3NP4A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np4A00
1AR1B 1JZJA 4DP9X 5EHFA 1JXGA 2GC4C 2CUAA 2IDQA 1FFTB 1PAZA 1ADWA 1DYZA 1AG6A 1A4AA 1BXVA 2B08A 4AKPA 1NIBA 1PNCA 2ZXWB 2J55A 4DP8X 4NAJA 4DP7X 2E86A 3SBPA 4YSAA 3OMAB 4G70B 3NJHA 4QKTA 1J5DA 1V54B 6PAZA 3CVCA 3WIAA 4YL4A 5I6NA 1EHKB 1L9OA 3L45A 2VW4A 4GXFA 4KO6A 2UXVA 4E9RA 3ABLB 4G7RB 4JHVA 3ZX1A 4A68A 4AI7A 2DYRB 2QPDB 3ABMB 2R7EB 1PZCA 4BWWA 2YARA 1W8EA 1T5KA 3NJLA 3AG1B 3NSYA 5E9NA 3ABKB 3CDZB 1J9RA 4A2DA 3SQRA 3T6VA 1SNRA 3X1EA 9PCYA 2I7OA 4A66A 4G7QB 4G72B 1XMEB 2BO0A 1BXUA 1X9RA 4WKXA 1ET7A 3UABA 3GYRA 3AG4B 2AZAA 4KO5A 4GY4A 4YSTA 1PLBA 1ILSA 3FYIB 3FT0A 2PPEA 1PF3A 1KBVA 2VN3A 1NZRA 1AZRA 1GW0A 4HAKA 2XXFA 1SHXA 1F56A 2YAMA 2DV6A 3KW7A 1OCOB 4P5RA 3X1NA 1URIA 1AQ8A 3T9WA 2VM4A 2XVBA 1MZZA 2JFCA 3PXLA 7PAZA 4E9SA 1ZV2A 3ASNB 3HEIB 3UACA 1KDJA 2QDWA 4HCGA 8PAZA 1CYWA 1JVLA 1NICA 2IWEA 3FPYA 1CYXA 2FT8A 2XLLA 1AS8A 3FQYA 1MG3C 2WO3B 3NYKA 2IWFA 5D4IA 2N0MA 2Y69B 3OMIB 1GYCA 2DYSB 2VSMB 1NIEA 3T6WA 3BQVA 5I6OA 2BP8A 3NP4A 1JZIA 4AZUA 2YQBA 1SFDA 2UXTA 2I85A 4YSCA 3FSVA 1ZPUA 3UAAA 3IEAA 4KNSA 4G7SB 5F7BA 1AANA 2QPEB 1SF3A 1L9PA 2PPFA 2CJ3A 1BQ5A 1NWOA 4KO9A 4KOCA 1X9UA 2HRHA 1RCYA 5I6MA 2UXFA 4FA7B 1EZLA 2FQDA 4K9JA 1PCSA 2YXWA 3NSFA 5B1AB 1B3IA 1NDTA 2UXGA 4KO7A 2AFNA 3FS9A 2QT6A 3MBWB 2GIMA 2ZONA 2BZ7A 1TU2A 3D12B 3TBCA 4HHGA 1J9QA 3CVDA 4DP2X 3CZUB 1SDDA 3X2QB 2WO2B 2YAFA 2JXMA 1ET8A 1XB3A 5I6LA 1I53A 3DKHA 2J57A 4HALA 5AKRA 2GBAA 5B1BB 1IBYA 1XB6A 3EH5B 2BHFA 2GI0A 4MFHA 4X4KA 5F7AA 2HRGA 3UAEA 4A2GA 3H4HA 1V55B 4A67A 3N2JA 1AS6A 4BDVA 3V9EA 1SF5A 2BP0B 3AG3B 2J5WA 3KW8A 2VW6A 4HHWA 2YAEA 4E9WA 3OD3A 1AACA 1QNIA 1A3ZA 3NJIA 1ETJA 3UGEA 1ZDQA 4GP4B 4CSZA 3N55A 5B3SB 5B1JA 1N70A 5TK4A 2H5UA 1OE2A 2CBPA 3H4FA 2VW7A 1HFUA 1BEXA 3QJUB 4FAAB 1ASQA 1JOIA 2IH9A 2MRYA 2OV0A 3FSAA 4YSDA 5I26A 4L0PB 2GC7C 4AKQA 2YAPA 1ILUA 4E9XA 2TSAA 1NTDA 1KYAA 1BQKA 1JVOA 4YSQA 4DP4X 3CVBA 1A65A 1KV7A 1JXFA 4P5SA 2UX7A 3EF4A 2TSBA 5AZUA 4ENZA 3FU8A 3NJJA 2HX8A 3X1BA 1FA4A 2BW4A 3WI9A 2PLTA 4GP8B 4Q8BA 1E5ZA 1E67A 1OCCB 3OMNB 1V10A 3IN0A 4A2HA 3NJKA 1PZAA 4RH4A 1KCWA 3C75A 1N68A 1BYOA 1TEFA 4GP5B 1MG2C 4TXVB 5TK2A 1GS7A 2UX6A 4YSSA 1ZDSA 1M57B 5PCYA 3ZIYA 4JHUA 3AY2A 1GSKA 2XV0A 1MDAA 2PCFA 3AZUA 2W88A 3UADA 1YLBB 2FQFA 1PY0A 1AIZA 2W8CA 3ABGA 1JZEA 2IH8A 3IBOA 1SHWA 1JZHA 4CSPA 5I28A 3QJQB 3WNIA 1KBWA 2IAAC 2ZWNA 3FSZA 1J9TA 3NJNA 1WAEA 2AZUA 3PAVA 1GS6X 4DPAX 4UF7C 1W6WA 1AZUA 1OE3A 4E9QA 6PCYA 2PP7A 2VMJA 5I6PA 1KGYE 2PPCA 3FQ1A 2XV3A 1DZ0A 2A3TA 4AKOA 1L9TA 1L9SA 4A2FA 4YSUA 1E5YA 3FYEB 4BXVA 1PLAA 3S3CB 1OF0A 4UAHA 2BW5A 1WS8A 2IDSA 2Y1AA 2DWTA 3JT2A 1A4CA 1NWPA 2FT6A 4E9VA 2EIKB 3PPSA 3FU7A 2J56A 1ET5A 3S3DB 2Q9OA 2FQGA 2ZOOA 4KOBA 1RZQA 2YXVA 5I5IA 2BP8B 2HX7A 4A2EA 4G71B 1AAJA 1IKOP 3RYMA 4YSPA 1AS7A 2X87A 1JERA 3EHBB 4BK5C 2FQEA 4DP1X 2QDVA 3GXUB 4UANA 5I6KA 4DP0X 5B1KA 1KDIA 3FU9A 2EIJB 1TEGA 4GYBA 2VM3A 1GS8A 2P80A 5A7EA 3QJSB 1AZCA 1VLXA 2XXGA 1FWXA 4W9ZA 2PPAA 3NJGA 5FC9A 5ANHA 2XWZA 4YVNA 4WTQA 2B3IA 1E30A 3HB3B 3WNJA 4KNTA 1ZIBA 2BWDA 4QLWA 7PCYA 2PCYA 3FSWA 1RKRA 1R1CA 2HX9A 4E9TA 1WA1X 2WSDA 3MX0B 5B1JC 3PAZA 2EIMB 3IE9A 2EILB 1GY1A 2YAQA 1OCZB 3NT0A 4E9YA 3QJVB 4HIPA 1XB8A 1SDDB 2CALA 2R7EA 2XUWA 2JKWA 4EF3A 2GB2A 1WA0X 2IDTA 2IDUA 3TA4D 1WA2X 3X1FA 1WS7A 3CDZA 5PAZA 4YSOA 4F2EA 3S3BB 1CC3A 4PCYA 1BXAA 4ZK8A 4BDVB 4YVUA 1ID2A 3AG2B 2CCWA 1CUOA 2FT7A 1QLEB 3H56A 1PNDA 2P80D 3PLYA 3NSCA 1HAUA 3SBQA 3QJTB 1PLCA 2CAKA 3WKQA 2IWKA 5IY5B 3OQRA 2FJSA 1IBZA 5B7MA 4N4YB 1ASOA 1JZGA 1KCBA 2X88A 3TASA 3T6XA 5D4JA 2Q5BA 2GSMB 3FPXA 4DPCX 1L9QA 2EINB 2PPDA 4BWUA 3QJRB 2RACA 1MZYA 2FWLB 2YAHA 3S8GB 1BAWA 4M3HA 1PZBA 2GHZA 1A8ZA 1AZNA 1GR7A 2PP8A 4AX3A 4BWTA 2YAOA 5B7FA 2XU9A 2HLEB 2MTAA 3DIVA 2XX1A 3V9CA 2NRDA 2HZHA 4W1TA 2IDFA 2FTAA 1A4BA 4NERA 4BXSV 4PAZA 1J9SA 2DWSA 3OM3B 2FNWA 1SJMA 1NPJA 2XV2A 3QQXA 3WKPA 3JTBA 2VSKB 2XX0A 4Q89A 3S8FB 1J5CA 2XYBA 4DP5X 5I5MA 1ASPA 1OE1A 1AZBA 4KNUA 1IUZA 2BZCA 3PAUA 4HCFA 1L9RA 2H3XC 3PCYA 2DY2A 1TKWA 3T6ZA 3TU6A 3NJFA 1NIDA 4YSEA 4DP6X 2AANA 4YSRA 1IC0A 1NIAA 4HCIA 3T71A 1OV8A 3U25A 3WG7B 4JKNA 3DTUB 1SFHA 2OCCB 2I7SA 3G5WA 4NB7A 2H47C 2LLNA 4M4RB 1E65A 5AFAA 4F2FA 5D4HA 1AOZA 3AW5A 3EH3B 1CURA 3CG8A 1NIFA 1HAWA 4HZ1A 3ZDWA 1GY2A 2HXAA 1PMYA 2AVFA 3NSDA 1M56B 1JZFA 3GDCA 1BQRA 1W6LA 5I5JA 3SBRA 3X1GA 1RZPA 2PP9A 3ASOB 5B7EA 2BP0A 1JXDA 1M9WA 2OJ1A 1BYPA 3BVDB 2BWIA 1OOWA 1AG0A 3FU7B 5LDUA 1ZIAA 4DPBX 3FQ2A 3TBBA 4N8UA 3NP3A 1NINA 3IN2A 3ERXA 1OCRB 3ZBMA 3NJMA 1QHQA 1UATA 1NPNA 3QPKA 4F7KA 3EH4B
chains in the Genus database with same CATH superfamily
3REVA 1P9MA 4NN7C 4H88L 2Z92B 3ETSA 4RGNC 4NJ9H 4EO5A 3OJDA 1FFTB 4POUB 3QIWC 1WF5A 4PBXA 1B2WH 1ZTMA 2Y7OA 2GCYA 3BKML 3KDMA 3N9GH 4X4ZA 1H15B 4NOBA 3LVTA 1OALA 4BCZA 5D7KD 1RP9A 2BSCA 1OW0C 4JUTA 4XZUA 4YNYA 5I30H 4Z3JA 3GMQA 5AZEH 3W39A 5C0DB 1I9IH 3OKMA 4PG2A 4ZTEA 4YL4A 2DIJA 3GSNL 5DJ2B 3WN5A 5DMKA 1L9OA 3QZLA 4PJFF 2ZP9A 1S9WB 1PD1A 4YXLL 1CXFA 2Y1YA 2JJWA 4NM4L 2PETA 1TZHA 1KCVL 1NFDA 4G8GB 1IKFL 2QQKH 1S7UB 5I82A 2F68X 4FQ1L 1I8MA 1O9ZA 2XWCA 4MQ7A 4LU5H 5KYYB 4IU2B 3H3BC 3V0EA 2J1YA 4O51A 4Y16C 1MFEH 1A6PA 4CGTA 1DSYA 4ZAKA 4D0BB 3LKPA 1X9RA 1ET7A 2K8QA 3SCMB 5A6LA 5EIIA 3UABA 3HUJF 5I71C 1UXMA 3AG4B 3PYCA 2AZAA 4J7RA 3VWKC 2AK4D 2HMIC 2WNWA 1TMQA 3FYIB 4JDVB 4KROB 1C7TA 1G5GA 2PPEA 3O4OB 3G6JE 4KV5F 1KBVA 1YUHA 4N0YH 1AGEB 3PNWB 4Z7VE 1YAZA 2CR3A 1FRGL 1GW0A 3HCVA 1MJ8L 3NA9L 2GAZA 2ZCKL 1SHXA 3ESMA 3FT4B 2XVGA 1WV7T 1R17A 4IBQA 4Z7UA 1URIA 2KPWA 5FUCC 5J12B 3GIZH 1FNGA 3DVIA 3HZKA 1XR9A 1G0YR 2LU3A 4JFXA 4KAQL 1LWJA 4TL4A 5GGUA 4RGOL 5JHLH 1A3LH 3GMMA 2YXFA 1RZIA 1BX2B 3ESPA 3FB6B 3QXTA 4HCGA 5DRWA 1T6WA 4JO4L 4PGEA 1CGTA 2XLLA 5I1CL 3VFWB 4XNXL 3K8KA 3UIZA 3CSGA 4DKDC 4Z3HA 4TNVF 1KBGL 4HS6B 4OCSL 1R19A 4OFYD 3IXAA 3I6LD 3RUGB 1FFPB 4B9CA 4JO3L 5EN3A 2XY2A 4NNXB 2WUCL 2ICWA 4NJ9L 3K2UH 4L18A 2BY2A 4X2UA 5E7FA 1MFCL 1W2KT 3JWOC 3FSVA 3MRNB 5GS1B 4ZPTB 4X4YA 1NA8A 1JF5A 1GGIL 1JPTH 2XTJC 2ZUUA 5C0BD 3RVVD 4X5XB 3FU3A 4KZEL 2YFOA 1M9SA 4HJGA 2K4AA 4J3BA 1SMDA 1JD7A 5I30L 4K71B 1A6TB 1TKWB 2OX5B 4NIKB 4PWEA 5AZEL 2IXQA 1I9IL 1PG7X 2OLDA 5K1NA 1QO3B 3O8XB 4NS0A 1PZ5A 5DVPA 3BWAA 3BRDA 4QRUA 4G82A 1ID5I 3SDXA 4OVUA 2YOAA 3BEWB 4M61B 3EFDL 3V2AR 2WIIB 3QR0A 4LU5L 5GXBB 2G3ZA 3D33A 2RTTA 1XB3A 4DUVA 5CCKH 3SGJA 1NANI 4NN6C 1MFEL 4X42A 2GBAA 5HYJD 1UURA 1DDHA 4GUQA 3BGFB 3VXQB 3RWGA 4A2GA 4X4XB 3EHBD 3HLAB 4LP5A 4A67A 5I5RA 1UH4A 1S7RA 2R0WH 1SOQA 3AQXA 4G8IA 4HPYH 4LVOC 1YEIH 3KW8A 2KL6A 3H9SA 2NY2B 3L3KB 1QVOA 2YAEA 1WVZA 2J6EA 2P5WD 2YBGA 5LN4A 3TVMD 1BREA 4K73A 3NJIA 3NZHH 2NOYA 2ZCHL 5HHNA 4N0YL 2HVJB 2LLLA 4U1HA 4FABH 2AJVH 1SLWA 3N55A 3NIFF 5B3SB 2OJZL 2XHNA 4JKWA 1WEJH 1GMEA 4QRPE 2VAAA 2DQHL 3QJFB 4OTXH 4TUKL 1VEOA 5CIPA 3SGKA 4XO4A 5HI4D 3F12A 3CVHL 4Z95L 5FO7B 3ZPDA 4L4VA 1HS6A 4KHXH 4X6EB 1UC6A 5DJDA 4LKXB 2LU7A 4L0PB 4PD4K 4AV4A 4AKQA 4YHML 1A3LL 2PXYB 1ILUA 4WI7A 1HHHA 3CC5B 3H1ZA 1YY9D 3I9GH 3CH1B 3P3TA 4APQA 1HIMH 1VB9A 5DGQA 4PLJD 5H2BA 1EJOH 2VWEC 4I18A 4Y19D 2X3AA 5CNHA 3ZT7A 4XPGH 5AZUA 3NJJA 4GI8A 1Z1WA 1XF2A 2R51A 3FCUB 1FLRH 2ZOTA 4YHLH 3JXAA 3FRPB 1KTDA 4AENA 5EULV 4MTMA 5EUKA 4YPJA 1V10A 2EDOA 4UT9A 1IM3B 4DPRA 1MCKA 3JYBA 4PGDA 2VDPB 1M53A 3OLIA 4PJCA 3ROLA 3SE8H 4JBSA 2B1OA 5EF0A 1WISA 4XP4L 1G9HA 4YSSA 2A77L 5PCYA 3IJSB 2E6PA 2OSYA 4G7YH 3EYOA 1M7DB 3RX5A 4ZMAT 4OF7A 5D6CB 1GZPB 2VN7A 3V79C 4KGLA 1T1YA 3M1CA 2KQNA 3MMEA 4M5SA 4G6KH 5AAMC 2IG2L 4QHMA 2W88A 4FMFA 4U7SA 1EHAA 1YLBB 5F8RC 1G6RH 4AIOA 3G3LA 4N8VA 1OLZA 1H8NA 2AQ3A 4RA3A 3MBED 4MRCA 3DUUA 1QPPA 2WXGA 5AOMA 3PAVA 1ZLUK 2X6VA 5F93C 1NDMB 2D4DA 2D7MA 1ETA1 2MQ0A 3IU3A 1BBJB 1BQSA 3HJEA 4PB9H 2CHZA 4H1LA 3LRSB 4IMKA 4B97A 5CCKL 3DBXA 4K7PX 4JFOB 3GSUA 2FO4B 2AAVA 2GUYA 2IANA 4R2GD 3ARWA 4GUPA 3KCWA 5DZNA 1F41A 1A7PH 3WLBA 1FH2A 5FPIA 3BGMA 4V1DE 4AKOA 4GQQA 5F0MB 1I75A 3F64A 3LKNA 2A9NL 3MRIB 5HHVH 1L9TA 2V5MA 2WAHA 3AC0A 1XF4B 1H3VA 1SOSA 2GTWA 4J6IA 6CGTA 1S5HB 5IKCB 3ULUF 4Z3TA 1VSCA 4HMCA 3NZHL 1JK8A 4P46B 3VXRD 3QFDB 5IMLB 4LOVA 4FABL 5IM7A 2AJVL 2YPVA 3CBJB 3TPKA 3PPEA 4L23A 5CD3A 1RSYA 1WEJL 1UKTA 2FQGA 3BVTA 4XMVA 1KMGA 1L3WA 3H3KA 4OTXL 3VH8A 1AR1C 3MACL 4FQXC 2J7LA 1PYWB 2YMTA 3O0RH 4U3XA 4PJ9A 5L2KA 2VDOL 4KHXL 1WZAA 2QLVB 1OL0A 4MKTA 1KENH 2NY5C 1KZYA 3ARPA 2Z92A 4EI5B 3I9PA 4YDIH 2EDRA 2OZ4A 1MCIA 2K1MA 2K7PA 3I9GL 1ODUA 2VM3A 3I02B 5KVGH 2AP2A 3OJMB 1AFVH 1VLXA 4C4KO 1FWXA 1H15A 3EXJA 4XPGL 3IJYB 1LHZA 2CMRH 4JFQB 4Y89A 4KK8D 3WNJA 1ZIBA 5C0DA 4GQ9H 4RGMC 4NC2B 1EDYA 5DZVA 5CP7B 3NFNA 4HD9A 3L7FB 5DJ2A 1MCLA 1K72A 1S9WA 4JFEE 4XOBA 1KCKA 5SV3A 3K72B 5GRVL 4G8GA 3VQ1C 1S7UA 4M02A 3RDTC 3HMXA 5KYYA 1ZA6A 4IBLT 4DVBB 2P26A 4IU2A 4XN9A 4JZNA 4G6KL 4R9HA 3S6CA 4NUPA 1E5AA 3MV9E 3OKNB 3P9MB 4D0BA 1U3ZA 3SCMA 3F3HA 4X6DE 4P9ML 3WO4B 3L5IA 1NQBA 4AQ1A 2D0FA 3WY4A 3ZKMD 4PB9L 3FO1B 2CLVB 3SBQA 2CKNA 2F54E 2IWKA 1HYSC 1GHFL 4N0CD 4JDVA 3ILEA 5ACMA 1A7QL 5TE6L 1EHNA 2WWNA 4MS6A 1AGEA 3BE1H 3GXFA 3PNWA 1IM9D 5FYJD 4AY0A 4ZZKA 3FT4A 1A7PL 1MFDH 4L8CB 5C9KA 3JT0A 5JO5B 2GSMB 5C08E 2FATH 2HCZX 2FYVA 5D2LB 2X7LB 2HT4C 2AJYH 3FTSA 5KSBE 4HS8H 4ZMVA 3P54A 1LO4H 2UZIL 1TZAA 2I60L 1A8ZA 3H3PH 5LNEA 1CLYH 4FYSA 4OV6F 4PJ7B 3SIKA 1BX2A 3FB6A 3ZMEA 3I3BA 3VACA 2L4OA 5GGVH 2RH0A 3Q06A 5BCAA 3VFWA 4YXKL 2LLGA 1BVLB 4P2OC 2Y36H 4K94H 2EE6A 1BPVA 3L9EA 2WJ5A 2Y5QA 4HS6A 3VU1A 3T4AB 3AREB 5F0JB 4LCYB 3RUGA 3B2XA 1FFPA 4GB9A 5DQDH 4IOFC 4NNXA 3QZBA 4E41B 1SJMA 2C9QA 1YDPB 1J88A 4BK8A 3RLSA 4YLQT 5C92A 5JPMB 4JW3A 3CAFA 5FLUA 2BNRB 2ZF9A 4PJBB 4AG4H 4PJHE 3II2A 2ADIB 2YKKA 3MRNA 4PJDB 5GS1A 4ZPTA 2PABA 5KVGL 5KBLA 4X5XA 4IBVA 4HV8B 5CZXC 1JSYA 4JO8A 4NNPL 4ZPVB 2Y5TB 1NEUA 3QQDB 3PCYA 4ZMTA 4EZLA 1A6TA 1TKWA 2OX5A 2F0CA 4XE0A 5MEPA 4XPFH 3PHOB 1IC0A 4H8WL 3QEQD 1QO3A 3O8XA 1OV8A 2BVUA 2JI1A 2IWGA 2VM9A 3M86A 1F3RB 3MAWA 4LQ1A 4QXVA 3LX9A 3CU7A 2X5PA 3SDDB 2BHZA 2ZPKL 4OCYL 4M61A 3BEWA 4X9YA 4M4RB 1SYSB 3OJVC 3Q2WA 5HVFB 1CURA 5LVEA 1FYTD 2XKSA 2BVQB 5E56A 2WBKA 3QZWG 1RUMH 2VDKB 3VXQA 3VWJD 3CPUA 2X4TB 4X4XA 3HLAA 2R29H 3IT8D 4FNQA 4OM0L 1NEZG 1CDCA 4I0KA 5HI5C 5IBLD 4DTGH 3WNOA 4BZ1L 3GRGA 3L3KA 1IC4H 4UT6H 1OOWA 2VZSA 2YZ1A 5ERWB 2C3VB 1KTKE 5LDUA 1ZTXE 2HVJA 1DL7H 1DJHA 3LEXB 3HAEH 5BOJA 5D2NE 1I9RH 1NAMB 4HWNA 1Y7VA 1L5GB 2DL9A 4ZODA 4DN4L 4QMEA 2FATL 4HG4K 3QJFA 3OAYH 1N9PA 1JN6B 2X2HA 1PZUB 5AYUL 5FO7A 3HS9A 3F7QA 3JWNG 4HS8L 4X6EA 1LO4L 4LKXA 3US9A 1NGYB 1FVDB 3IMBA 3LZQA 3WEMA 2PXYA 4ZTPL 5J56B 3CC5A 1L7IH 5D72H 4KUCF 2Q87A 5AENA 3B2DC 4IOIB 3CH1A 2Y2YA 5GGVL 1U6AH 3VXMB 1DHKA 2Z65C 3R19A 5DFAA 3VA2C 2Y36L 2ZSVB 4HLZH 4CKQA 4BQCA 1M42A 43CAA 2A74B 4ADIA 1N7ML 4EI6A 4KVPA 3FRPA 1MPAL 3Q5YA 4O5LH 5JYLA 1D9KB 3D3VD 5IIEB 5DJXB 4JHVA 1SXZA 4AG4L 1IM3A 2OMNA 2X3CA 2NDGA 4PW9A 4W9IC 4IKKA 2YPKB 4JDTH 4LARH 4Y4FD 1V05A 2LQRA 3IJSA 4BA8A 4PRIB 1M7DA 2UZYB 3TCLB 5D6CA 1GZPA 3KR3H 4GFTB 4RFEB 4ZD3H 1UJ3C 3TA3C 3EH2A 3P2TA 4F37K 4XPFL 4G6MH 1MQ8A 1YCSA 2AK4E 4J4PA 1E7VA 3GBML 4JFDE 1KB5H 2Q6WB 3A22A 2VRQA 3BPCB 4JFZH 4ZMNA 3VYNA 3QIWD 4LASH 4GY4A 3V8OA 1ILSA 1OB0A 4CN4A 1NDMA 5IFJB 3DHUA 1BBJA 1MHCB 3PGFL 3LRSA 3SGDI 3SPGA 1MFAH 1UFUA 4JFOA 1PX4A 2FO4A 2CE6A 3GMNB 5ADPL 1RUML 4KQ0A 5IROC 2OMVB 1RLWA 2R29L 1N18A 1SZNA 1JD9A 1A7BA 4PSPA 5EF2A 2AITA 3MRIA 2JFCA 4X5WB 3IB4A 4JCLA 1XF4A 4R7NB 1S5HA 4PQXA 5IKCA 3AQYA 4WI2A 4D2NA 1RZ8B 3LXAA 3O45B 2EE0A 1KBKA 5T3ZE 4P46A 2BSSB 3QFDA 5IMLA 3WLWC 1PS3A 3I6LE 4ZX5A 2VDQH 4UNTA 4OKVB 4LSSH 2WPGA 4K5LA 4Y16D 2F7QA 3DNKA 3RFZC 4L3EB 2WN3A 4BFNA 2FJUB 3DXAB 1DQKA 1IGFL 1HL8A 1HSAB 3BVNB 4GRWF 1PYWA 1FO0B 1YMMB 5AW6B 3W0WB 4CDHA 2FGWH 4OM1H 5LAXB 5DVKA 3GJFB 2DAVA 4DGIL 3SE9H 3MUGB 4EI5A 3VWKD 5C97A 1K2DB 3ILPB 2R15A 5D72L 5JXED 1U6AL 2PWDA 3I02A 1TUPA 1Y07A 1MN4A 1CF8H 1EPFA 4KO9A 1IC5H 3IF1B 1XL4A 4RBPH 3S36X 1ZEAH 4XO8A 2ZYSA 2WZPA 2B1HH 2WVVB 3IJYA 4RNRB 2FLMA 2V5RA 1CTNA 4YZFE 3MGAA 2FQDA 4JFQA 1UWXH 1XCWA 4O5LL 5CP7A 2Q2LA 2UXGA 3L7FA 2QQQA 3CGTA 1MI5D 5L8KB 3MFGB 3KLQA 2DN7A 3B3BA 3G04B 3GLZA 4JDTL 4LARL 4M8VA 3VA6A 4BYHA 5BW7A 1FZOB 1ZWIB 2E0PA 3HG0A 5IW3A 1ET8A 1BVZA 5HJ3B 7FABL 3QUZC 4WTZA 5BVPL 5FYJH 1XB6A 3Q0HA 5CD5D 4X4KA 4XTRC 1W80A 3N40F 5F7NC 4HKXB 2IGTA 3FH7A 4JFZL 3OKNA 3P9MA 1UT9A 4GLRI 1HSBB 5ID1B 4YQXH 5AVQB 3MRFB 3DUHA 1X9LA 2XTJD 3EAKA 3FO1A 4B0MB 1WIPA 4R90H 3WAKA 5TGBB 5MHSE 2FL5B 5FYLD 3UPAA 1AE6L 2VIRB 5D7SL 1MF2H 2E8YA 2OSLB 4BKTC 1LE9B 3QS3A 2L04A 2WC7A 3K5SA 4L8CA 5KVFH 1FIGH 5JO5A 3T04D 3M6DA 4F8OA 4XXWC 1RL1A 5JIQA 3Q2VA 1Q9LB 4BCXA 5D2LA 1JOIA 2X7LA 3TGXA 3FUNA 3HC4L 3RBSA 5I6XB 2AQPA 2H45A 5JIIA 1NTDA 5DJ6B 3KVPA 4I0PB 4PJ7A 3U2JA 1OGTB 1TZGH 5E6IC 5LGKA 1EJ8A 1BVLA 1H8SA 4J3OH 1CLOH 1Y1UA 3SPVB 4PY8J 1OAJA 1WIOA 5I18H 3T4AA 3AREA 4LCYA 1GTNA 2PLTA 4NQDE 4GJTB 4ZMOA 3IN0A 1YPZB 4JQVC 2O5XH 1HZHH 3LKRB 1YDPA 4E41A 4LLQB 2ZX5A 4TQEL 5JPMA 2BNRA 2QADB 4HJ1A 4PJBA 2Z1KA 1TQTA 4LRIA 4RWYH 4ZBJA 5IJCC 2ADIA 1J5IA 4PJDA 1X5ZA 1GS7A 3QNZB 2Q3ZA 3LIZH 5SX4H 2PWGA 3AWGA 5HDOA 5F7UA 4HV8A 3VTAA 1J0HA 1ZS2A 4LLUB 3E1F1 2B1HL 4ZPVA 2Y5TA 3QQDA 3WFBL 2XN9D 3IBOA 1XV8A 4JFTA 4S0HA 3PHOA 5IMOB 1LLAA 1KWGA 4WENB 1AC6A 5T8IA 2CSPA 4MQTB 2Y2TA 3SDDA 5FLVA 1A21A 4IHOB 3CZKA 5EOTB 4AGNA 2OK0L 1VAHA 4M4RA 2DQJH 3AXLB 3KPRE 1EZVY 1S6NA 1SYSA 1YQVH 4MMYB 3V0JA 2BVQA 4NO0D 4XX1G 3KD4A 1TYRA 1U21A 5EOQH 2X4TA 3GXNA 3FN0H 4KK9C 4YQXL 1MH5B 1FC1A 1SRDA 3VD1A 4Z76A 3S3CB 4QNPF 2WP3O 2J8UB 4N2IA 1XGPB 2J72A 2GK0B 2VLJE 4R90L 3U6RB 5M95B 4BK4A 3R18A 5ERWA 2C3VA 2J1ZA 1ZLWH 1DE4B 1MF2L 1T7XA 2MNJB 2EDDA 3LEXA 4JR9H 3UYPB 4IDJL 1FHNA 4OQ1A 1DQQB 1NAMA 3NFSH 1KACB 1HEZA 1L5GA 2F08A 2VKXA 3CSPA 4N28A 3FDWA 3UZQB 2CKBB 1YAIA 4E42B 2X9ZA 4A7VA 1JN6A 3TESA 5DZAA 4KVNH 3I3DA 1T7WA 2NUTB 4UANA 1WZMA 2NSQA 4XXDB 3MNDA 4KTDH 3WKYA 4DSYA 1NGYA 3T8MA 1FVDA 5B1KA 3GFUA 2BS71 5JHDB 1RZKC 4IOIA 2XXGA 4WFHE 2DI7A 3UAJC 3VXMA 3DSFL 5IJKA 1FJ1B 3MA9H 3NJGA 4MGXA 4QRQB 3VB8A 2BY1A 5I8CB 1UHVA 4YVNA 1CLOL 2DMGA 2X6CA 2ZSVA 1E7UA 3C60B 3HB3B 1KPUB 5I18L 1G9ML 1VERA 2A74A 2BVYA 1WA1X 3QRFM 3KE0A 2ZCLH 4X8GA 1HZHL 2Z0UA 3WUWB 3MOBL 2EIMB 2B2XL 1D9KA 2HPTA 5IIEA 5DJXA 3UTTD 3Q05A 4RWYL 2NY4B 1W72B 4TNWK 1XB8A 2BP3A 3SE3C 2YHGA 3P0VH 2YPKA 2YGVA 1TQBB 4U1GC 4PRIA 1CGWA 2UZYA 3ZRCC 3TCLA 4RFEA 4JFFE 4Z0BH 1AR1D 3RGVB 4LEBA 2H4EA 5IGXH 4FQXD 1FIEA 3I75B 4HJJL 3FBQA 4CSSA 3MO1B 5E8EB 2Q6WA 3H56A 3BPCA 2P80D 4ZG1A 4ZW6A 4PMEA 3WELA 1YYLH 3WKQA 2AV7B 2G9KA 2HJKB 1MOEA 4EIGB 2DQJL 5IFJA 2A6JB 3FHEA 1ZE3H 1MHCA 1MREH 2FNBA 2QKSA 5A43C 3Q1SL 1YQVL 4NZRH 2Q8BH 5B7MA 2DJUA 3D69B 1YEFL 1EAPB 4FQJH 2YS4A 1JNHA 1QPXA 2FX9H 3GMNA 1UD5A 5LBSH 4DPCX 3Q3GB 2OMVA 5BOZG 3C87A 3FN0L 3ETBJ 1QZNA 1F1DA 2YAHA 2NYZA 3GI8H 4X5WA 1GIGH 4M3HA 4R7NA 4UAOC 1YMHB 5DHEA 1NKGA 3UTSB 4NCC2 1R3KB 3CSTA 1RZ8A 4BWTA 1H9VA 3O45A 2YEZB 2XIBA 3C9NB 2H1PH 4I77H 4ONFH 3RDTD 1FZMB 4AQAB 5DHYB 4JR9L 1M7XA 3FTXA 4CUCA 1OHQA 4OKVA 4CA4A 2F7RA 3BP6B 4L3EA 2BSTB 4NZ8A 5HHOD 3KLSA 3DXAA 2ZOLB 2XN1A 2X2IA 1HSAA 3BVNA 4KVNL 3W0WA 1YMMA 1FO0A 4OI8A 3M1BB 5E2UH 5FCSH 3QQXA 5LAXA 3C12A 1NFDE 3GJFA 2W9LA 2O93L 3QI9C 3FAWA 3MUGA 1ND0B 4FKEA 2FBJH 4LSQH 1HYSD 1K2DA 3ILPA 2FX8H 4UZGA 2AJZB 1SXSA 2HLFC 1G87A 3CN3A 1IAIM 3O6FC 3IF1A 3TJPA 2WY3B 2IJ0C 4NFCA 3QEQE 2EXWC 2WVVA 4RNRA 4ZOCA 5JIPA 4G1MB 3OHXB 5C9JB 2AQ1A 4MA3B 3DX1A 2HT4D 3L1OH 5E5LA 3U25A 4F80A 4OIIL 1S8DB 1IJ9A 1CXHA 3V9FA 1WAAF 3JWOH 4Z7WB 5BV7B 2AS5M 3P0VL 4HVBA 1BVNT 2FB4L 4F9LA 2DQTH 1A1MB 3G04A 4XR8C 4ZJ9A 3V4PH 5AFAA 5HYFA 1FZOA 1ZWIA 1MNNA 3DX9B 3QJXA 2O30A 4LDLB 1HAWA 4P2OD 5HJ3A 1W8NA 5FYLH 2R69L 4B95C 4WW2B 5E8DH 5IGXL 1QUPA 2A9MH 3BUDA 3VD7A 1JZFA 4ZOAA 3IMSA 4FFZH 1BF5A 5CZVL 4IOFD 3X1GA 3AJ7A 4HKXA 3RPKA 4Q2ZB 4EKJA 4S0TD 1HSBA 3F7PC 5ID1A 2CIIB 2ZUYA 3TH2T 4EUPG 1YYLL 3INUH 3MRFA 3FB5B 5FYKD 3TL5A 4Q74A 3FU7B 3GKZA 5A2IH 4NZRL 3HKFA 2WO4A 5CZXD 5TGBA 4WDIB 2FL5A 4KPHL 4K23H 3LNIA 2VIRA 3EFFB 1Y0LB 2FX9L 2OSLA 1LE9A 2YRZA 3T0XA 3VFGL 2HRPH 5AYTA 3TLRA 5I76B 3IDIB 4LHUB 4OV5B 1Q9LA 4HISA 1KJ2L 4JFHD 2JI2A 3BD3A 3D48R 1RZJC 1EGJA 4RDQG 1A4AA 2YO3A 3CFQA 4P5KB 3QCTH 2J5LC 4P5MA 5DJ6A 3DHMA 2QBWA 4QGYA 4I77L 4R97B 4I0PA 2BSBA 1FQ9C 1L7TH 4ACPA 3DJSA 1OGTA 1MWAH 4OZFG 5DDHB 1U2HA 3ZDXE 4HEME 4GOSA 2HSIA 4MMXB 1K4DB 2XZQH 3ZN6A 1J5DA 3PIQB 1A7RH 3EDKA 3SPVA 1JDCA 4KFMA 4NZUL 4G7VL 5T5NF 4KWUA 1U3HB 2G4EA 2UXVA 1YPZA 4G7RB 3LKRA 4LLQA 5HI5D 4HX1B 2EUXA 4JMNA 4LPYA 4U6VH 3QNYB 5HSFA 1JMZA 2Z34A 1RAMA 2V17L 4LIQH 5LWYH 4LFHG 4OLYH 3QNZA 5JQHC 2SEBB 4MJJA 4YX2H 4ENEC 1SM3L 1SNRA 1ZJBA 3KBFA 3RAJL 1NEPA 4LLUA 3VW3H 3H42L 1UA3A 4UINH 5FGSA 5T33H 3L1OL 4NBXB 5IMOA 4FFYL 2JLPA 5K59F 1YEWA 5CJXC 5KSAC 1OAYH 4MQSB 2O6CA 1A5FH 3MV8D 3GMOB 3KAAA 1QSEB 5CWSB 1AXTL 5GRXG 3S34H 4IHOA 4M56A 5EOTA 1HX0A 4B9FA 1J5HA 1NZRA 2E7LC 1EWHA 3AXLA 1NCWH 5AW8B 2V2XB 3CFJB 2YRBA 4Y5VC 3NCYP 1IQDB 4MMYA 1Z3GL 5E8DL 2R56L 2A9ML 1DBAH 4FFZL 3BD5A 5LGHH 4NQCD 4A2LA 3U6XA 5DS1A 3BSGA 4GKSB 1CR9H 2RIKA 1MH5A 3BUTA 1C1EH 2J8UA 5E9DD 1XGPA 2GK0A 4ZSOB 4FS0A 4UV7L 1JHLL 1YEDB 1F4YL 1T83A 4KKBC 3BYYA 3IFLL 4K23L 3DJ9A 1JF1B 2DQUH 1DE4A 1T89C 2DS4A 3PABB 2NMSA 3UYPA 3TA3D 1DQQA 4Q58C 4L4TB 3UZQA 3DIFB 2DLTA 2VCOA 1AQKH 2CKBA 3VSVA 4BQBA 4E42A 4PJCE 4HJUA 2OMWB 5IHWA 2ZP0T 3NACL 1NCHA 2NUTA 5GRVK 4XXDA 3QYCA 1HWHB 4J3SA 3HI6H 1BEYL 1SHMA 5JHDA 2CJ3A 2JQMA 1HTYA 5D7LD 3ZHNA 4WK0B 3SO3C 3CVHB 1FJ1A 1X9UA 2XZQL 5I8CA 4QRQA 1LD9B 3QUMB 3A67L 4JM4H 3DK0A 4LBAA 1A7RL 1N10A 4ZW8A 3C60A 3WFHB 4FA7B 1KPUA 1TQUA 3BKCL 3RG1C 5IROD 3JUYA 2P44B 4Y7MA 1XTLA 4P9HC 4KO7A 3NK3A 3WUWA 4IBUA 2QT6A 4K3DL 3L4XA 3WS6A 3CZNA 3VAEA 2IQ9H 4U6VL 2EVFA 4FNLL 4M43H 3TBCA 5IHLB 1P9MC 2Y6SC 4QRRD 3X2QB 3EJPA 1T03H 1ROCA 5E1AB 2IANE 2YAFA 5CKGA 5DZ9A 4YX2L 3WLWD 2P8MB 3ESUF 4IRSC 2E27L 2FDBP 3BPOB 4EN2A 1UB6B 3P4LA 2VDLH 3LZFH 1B2YA 1M6OB 1SEBB 4YMPA 1DSFH 4XVJH 4UINL 3RGVA 3GXPA 5EWIH 3I75A 5FGBC 3QZPA 5T33L 1UEYA 3V9EA 5I0WA 4IW4C 3MO1A 5E8EA 3S97C 3D6GA 3OWEA 4HHWA 4BQ9A 1A5FL 1FPTL 5CU9A 1AACA 3GXIA 1QBAA 4AM0Q 1D6EB 5C2UB 3S34L 2AV7A 2HJKA 3WN5C 5DZJA 1BD2D 2A6JA 2AABH 1IL1B 4XPAH 1YEJH 3QC5X 4QXGH 2YPLD 2XKUA 1TZOA 4P8QA 3D69A 1S7TB 2VR7A 3U0WL 4NYLB 3UL4A 1EAPA 1VF5C 5LGHL 2RB8A 2X1WL 1TQCC 5KSVB 1I8LA 3HLKA 4JKLA 5EEVA 3Q3GA 4Y2DB 4F93B 1OZTG 1CR9L 4Y5XB 1S5IH 4FFTA 4OU3A 1N8ZB 2OSXA 4ZFQA 4OZGF 2QGCA 1BGXH 1C1EL 3B5TA 4L5FE 3BAEL 1YMHA 3UTSA 3AAZB 4YSQA 5F6IB 1R3KA 3AM8C 2Y9RT 2Y7SA 5HJDA 3RGBA 2YEZA 4O2EB 3C9NA 2X70B 5DMIH 1FZMA 2WXNA 2X1XR 2DICA 3RWFB 4AQAA 4DT2A 3QUZD 1X5MA 2G2PA 3QFJE 4F8NA 3BP6A 2BSTA 2PWHA 4MDIB 4PYGA 5HI3C 1AKJB 4CN6A 1HINH 1AQKL 1MCPH 2ZOLA 4XTRD 3LD8C 3V0GA 3US0A 2VT0A 1NGQL 1B9KA 3GSQB 3M1BA 2VL5B 4BFJA 1R5WB 1N68A 3R1GL 3GC3A 2N01B 2ZWYA 4WY7H 1ND0A 4X83A 3ZE1F 1TO4A 5K93A 1QR1B 5D1QC 1RK1B 5B38G 2FWUA 2H9GB 4PBWD 4YGAB 1M57B 1UD4A 3BWUF 2AJZA 2GEEA 3RBGA 1YO4A 4XCCH 2YKLH 2XV0A 1KB9K 1G84A 4JM4L 4JRXB 4KRPB 3DX4A 1ZCRA 3S96B 5KUKA 1I1CA 2R0LH 1NCOA 2G3MA 3AU1B 3IE4A 3OC5A 1OP5H 2AGJH 1S7QB 4OLUH 4G1MA 5AWNL 5C9JA 4MA3A 4OLVH 1ZJAA 2OFQA 3N1PC 4M43L 3APFA 1S8DA 4HOXA 5H4YA 2DTSA 3SN6N 4M7KH 1A1MA 4AUYA 5FYKH 1WZKA 1CBJA 5E6ID 2VMJA 3DX9A 4WFGE 2PPCA 2WLYA 3GUTB 5CM1A 3EF7A 1KFAH 3QO1B 4WW2A 3ZHFA 4AM0B 1RZFH 1UYWH 4GI6A 4KRLB 4K5PA 3Q8EA 3DX2A 4WFFD 1UB5B 4YSUA 3EDJA 2QMKA 4Q2ZA 1BBDL 1BZEA 4CN1A 5I15L 2CIIA 4FI6A 4TUJB 5JOPE 4XNDA 3FB5A 4UM9B 1QW9A 1GJIA 4XPAL 3FU7A 2ICWJ 3AWFA 4QXGL 2LV4A 5SWSD 1T0MB 3ASWA 4WDIA 2HN7B 2YXVA 3RUGE 1CXLA 1A9BB 3EFFA 1Y0LA 5I5IA 2QZ5A 2BS8A 2HX7A 2EEFA 2QGDA 5GRJH 4PJAB 5JQ6L 4FZ8H 5I76A 2GBUA 1NOLA 4N90D 3IDIA 1RZGB 4LHUA 4OV5A 3BWSA 3WTSA 1NL0H 2BVOB 2WTOA 5A2BA 1BGXL 4P5KA 3FU9A 4Q6KA 4Q9CA 5EUOE 4BE6A 5HTSA 3LDBB 1BAFL 5DMIL 1PY4A 1IAOB 3QARA 3SB3A 1QW8A 1C8PA 5DDHA 2AJSH 3CMOL 2A38A 4MMXA 2V9UA 4A7SA 1K4DA 4NUMA 3PP4H 3PIQA 3GMRA 1HCZA 2AI0L 5CP3H 3DO3A 4KK9D 1U3HA 1GY1A 1VESA 2ZXBA 5M7QA 4E9YA 4WY7L 4HX1A 3IKKA 3WJJA 2B14A 3HE7C 3NTCL 4H8QA 1FBIH 3QNYA 3GMPB 2ZF8A 4MZIA 2Q10A 5C70A 2SEBA 1KWKA 1KC5H 4JG9A 3B56A 5JIDA 3FF8A 2IPUG 5ETUA 4YSOA 1N26A 3VFNB 4I9XA 4APQC 1QWNA 4PLNC 3T2OA 4DUWA 5ICXB 2A9AA 3NZ8B 2CO7B 3AG2B 4OLWL 4WHCA 2DBLH 4QRTB 1TPXB 4J39A 1XAKA 5CHNB 4OD1H 1B9ZA 2YWYA 3GMOA 2Y24A 3O4LD 1QSEA 5CWSA 2PYEB 4DEPC 1TFPA 5IT2H 1RD6A 3WIHL 2HTLD 1QHPA 4M7LT 1IBHA 4DCQB 3UAJD 4OZHF 2V2XA 2D9CA 3CFJA 4NPYB 1PD6A 2I69A 1IQDA 3IETB 4L1LA 3T6XA 3OAYK 3V55A 1KFAL 3MCKB 1OXYA 3D07A 1NLBH 4EOWH 5F9JB 1T7VA 3UFIA 5CEXB 4MSWB 2WZ0A 3QAQA 3MPCA 4GKSA 4F37F 4LXFA 3HRZB 3MJWA 1PZBA 2JH2A 2W07B 4PVLA 4WI9A 4EI0A 2KDGA 1IBFA 1SXCA 1KXTB 4YHPB 5TPWH 1IE5A 1PVHA 2YAOA 4S1RH 4ZSOA 2FX7L 1YEDA 2BVPB 4B0MM 1IFHH 1DJIA 4ISVB 1KSRA 4GI9A 2UWEB 5DS2A 1JF1A 4TS6A 4ZT1A 3PABA 4F3FB 4L37B 2H26B 2X4OB 3UTPD 2J2ZB 5F89B 1A2YB 4IMKC 3KCPB 4L4TA 3RIAK 2BX5A 3DIFA 1NCJA 2DDQH 2D4FA 1NL0L 1MAKA 2OZNA 1JPST 2OMWA 3CN4A 3FXIC 2UV3A 4ELMB 3B2UC 4K0OA 1ZLSL 5LAPA 1ZV5A 3BXNB 3DDGA 1UGNA 1DTUA 1UD3A 4HBQA 1DQVA 5IEHB 4HAFA 5ICZB 2N7SA 3CLFH 3ARFB 2J21A 4QXWA 5I1EH 3CVHA 2AJSL 4OFPA 4GQPH 3T3PB 2WAQA 3RX8A 2P28B 1Z9LA 1LD9A 1COBA 3QUMA 4YDVB 3WFHA 1PLGH 1TQVA 2JV6A 3LIUA 2Z8SA 1FCCA 4P23B 3U0PB 1JYVA 4LVEA 1DQML 1BM7A 1SFHA 2OCCB 2BFGA 4FZEL 3VD4A 4NB7A 1FBIL 4X9BA 4PEEA 4HGMA 1ITCA 1K8IB 4KRMB 1AQDB 3LNDA 5E1AA 2P8MA 3KWXA 4OLZH 1VCBC 5A1AA 1ADQL 4HUVB 5IHUH 4PGBB 1UB6A 2XXMB 5DS8B 3WFDL 1M6OA 2R0KL 1SEBA 3FQXB 4M5YH 4B96A 2L3BA 2DBLL 3IPEA 4POZC 4XWOC 2Y3NA 3DI2B 1M9WA 4OD1L 2W80C 4A39A 3L4WA 5ADOL 1NUGA 2SODB 5CZRA 1D6EA 3FH5A 5IT2L 2OJEB 4DPBX 2HLFD 3WY1A 5AVXB 1IL1A 3NP3A 1AP2B 1BQLH 1R3HB 2R39A 1I8UA 3B9EA 3O6FD 5E4OA 4P5TC 5IVZB 2JKTM 3NJMA 1QHQA 2EXWD 4NYLA 4F7KA 3BQUB 3CK0H 4EOWL 5KSVA 3T0EB 3CQPA 1JP5A 4Y2DA 5T1DL 4NQED 1X4YA 4GO8A 4UTAA 4Y5XA 1D5IL 5D1XB 5J06A 2R8SH 1AG6A 1LQSR 2VC2H 1HK6A 1NIBA 1N8ZA 3IPBA 4U1NA 5B3NA 2J55A 2YD2A 5TPWL 4RBPK 3AAZA 2Z35B 4BUQA 1QATA 3PP3H 4LNRB 4RQQB 1HOEA 2CBMA 4O2EA 1WGVA 1QBBA 2O5ZH 2X70A 4AQ1C 4J2XA 3RWFA 1O7SA 5DWPA 1UWXK 4GMTL 3TJEH 4X99B 3SYOA 3O4OC 4MDIA 1AKJA 1JGUL 1RMFL 2DDQL 4IDLA 5H94B 5HHQB 3O2VL 1VEMA 1XXFC 3GSQA 2VL5A 1H3WM 1R5WA 3QDGD 3V7MA 4HDIB 4N2CA 5JYMA 3QDME 1QR1A 1HZKA 3ML8A 3ZYZA 1T5KA 1RK1A 2H9GA 3CLFL 1EH9A 2V3EA 5J12C 4MA8H 3UGUA 1X4ZA 5KG9B 3BVWA 1H6FA 3IXTB 3MDJA 3UC2A 1VZHA 1PLGL 3EJJX 4JRXA 3IGFA 3QUGA 4NFDA 3S96A 4KZDL 2FAUA 3AU1A 1UXWB 2MH4A 3FJTA 3MLRL 1PZDA 2PR9A 3WFEH 1S7QA 2QGEA 2Q7YB 4PWHA 3OLEA 1AOHA 1LILA 3VSQA 2WN2A 4GG8B 3I84A 4HLZG 4NLAA 5K69A 4JX0A 2ED6A 1MCDA 2R0ZH 4HAKA 3B7TA 2LE9A 4HLEA 2BC4B 4K7FB 5E95B 4XN8A 2VLMD 5GS1C 1C8QA 3GUTA 3VX1A 2BDNL 2X4RB 1X4XA 4DVRH 1QWHA 3QO1A 4AM0A 3UEQA 5I0VA 1MZZA 3AGWA 1JGLH 1I8IB 2F1BA 3S5LB 1UB5A 1LMIA 3STBA 4E9SA 5I0ZA 3LCYA 2J88L 2A6IB 4PJ7E 3ZY7A 2VR6A 1YHPA 8PAZA 3NCJH 1CYWA 4TUJA 1A6WH 3MUUA 5DVMA 1S78C 4UB0H 3RGHA 4UM9A 1ZGLM 4ENED 1T0MA 2JKIS 4KY1H 2X42A 3ZDYB 1ODAA 1A25A 2CJSA 3C09C 1A9BA 3BUBA 1S46A 2OMTB 1JZIA 4E41E 4PJAA 4DK5A 3VD2A 2PTVA 2WKOF 4N2OA 3U1SL 4YSCA 2VC2L 1RZGA 3I50H 2VSDA 4PJDE 5KSAD 3OSVA 2BVOA 3BGFC 3FL7A 3VD0A 2EH8H 2FD6L 2EDNA 5A40E 3L4ZA 3OV6A 4LL9A 2O5ZL 1FGVH 1IAOA 2Y23A 1DVSA 2NY2C 1CE1H 2AQSA 1UD8A 2HB0A 2CDFB 3JSSA 3KH4A 4R4FL 1ZD6A 4JJ5B 4JL1A 4U0RB 4TPRH 4LZKA 4UUJB 3L1EA 3VGHA 2ITDA 4XMUA 3CZUB 3CBRA 1ZGLP 3ZU8A 3GMPA 5CXPA 4UV4H 2AQTA 2MPAL 3KM2A 4Q9RH 3TM6A 3ZDZB 2BHFA 2YGOA 1LO2H 1RK0B 2B20A 4MJIE 1V55B 3VFNA 5AW0B 3WFEL 1F45A 3ES6B 4OH2A 3CFCL 3NZ8A 5ICXA 3NJVA 2CO7A 3SYAA 3T09A 2C3HA 4QKXB 2ZWZA 3EH1A 2QSCH 4QRTA 4JGNA 4I3SH 2CBQA 4UM8B 1BD2E 5CHNA 4XNAA 2H0EA 2OMXB 5E1HB 1ZLWK 2R0ZL 3FUMA 3MQIA 2PYEA 5TF0A 1XH3B 5EA0H 4DCQA 5TF1L 3F6IA 1KEGH 2OP4L 3BH4A 4RDQF 4NPYA 3IETA 5J3HC 5BZZA 3MCKA 3CSBA 5IW6B 1HFUA 1ZLEA 4NGHH 4MNQB 1ASQA 5F9JA 5CEXA 2XWBB 4NXKA 3QXUA 4MSWA 5I26A 1SLUA 1ZTXL 4ODUB 3HRZA 2FJFB 5AB1A 2W07A 1BQKA 4OAWB 3RTQC 1RIVH 2NXYC 1NJ9B 2P52A 1KXTA 4J4PC 3FFOA 4YHPA 3VXME 2Y6SD 3ZQ9A 2EACA 2IBZX 3GEWB 5ALCL 1MRFH 2BVPA 5GGTA 3TFKC 4IRSD 4ENZA 2BM3A 4ISVA 5DUBB 1QNZH 2UWEA 3MV7B 3EZJB 1J8HD 4L2LA 2NNAB 3FC8A 3WIFB 1S9XB 1OD9A 1Q0XL 2YD4A 4L37A 4F3FA 1GYUA 2H26A 1QTSA 2IO5A 2J2ZA 2X4OA 1A2YA 3Q2NA 3KCPA 4MXQC 5F89A 5FV1L 4C4KT 5FFLA 3I50L 3RVUC 4LQFH 3PGDB 4ELMA 2C7UB 4DAGL 3BXNA 4LLYB 4M3KB 3SDYH 1BJ8A 1MUJB 4TF4A 3K2KA 4A7GF 4YO0B 4EBQH 4UTBL 3QIUB 3HS8A 5IEHA 4TKWA 1MCRA 5ICZA 5IOKA 3ARFA 4OZIE 1KGXA 4JMXA 4MD0B 1AGCB 3OF6A 1WWBX 3P69A 4M1GH 4YDVA 4LVNC 2LOEA 1AIZA 1PTZA 1JZEA 4P46C 4XP6H 3V6OA 2W38A 4WFEE 1VENA 5E5UB 3QWRA 2VLKE 5A2JH 4PCTA 5MP6L 4NZTH 1NLDL 4P23A 3U0PA 1J9TA 4FHKA 3WIIL 3PGCB 2WXPA 1ZY9A 3BEVB 3F7LA 4J3OG 1TF4A 3CFIC 5J9PB 4DGWC 4Z3GA 1IKNC 1K8IA 4HIEB 4PJXF 5F6HI 2PP7A 1AQDA 3D85D 4Q9RL 5LGYA 4EI5C 4ZFGH 5IESH 1LO2L 4HUVA 4PGBA 5DS8A 5HI3D 2ZTBA 2X4SB 3FQXA 1QBLH 3OXSB 3SGEH 2K6WA 1OB1B 2FK9A 2XBZA 4I3SL 3QZWB 4O58H 1TETH 5AW1B 3P4NB 5BS0B 4UAHA 1CJYA 4H20H 1HQRB 5D1QD 1CGYA 3PFUA 1LO0H 3DMMC 1NEZB 2OJEA 4X6CF 3INOA 4FTDA 5EA0L 1LP9F 2HFGL 2ZT9C 4L3EE 4ZRGA 4YN3A 1AP2A 1R3HA 3DXAE 5CMAB 5IVZA 3T6QC 5BW7C 3W0WE 4F1SA 5G55A 1IKOP 2IOMA 3BQUA 3TXAA 3AS2A 1BDYA 4NP4H 4NGHL 3T0EA 3ZGIA 1JZDC 5T3ZL 2IGLA 2ZYRA 3QHFH 3IGUA 4FNTA 4OF6A 5D1XA 2YFNA 1DVYA 5CSBA 3WMSA 1RIVL 1I7ZB 2KLSA 3QWOA 4MNGE 3VI4F 2GJ6B 1ZANH 5D5MB 3ENEA 5CILH 5TD4A 2Z35A 3A5VA 4RQQA 4LNRA 3WO4C 2ADFH 4U1KA 1QNZL 5BMFL 2FIKB 3M46A 3GPSA 7PCYA 1X3DA 2PCYA 4X99A 5CEZD 2JWYA 5GQBA 2WSDA 1CICB 2GEQA 4FADA 4LSDA 3NAAL 4NC0B 5H94A 4I0CC 5HHQA 5EIVA 1NOFA 4LQFL 4XBGB 4BIKA 1RZJH 3LN5B 4HDIA 3OLDA 4KUCD 4AQ8A 2IDUA 5DEGB 4QHKJ 4FLQA 4N2BA 4DFHA 1OVZA 5KG9A 4M1GL 3IXTA 3NVQA 3LTVA 2Z7UA 3CFUA 4XP6L 1L6PA 1ZHBB 1DZBA 4F7PB 1UXWA 2FT7A 2Q7YA 4NZTL 3KJ6H 3O4LE 4L1BA 3B9AA 2LW3A 4GG8A 1ED3B 2CUMA 3D0AA 4ZFGL 3QR2A 5IESL 1TSHA 3H9SD 2BC4A 4K7FA 2PTUA 3NMEA 4LRIC 1XBRA 5GS2D 3HUJE 1BF8A 2DEWX 2D31B 3MYJB 2CQVA 3CLEH 3RILA 3FQWB 5I1HH 2X4RA 5GZOA 1T1ZB 4HUUB 1XO8A 5DEJA 5GGQH 1DBBH 5J13B 4O58L 4UWQB 5L4MA 1I8IA 3S5LA 5C09B 1K5NB 4Z7OB 5HHXH 3KL0A 2A6IA 1GR7A 4H20L 5DT1H 2CHNA 3HE7D 1QEXA 1LO0L 1OM3L 1U8HA 3NQIA 2XU9A 2HLEB 4L4VD 1URZA 4FQCH 3ZGHA 3V9CA 2NRDA 2P9RA 5F3FA 2EABA 4TQPA 3O3EB 4APQD 2FUQA 4O4YL 1A02N 4ZQKB 1YPZE 2OMTA 3GRWH 2XNAB 4IHBA 1CDGA 1MRDH 3OKLB 4JFWA 1E27B 3NIDB 4X8JB 3WAJA 1ICTA 5SWZD 1HH6B 4A37A 3B2MA 3V10A 3EXLA 2WNXA 2Y6TE 4TL5A 4Q9BA 4GINA 2RCSH 3U1QA 4CC0A 1F4XH 3LYRA 5KYUB 1N2RB 1G4RA 5HPMB 2CDFA 4ZFOB 3DI3B 1A4JB 5GZNC 2L7JA 2TAAA 5F7FA 3A4DA 4PJIB 2YQ3A 3ARRA 4JJ5A 1P4BH 3ZL2A 4DK3A 4UUJA 3REWB 3VXSD 2D3LA 5C0AB 1NCCH 5DVOA 4AV5A 4KI5F 3STLB 1P7KB 5AW9B 1NMBH 3EH3B 3NGBB 3EKCA 1BM3H 3KL3A 2FLRT 1UM4H 4G80B 2ZX7A 1M56B 1MFUA 4JZJC 1RK0A 1W6LA 5I5JA 2GT9B 3F8UB 3DHPA 3ES6A 3KJ6L 1OSYA 2B4CL 5AVTB 5DFWH 4DEUA 5B8CC 4WEBH 3QGVA 2J8UE 1TMCB 1E8ZA 4UM8A 2A74C 4WWID 4OLEA 4L1HA 2OMXA 4GW5B 2WM0A 3S37H 3CHOA 1D9KC 2VQ4A 5F7EH 4BUHA 1XH3A 4PRHB 1TYEB 2QEJA 1OCRB 3OX8B 4AEHH 3QPKA 2BSDA 2ZOUA 3KWUA 2RAMA 1E90A 1T04B 3I2CH 5IW6A 1FNHA 5JR1H 3IWUA 4O00A 4K15A 1MDTA 2XWBA 1JZ5A 2MCPL 4ODUA 5E1QA 1IAMA 2FJFA 4OAWA 5L2KD 3BWUC 4UOZA 1NJ9A 5D55A 4FQQB 3LXUX 1TTAA 1NCDH 2F7IA 4HFUH 5ICYB 1CL7H 4N0UB 2VLRB 2GSIB 3MV7A 1YEKH 1AC0A 3ULVE 2NNAA 3WIFA 1S9XA 2E56A 3X3GH 2NY0C 3QK0A 3NRPA 4GXFA 5DO2D 4POZD 4XWOD 5KANG 2XVLA 4H0GA 2AEQH 3V0WH 2QPDB 3N43B 1KB3A 3PGDA 1U4EA 4FXGB 2C7UA 2XZAH 4W9DC 1OLLA 2EDWA 4LLYA 2JCCF 1SMAA 1MUJA 3D52A 4YO0A 5E9NA 1BP3B 3QIUA 4P2QB 4XAKD 2QVKA 3RZCB 3MOQA 4P5TD 3RU8L 5MEND 4G7QB 4MD0A 4P04A 4PV8B 1AGCA 2CRMA 3BWZA 4N24A 4G8GD 4YFLF 1F4XL 4W93A 1EMTL 2WXQA 5CO1A 3BPLC 4Y5YC 1UD6A 4JM2F 2X6UA 5CINH 2Y2WA 2VH5L 1UZ6F 1NCCL 3PGCA 4LAQL 3P3SA 3BEVA 5FGCB 3AB0C 1JV2B 1NMBL 2VLME 5J9PA 1NFKA 1AZRA 3X17A 4HIEA 3A4FA 5DGRA 4LLAA 2D7TL 2PYFB 4HS3B 3NABL 2DV6A 5C07B 4BSJA 2C34A 4KQ4L 1R75A 4MXWH 3DJTA 2X4SA 1R0AH 3OXSA 3SODB 5AL8A 4YE4L 1FVEB 4XMZA 1OB1A 1A66A 1PU0A 2RALA 3QZWA 3UTSE 4FERA 1G7LB 4FYRA 3P4NA 5BS0A 4JO5A 4XP9H 5CCHE 1CVRA 5DA0B 1M2OA 1HQRA 2Z9TA 2FT8A 1SXBA 2F19H 3IAGC 3N44F 1MG3C 1NEZA 5F7EL 3QDJB 4AEHL 4MB5A 4XMLH 5CMAA 4WUKL 4F9LC 4QXUL 1Z9OA 4NWTH 1E2VA 1WBYB 4NXSA 3ULUE 1QFHA 3ROOB 5CEZH 4BEIA 3LNFA 3D39B 4J8QA 4U3SB 5IB2A 3MJ9A 4GAJH 1AZZC 1EO8H 3B6SB 3MRCB 4L29B 1I7ZA 1L9PA 1L3NA 4Z7QF 2GJ6A 5D5MA 1JVKA 1NCDL 2BMKB 3QORC 2NR6C 2OBGA 4PRAB 4EMZA 5ENWB 1EJFA 4HFUL 5J6GB 2A5UA 2CCLA 2X44D 3VGEA 1CL7L 1KXHA 1MCNA 3MRMB 1OP5K 3ZTNL 2XA3A 2FIKA 4YFEA 5AAWA 3GT6A 4OCWL 3JBG7 1B3IA 2NY3B 1MLCB 2ZYHA 2BNQD 4UCFA 4YPGB 1CICA 3PJNA 3K0YA 3WUZA 2AEQL 3NIGB 3V0WL 4PJGF 4FQ2L 4Z7WE 1QOKA 4XBGA 2R2HB 3LN5A 2NCMA 4KNQA 1S78D 2IPTL 2WIMA 2XWJB 3RKPA 3V8CA 1P2CB 2K7QA 5DEGA 3CTTA 3W1ZA 4K7PY 1EHLL 3SQOH 2QHRH 4XO9A 2BOLA 2J6EH 5GS2H 3VFUB 5CSZB 1ZHBA 3K1DA 4YXHH 4PWIA 4JJHA 4TNEA 4F7PA 3SPIA 4XCNB 1DBMH 2ZSWB 1V5JA 2PW2B 5EEXA 3VFPB 1D2PA 5L2JB 2G3NA 2WQXA 1YA5A 1ED3A 1HWWA 5CIPH 5BUAA 2ZXCA 4LEXL 2XQYK 2E74C 2EDLA 4GS7B 2QADC 2XFGB 2WP3T 5EORH 3F00A 3ZTJG 3NCCB 2D31A 2CBPA 3MYJA 3WE1A 3FQWA 4AMXA 2ENYA 1OD7A 1BEXA 5FGRA 3GSXB 1T1ZA 4HUUA 4YSDA 5CGBA 4CBPA 2X38A 1F42A 5C09A 3GS0A 4XN4A 4XP9L 2EADA 1K5NA 4FQIL 3QAZB 5JA9A 2F19L 2R69A 3Q6FB 3RHWK 3GLEA 3EF4A 2QKIB 4UT9H 4YFLI 4XMLL 5LNDA 4G11A 3O3EA 4NWTL 3VFVB 2Y72A 5FF6B 5IW1B 1EFQA 3W82A 4NI6A 3QPXH 4BRVA 1BVKB 1E67A 1WYJA 4ZQKA 4DHLA 2C4FT 4GRWH 5AZ2L 1J0YA 5GISL 2XNAA 4NM8H 3OKLA 4GAJL 2YJQA 1PQZB 1EO8L 5DRZB 1E27A 4AYID 1SJEB 4X8JA 2HFFB 1V8HA 1B0WA 4D9QD 2D73A 1HH6A 3LH8A 5C71A 4JFUA 4BH8B 3GB7B 1RUKH 1FAIH 3UPCA 5KEZA 2IV9A 3RE0A 3ATEA 1KTCA 4H1LH 5IVXB 5KYUA 1N2RA 5HPMA 4ZFOA 3QJQB 5G4MA 1A4JA 1IGCH 4PJIA 1OAXH 2AZUA 3QEGL 4JY5H 4F57H 4C47A 1PJWA 4WV1C 3RIAF 3RTQD 2N1TE 2NXYD 3REWA 4J4PD 4UOW0 5C0AA 2CK2A 4E9QA 3STLA 1BZQK 1P7KA 6PCYA 1WHOA 4F15C 2VOTA 3S3JA 3TFKD 1KGYE 2JI3A 4L4JA 4CADB 4QWWC 3V4LA 2G3XA 4G80A 3SDCB 3MLXH 5J7CC 1U2YA 4G6JL 1NC2B 2VSCA 3GZQA 2WOYA 4ZI8A 3O11B 4YXHL 2KMWA 5FUOH 1X5XA 5AB9A 3X11B 2GT9A 4MXQD 3CCHB 2YPVH 4XRCB 2GJPA 3RVUD 3HB3C 3WMQA 2ZG1A 1A9VA 4ZSOE 1X5HA 4F9PA 1NWPA 2G75B 3V6ZB 7TAAA 1A6ZB 4GW5A 1Q0YH 4ZTOL 2XQBH 3WS6C 2ZOOA 4QTIH 4PRHA 1TITA 3T1FB 3DECA 2NY4C 2DJ4A 5EORL 4AYSA 4HJ0C 3OX8A 1S7SB 4QJ5B 4FFYA 2ZUXA 1YQ2A 3ZTDC 4P46D 4YSPA 1T04A 1TQBC 5FM5M 3KLLA 2QDVA 5IG7B 4B7LA 3FU0A 5E00B 4BK5A 3UYOD 3KYNB 3K8MA 4JPWH 3RGVC 2YEVB 2CNYA 3BT0A 3E1ZA 3GI9H 4W9ZA 4FQQA 3MU3A 5ITBH 2X09A 4PS7A 4UT9L 2BWQA 4U49A 5ICYA 4N0UA 2A4ZA 2VLRA 2GSIA 4XP1L 3QPXL 2E47A 4OFDA 1WFNA 5JUEH 3NDZE 4NCDA 4QRPB 5BO1H 2WZPD 3IJ7A 1TU2B 3CFBB 1AXSB 3VMPA 3ARBC 5IMMB 1WD8A 4FXGA 4WWPA 2VO8A 2JXMB 4JB9L 4EF3A 2VE6B 4FULA 5HHME 3DMMD 3WJLA 1JTTA 3KM1A 4CJ1A 4BE5A 4P2QA 1RUKL 4C56B 2WHVA 4LCCC 3RZCA 1LEKB 2I27N 3EJSA 1TTRA 4PV8A 2YA0A 4K8RC 4CSTA 3V4VL 4PJ8B 3TN0C 3VI3B 3VSTA 4BFBD 4D9RD 5J11B 1IGCL 4TV3A 1GAFL 2G5BB 1OAXL 2BIQA 2DKUA 3CMGA 4JY5L 3HNSL 3NSCA 5LBVA 2PWFA 5FCUH 4UIKL 1E4HA 2FJSA 5F9OH 1O7DE 2NX5B 1WHPA 4FEIA 4XC1L 1JV2A 4FTVD 1FORH 5E03A 2P47B 2C4XA 3T0DA 2OULB 2PYFA 1OIOA 4HS3A 3N50A 3IU4H 5F70A 5C07A 2MQGA 1YNKH 2Z7YA 5FUOL 3LS5H 3VXOB 4HEPA 3QJRB 2YPVL 3PDDA 2DOCA 1FVEA 4KTEH 3H9ZA 1AZNA 5AEAA 1G7LA 1WFMA 3PP3K 3UH8A 4X6FB 4AQZA 1NCBL 2Q7AA 3MJ8B 5HYEA 1Q0YL 4OLXH 1NC4B 1U95A 2MTPA 2XQBL 3RKDC 4QTIL 4RFNB 2VR5A 3QYNA 1JFHA 2C26A 3PWNB 3QDJA 2FTAA 2OZ4L 4P2YA 4EN3B 4PAZA 4PMFA 2OMBA 3RVTC 5G2NA 5F9DC 1WBYA 4L5FL 3FUDA 4XB8A 3VUAA 4TMPA 3ROOA 1RJZB 3TZVB 2CU9A 4HJIA 1U8JB 4KTGA 5F1KC 4V1DB 3D39A 4WW2C 4X98B 4U3SA 2EXYC 3L4UA 4N2MA 1I9JL 4L29A 1ZLVH 2EJ1A 3B6SA 3GQFA 3MRCA 2G4GA 1OE1A 4JAMB 2BMKA 5J6GA 4PRAA 1UWGL 5ENWA 5EOCJ 1JYXA 1LO3L 2BNRD 2DL2A 3PAUA 1F3DH 3RY4A 5A6IA 2JNZA 3MRMA 5JA8B 4E68A 4DP6X 4D3CL 4J3OF 3PWUB 1XZ0B 2VDNB 1CBVH 4HCIA 3MKKA 3RQ3A 2DQIH 1MLCA 4YPGA 1HNFA 3HMXL 4GQZA 4JKNA 3LEYL 3MROB 1AQMA 3IDYB 3E8UH 3R8BB 3OZ9L 3ZR6A 2OPCA 2R2HA 3AW5A 1WBXB 1EEYB 2XWJA 1ZT7B 1RXLA 4XN1A 1P2CA 3VGGA 1GSMA 5HPOA 1PMYA 3BUYB 3FFCD 4TRPH 4U6XA 5DC0A 1WC7B 1JFQH 4JKMA 3BKYH 4Z1PA 3L08A 4G9FD 1IT9H 4R97C 3VFUA 1RIHH 5CSZA 3UJTH 5KBPA 2CDEB 1P4IH 3DVFA 4XCNA 3RWEB 2ZSWA 2NQCA 2XG4B 2C9UA 2PW2A 4R5TA 3VFPA 5J1TC 5F9OL 3ZE2F 5L2JA 3UBXG 4IIQC 4JLRB 4JFEB 4Q97A 1U3HC 3VD5A 3O3DB 4HK3J 5E4EB 5HVWA 3ZBMA 4BSWB 3IU4L 3RNQA 3DYPA 2ADYA 3ARTA 4KRNA 3LS5L 3IFNH 5F9WB 5K9JH 1IZJA 1IAIH 3CHSA 3GSXA 5GZND 1TQSA 5GSVB 5C2BL 3FMGH 1KJVA 1E4WL 3MV9B 4NP9A 1Q72H 1TJIH 2ICEB 4X6DB 4MMZC 4XN7A 4OLXL 2WWOA 1R3IL 2K9UA 3Q6FA 3PXJA 3BP7B 1NGWB 2QKIA 3FO0L 5DR5H 3ZZLA 4N86A 3WIAA 3VO0A 2VDPH 4U6HB 3VFVA 5IW1A 5FF6A 3P0YH 5T5FL 1TJMA 1OSPH 4F58L 2QELA 2ITEA 3ABLB 3ZX1A 5FM8A 1SVBA 1IEAB 2R7EB 4N9GB 1PQZA 3K7UA 5DRZA 3L13A 1SJEA 1H6UA 2HFFA 4U1JB 3BI9X 1D9KD 2DKSA 4BH8A 1DJYA 2CJUH 5B38B 3GB7A 4Z8FH 4B9ZA 5EF1A 2IH1B 1CBVL 2A83B 5SX5H 3S98A 2DWYA 3AADB 5IVXA 4PRID 3UO1L 1IQWL 3LQAH 2RJMA 3E8UL 1INEL 1OGSA 1IAKB 4BQ6A 4TSCH 5AW4B 4LLDB 2PYEE 3F5WB 1MCBA 3GM8A 5T1MB 1J86A 1OM9A 1MWOA 3D7PA 1XFPA 2X4PB 3IAQA 2KERA 2FWSA 3KH3A 4TRPL 4CADA 2NY7L 1JFQL 5LXVA 3BKYL 3SDCA 3NCYS 1ZSDB 1NC2A 1AQ8A 2NUPB 1NMCC 3O11A 2NY0D 1MJ7L 3X11A 4YHOH 3CCHA 3ASNB 4XRCA 1TZIB 3H8NA 1JVLA 2IWEA 3SJVD 4NC1E 2X1PA 2G75A 3V6ZA 1XZWA 2KKQA 3FCTB 1A6ZA 3NYKA 2IWFA 4XCYB 5GHWH 1XBDA 3I6KB 4LDEB 4TLTA 3T1FA 4AXWB 1S7SA 1YN6B 1G6RB 1TO5A 5FW7A 3IFNL 4TVPE 3B9KB 3ZZSA 4QNPE 3DV4B 1IAIL 2CO2A 5H37G 3K46A 1CGSH 3BPOC 5IG7A 3IEAA 2IAMC 1OGAE 1BMWA 5C3TA 5E00A 4G6FB 1SF3A 4WHDA 3KYNA 5SX4I 1SPDA 1YMMD 4XO5A 3DV6B 4WIQA 4H25B 3BZFB 2YRPA 2M26A 1EZLA 3LS4H 2V9RA 2VLLB 3P9LB 3VTMA 2YXWA 1N0LB 3CWGA 3KWTA 3EW3B 4J27A 1OSPL 5D2NB 2G2RB 3MBWB 4J3TA 4QRPA 1RH8A 4NKIH 4KKRA 3TWCL 2X6AA 1VA9A 3IGKA 1TU2A 3CFBA 4KBPA 1AXSA 1VGEL 4U3HA 3ZO9A 5KW9H 3QYMA 4DP2X 8FABB 5IMMA 4RMWA 2VDMB 3NN8B 3N5AA 2F58H 1BW8A 4Y2DC 2JXMA 2VE6A 5DA4A 2BERA 2J57A 1TJXA 3D2TA 2CJUL 4H8PA 4Y1TA 3VG9B 5DZPA 2C7FA 4C56A 5E24E 3MCLH 1LEKA 3PWLB 4FP8H 3WHXB 3COOA 1THCA 2XN2A 4PJ8A 3CFNA 5FHAH 3VI3A 3LQAL 3N1MC 1NGPH 5JQIB 2NQ3A 3ECBB 2G5BA 3LQMA 4TSCL 5FAAA 1TTFA 1KN4H 1JDAA 2NX5A 3QORD 2NR6D 5B1JA 4AUUA 1MJUL 3MV01 3HFMH 3L1GA 3V6FB 3H7LA 4B9PA 2V2WB 1UXSB 2X9YA 4OGXH 5JOEA 1ZT1B 1H9DA 1OT4A 4ICXA 5B3JF 3GXDA 1OE2A 3WENA 4Z7NF 3H4FA 3T0EE 3P11H 1A3QA 4ERSH 2B7DT 2FO8A 4YHOL 4GUCA 5D1XE 3NCXA 4AEIL 3N41B 5C0CE 3EOAB 3GSRB 1TJGH 4KRPC 2AK4B 4ZMLA 4JFDB 5C7XL 1IC7H 4X6FA 3MJ8A 4P3CL 1C12B 3GM0A 1NC4A 2GY5A 3ZJAA 3RA7L 2F53D 3TEZA 3PWNA 1XQ4A 1HEJC 3KHQA 4EN3A 5JDJA 2CRIA 1DQTA 4U4IA 2YD1A 1CGSL 4RH4A 4H5SB 2AXJA 1C7SA 3U9WA 1RJZA 4GP5B 4FLRA 4CILA 3TZVA 1U8JA 5IFHH 2FEEL 5KOVC 1PKOA 3MBXH 4V1DA 4WLCA 4GQRA 4X98A 2LGNA 1JTPA 2WV3A 2HKFL 4KI5C 4M6AA 4YDZA 4MZ3A 5EO0B 5FYJU 1HN1A 4JAMA 2CK0L 2A4EA 1AKPA 2QADD 1VFBB 2NW2B 1WFJA 5F0LB 2BRRL 3IDJB 2LVCA 4PS4H 2G2NA 2K6ZA 2R1WB 3HNTL 3DDFA 5K9QG 3PWUA 3KVQA 4MA7L 1MKFA 2Z8WC 3I6SA 2YR3A 3HBGA 2IAAC 1CPUA 3QCVL 5JHLA 2EO1A 4N2GA 3R0NA 3MROA 5FV2A 4P4KB 1BA9A 5C0BB 4UF7C 4OCMC 1RFDH 2WGXA 2MNWA 4Z7AA 4DKEL 2VDKH 1WBXA 1EEYA 1ZT7A 3MLZL 3LZPA 3MCLL 2X4UB 3BUYA 1WC7A 2WLMA 2ZX6A 3LDBC 4TTDC 1JWSB 2N1KA 1MFMA 5AB2A 1NGPL 4AIXA 1XX9C 2BCKB 2CDEA 2EDEA 2EEBA 3IDXH 3RWEA 4HKZB 3EYVB 5HDBE 5IP4A 1Q0EA 2XG4A 1NAMH 4B5ZA 4GIPD 4HF5H 2J56A 1ET5A 2WXOA 2OR9L 3C2SA 3HFML 4JLRA 4JFEA 4HC1A 5FB8B 3AT0A 2XWXA 3O3DA 3U36B 5HYJB 4LEOB 2VN4A 4ZS7H 4BSWA 3P11L 4NT6B 2Z0BA 4ERSL 3UGXA 3EHBB 1JERA 4QT5B 1T6VN 1XR8B 2EZ0C 5DJCB 2C9SA 1TJGL 4OCXL 5E5MB 5GSVA 1WPCA 1WBZB 4HT1L 3WGUB 3MXWL 5GIRB 1WRFA 3MV9A 1IC7L 3HE6C 1G5AA 2ICEA 4XMPL 4X6DA 3MRGB 2DKMA 3KEHA 1TPXC 3NZSA 1E9OB 2V5TA 2M8XA 2WB7A 1QRNE 2C9XA 4QWWD 5JPNB 3BP7A 3KS0J 3B83A 4XP5H 1NGWA 2HWZH 3LZOA 2AHIA 2HX9A 4LPCA 2IC2A 4LRNH 4U6HA 4G5ZL 3TT3L 5JHDD 3U7WH 3QQ9C 3VDAA 4PJEF 1EXHA 5GS0L 4MJHA 3ILQC 2C4FU 2B59B 1P53A 4H8WC 4JM2C 1CWVA 1KF9B 3QJVB 5IFHL 3PQYD 1IEAA 2R7EA 1AI1H 3HB3D 4KMLB 4N9GA 2WINB 3O3UN 5I16B 2AQRA 5CFAA 2IDTA 4NFBA 4Y1SA 5KVDE 2CIKB 2VITB 3TV3H 1Q1PA 1WS7A 3S7GA 5C0RH 3ZDZE 4U1JA 3HRZC 4TULL 3MKGA 5IQNA 2NY4D 5B38A 4HJ0D 4PS4L 2YQ2A 1JGVL 1HESA 3HI5H 3U4BH 2IH1A 1JWMB 2DB8A 2A83A 5KTEH 4KVCH 1QWUA 2MPVA 3PLYA 1HAUA 4I3GA 4FTVE 1PLCA 5IY5B 1IAKA 4NQDB 5JW4Q 1HHKB 3RGVD 4LLDA 2XWEA 5KANI 3F5WA 1RUPH 2F7OA 2VDKL 4LPWA 5T1MA 4A6YB 3GKWL 2X4PA 2X2YA 4OB5L 2WXMA 4MHHG 4EPSA 2BFVL 4OFQA 3JV0A 5I1IH 2EINB 1UADC 1ZSDA 4MNQE 5DC9B 2NUPA 1RPKA 2Y1VA 3ARFC 1DVFC 3MBEB 3D0LB 1BAWA 4M48H 3KYOB 4NX0A 3N42F 3ARBD 4Q4IA 1TZIA 4PP2B 3AU0A 3G6JF 3TBVB 4JGJA 3V6OC 1BVOA 3LKOB 3G6DH 4HF5L 4Z7VF 4PFEA 3B7SA 3FCTA 4URTB 5DD5H 1CDIA 4LSUH 1GL4B 1BYNA 1DJZA 4W4OC 3GJFH 3OB0H 3T3MF 3I6KA 5JHBA 4AXWA 4K8RD 1YN6A 3BN9C 4AK1A 1KB5B 5AQ0A 3B9KA 3TN0D 3DV4A 3ZE0F 2VMEA 4TLSA 3MRBB 1KN2H 4MXVF 3BDYL 1E4KA 3IM1A 5IEKB 3PE9A 1IVLA 2OA9A 1P1ZB 2GKIA 4HFWB 1OAUL 3VXRB 2Z4TA 3DV6A 3W5NA 4AQEB 3CZLA 4H25A 3KPSD 1AIFB 2VLJB 1CXIA 3BZFA 4LCIH 4OCRH 4XP5L 1WT5A 4XVTL 1THAA 2VLLA 3P9LA 2EXSA 1N0LA 4FGMA 3UTQB 3BH9B 1JRHH 1C5BH 5D2NA 2G2RA 3VG0L 4F7CB 5F3BB 3MBWA 4Q52A 4QHNB 3MR9B 4PLOB 2BY0A 4WNQB 3BQUC 3V0AC 4JG0L 8FABA 1DVQA 1URLA 3NN8A 3FFCE 4YDLB 4X8XA 5C0RL 2EKJA 3RKDD 4G9FE 2QQNL 5FUZL 4QAMB 1SLXA 4XB7A 3V0VB 2DWXA 2W59A 2E8ZA 3HI5L 1QSFD 2HG5B 2ZUWA 3GHBL 3PWLA 5KTEL 2X4NB 2PP9A 3RVTD 2YOCA 1BF2A 3WHXA 4EZJA 5BPPA 4X5LA 3THML 3X13B 2F5BL 5BS0E 3BUIA 1VPOL 4UTBA 1QA9B 3ECBA 3TIDB 3RVXC 4WEUD 2BWIA 2ZXGA 1QFUL 2JJVA 2EXYD 2P43B 3G5ZB 4DETA 1CVSC 1PDKB 2B0SH 5T3XE 4GW1B 2CBOA 3ERXA 3V6FA 4F92B 4ZFZB 2V2WA 1EGJH 4J3UA 1NPNA 1UXSA 1ZT1A 1OTTC 3B9VA 1NBZB 1FH5L 5DVNA 3QG6B 2LVEA 4CAGA 3WTXA 4NQXB 3KPPB 2GC4C 4RETB 3TBWB 4NRYB 5KS9F 3DC0A 2CLRB 3BESR 1Q1JH 3EOAA 3GSRA 1SDAB 3OHMB 1AD9B 5D5ME 2AK4A 3JWNE 4UDUB 1RULH 4JFDA 4NO3B 3JWDH 4X7DC 4LHUD 5DD5L 4NOFA 1EUTA 1FO0L 4LSUL 3PRZA 4B50A 1C12A 2IMNA 4XB3A 5EZIH 1AGBB 1WO2A 3LPWA 3APNA 3CVCA 5A6MA 5I1AB 4HWUA 1DVUA 3UROR 4DQAA 4OT1L 1WTGT 4O02B 4FN0A 4J3XA 3GS7A 2P45B 4MA1B 1KN2L 2HUEA 4H5SA 1OEZW 3ABMB 3Q5TA 3TX4A 3QFGA 2YN5A 5GZOC 3RWCB 3JVFC 3FHQA 1V3JA 2K70A 1HH9B 4JFSA 4XNQB 4L8SC 1U3HD 5EO0A 3T6VA 4CKVX 4YHYB 4LCIL 4R0LC 3X1EA 1U8PB 4JPSA 2ZWSA 1VFBA 2NW2A 4M03A 3IDJA 4OFYA 4LFHD 1DJGA 1XH0A 2R1WA 5TTRA 1C5BL 2FZ3B 3GYRA 5E6SB 2ED7A 4YSTA 1CG9B 2MOVA 3U6XS 1B4JH 1Q9OB 2WQSA 4P4KA 4A38A 5C0BA 3ZUCA 4E36A 5D93B 5I1DB 3KYAA 4DW2H 1RURH 4JHBA 2YAMA 1IRAY 2YMXH 2W0PA 1Z0MA 1PIFA 2X4UA 1QSED 3BKJH 1E5UI 1JWSA 3CPLB 4ZXBC 2EYTB 4KJWC 3QEQB 4JO2H 1SY6H 4Z7OE 2BCKA 1FDLL 2I5YH 4ODHH 1JI1A 5EIIG 3CBKB 4HKZA 2H6OA 3EYVA 5ECGA 1SBBA 3P4OB 4GKLA 4QOKE 4MAYA 4Q7DA 1JNLL 3KXFD 1YNLH 2CKBH 2B0SL 5FB8A 3IJ8A 2YZ8A 1QEWB 3IRCA 4BCYA 1FYTB 4R7DB 3A47A 3U36A 5HYJA 4LEOA 3KYMB 2YQBA 4NT6A 3VWJB 1FNEB 4QT5A 2DLIA 1XR8A 4OJDH 5DJCA 4QO1B 5E5MA 1WBZA 4Y4HD 5GIRA 3JWDL 5I74B 2PPFA 3Q2CA 3MRGA 2K9FB 4LL4A 4YK4B 1E9OA 2X0WA 4A1RA 1OAQH 5JPNA 3NCWA 1VZIA 5J0BA 1GCYA 4J6RH 2YSTA 4GXVL 5D8JL 3VFSB 1J18A 3FQ4A 1E4XH 2OS7A 2B59A 3CVIH 1LQBC 4FLOA 4UT6A 5K33A 5CFHA 2BS9A 1WWWX 3O6LL 1UZGA 3MFFB 2WINA 2GSGB 2ZJSL 5DUPL 5I16A 3RI5K 5CCJA 2CIKA 2VITA 3L17A 5F7YC 2I07B 3EH5B 3SEPA 5I1KL 4TOYL 3NOIA 5CLWA 2O5YL 3N2JA 1SOXA 1UWYA 3ZDXB 3UG5A 1JWMA 4NUGH 1IGJB 3EO0B 4NKOB 2J4WH 5CN1A 1NMAH 1QASA 3D3VB 3ZMRA 2VERN 4W9FC 4HQQH 2IAMD 3MNVB 1B4JL 4EJ1C 4KH9A 5HVHC 5EU7E 4NQDA 1HHKA 3OGCB 5JIKA 4Y4FB 4K2UL 1RURL 1T6BX 1B0GB 4A6YA 2XIIA 4XAWH 3QQNA 3QPQC 4BBWA 2YMXL 4Y1AD 3BT2H 4GIAA 3BKJL 4HD5A 1OT2A 3NSJA 4XBPB 5ESVB 5MEQB 3O81A 3VRLF 3QJUB 4K8RH 2IH9A 4JO2L 4KKLC 3HG5A 2GC7C 5GRYA 3MBEA 3D0LA 4XBEH 4URKA 1IGYB 1GOFA 3KYOA 4JG1H 5ITFB 1CZ8H 1UM5H 3ZL4H 4IEFB 4OD2B 1M3IA 4PRDB 1A6VL 1NBVL 2FJHB 4PP2A 4QEGA 1A65A 3TBVA 3LKOA 3GPEA 1YNLL 3LNEA 2CKBL 4Y2DD 4ONGH 4LLWB 1WCBB 3C6EA 3LHPL 3FU8A 4OJFL 4CU6A 2DM2A 5L9DH 4FXLA 2R2BB 3LZNA 4LCVA 3X1BA 4TTGA 1U9KA 2ITCB 1DN2A 5JORA 1AH1A 1JBJA 4J3OC 4U2YA 2PTTB 5ISZE 1S3KH 5I0YA 1G9MC 5J4MA 3A6BL 1KB5A 1WH0A 2X6MA 5KSBF 3KWWB 1BYOA 3MRBA 2AQ2A 1I1AB 3CHPA 4I88A 2FBOJ 4H88H 5TK2A 3ZOAA 5IEKA 3HR5B 3W11C 3PHSA 4KJPC 2ESVE 4KXZH 4P2QE 1P1ZA 3RJDA 4HFWA 5DK0B 4YGVB 1I9EA 3VXRA 3ULVL 4AQEA 1M7IB 3BKMH 4KDTA 1PX8A 1AIFA 2VLJA 4G1EB 3AS3A 4Y16B 1RJYB 2WQVA 2FQFA 2GIXA 1W72L 4J6RL