIA 2A38A 4PJCB 4HEME 4X5WA 4WNJA 4JQIH 5FYKD 4QLRA 2XV3A 4JFEA 1PAMA 3V5DB 3BVVA 1KY7A 3VI3A 2DJ4A 2IQAB 3QJUB 3QH3A 4FG2A 1WT5A 3HZMB 2FECL 2AQ1A 2FDBP 4FQ2H 1BX2A 1U30A 1ETA1 5BQDA 1MF2L 2VQ1A 4M7LL 4X6CE 3EO0B 1G7JA 3QUHA 4NKIH 5DMGC 2TSBA 3T4YA 2F9BT 4KGLA 1O75A 4MS8D 4YHZL 1KTLA 2E75C 1NMBH 2NXYB 4GRLA 2WBJB 3QQ4B 1RZFL 1XT5A 4KXZH 3QZMA 3JZ7A 3RIFF 4ZPVA 4N90E 5AD0A 3EO1B 1AFVH 1TJHL 5FO8A 4HH8A 2J5WA 3GXFA 1FIGH 3NSCA 1DR9A 3V9CA 1ZEAL 2FAUA 3V7AE 1OHQA 4HS3A 3TA4D 2Q1EA 1EXGA 1WEJH 3PE9A 3DX9B 1EFXD 1ET5A 1ZT7A 4PLOB 1EUTA 3HE7D 4FGMA 4G83A 3SOBL 4JRFA 4RWYL 5C0RH 2QPDB 3VXSE 2ICEA 2VDQH 3WKML 1FH5L 4G70B 4F7PB 5BXFB 1MCCA 5T33L 4YO0A 2Y5EA 3H7BB 4PRBB 1RIUL 2HAZA 4HUXB 4ZO9A 4FG6C 4HFUH 4LSRH 1D5MA 3EJYD 4DGVH 3O41A 5K33A 3NJXA 4DETA 3QCVL 1SY6A 4LPVA 3CH1B 3T2NL 3RP1A 3LRHA 4PJ9B 4G6ML 3VA2C 43CAB 5CGYD 5JTWA 1GZPB 3HIZA 3RG1C 2BIOA 3J27A 1QD0A 4A39A 1IGCL 1ZXQA 2FJGB 2XFXB 1NKGA 4NS0A 4KJYB 3ZK0A 4JKMA 3ZHFA 1JVKA 1AQDA 5TDNA 2DQCL 3QDJB 5JHAA 2X9ZA 1D6EB 4DZ8A 2NCMA 1FRGL 3EYFB 1ZT1B 5D7JC 4HWNA 4EVNB 2KDGA 3WSQL 2QHLA 4WW1B 1RERA 4GAGL 5K1NA 3RWDB 4M6AA 3FU7B 4U49A 1AO7E 4UV7L 3D0VA 3CVIL 4UYPA 3PHOA 1AO7D 3Q1SL 2IAAC 3M46A 1JK9B 3ZDZE 5EO1A 1OOWA 5DFTA 4HUKB 1MFAH 1AH1A 2ALWA 4C4BA 4L4VA 2W91A 1JYXA 1F0LA 3PWUA 5HYJE 1AGBA 1G1YA 4F93B 3DV4A 1A7PH 4O9HL 4BK5A 3LQMA 4JRXA 4RRPG 3LYRA 4Y2NA 3RWIA 5ABDE 1K8IB 4N2NA 2X3AA 3EOAA 3CUPB 1AFVL 3QUKA 2NZ9C 2GC7C 4HSCX 4OLVL 3R8BB 5IMKA 2VISB 5H35A 4JQVA 3P3TA 1JFQH 2XWCA 4DZBB 4N4YB 4F8NA 1ZK5A 1UZGA 1F4WL 4WI2A 2OQJB 4XAWL 4OFQA 4WY7H 4ONGL 2Y9RT 4RBPK 1R3LB 3O6MH 1HQRB 5K9QI 4X7CC 5C0JA 5BUAA 4HZLA 2Z31A 3TVMA 4MA3A 1C08B 4N2EA 1SJMA 4E9RA 3H2QA 1OGAD 1MUJB 1IGYA 2BY0A 3OWEA 4R8WL 3AG4B 4Z78B 5KVDE 4IBUA 1E6OL 2QKSA 4XWGH 4JFXA 3S37L 3WUZA 1JHKL 4PJHE 4AKQA 4AQ1B 4AQOA 4WFGE 2VUOA 3QJXA 4F2MA 5CLWA 3CE1A 3D39A 4KROB 1YQVH 3EBIA 4Z8FL 5HVWA 4PJIB 5EOTA 5F6IC 1F3DH 1H5BB 4IBWA 2VQ1B 2PPEA 3QRBA 3IVKB 2HT3D 4HCFA 2BP3A 2DBLL 2E6QA 3T4YB 2K4WA 2YQ3A 4TL5A 3GLDA 3BDBA 3VGAB 2V9UA 3P4LA 1XMEB 3CFBB 2V7HB 4OCMC 1CDIA 2D7TL 3MLRH 4CBPA 3K74B 1QLFB 1A6UH 4IU2A 4TULH 1PL3A 3B2PA 3MJ7A 1QFUL 5AD0B 5I23A 1Z9NA 5MERB 2VH5H 4Z1PA 4UM9D 1Z5YD 2HTKC 3LSOB 3L3JA 1E2VA 2ZOUA 2D31B 3UFIA 3FT3B 1U8QB 1H3UA 1INQB 1MFDH 4CVZB 2FE0A 2ICEB 1N59B 2XTJE 2DEXX 4FNSA 1OALA 2R0LH 3KYOA 1WIPA 4XAKD 3W81A 5KBKA 4K0OA 3V6BR 5DJ2A 3ILPB 1BQHB 1SLXA 3W9DB 4KKAC 4P48A 2Q7YA 5I8CB 1JFQL 4GXVL 3O41B 3GRWA 5DU7A 1U8OA 1GY1A 2DJSA 2EO7A 4WV1C 1OTUC 5DD6B 3POHA 1ASPA 1M7UA 3QPQD 1A6VH 1GVIA 4RCAA 4Y19A 1PG7W 3MODH 5LQBH 5KW9L 4TVSa 1TTRA 1SDDB 4PJBF 4XCFH 1RUAH 1RJLA 4J4PC 4UIMA 5TDNB 3QI9C 2ZG3A 1UZ6E 2FO8A 1KTDA 3CC5B 3G6AA 4G7RB 3X13B 1CFNA 1IE4A 2VDMH 3X1FA 1UYWH 4KRPB 4AEEA 1CU4H 1AYRA 2W65A 3QA3A 1LL1A 4HFWA 1VA9A 2DIBA 4LSQL 4JPIB 1JI1A 2HX9A 4E41E 1F56A 5ERWB 1ZGLA 4UAHA 4LDCA 3BAYA 5A2KH 4L05A 1ZIAA 1RZKL 5BRZE 1NDMB 2RHEA 2X87A 2PR4L 2XTSA 4BSWA 2WXPA 5FFGA 1WYJA 3EGSA 3PWUB 4PJ8A 3KYKH 1H8OA 5BRZD 1EV2E 3REWA 5CR1A 1IGTA 2MCPH 1UASA 4H44C 2R0ZL 5D6DA 4LL4A 3ZL4L 1A3LL 3WXVL 3ZZSA 4FNLH 4QXUH 5FM8A 4F9PC 5H35B 3UTQA 4M1DL 5KSBA 4LEOA 2Q3XA 3ILQC 2VQ4A 3CG8A 3HAEA 1T1XB 1XGTA 2F0CA 5AAMA 3E1ZA 3U4AA 1FFPB 4HZLB 3LX9A 2J4WL 4MA3B 5DXWA 3B9KA 2EVJA 1ND0A 1SJHB 1BOGB 5LXGH 1IGYB 1M57B 5FA3B 1BZ8A 2JJWA 3DI2B 4L3EE 4OZHA 4JFXB 4NP4L 4TQPA 5JNYB 3IGLA 1XZ0A 3HRPA 4YHMH 5EOCL 4N2OA 1LP9F 2V5YA 2HKFL 4LCCC 4ZQKB 3LKNA 4MYWB 1A0QH 4JPWL 5HYSA 4S11A 3ZDXE 2HB0A 1YMME 1QMUA 3OB8A 4MQXD 4CA4A 3MV8E 1ZY9A 2XA8H 4ZO8A 3CFQA 5CZKA 2ZOWA 1QLEB 4KHTH 4NQSA 1ZSDA 1AR1B 3DMMA 4KJWD 5D7SH 1Y1DA 1KCVH 4AIEA 2AXWA 2QPFA 1LWRA 4HHGA 3H9YA 3HUJB 2DQFA 3EZ8A 1QPPA 3LV3B 1I1YA 4EOWH 4PVBA 2YAOA 3V4UH 3N6YA 4U1IB 4WO4D 4G8GB 5TGBA 1N26A 3SDCA 5E00B 4BH7A 3L3JB 4A7GA 1BDYA 2GIYA 4QRTB 1L9MA 3U30C 3CJJA 1OLLA 1JGVH 2NY7H 3WO4C 5KVDH 4F20A 3WJMB 4JGMA 1RUQH 1U8HA 4R97C 4FNLL 1BIHA 1D5ZA 3OR6B 4X8CA 5HY9A 1BQLH 1PBYA 1UT1A 2BOLA 2B8OT 2VM3A 3CD4A 1ES0B 3O8XC 3RWGA 1OAQH 3PHQA 4OD1L 3G9VA 4MWFA 1EBAA 1BZ9A 1KBBA 3ZR6A 3PDOA 3QZWA 3WTYA 4UIMB 4D94A 2UYLA 2I27N 3ZHNA 2KHAA 3KPOB 4YSAA 4PWGA 1CFNB 3GHBH 1N70A 3MX0B 4EQ2A 2MQGA 5TK4A 1GYWA 2XU9A 4HFWB 2JIXB 2F61A 4ZI8A 5T1DH 4MNHB 2BERA 3VH8A 2DM7A 4EZJA 5CWSB 1CIUA 3WNPA 3HZVB 2W80C 1IC7H 3H42H 4HOXA 3MROA 1INEH 4WFFD 4QRPD 4Y16A 2V5SA 1IQDA 2ADGA 1MPAL 1YEDB 5E5LA 3CN2A 1DZ0A 2V5RA 5I1IL 2JKSA 1ANUA 3A4EA 4UQ3B 3PNRB 1CD9B 3EGSB 3REWB 4EI5B 4X98B 3UGUA 3VXMD 1IGTB 3FTWA 2OLDA 4PEEA 3CVCA 3ILEA 3QJVB 3U0PB 2FRGP 5BOZG 1KCUH 3OZKA 4E5XA 3P4MB 2HX8A 5L6YH 4MJIA 1NMCC 3UTQB 4I8DA 2VITB 4LEOB 1MRFH 2VC2H 3G6JE 2DAVA 1XGTB 1J18A 1NSNH 4PJCE 3MRNA 2WTPA 4QRSB 5I0WA 4I5BA 2HG0A 4J8RB 2XRAL 4PP2B 1R5VA 4LCYB 4B95C 2R0WL 1JK8A 2JJUA 3AU0A 1ZCRA 3AAZB 1GJIA 5I2IA 1VACB 1BQLL 1GGYA 2QV2A 3B2MA 4FXKA 2NSXA 3MV9D 4EMZA 4K7FA 3U25A 1RUMH 3E8UL 2YUXA 3E3QC 4OZHB 1IBZA 2OJ1A 3OB0H 5D7LD 1MFEH 2DWDB 1XZ0B 3NT0A 3SPIA 1T0MB 5D2LF 5IBTH 4LLDA 1UCBL 4YL4A 1QFWH 2NY3B 3HA0A 4TVPD 5DWPA 3LKNB 3QEQE 5IKCB 3QUMB 5CILH 4GXUM 4HS8H 3H9SA 2XQYK 3EYVB 3QEQD 1FIEA 4OJFL 3CZEA 5CMAA 1MW3A 3FUHA 1HINH 1CDUA 2H0JA 3BSHA 4JG1L 4KV5E 4WUUB 5D1ZC 3BHBA 2DL2A 2VDPL 4H25A 4FEIA 4LLQB 4NQSB 5F7EH 3X1NA 4OCRL 1IILE 3QORB 5JR1L 4DAGL 4FOMA 5MEPA 1XBDA 1FH2A 4YHKH 3GDCA 5L2KA 2DQFB 3UBXG 5HPMB 1UH4A 2WO4A 3B2XA 1J05B 2RACA 1BEYL 1KJ3H 5CEYB 2DQUH 1MFUA 3R0MA 1OAKH 1YECL 2ITCB 3MBXH 4OIAA 3CFJA 5K9JH 2I32A 1SFDA 4JG0L 4APQD 1T5XA 3QRGL 2D03H 2Z9TA 4NC0B 4LGPB 3RGBA 4Z76B 2VAAA 3TZVA 2DTSA 3SD2A 2H3KA 1J8RA 1U8HB 4QY8A 5IB5A 1T89A 5HY9B 1JZJA 1IBGL 4JHWL 2GW5A 3MUUA 5AWNH 4DGIH 5JHMA 1SYSA 4Q56A 3HG3A 4PRHD 1A7NL 5CZXD 4HIEA 5HGAB 4NZUH 4KFMA 3TBWA 1KJ2B 3FTSA 4AYFA 3T0EA 5C6TL 5I6XB 1D5XB 5CSZB 4MWFB 1UFGA 1E3XA 4N2LA 1BZ9B 4POZD 3QDME 4JDVB 4N28A 5DTFA 3PDOB 1LD9B 5E1IA 1TJIH 3PXHA 1RUML 1F4YH 2DJMA 3ARDC 3QDMD 3ZPDA 5JQIB 1EHLL 4WU5A 1QVOB 4HQQH 5IEKA 1XR8A 5IBTL 1AS8A 4PJDE 1A1NB 1WDAA 3AY2A 2KPNA 4ZFOA 4C4UA 2A3TA 2YD2A 3GO1H 5EU6A 3ZQ9A 3QARA 2P7TA 3QDHA 2OYLA 5LUMA 2ZUUA 1YO4A 4ZO6A 3FTGA 4J27A 4GINA 4HAFA 4JFPB 3OPZL 2R27A 3D69A 2Q6WB 3Q06A 4XPFL 5JORB 4DEPC 1NPUA 1RXLA 4XNZB 4OSUL 2FX9H 1Z9PA 2WTOA 5KYUB 5K9JL 3BWAA 4FAAB 1KPRA 2P45B 2B14A 2Z4QB 4F27A 3BAWA 3O9WD 3MRNB 4MD4B 1AP2B 1XFPA 5GGVL 4QF1A 3G5ZB 3U7WH 1J48A 4YHPA 3BAJA 5TF1L 3SJVB 3WIFB 4Z7OF 1UM4L 4JFED 4EE2A 2ZKHL 1S7WB 2QSTA 4HP5A 4K7FB 1BIIB 1L0QA 5GS1B 4C8XA 4QHNB 3LZFL 1IVLA 4YDKH 2F8OA 4ATWA 2VN4A 3V4VA 1OAUH 2AQQA 2PW1A 1DQQB 3C6EA 3PWVA 3H9SB 4I4WA 2CKBA 3UYRL 1A6PA 1JTTA 2X4SA 2OP4H 5HBBA 1MCIA 3FU0A 1WAEA 1P7BA 4GRLD 1PD6A 1NC4B 4IOFD 1MCLA 4PS8A 4POUB 4H25B 4JY6A 2X4UB 3D33A 4GMSL 4TUKL 4DFHA 2G60H 3ZYZA 4ZXBC 3LDBB 1K4CA 4PBXA 5C0AD 1EAPB 5HGBB 3ZMRA 5EWIH 2LABA 3SKUD 1TFHA 5T3ZE 3WU1A 5L2KB 2XYCA 1NGYA 4Q0XL 5D5MF 2VLRB 4IDJH 5IOPB 5T3ZD 1P2CA 3GXNA 4UZGA 3LKOB 3TT1L 3MLSH 1P4UA 1MQ8A 4JO4H 1NCTA 3BZEB 2DM2A 4ELMB 1T5XB 4OCNC 1WFMA 2OZNA 5G5DA 4OV6F 1E27A 1UB6B 4JHUA 4TNGA 1N4XH 1OARH 3RTQD 1SDYA 1ILSA 2VXQH 3KBPA 3X3FH 4F15B 4QWWC 1T03L 3ULAB 1ZWIA 4UDTB 3TV3H 2X3CA 4GG6F 2IPUG 2WINA 3UH8A 2QTVA 4ZUSB 1C1EL 4JANA 5A6LA 1M05A 4K94L 4V1DB 4FF9A 4FFWD 3EH5B 4CKQA 4EZLA 5EEWA 1T2JA 2HT2C 3GSWB 5BV7L 4BFOA 1Y7VA 3K6NA 3APNA 4AYFB 4PS4H 5BV7C 1GZQB 3QUXD 4HLJA 5B4MD 1IC1A 2JB6B 3UTZA 1T6BX 1KELH 4CU6A 2E74C 2GJPA 3NFNA 3IFLH 5I6LA 3BEWA 1L7TH 5L8KB 1SRDA 3VG0H 5T5NG 2QVIA 1KTJA 4RGND 4IHOB 4NNXA 4M7LT 5JLZB 3I02B 4ZFOB 3BPNB 1H3GA 4L4VD 2OP4L 3KL3A 3NIFE 2XQBH 3N04A 5AVYB 3KPLB 1EERB 3E2HC 3QEGL 4IMKC 4FNTA 4JRXE 4NHCH 5I0VA 4GUPA 3ZRFC 1CGXA 2WLIA 4JRXD 4YNYA 4YHOH 4UT9L 1TEFA 3LN5B 3L08A 3MRCA 5HGGS 2KLRA 4BBWA 4C4KO 3M88A 3QJTB 3AY4C 3ZE1B 3QYMA 3QNYA 2MHAB 3NRQA 6FABH 4EN2A 1NGXB 4MZ3A 5IW1A 2F7QA 4L1TA 4AQ8C 3CFKA 1M6OA 2EDHA 1BQSA 3GSUB 5C08B 4UIKH 4A2LA 2Z31D 3TVMD 2X0VA 3BCDA 3MXWH 4O2CB 3VO0A 5CD5D 1QSFA 2CM6A 1YEFH 1V27A 2ARJB 2FLBT 2NNCA 3WNKA 3L3HA 3E9UA 4FTVB 4X5PA 5J1AA 5KYWA 1GJWA 1ZANL 2EKSA 1IGFL 4WLCA 4F2ME 1B2WL 3D39E 4MYPA 3GB7B 3KLAB 3TN0A 1D9KA 4OD3L 4WI5A 3D39D 1A6AA 4PRIA 4TSBL 5JW4M 2NXYC 4LHUB 2G9HA 2WBJC 3HBQA 1HXYA 2BS71 4R7VA 3BDXA 1HWWA 4F5CA 4DO4A 4CAGA 2VR4A 1U41A 5ADPL 3U0WH 2Y6SD 4FQCL 5D8JH 1DL7L 3RL2B 3H4FA 1WE5A 4PJEB 3UTPD 1Q4NX 3CVHA 2YD6A 3BGMB 3QIBD 1LWHA 4S2SA 3PL6B 3CXDL 1EDQA 4PW4A 4HIIA 3TONA 1F6FB 3LPPA 5DRNA 3O4LA 5D93B 3EYQC 3RNKA 4QHPA 1DLHA 4Z7WA 2XZAH 1LJMA 3F64A 5DA0B 4YQXL 2YLHA 1E9PB 5DC0A 1S9VA 3AW5A 4GRWF 5CLYA 3EIFA 3WV0A 5TPWH 4H1LA 3V0VB 4IOIA 2HJKB 3H0TB 3OZ9L 3AU1B 5TFSH 3HW7A 2FB4H 3WLBA 3N0AA 4Z7UB 1JXKA 1E40A 4PJ9C 1VSCA 4QO1B 1U2YA 3TYFA 4H2CA 1NCOA 1E27B 4ODWA 3VD5A 4EEEA 5KVFL 2EDJA 4U1MA 1FI8C 3QO0A 3UCQA 1IM9A 1N10A 3WFBH 3ZKND 5T3XE 4TSAL 1P9MA 2AJZA 2WGNB 5HHMB 2FJUB 1MSPA 4Y19E 4F37F 1UA6H 1MN4A 4MCZB 2M1KA 1EDYA 4Y19D 5FW8A 3LZLA 2AI0L 1CE1L 3BUYA 2YGQA 3WDHA 4B5ZA 5I17A 5B1BB 1KSRA 4LB8A 3DHPA 5J13B 1GR7A 5IBLD 1DJYA 4JQXA 1I8KB 2FLRT 4MD5A 4Q9QH 2BW5A 1KN2L 2MRYA 3B2DC 2EDMA 4WFED 4ONHA 2JELL 1H6EA 4I89A 3TWCL 2ZE0A 2XZQL 3BT2H 4OZIF 3BKCH 1J11A 3SD5A 4LCUA 4XE5B 4ZOBA 1YYLH 3DROB 4YHNA 2LLGA 4QHUA 4XOEA 4JPKH 3JTTA 3ULVE 3T6QC 4BXSV 3L9RB 4I18A 4NNXB 4KTEH 3MRRB 4PBVC 1EANA 4YFLF 4PJ8D 4IRSD 3H7LA 4LGSB 4U1LA 3EJZC 2WXHA 3OQ3B 3QVAA 4GUPB 1DDHA 1NCCL 1UZ8A 1ITCA 4JN2B 2V6HA 3HBZA 3PF2A 4HA1A 4D9QE 5KSBE 1NCDH 2FJSA 4PRNA 4KTGA 1OAXL 5HDQH 4HCRA 3KZ8A 1MHHA 3T08A 3JVGC 1U8IB 2WANA 3IDGA 1T1YA 5E70A 5I16B 3ZGIA 1WZAA 4G7SB 8CGTA 3RHWF 3INUH 1KTKE 2GUOA 4AQ1C 3MRGA 5ICYB 4P3DB 2DH2A 2YQBA 3B9KD 4K9EL 4OZHE 4KROC 4K9EC 1Y0LA 3MGTB 2XG4B 5C0CD 5DVKA 1TZGL 4F58L 2YUVA 4MAYB 1PNDA 1H5BC 4G80B 1II4E 4YS4A 4PBDA 4WFHE 4A2EA 5EZIH 2V9QA 1U8NB 3LMJL 1NCAL 3F7RA 4P49A 2EEBA 4WFHD 3OKOB 1Q9WB 4JLRA 3TN0B 4D9LH 4KUCD 2XNAB 4HGMA 1QFWM 3WD5L 4PRIB 1B4LA 3VGAC 3RIAK 2G9HB 2XN2A 1CN4A 3MLXL 3J07A 5GRXG 2G0LA 5CIPB 3B34A 3EGXA 2BSRA 2EUZA 1J5DA 4ZYKA 3DMMD 1AHWC 2A6KA 3BKCL 3Q0HA 3EGDB 3GEWB 3VGGA 1IL1A 2D9QB 4FNPA 2L7QA 2UY7A 1SZNA 4S2SB 3UPCA 1DE4A 2CO6A 2FQDA 2ICEC 1DLHB 5EBLB 3RWFB 4H26A 1F00I 2EDWA 1Q90A 4JDTH 4WHCA 1JZ4A 1I9IL 3AT0A 3FO1B 3KR3L 5FKPA 3GGWA 3GIVA 3SDCD 5A43C 2GYSA 2BNQA 1JPSL 4H1LB 1DSYA 1CFVH 1RJZB 3TIDB 5C71A 5L9DH 1IM3A 3AT9A 1BVLB 1SBSL 5IG7A 1CGSH 3ZT6A 2Z64C 4NZDA 3RWEB 1SLUA 4W9IC 1XB3A 2C3VA 2B59A 2BVYA 1EIBA 1HOCA 1JMZA 1IM9B 5DJYA 3CGTA 3WFCL 3UP6A 4AEFA 4GI8A 3SKOB 1A9BB 1A2YA 3IMBA 3FTUA 1QLEH 3ORJA 4KRPC 3WG7B 2ZUSA 1HILA 3K5SA 2VMJA 1HOEA 3ARVA 1EJ6A 4RESB 1G6VK 3HC0A 1E7UA 1MCWW 1XSIA 2FJFB 2VSKB 2ZOLA 2O6CA 1MWAA 4ONHB 5IVNA 2O26U 1T6VN 1CVRA 2AJYH 4H20H 2MOQA 4MAUH 3US0A 4YSRA 2FEEL 2MFNA 4LCUB 4YHNB 1IC4L 1VAHA 2EZ0D 1KEMH 1KCKA 2CO3A 4QHUB 3UGEA 2HKHH 2R83A 3NH7L 4Y16D 3RAJH 1GMIA 1X5YA 1SBBA 1HEZA 1WIUA 2BC4B 2VO8A 4XVSH 3KPMB 3VFOB 4OGAC 2C5DC 3V6OC 1CR9L 3BUBA 5J4MA 3IFPA 1BMGA 4M00A 2WB1A 1OL0A 3NIDB 2VDKB 4JO8A 5EBWA 5ALBL 5T3XH 5A2JH 2BW4A 4QTFA 1IC5H 2B39A 2WBWB 3L5XH 5TD4A 4MJIE 1I7ZB 4PRNB 1O6SB 2HG5A 3GBEA 5JDSA 4MJID 3ECBA 3QIUB 2J21A 4AT6A 3VRJB 3KS0J 4Y2OB 2EJ1A 5IVXF 2I9TB 4X9BA 1DEEB 1BFSA 2D7NA 1MJ8H 3T1FA 3FQTB 4NQCA 4PLNC 3C60A 1IKFH 2J6EL 5DK0B 1CICB 3GTVA 5LBSH 2RCSH 2C3HA 3X1GA 1HAWA 1IAKB 1KGCE 5I6MA 4Y5XA 2BJMH 2UZIL 3HS0A 3PWLA 1BVNP 4XO3A 3HAEG 2EXYD 3EJQA 3CN0A 1UWXH 2X2YA 3ECUA 4EIGB 1AIFB 3ULVH 1Q9LA 4GQRA 4NUJB 1U0QA 3HJ0A 5HP5A 3H9SE 1AR1C 2Z1PA 4W6WB 2HN7A 1T21B 3BEVA 5IMMB 1MFVA 1F6LL 2YBRB 3RFRA 4QR7A 2ZTBA 3P2TA 3CBJB 1AR2A 1W0WA 3L2LA 4MA7H 5FW7A 3C09C 1ADQA 4XHJD 1BWWA 2MMXA 3ZIMA 5EF2A 2XV2A 4PJAA 3IS0X 4QRFA 2A6KB 4AM0A 4I9XA 4J1UB 5L2KE 3RURA 3W2DL 3VXOA 5HYSG 2V2TA 2R1WB 1S7RB 3CFUA 5B3JE 3UJJL 1KTBA 1DE4B 3UBHA 2XI9A 1BYPA 3LNIA 2QSVA 2YAFA 2Q87A 4J3OG 1FCCA 4ELME 2YPLD 4F80A 3LKPB 1IEAA 3OHMB 3K5RA 3ISRA 1AE6H 3TZVD 1FG9C 5HDBB 1I1CA 1ZS8A 5EEYA 4JM2F 4AMKL 4YXLL 1C5DA 4ZTOL 3EUUA 4HZ1A 2FR4A 4PJBA 2W0PA 3QUMH 3SOTA 4JJHA 2B59B 1KTRL 4I0CC 4FJYA 4V1DE 5IIEA 3GTNA 3TX4A 1UWGL 2OJZL 1HOCB 2IALB 2CO7B 2CUMA 2EAEA 5DJYB 4P3CH 3ZR5A 1E4XI 3CXHK 3OMNB 2I60H 4J3OH 3T0EE 4E9XA 2AP2A 4DCQA 1FO0A 1PLGH 5T1KA 4TUOB 1S7SA 1TSRA 1BF2A 4JO3H 2Y23A 1IJNA 2EDDA 3WY1A 3H3PL 3PRZA 1KCSH 1ZHNA 2XBTA 4F9LC 4WI4A 4YZFF 2O72A 3W11C 2V0AA 3GK8H 2CMRL 2FNWA 3ULVC 4L23A 1IZJA 4G8FB 4RAVA 4EI5C 1K3IA 5EU6E 4NUGH 2R69L 5IF0A 2G2RB 3FSAA 3QZWG 5F7KC 2Q7AA 5TQ2L 1JYNA 1JZ6A 2X0WA 4M1GL 4WEEA 4HV8A 8PAZA 2LQRA 1GYUA 1MEXL 3GSVB 3X12B 3T9WA 4X6FB 3HZ3A 2PF6A 1OE1A 3OWRA 2BNRA 3VH8G 1PU0A 4LU5L 2AEOA 4RGOH 2JKRM 3ZT5A 4JJ5A 4JW3A 2H4EA 2D4DA 3U4BL 5ICUA 5GISH 2A4CA 3BZ5A 4AT6B 5GQBA 5GHWL 4HJGA 4RSVA 4ZMQA 3R06A 1QZ1A 4MVBD 4OLZL 4U1HB 2R39A 1L9TA 1LP9A 3FQ4A 4NQCB 4OGYL 5KTEH 2BXYA 1XR9B 2X6AA 4ZFFA 1EZSA 2YWZA 3CZKA 1KY6A 2NY3C 1ODAA 4OV5B 4E5XG 2Z91B 2H1PL 3PU7A 5FO9A 1ZLVH 5JHBA 3ZKXB 3ZTJH 2A77L 1A7QL 2WPGA 4P46A 3W38A 4MXWL 4ES8A 3QJZA 4DN3L 2CRIA 2NY6D 4X83A 4XNYL 2G9KA 4LSPL 2ZXEB 4PIRF 1HS6A 1ZXKA 2CRZA 4HIQA 2ZXGA 1F11A 3FFOA 2IF7A 3GSXA 1NCWH 3QORC 4R84A 1B9KA 1PF3A 2CLRA 5ENWA 4B27A 4AYID 1CYXA 4S1QH 1AY1L 1MELA 5MENB 4PVLA 2MEJB 2GIXA 4TQEH 4PJAB 3ZQXA 1ASOA 1VPOH 2DWTA 4J3SA 5F7DB 1AKJD 1QOKA 2GK2A 4TXVB 2I5YL 1I8IA 1UM5L 4HJ0D 1V8HA 1F1GA 3HHMA 4G7VL 2B1HL 4QXGH 4BINA 2QKIA 1CURA 5D6CA 5KG9B 5DZPA 3P9MA 5TQ0L 4WVRA 1IBHA 4RDQF 4TLTA 5IB3B 4X7TA 1O7DC 5KYYB 5IT2L 1EQWA 1JS4A 3STZA 4NHUB 3DLQR 3S35L 1TG8A 2Y7NA 1G43A 5GSRB 1ZS8B 1KJ2L 1Q1JH 4R7LA 5HHME 3D25A 5LGHL 4PJBB 1NFDB 1ONQA 3VFUA 5I6XC 1GGCL 3BZDA 2C3WA 2DF3A 3DUHA 3OJVC 3WJLA 2XKSA 4KDVA 5E2WH 2VLLB 4TOYL 2A1WL 4RQQA 4NM8H 2A6DA 2DZEA 2F7RA 2WUBL 4DCQB 1FN4A 2W07A 4S0TD 4WRLA 3LN9A 2GI0A 3H9HB 3ETBF 4PGDA 1WFUA 5SV4A 3V0DA 3VGFA 3FYIB 3GWJA 3CFCH 4MJ5A 4FYRA 1XF1A 1C7SA 1ZHNB 1WVZA 1MDTA 2QQQA 4IKNA 4PG2C 5AL0A 5ABZA 4OFIA 3ZZ1A 1WBXB 1F4AA 4CU7A 5EIIB 5GGVY 3X1BA 2Q10A 1SN2A 3ZKQD 5F9JA 1E4KC 9PCYA 3WAJA 3BO8A 4NZTL 1VGKB 1NCWL 1YJDH 4N8CL 3DHMA 1XO8A 4ECNA 1HHJA 1RUKH 1A5FL 2BP0B 1F3DJ 4PJ5B 1CDGA 4HKBB 4NO5B 4XNZC 4X6DF 2QGCA 1NUGA 4KJQD 4KXZI 5E5MA 2NZ1A 2ZCKL 1YEHH 5KS9F 2EVIA 2P43B 1EAQA 4IRJA 2C9VA 4JZNA 3EXJA 4MX7A 5IFAL 5B3NA 4GW1A 2WXFA 1W8NA 2GT9B 5ISZD 1IFHH 1ETZB 2WQXA 3SGEH 3APMA 3L6FB 3E1F1 4Z0XA 1UM6H 3B7TA 4UINH 1JF5A 3IMWA 3B5TA 3FQWA 5IMLB 4JFHE 1GH7A 2J2ZA 1H3PL 1QSFE 5D2LA 4FKKA 1CLYH 5GS1C 1JZFA 1QSFD 4RZKA 5EF1A 3IAPA 4MXQD 2XETA 4OUOA 4FP8L 4ZFFB 3BKML 1A7RH 4QT5B 4TKWA 4S0HA 4FTDA 5CJ5A 3OAYH 4PRIE 3K4AA 5E6IA 1D9KD 1GAFL 1LO5A 4MQTB 1E65A 2YD9A 4GOSA 1LILA 5C0NC 1BA9A 4WHDA 3MJ8A 1C5BH 5D7LB 4F5CE 4FZ8H 2X89A 5KAQF 2OW7A 1X9UA 1PW3A 3CXHJ 3LDBC 4LSTL 3H3BC 1OOAA 1U36A 3BIBX 1QW8A 2VIRA 2Z8VC 3CTTA 2MTPA 1JV5B 4NQDA 4Z0BH 1JE6A 1U3HA 5F7UA 4OT1H 1MY5A 5ANHA 3HLKA 1EXHA 4XBEL 2ZF9A 4I7ZC 5LDUA 1N64H 4Z7WE 3O4LD 4Q8BA 4IBSA 4E0RB 4DP6X 2BP8A 3IETA 4WGKA 4MMXA 3JV6A 3ZZLA 1OT4A 1YJDC 2HVJB 4XN9A 1BGXL 2I24N 2G3ZA 4G9FA 1U6AL 4F15C 2EYRA 2E9WA 2AJ3A 5CAYB 5DGRA 4YDNA 1SHSA 3SKJH 1IEHA 2X2HA 5F9AC 2O5NA 4HKXB 4KKQA 2APBA 1MNUH 1TQSA 2D2CC 4MAZA 4GUQA 1F58L 2HRPH 4UBDD 1NFIB 5HDRA 4XNUL 4XVOA 2HTLD 4TSCL 3ZO0A 4LF3B 3QZOA 4FLSA 4U1JB 2WZPA 2OI9B 3BVNA 3D25B 3WMSA 1A3ZA 2Y25A 3BLBA 1U95A 1ZA3A 4NPYA 5BVJA 3TA3D 4UINL 3NVQA 3GNML 4XMXA 4OFYA 3TP4A 2DLIA 3UX9B 1F45A 3GJEA 1MVUB 2HLFD 1KIUA 4M7JH 4QNPF 4RQQB 2PYFB 2DMGA 2FT8A 4BQ8A 6CGTA 5DD5H 2V17L 1AZUA 4NQED 3N55A 1EMTL 3QXAB 1MCBA 2CNZA 2EE0A 3VGDA 3OGOE 4Z6AT 3ZN6A 5C9KA 1YUHB 3BPNC 1C9SA 3TFKC 1F4XH 1UOKA 3U9UB 1OE3A 4MQSB 5HHPB 3UAJD 3O0RH 1M71B 4GAJH 3U0TA 5F9JB 1HI6B 2VM4A 4TPRH 2G0KA 1PCSA 4AUUA 5HGHA 4NBXB 3F85A 5F9OH 5BVPL 2OTUB 4IJ3B 3PABB 3NIDE 3DSFH 4HAGA 4XN1A 4PCSA 4FFVC 2BZDA 3Q8BA 1KFAH 3L9BA 2MOGA 3L48A 5DD0H 3JV5A 3ARBA 2DEYX 4ZS6D 5E5MB 3P4NA 2YPVL 2CGRL 4FZEL 1JWUA 1Q9KA 4IRJB 3SPJA 5I6NA 1NOAA 4MX7B 1UQSB 3ENEA 4N3UA 3RIKA 5CLZA 1USQA 1ZJAA 2AKRA 1RZIA 3IDMA 1F1AA 4I3GA 3V4PA 1RMFL 4IRZL 5FYLE 4JZOA 2J2ZB 4PWIA 3VGBA 5DEFA 2FVNA 1IMHC 4P9HH 4NI6A 4YXKL 1GY2A 4OJDH 3QO1B 3S5LA 1JSYA 1CT8A 2CJUL 1P1VA 3GUTB 5BOPA 2FWSA 1LO5B 3IJYA 4ZO7A 3RYMA 3ULUE 3MJ8B 3DX8B 3U4EB 3ERXA 1MCPH 1UWYA 4HWZA 3PL6C 4I1RA 5DD3H 1PNCA 5DUBA 2PXYD 5D93C 2FWOA 4Y4FB 1WA1X 3P0VL 2KUTA 1A1MB 4P4RB 1HKFA 1G0DA 5D5MA 4E9LA 3L4ZA 2VIRB 3BXNA 1CTMA 2W94A 3DTDA 1MQKH 4K8RD 4OFDA 1QEWB 1O0VA 4IK6A 3DIVA 2ZX9A 4OFPA 5AW7B 4BELD 1BZQK 4JX0A 4IBTA 1YSOA 5I1JL 4JE4B 3CMOL 3UJIL 3IETB 1EHKB 5C0AB 2Z7YA 5EC1B 1HYSC 2DKMA 3LQZA 2BNQD 2NRDA 3CK0L 2EYRB 3HS9A 1J0HA 5HDBE 1U8PA 4GG6A 1EBPA 3DVIA 2GEEA 1FP5A 4A6YL 3MA7A 4JN1L 3LIZH 4BZ1L 3EDEA 4BQBA 2O5ZH 4PV8A 3N3EA 4ZZFA 2J20A 1NBQA 2YRZA 3CPLA 1B4RA 1CXIA 4XXDA 2K4AA 3RTQB 3O3BB 5J13C 1KIQA 4PW9A 1KFGA 2GC4C 3BVNB 1P6WA 1QI4A 2N4IA 1B4JL 2Z65C 3KWWA 4Y2DA 5CIPH 3SQBB 1QZNA 2IC2A 2J3SA 3B1UA 5B8CB 5CEZH 3FQ2A 1V54B 3CZFB 1TYRA 3GJEB 5J6SA 3VFVA 5IK3A 3HNSL 1HL4A 1S5IL 4CN6A 2F19H 4P9HL 4P9HC 4HMCA 3QUXB 3DJZA 1NH6A 4M61A 5DJ8A 3NPSB 2QADB 2PNDA 5HVHB 1WC7B 2FL5B 3RL1B 3QG7H 2XZZA 1I3UA 4OIIH 2HT4D 3DYMA 3Q1EA 4H1LH 1D2PA 3P73B 5I0DA 1MCHA 5HHQA 4MDJA 3GXIA 4P9ML 3IF1A 4ETQA 1MREH 3KLKA 1H15A 3JUZA 3MCLL 3S88L 1EWHA 1DVFB 3L3IB 1D6VL 1T04B 1MAMH 4HIXL 1AD9A 4NKOA 4PB0H 5AAWC 5DHVB 4KRMB 5L0QB 5I8OH 3L3OA 3C6LA 1BXVA 2Y2YA 3ARBB 4XI5D 2B16A 3HG2A 4HWBA 3NSJA 4O5LL 4PWEA 1CBJA 5D72L 1T1WA 3QG6A 2GAZB 3P4NB 5E9NA 5HVGB 4F33A 2WJ5A 3OKEA 3TO2B 1TF4A 3LEYH 4AIZB 2HWZL 1ZV5A 1OF0A 4KTDH 4NQCE 4ONOA 5BQ7A 1CLCA 1HNYA 4MAYC 1JPST 1RZIB 4L0YA 4N2DA 2HUEA 3IMUA 5BZWA 5FYKL 4EI6A 1AOHA 1ZHLA 5JHLH 5C1MB 1JUFA 3MUGB 3GXPA 3RVTD 3KLDA 3S36L 5AENA 2J8HA 5TDOB 1XXDC 3ZT7A 4HSQA 3DO7A 5DEFB 1GTFA 4ZG1A 2CDGB 4WCYL 5HGDA 5FUZH 3DKHA 1IARB 1AZVA 1CT8B 1X5JA 2YARA 3O81A 1IEBA 4M02A 1P7QB 1XAUA 4R96A 3VJ6A 4IYKA 2ZUTA 2XN9D 3T0AA 1CZ8H 1IV8A 4O2EB 2VDKH 4RMQA 1TTGA 1S9XB 4GP4B 3ULSB 1DBAL 1KPVB 1E9OB 2FWOB 4EN3B 1XIWA 2DMCA 4I0KA 1AANA 3DSNB 4PJAE 4FQHA 1JERA 2X6CA 3EH2A 3M7FB 4N20A 2Y7OA 4P59H 3ZTDC 2HJLB 4IU3A 4FQJH 1EHXA 3MYJA 1T83C 3QNXB 3WFDH 2X4OA 4ZFGH 3QIBB 2BIHA 5IB2A 3ESOA 2B77A 4HIHB 3SDDD 1FSKB 3FRPA 5EORH 3N42B 5AW4B 3BWSA 5CINH 5FYLH 2XPGA 4LASL 4EDXB 1TU2B 1P4LB 3VAEA 2CDEB 2AV7A 5CZRA 5C8JA 2RALA 2EUWA 1U8PB 4L5FL 2AEQH 1EK3A 1FG2A 3HMXL 2FUQA 4LSVL 4NC1E 4PJBE 1NFDE 3WIHH 4GPVA 4X5RA 2N7AA 5BRPA 3VFTB 5FECA 1NFAA 5CGYC 5IFJA 1Q94A 3JWDL 4ODSH 4Y7OC 3F2LA 2ZWKA 1KIQB 2E6PA 3ULUH 1KBGL 4NO0A 1RIVL 1ROCA 3E7JA 1HHIB 4QD2E 2HFFA 2EYSA 4ODVL 4N2BA 3U2JA 2FBOJ 5T1KD 3V8OA 2CDFB 2E6JA 2MKWA 3UC0L 2EH8L 3WS3A 4OQTL 4NO2A 4DKAA 4YAQA 4NPKA 5DMYA 3FK3A 3A5VA 1WZ1H 1X4YA 3L7EB 3B7YA 1S7UB 2ADJA 5HHVL 1CGTA 5GS0H 1QLRB 3HMWH 3UO1L 3BP7B 4FLRA 5ANMB 5DVLA 1SXCA 1I3GH 4OCYH 3NESA 2NNAA 4GKSB 1AIZA 3NP4A 2VDLL 2F1BA 4MMYB 2HVKB 1GHFH 3K2UH 2WSPA 4LSDA 4A68A 3K71B 1JN6B 1ZA6B 5AVWB 5KSUA 4PJGF 4YLQT 5FK9A 3QIUC 5I1GH 2BNRE 4MSWB 4ALAH 4FQJL 5IROA 1U3YA 3MRDA 3BFQG 5D9SA 5E2UH 2BVPA 4J3UA 2EIDA 4GMTL 4QYOA 5EU3B 4KPHH 2WNGA 3MOAL 1JGUH 3QG6B 4F33B 4N2HA 1CICC 4LRIA 1BQUA 5EORL 2EH7H 1RFDL 3U7YH 1CDJA 1G7HA 2DM4A 3N43F 2FYYB 2WLLA 3HN5A 4HK3J 1LP9E 1CL7L 1G7LA 3AQYA 3PS6A 5DQJA 1A9EB 4FA7B 2FD6H 4XBGA 3R1GH 1G9ML 1QQDA 3GDBA 1ZHLB 2NY0D 1ET8A 5G4NA 1XCXA 1D7BA 3Q8AA 1TPXB 2E9GA 3DGCR 3ULUC 1G9HA 3FJTA 2HXAA 2NT0A 3L4YA 4FJZA 4P46D 1H3VA 4WI9A 1HWHB 5ILTH 5A3ID 3I9GH 2HT3C 1RURH 3GS0A 2AV1A 3G5XB 1JV2A 1N8OE 3E6FB 4G11A 4NQQA 3VJ6B 1R3JA 2EYTB 4JG5A 4WO0A 4JGUA 4U6YB 4AIOA 5I30L 1YNTF 2G75A 2IFFH 1XIWB 5FW6A 1WZ1L 3LEVL 4FQHB 2FHBA 1O5DT 3TPUA 5GS0C 1ECZA 1NEUA 4PWHA 3PQYD 1OM3H 2NY4D 2ZXWB 5KYXA 1F5WA 3CZLA 3QFDA 5L4JA 2OR7A 4M48L 4E68A 1OSPL 4ORGB 1ZHKA 1QRND 1N8ZA 5BMFL 4JCWA 3CNKA 3KCWA 2PCPA 3HG5A 1AGCA 5JA8B 2XSKA 2A0LD 5EO0A 3CSGA 4KKLD 2AV7B 3FFCA 4Y1SA 2R4SL 4D8PA 1XSOA 2H0PA 2R29A 4ZUWB 3ZSTA 2YOAA 5E94A 4M6OL 5C0FB 4OCXH 1P7KA 4JRLA 1A6TB 1HKLL 1MRCH 3QPQC 5DT1L 4P8QA 4ODBD 2YUWA 4GQZA 3QHTC 2QPEB 4LAQH 4NO0B 2Q8BL 1NGPL 3EXLA 2YA2A 5DD1H 4BFJA 1XF2A 4LL9A 4L4TB 4OF5A 4GSUA 2DQTL