3NP4A

C112d/m121e pseudomonas aeruginosa azurin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALEKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2010-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3np4A00
3AG1B 2H47C 3NT0A 3S3CB 1NIAA 1KBVA 2AANA 1KYAA 3ABMB 2IDSA 3PXLA 3RYMA 3UACA 4MFHA 1GY1A 2IWEA 4JHVA 1NZRA 1E67A 2HZHA 4YL4A 1PLBA 4DP1X 4WTQA 1ASOA 2IDQA 2XXGA 3UAAA 4F2EA 1GS6X 2PCYA 3UADA 1L9RA 1V54B 3WIAA 4E9YA 2ZWNA 3ABKB 2AVFA 2PP8A 3NJIA 2EILB 2XV3A 3OD3A 1PMYA 2J56A 3HB3B 4A2EA 1PLAA 7PCYA 4GP5B 4E9SA 1WA0X 1SF3A 4BDVA 2BP0B 2H5UA 1BQKA 2BP8B 4QKTA 5I5JA 2YAHA 1ZIBA 3WKPA 1B3IA 1X9RA 2VW6A 2UX7A 4NAJA 1J9QA 3WNJA 4DP6X 1JERA 4DP4X 3FPXA 3FSAA 2J5WA 1WS8A 5I6NA 3EH4B 2VSMB 4HHGA 3NJGA 3WI9A 3T6VA 1AZNA 1XMEB 1SDDB 3FPYA 4A2DA 3S8GB 1PZAA 2W8CA 1A4AA 2MRYA 3QJRB 2VN3A 1J9TA 2BZ7A 1A8ZA 1HAWA 4HCIA 1F56A 1SHXA 3ZBMA 2Y69B 3QPKA 1EZLA 2B08A 7PAZA 2QT6A 1ILUA 1V10A 4E9XA 2PP9A 3GXUB 1N70A 3AZUA 1NPJA 1A4BA 2GSMB 2QPEB 1DYZA 3FU7B 2PPDA 2BO0A 3QJQB 2UXVA 4G7QB 2QDWA 2CCWA 1V55B 4BK5C 5TK2A 1JXGA 2J57A 2JKWA 2TSAA 3FSVA 4KO9A 3KW8A 1OV8A 3BQVA 3NYKA 4UAHA 3QJTB 1BQ5A 2DYRB 2XVBA 4TXVB 4BWWA 2Y1AA 3BVDB 4JKNA 4DP7X 4CSZA 2J55A 4A2GA 1JXDA 3NP3A 2EIKB 1AZRA 2QPDB 3PPSA 4BWUA 4GYBA 1IKOP 1AQ8A 2DYSB 2YAMA 1IBYA 3MBWB 4AZUA 1I53A 1M57B 3T6ZA 2OJ1A 1NWOA 1FWXA 1SNRA 2HX9A 4UANA 1ETJA 3L45A 4ENZA 2HRHA 3TBCA 1BYOA 1CC3A 2GI0A 2WO3B 3H56A 3PAUA 2HRGA 3FYIB 3EH3B 3V9CA 2FQGA 5B1JC 5I26A 2YAOA 1AAJA 2YAPA 5IY5B 2IDFA 5I6MA 4F7KA 1T5KA 4BWTA 3OM3B 5D4IA 1PNCA 1RZQA 1EHKB 3FYEB 3TA4D 5B7FA 3JT2A 1GS8A 4NB7A 4BXVA 3AY2A 3QJSB 3TU6A 4YSQA 4HAKA 3NP4A 4KOBA 2PPEA 3DIVA 3T71A 2XV2A 2GC4C 3KW7A 1N68A 1DZ0A 3EH5B 4WKXA 5F7BA 1JZIA 2FT6A 2VSKB 1ET8A 3WKQA 2LLNA 1X9UA 1AG0A 3X1NA 1OCOB 2VMJA 1A4CA 3PLYA 4Q8BA 1M9WA 3AG2B 1PY0A 1ZDSA 1KGYE 4AX3A 3CZUB 5TK4A 3IEAA 4YSDA 4YVNA 4DPCX 2VW4A 3S8FB 3N2JA 2ZOOA 5B3SB 1VLXA 2CJ3A 1SFHA 2CAKA 2FQDA 4N4YB 3NSDA 5I5MA 2P80A 1AACA 5B1AB 2GC7C 3WG7B 1CURA 1QNIA 1TKWA 3IE9A 2JFCA 3UABA 1PZBA 3SBQA 4DP8X 5I6LA 1KCWA 1KBWA 1QHQA 4DP9X 1JZHA 1E5YA 3DKHA 2R7EB 1J5DA 4DPBX 1BAWA 3OMIB 3NJLA 4YVUA 4YSCA 2FT8A 4G7RB 2HXAA 5B1KA 5I6OA 4DPAX 4QLWA 1OCCB 1ADWA 1BEXA 4W1TA 2XX0A 2VW7A 1PAZA 2VM4A 5A7EA 1AANA 3FQYA 1E30A 2ZXWB 4A2FA 2BWDA 4KO7A 5EHFA 2JXMA 3CVDA 1A65A 1SF5A 3NJHA 2Q5BA 3CG8A 5D4HA 1CYWA 1CYXA 4A2HA 2QDVA 3ZIYA 1NICA 1W6LA 3ABLB 1AZCA 1PNDA 1WA1X 4HIPA 1BXVA 2IDTA 3EHBB 3U25A 1JOIA 1AOZA 3H4FA 1ID2A 4KOCA 1W8EA 1NPNA 3WNIA 2GB2A 4M4RB 2H3XC 1E5ZA 3ASOB 2Q9OA 2I7SA 6PCYA 2XU9A 1JVLA 3HEIB 4L0PB 4X4KA 4YSPA 3UGEA 4AKQA 3AG3B 2BZCA 1JXFA 3X1EA 3NSFA 2AZAA 2BW5A 1E65A 3PAZA 2IH8A 1SFDA 2FWLB 3N55A 2A3TA 3CVCA 2PPCA 3S3DB 1OF0A 2CALA 2MTAA 1AS7A 1YLBB 2UXGA 3ABGA 4KO6A 1QLEB 2YXVA 5F7AA 1IUZA 2XWZA 3OMAB 1TEGA 1NWPA 1OE1A 2XYBA 2YAQA 4HCGA 1ASQA 3DTUB 1SDDA 2I7OA 5I5IA 1RCYA 1M56B 2X87A 4YSTA 3PCYA 3X1GA 4HCFA 3ZDWA 3G5WA 1BXUA 4E9WA 3ERXA 4DP5X 1GW0A 3FU8A 1FA4A 1AS8A 4UF7C 1MG3C 3V9EA 2R7EA 3EF4A 2IWFA 1NDTA 1XB3A 4A67A 4G70B 2PPAA 1OE3A 2PPFA 2XV0A 2BP0A 1AR1B 2FNWA 4M3HA 4RH4A 1ILSA 1URIA 5I28A 5B7EA 3QJVB 1MZZA 1WA2X 4YSEA 2RACA 5AFAA 2E86A 2PCFA 5PAZA 1L9SA 3T6XA 1W6WA 2XX1A 1ASPA 1SHWA 2N0MA 3NJKA 2BHFA 1GSKA 2IAAC 3IN0A 4YSAA 1SJMA 1A3ZA 4G72B 3NJMA 1JVOA 4HHWA 4AKPA 4E9RA 4A68A 1BYPA 2YQBA 1J9SA 2EINB 2HLEB 1JZFA 1WS7A 4FA7B 3C75A 4FAAB 4W9ZA 3T6WA 5I6PA 1RKRA 2DV6A 2UX6A 3SBRA 1J5CA 4K9JA 2XUWA 3NSYA 1IC0A 2W88A 2AZUA 1L9PA 1ET7A 1ET5A 3NJFA 4GP4B 1OE2A 5PCYA 4YSSA 2GIMA 5AKRA 4A66A 4JHUA 1AIZA 2BP8A 2CBPA 3CDZA 4AKOA 1NIBA 1PCSA 3TASA 5AZUA 4KO5A 4NERA 4ZK8A 1L9QA 3PAVA 4F2FA 1HFUA 2DWSA 3IN2A 2FTAA 1PF3A 2GHZA 5D4JA 3IBOA 2FQFA 2PP7A 1OOWA 2XLLA 3GDCA 1L9TA 3AG4B 4YSRA 3TBBA 2NRDA 1ZIAA 1MZYA 2EIJB 1KDJA 2AFNA 2BW4A 4Q89A 1RZPA 2ZONA 2XXFA 1J9RA 5I6KA 4P5SA 2WO2B 2FJSA 2HX8A 4E9TA 3FSZA 3GYRA 3UAEA 1ZV2A 1MDAA 1FFTB 3H4HA 4PCYA 1PZCA 4GP8B 2B3IA 1XB6A 5B1JA 4YSUA 1AG6A 1AZUA 2P80D 3FU7A 4YSOA 2UXTA 3AW5A 3SBPA 3X1FA 1KDIA 1TU2A 5ANHA 1KCBA 4DP2X 4GY4A 1NIDA 2EIMB 4P5RA 1KV7A 1XB8A 5B1BB 1GY2A 2WSDA 3SQRA 4E9VA 2YARA 3NJJA 2BWIA 4G7SB 4KNSA 1ZDQA 1NINA 2UXFA 2VM3A 3X1BA 1OCZB 1IBZA 1GR7A 9PCYA 1NTDA 4HZ1A 4GXFA 4N8UA 2TSBA 5FC9A 2I85A 3OQRA 1JZEA 4PAZA 1HAUA 1AZBA 1OCRB 1TEFA 3OMNB 1NIEA 1CUOA 1GYCA 2YXWA 3FQ2A 2HX7A 4E9QA 2DWTA 3FQ1A 2YAFA 3S3BB 2FT7A 1BXAA 1L9OA 1ZPUA 3CVBA 5B7MA 2DY2A 1NIFA 2CUAA 2YAEA 2FQEA 4KNUA 4DP0X 2PLTA 3FT0A 3JTBA 3FS9A 1GS7A 2IH9A 5E9NA 4G71B 1UATA 2GBAA 4AI7A 3X2QB 2IDUA 3NJNA 8PAZA 4KNTA 1PLCA 2X88A 3CDZB 4CSPA 5LDUA 1WAEA 3QJUB 3ZX1A 4HALA 3MX0B 2OCCB 4EF3A 3NSCA 6PAZA 3D12B 1MG2C 2OV0A 1JZGA 3QQXA 1R1CA 3FSWA 3T9WA 4BXSV 1AS6A 4BDVB 3ASNB 1BQRA 1JZJA 2IWKA 3FU9A
chains in the Genus database with same CATH superfamily
1RIUH 3X13B 3SKNB 4OJCA 4E68A 4F92B 1U2CA 1DBBH 1R3HA 3LRHA 1HE8A 1T0OA 4KMQA 3BLKA 4IIQA 3MFFA 4MFHA 4QRRB 5D7SL 5GGUB 2DQEH 4NWTL 4XNUH 3QDME 5E8NA 1AKJB 5EIIG 4ELKA 2CHDA 4QJ5B 3M17A 4KI5F 5I1GL 4O2EB 2X4NB 1U8HA 4BRVA 1J18A 5LCVH 2QPSA 1JV5B 1T5XB 4BKSC 5TF0A 5JPNC 1QI3A 4XMZA 4KTGA 4DP5X 4JPKH 5TJWK 2V33A 5KZCB 1F00I 3ARUA 3BH9B 2OTUA 2IH1A 3WUWB 1KYUA 2F74A 1CDBA 4D7BA 3TJEL 3TA3C 5JYMA 1YNTB 2E4FA 1M7UA 2UYLB 3PABB 4JM2F 3SPVB 4FNSA 4UINH 5EO0A 2QEJA 4UV4L 4LP8A 2BP0B 8CGTA 1K8DB 4NYLB 3MRDA 4MASA 3A6BL 3RDTC 3OKLA 4F7CB 1OT4A 4QT5A 1N67A 3SGEH 3KJ6L 4RWYH 1UJ3C 4DUWA 1OALA 3BAIA 3PHSA 3HRPA 1SLVA 1TENA 3FPXA 5F8RC 1U93B 2CU9A 3QZOA 3BQUB 4HHGA 3GI9H 1MCPH 2YFOA 3MZTA 2E7LC 2BVTA 3IJYA 4GQPH 4LRNH 3VFRA 3FKUS 2WXHA 4MMXB 4G42B 1EHNA 2IDCA 2MJWA 3A4FA 1E6OL 4YHZL 5DT1L 1LEGB 4HCIA 2QFRA 4R4NC 3WAKA 2B4CC 3RY6C 1BVKA 4JFED 4UQBA 1RZJL 1YJDH 2CBTA 2DQDL 2FHCA 2P42B 4M7JL 5IEHB 3MNZB 4B0MB 2XIIA 4Y19B 4L05A 3AJ7A 3LTVA 1ORSA 4WW2A 1N70A 3F3HA 1QP1A 3QNXB 4MWFA 2VC2H 1ITCA 1LJMA 1IAOB 5F9OH 3UTSB 2X38A 5CILH 1WP6A 3SZ6A 5L2KD 2PPDA 3RA7L 5EOCJ 3LPWA 3MGTA 4GLRH 4BFRA 3KPMA 2CUIA 3QJQB 4G7QB 4L4VE 5GJTL 3IPEA 1WCBA 1QRNB 2J57A 2JKWA 3LNFA 1MFDL 4IS6B 4JFHD 4KQ4H 1R6VA 3ARDB 5IHWA 2EAEA 3VWJC 4YHOL 5C0JA 4HK0A 1BQ5A 5HYSA 3KPMB 1JFQL 4JKNA 5ALCL 5AOKA 3L7EA 1BAGA 2D73A 2R4RH 4LCIH 4XVTL 2R2BA 3X14A 3QG7L 2NUTA 1YQ2A 2EIKB 4PJXF 3SY0A 4BWUA 4ZFFB 1CDHA 1UOWA 2FVNA 4UBDD 5JHAA 1IKOP 5H35B 2X70B 5BVJA 1IBYA 5TH2B 1NGZA 3Q6GH 1FZJA 4DF9A 5ERWB 1KYFA 4KTDL 2P5WE 3ILPA 3DX7A 2DBLH 3O6FC 3KHOA 1SNRA 1A7PL 2HX9A 3FN9A 3KHQA 1TTFA 1VJSA 4P23D 4JKPL 1AO7D 1GGCH 2YSSB 2DKUA 5JW3H 4R7XA 4LIQL 4JB9L 3PAUA 4WU7B 1RZIB 4WI2A 4HSCX 2YMOA 4OIBA 1G6RL 3ISWA 2G5RA 5EULV 2C8NA 4JNXA 4WEBH 1TSHA 3N1GC 3E8UL 5D4IA 4QHLA 1RZGA 1XIWA 4LCCA 3VSTA 3IS0X 4ZTOL 1FRGL 5BVPH 4X5XB 1A7BA 4BSWA 1IC7H 2X4QA 3OR7B 4MDIA 3GTTA 4Z23A 3QJSB 3N1MC 4LB8A 4ALAC 3ULVC 4P5TD 2VERN 4JHWH 5DRZB 1LO4H 3JTSB 3I9IA 4OF7A 1AI1L 1KJMB 1MI5A 2Z31D 1G9MH 1OAUH 3HZ3A 4BGDA 1MCWM 4PI0A 2Y6TE 1KNOA 1UACL 4KWUA 1KNOB 2VABA 2V2WA 4WFGD 2A9DA 2C9SA 1U41A 4GMTL 1HKFA 1AQHA 3LZFL 2RB8A 3BD5A 1KJ2B 3DX4A 1OEZW 3U2JA 5K9JH 1BLIA 3D85B 4BK4A 4MHHG 5DS2A 4P59H 1BMGA 2HLFC 3QJOA 1MELA 4X7CC 4UQ9A 4YX2L 2X4PB 3MN8A 4ATWA 1BJ1H 3W39B 5KBPA 1BLNB 4NZRH 1N2RA 4OF8A 5K9KA 4M7ZB 2P9RA 3GTVA 3D69A 4KJQD 5E5RB 3L1EA 4DTGL 4L23A 1JAEA 2I9TA 3BZDA 4G8GB 2EYSA 3B6SB 4H25A 1HESA 4CDHA 4M8QB 2BNRE 2ZOLB 4JRXB 5L9DL 2ZYIA 1UXLA 2R7EB 3CC5B 4HV8A 3FB7B 5D5MA 2UVEA 4DPBX 4NAMA 4ZDHA 4O4YH 2PCFB 3VXQA 3ARDD 4L3CA 3Q1SH 2IANA 1NSNL 1QBMH 1T4WA 1REIA 1DJHA 5G5DB 1XD1A 3CIAA 4NDMB 5T1KA 2NSXA 3I50H 5E2UL 2XZCL 4OZGB 4M02A 3DMMB 1AANA 2B16A 1J0KA 3VFGH 5J9PA 5FKAB 3VNZA 1QSFD 1J87A 3FTVA 2ED9A 5FXCH 3QYMA 1CDYA 4HX1B 3ABLB 4WUUD 5JHLH 3ET9F 4WCYL 3QFJB 5CU9A 2IV8A 2I24N 3B8SA 3CGTA 3H9SB 3O9WB 1JWMA 4K0OA 5CD3A 5EU3A 4MMZA 3NJVA 1UUNA 3B7TA 2JCCA 4QYOB 5DS1A 4XNXH 4KXDA 2PW2A 5JPMB 2VMDA 3P54A 4AGOA 1HILA 3UDWA 3EDFA 4UQAA 1YUHB 4MNQD 3IDMA 1Q72H 4P5MB 3JV5A 5IB3B 2Z35B 2YQGA 1SFDA 3GSQB 3N55A 3S97C 5BRQA 3RWCB 3AQZA 3BRGC 1S7TB 5CJOH 3TYFA 2E76C 2WVSA 1YYLH 2B2XL 5K9QG 2MTAA 4NO5B 2VITA 3PAYA 1UACH 2IQAA 1ZOXA 5HGAA 1OWRM 1LEGA 1UWXK 2JXMB 3HHRB 1D7DA 1U3NA 3G6AA 5F7HA 3UOAB 1PSKH 2A9AA 4XMTA 2CG9X 4LLWA 4MMXA 2GJ6D 2E0PA 5JIHA 4EN3A 1TUPA 4IHOB 4HIQA 3FQUB 3VQLA 1YNTF 4JM2B 5HDBF 2ZSVA 4XCEA 3SDCB 3KPRE 3MRIB 3IDGB 3DROB 5D55A 5DZ9A 4WF7A 2WZ5A 3WY2A 4WI4A 1URLA 2Q8AH 1YMMA 4AQ1A 2BP0A 3ALPA 1BX2B 4P3CL 3J7HA 2CHWA 2HN7B 1RUAH 3MKGA 2KHAA 2DQFB 2BVEA 1S7XA 1UHVA 4ENED 4LPWA 5GGVH 3RVWD 3ARPA 4P4KA 3I2CL 1JV2B 3OZ9L 1E9PA 5E1IA 2ZXDA 1U6AH 4RCAA 3LVEA 3SCMA 4Y5VB 1F3DJ 3D4CA 3GMRB 25C8H 1X3DA 4ZBJA 3DX0A 4OTXH 4BZYA 3OKNB 5D9SB 5F7KC 2X4RB 1JMZA 5HVHC 4XOBA 4NEHB 2YR3A 2QGCA 5C0GB 4HOZA 1KGWA 1J9SA 5CP7B 4G8FA 1PYWB 1TZGH 2BHYA 4RGMB 4QRRA 1JI1A 1NUFA 4ZRGA 3BGMA 1JYVA 4M1DH 3CMGA 3T6WA 4AENB 1DBAL 4B6ZA 3SE6A 1T89C 4FLRA 3IVKB 2Y24A 3FHAA 3NSYA 1BZOA 4YNYB 2LFGA 3MNWA 1ET7A 1VACB 4IKJA 3CSFA 2BVOB 3O45B 3WKML 4LNRB 1MJ7L 2EDMA 4M5SA 4E5XB 2ZP8A 5TE7L 3IXTB 3U1PA 2WGNB 5FGCE 4MMYA 3GGWB 3PNRB 3FK3A 4U6VL 1NGPH 4OF5A 3FQWA 1R3LA 2Q0ZX 2EC9U 4L8CA 4G6KH 2Y7NA 4MD5B 1CF8H 2DH2A 4KO5A 3PQYE 1EDHA 2OP4L 4W9FC 3R18A 5HSFA 1EWHA 4B60A 1NUDA 3VI4F 3X12B 43CAA 3GRWH 5HD8C 1I3RA 4OLUL 4HEPG 4J12A 1QWHA 1IEHA 2I27N 2JH2A 4X8CA 2DM2A 3JWDL 4MJ2A 1NUGA 2J21A 5D1XB 3LY6A 3ULSB 1ZIAA 5L4IA 3V4PL 1LWRA 5G4NA 4LEEA 4BBWA 4Z7VB 5KSAD 3WBDA 4JPWL 4ZMPA 1DVTA 2P26A 5D7LA 4XPHL 3PQYD 5HY9A 1CCZA 1OAQL 1YMHA 1OM3H 2ZX8A 3R0NA 3D50A 1J9RA 1WPCA 4OSUH 3IDXL 1LM8V 4PRIE 3SYPA 2O5ZL 3DGGA 3MYJB 1OK0A 5E4EB 3AS3A 5DQJB 5E94A 1MKFA 2VN7A 3AT9A 4TSCL 1H3UA 3B9KC 1RP9A 4P57B 2IFGA 2EDHA 4BCXA 2EYTB 1RL1A 1SXSA 2GITB 2WBJA 5EIVA 2HB0A 1RK1B 2RHEA 1IGIH 2R1WB 5I30H 1BPVA 4OLWH 2X12A 5MEPB 5CMAB 1H9VA 3LDBB 1CFQB 1SOQA 5B8CB 3EBHA 4DAGL 2XSKA 4MJIE 5IQLA 4H8UA 4NJAL 4WFFE 5CJ8A 4ZSOB 2HMID 3EGXA 5ICYB 5ISZD 1EXGA 2BSTB 3U9PL 5B1BB 5AVSB 3RU8H 1YEIL 1WO2A 4BRJA 5TFSH 2YPLD 3ZGIA 5BS0B 3HE6C 4JRYD 4LSRH 5J1TC 1N5YH 2K45A 3X1BA 2GSGA 4FCHA 4NM4L 2OMZB 2QV4A 2XFXA 5DEGA 2XT1B 3RWIB 5KS9B 3BP5B 3ZTEA 4UV4H 4Y2DA 4YDVA 3JZ7A 1HAUA 3SKMB 2IPKB 1BZDA 3UMTA 2ATKA 3QRGL 3PWJB 4PJHE 2CIIB 3P4MA 3ZL4H 3HZVB 4RA3A 4HIEA 3FQ1A 4XNXL 1LO5A 4K55A 2NY2C 3TIDB 1CL7L 3DDGA 1K85A 2ZKYA 1OAXL 3OR6B 1I9JH 4HPOH 1IAII 1YYML 1DQLH 1X4YA 5JW4N 4GKZA 4J8RB 5I9QC 5F1IB 3HI6H 3T0BA 3QCUH 4RGNE 4KNTA 2X88A 1L7IL 5AB0A 3N41F 4OCSH 4PTTA 5H35A 3K6NA 4BZ1L 3MX0B 3BE1H 1JXKA 3SDAA 4PW4A 3QJFB 1Q94B 1R0AH 2NUTB 1KOAA 1T2JA 4PHZA 1DVZA 5IVXF 1YECH 3I9AA 4GSUA 1G84A 1UASA 2IWKA 4KTEL 4YE4H 3V4PA 2OQJA 1L6XA 2JWYA 4HG4J 1UZ8B 1RPQA 2Y1ZA 4PRDA 4DKEH 5EIQA 2GEQA 1EO8L 1FFQA 1HOCA 1XVSA 3GFUA 4L1SA 2IWEA 4JHVA 1A3RL 2W0FA 2MEJB 4WFHE 1MF2L 2X1XR 1LQBC 4JZOA 2A73A 4FXKA 4JHAL 4UM8B 1E3XA 4WTQA 5HHMB 5I16B 3V6OA 2Q8AL 3ZOAA 1NGWA 2LOEA 3HBZA 1DQMH 2PR4H 4P46B 3MCKA 4XI5C 4XHJC 1ZMYA 1JD9A 4FNLL 2BCKB 4O51B 4Y5XB 3IT8D 4BINA 5KSVB 4OD1H 2ARJB 4A1RA 2XN9A 3U4KA 5EN3A 4CKVX 4BCYA 1BG1A 2EILB 1I8MA 4JPKL 1G9NH 4UQDA 4E9SA 1RHHA 4XCYB 4Y2NA 3LQZA 3QCVH 3MJ7B 4QRPA 4UQ3B 2YD1A 4ZPTB 3V6FA 3L48A 3UP6A 2VZSA 2VDNL 2BP8B 1HHKB 2Z91B 4QKTA 4X6CB 2WBWB 4R26H 4QHPA 3QG6B 1X9RA 2DM4A 3SGKC 1LHZA 1J9QA 5C07B 3O4LD 4OLVL 4XBEL 3K0WA 4M61A 5KVFL 1ICTA 3RPIA 4NUMA 1MHHA 5KAQF 3CFCH 1LO0L 1K4CA 1I7UB 4QXTA 5IIEA 3F64A 1FORL 4HJJL 2VXSH 2EXWD 5IW1A 4PTTB 3SYAA 2EKSB 2E75C 2F68X 1VENA 4JO4H 4DGVL 5DHVH 5GGVY 1FAKT 4JRYE 3NFNB 4Y89A 5F1IA 2YC1A 3ZL2A 2WVVB 5K9OB 4Y19E 4HDIB 1YNTA 2UYLA 3ARVA 4XOEA 4GG6F 1P7KB 1RZ8A 5DD6B 5DUMH 4JUSA 4N87A 1E4JA 4KI5D 4Y5YB 3Q8AA 4JY6B 1X7TA 1BZ8A 4NP4L 5ITFB 4RISL 4I87A 1E50A 4QTIH 5DVKA 3FN0L 4GAJL 5H4ZA 3OV6A 1F11B 3ETSA 1NKGA 5DVLA 2JJVA 4GKSA 3BUPA 1KGIA 4BKLA 1FH5L 4UAHA 2EIZA 4K8RH 3DX2A 3WNOA 4ELMB 1H9DA 1MCCA 2BP5M 1INDH 2PTTA 3QO1B 4KI5E 4Y1TA 4Y2OA 2WLLA 4WV1A 4KAQH 4K94L 5HHOA 3EGXB 3CAFA 3HMXL 4BZ2L 5KSVA 2QTVA 2JK5A 1JFQH 5ADOL 3Q8BA 1DN2A 3AWGA 4HBCH 2P8LA 1JGLL 1TQTA 1BOYA 4WSKA 5IR1A 4K3HA 4PG2A 3HS0B 4NO3B 1NGWB 3D48R 2JJSA 2PABA 4FNLH 1GA2A 1CDGA 1I53A 3UIZA 3QXUA 3SZKC 1AGCB 4ELME 3RJQB 4TRPL 3B2DC 2Q86A 3L5IA 1RUPL 3TBVB 4ONOA 4PBWD 3VWKB 1WHPA 1CC3A 3WFBH 2F5BH 2OZNA 1NC2D 1AP2B 3CLEL 5A40E 4TVPH 5C0BE 5KYWB 2CJUH 3QIBC 1G0XA 1EIBA 3BN3B 1E2VA 1YC7A 3HI5L 5IM7A 2JJSC 3BMVA 2DICA 5D5MF 2CXGA 1FL6B 4BE5A 5DU7A 3P1VA 1E9QA 4HS8L 1PNCA 4N2AA 5AKTA 4XBEH 3G5XB 5DCCA 1TZ8A 3UCRA 2ZNXA 2OCJA 4PJDA 5KYUA 3WTYA 3MA7B 3GSUA 1N68A 3NIFE 3QI9A 5EU6D 4WKXA 5A6IA 4F8PA 2XN0A 4MD5A 2LLNA 1WBZA 1YYMH 3FNKA 4FJYA 3RLSA 4KVCL 1VEOA 1LO4L 2B1OA 2W94A 1T7YA 5C2BH 4LVNC 3VG0L 3GJEB 1QNZH 4CSSA 2AMGA 5I1LA 3THMH 2JVUA 3OC8A 3JVFC 4DKAA 1IC1A 4YE0A 3B2UC 1RSYA 2BWQA 2ODHA 1JK9A 3MKKA 5CJOL 3VMPA 4LBEB 5MERA 2YGQA 1QO3A 4Y19D 4A63A 3NIDB 3IWVA 4NN5B 3RWDA 4LPVA 3WG7B 1CURA 1NBVL 1BV8A 3IMUA 1XFPA 3LEVL 2J8UE 3VTTA 2XZAL 1NCDH 1UYWL 3RE0A 3SE3A 4DUVA 2AS5M 5K39B 4CA4A 4BFKA 5ECGA 2EO1A 4PWJA 3CPUA 4B96A 1UOVA 1FZOA 1YY9D 3O81A 4JN1L 4IOFD 2WQRA 3U9UA 4OQTL 4DP9X 3QQ4B 3KWTA 3E7JA 1RZKC 4LNVA 1B88A 1JUFB 2WQSA 3LN5A 1DQML 1BAWA 2PR4L 2XN9E 3NJLA 3TBYA 1XF2B 4BH8B 3UTTA 1CIUA 3SQOH 2X7LA 4G7RB 2GTZB 3WNMA 4HU2A 3L4YA 1HCYA 3EBAA 2HN7A 3BO8B 3GHEL 5DHXB 5L7XH 2IPUK 3WE6B 4ZPVB 5GZOD 3QPQC 4W9GC 3WSQH 3ESPA 1MRFH 2HVKB 4FZ8H 3SJVB 1RJYB 4WO4D 4RDQF 3TGXA 4A2FA 1A4JA 1TTGA 2K7PA 4FEIA 1JRHI 4WK0B 3GMMA 1OP3K 4XC3L 3BKJL 3Q0HA 3ZIYA 2AEQH 3LEXA 4M6NH 3BPLC 3VXUA 1XHHA 1QFWL 3WLWC 1H5BC 2XQYK 4XH2A 2R0WH 3TA3A 3FCTB 1TETL 3LIZH 3QRFM 1Z0NA 3VQ2C 1CD1A 3G6AB 2VUKA 3WJMB 5FHAL 4JY5H 4HS8H 2I7SA 3RG1C 1N59A 3U6RA 3UYRH 2XWJA 2IWGA 4NO5A 1JZ3A 1QWUA 1U8NB 3L1FA 2B7DT 3AABA 3TN0B 2NX5A 3FO0H 3ATDA 1UEYA 5C08D 1GKOA 5BQDA 1UWFA 4PGDB 2BNQA 3IDJA 3B7UX 5IVXE 5HP5A 1JMXA 1GOGA 1NGPL 4MCYB 4HIXH 3GSVA 4Y7MA 1HH9A 4OAWB 1NDGA 1UT2A 5FS5A 3P11H 4LL9A 2JKLA 5GRVL 4B9IA 5MI0B 4JFDA 5IMKA 1DBMH 3O2VH 5GZNA 3GI8L 4F33B 1CLVA 1LK2B 3HI1A 1QG3A 1RMFL 3CQQA 3PCYA 4JVWA 1ZHKA 4HCFA 4A55A 3Q3GB 5HI5C 5M94B 4Z78B 4JDEA 3GMRA 3HNTL 1CFSA 2X2YA 5CINH 4R4BA 4X6DF 1VA9A 3MROA 1NSNH 2DPKA 1U8PB 4MAYA 4GBXB 3WY1A 1X7SA 3LMJH 3SPJA 1OE3A 3RDTA 1MVFA 2WQUA 3BZFA 5LJYH 1UTDA 4X83A 1DBJL 3EJUA 2V9RA 1OARL 1URIA 4RAVA 1G43A 4ONGL 3TH4T 4YSEA 2FUTA 2QV2A 2PCFA 1JZ7A 3LRSA 2JIXD 1F6LL 2BHFA 2P24A 1FAIH 1QA9B 4LE8A 3ROLB 1D5BB 4XNBA 3K4AA 2XKNA 3NJMA 1U33A 4AM0A 1JVOA 2DEWX 3L3KB 4W9CC 2IAMB 4B5ZA 2EJ1A 4TNEA 4FNPA 1SBSH 4I4WB 3MLXL 4Y4FA 3T2NL 4DH2A 1D5XA 1XGYH 1PD0A 5H8DA 3MCLL 4FA7B 1QPKA 2F54D 5I6PA 3LN9A 4OF0A 3SJVD 3GLZA 4NQQA 2UWEB 4K9JA 1WLHA 1YPZA 4XCCL 1JDDA 1XQ4A 2C3WA 1JZ8A 1CJYA 1KWKA 3HA0A 3M1OA 4JDZA 1U8JA 3CMOH 1RVFH 4V2CB 1K6QL 5HHVH 3FRPA 4TQIA 2NY2D 4KHXH 4NHUA 4AM0Q 2FO1A 5F7NC 1CICB 5EH1A 3CDZA 3BWZA 2V7NA 5AZUA 4K2UH 5E0FA 1NBZA 4F7PA 5EDSA 3HHSA 1DO5A 4NKIL 4N2BA 2HJLA 3IETB 4WDIB 1DJIA 2BFVL 4OZGF 3F12B 3ZLQC 4ONHB 1OOWA 2XWTB 4TLUA 1NUNB 3PGFL 4XB3A 5L8JB 1MJJA 4YSRA 3QPXH 1IT9H 1Y18A 3DUUB 4H0LC 3IDXH 2D3VA 3V6FB 4EO5A 1I9IH 1MAKA 1KTDA 5TDOA 3T77A 1B6UA 1LYQA 3BHBB 3MZGB 2IVFC 2R39A 5AZ2L 2X1OA 1A14L 1V05A 2ZSWB 3MODH 3N42F 3I3EA 3UP1A 1DSYA 4L1LA 1RLBA 2W9EH 4DOHB 4XN7A 4QPEA 1GPOH 3WLBB 2F7QA 4FJ6A 4PWGA 4X9HA 5JDSB 2B3IA 4HC1L 3HAEH 1XB6A 4GG8A 5TH2A 1EXHA 1AZUA 1MCHA 3E0GA 2A2QT 3REVA 1NMAH 1RERA 4DEUA 2A6IB 2WANA 5DD3H 3Q2WA 5CSZB 2Z8RA 4LLYB 4KPHH 4LHUA 1UD5A 4XXWC 1KJ3L 4F8LA 2QVFB 3RAJH 1P0SE 3L1OH 1GY2A 4RWYL 3WEAA 3OBAA 5DSCB 2KZBA 4NSKA 4PCSA 3N04A 4Y4HD 2NYYD 2DQJL 1I85C 4OLZL 4W9DC 2QHLA 5A16A 5TPWH 3V79C 4O2CA 4F9LA 4EDWL 2K6YA 2JB5H 2BNUB 1E4WL 3OL2A 4U1IB 5CD5C 4NQEA 2A74B 3AFLA 2VJ8A 3ZR5A 3QNFA 1XBDA 3MGTB 3HE7A 3O4LE 4G8EB 2VDPB 4PD4K 3HB3D 1WVZA 3UTSA 4LEOB 2CMRH 4FMVA 5J11B 2WWKO 4O58H 3ECWA 2F9BT 4DUXA 1O9VA 4UTAL 3NK4A 4OJDH 4PJ6A 1WAAE 2OK0H 1YJDL 2DQDH 3OLIA 2PLTA 5AW5B 3DPDA 2IH9A 4F9LC 2WKOA 4FEMA 5E8DH 3ZY7A 3NJNA 2NY1D 3NSJA 4I9WE 1O9WA 1Z3GL 3CLFL 3E38A 1JIBA 4XN8A 4G1MA 2P8MA 2VLKE 1FZMA 3SCMD 3WMQA 4A37A 5AUMB 2DI8A 4KI5C 2GEEA 3ZYIA 4BJLA 2XG5A 1CLCA 5DK3A 3T9WA 2P49B 4X5QA 5DEZA 1MI5D 1XF3B 1W80A 5H94A 4AM0B 1X5YA 3GD1C 2YUVA 1RZIA 3UGXA 5IJDC 1IT9L 1S7WB 3O6MH 1E3FA 4JPIB 5B38G 2IOIA 2UY7A 2GTQA 5CGTA 2PETA 2WXKA 4XAWL 3CX2A 3IJSA 3UYPA 3DX9B 2VN4A 3OKEB 1AYRA 2PUQT 3WFDL 4PJBA 1MFBL 2GY5A 4FF9A 4YHIA 2E74C 2ZXCA 3O2WH 4KH9A 4FQJL 2CM5A 2WXJA 4GXUM 1I7ZB 1A0QL 3OD3A 4MRCA 3BEVA 4A2EA 1NQBA 4K5OA 3DJ9A 5DJYB 2VO8A 1ZHKB 1ECZA 3O0LA 1WA0X 3V0JA 3NN8B 2JF1A 3NIDE 3C5ZB 4N8VB 3CFKB 3QIUB 3MLPA 3HG1B 1S3RA 2X3BA 3FUMA 1TPXC 3LSOB 4PJFB 2VR6A 4K23H 1UWEL 2AKRA 5FYJL 4LT7A 4N24A 4I5BA 4KVPA 4YHMH 5D7LD 4NQDB 4MDRA 4NI6A 1JERA 4FKKA 2CDFA 2IXQA 3RI5F 1BFVL 3KYOA 3ZQWA 1B6DA 1G7JB 4ZD3H 5KTEL 1OGPA 2BNQB 3T6VA 4M1CC 4M8UA 3P3SA 4Z7QB 3AU0A 5KUMA 5I15H 1Q4NX 3FQWB 4KKPA 3ARBB 1J9TA 1XZWA 4N2IA 5FYKE 4U6HA 5BO0D 1PG7W 2WTOA 3L3JA 4IDJL 1UFGA 2R2HB 4I0KA 1GGYA 3CCHB 4PRPA 3SKJL 3IF1B 3UBXB 1EZLA 3IJ7A 1ADQL 5T1JA 3BAWA 4A2MA 3MV8E 4E9XA 2O6DA 3QORC 1AGFB 1A6ZA 1NPJA 3EOAA 2BMKA 5FM5O 4NUPA 4HIJA 3TJHD 1OT2A 1KBGL 5EPMB 1B0GB 5IWLA 2JTYA 2X42A 4XN4A 5GRJH 1BEYH 1XDTT 4MAZA 4OCNC 5FHBH 4MLSA 4HXBH 5I2IB 3KE0A 1MJUL 4LRIC 3A47A 5DZNA 4G6JL 1QPXA 1OAKL 3SCMB 2X2IA 4LLDB 2DLFH 1BPLB 4LCCC 5DHYA 1N7MH 2PYFB 2GSIB 3K72A 1A7NH 3NPSC 3K2IA 5L6YL 2Q3XA 2ZF9A 1PGRB 2QGBA 5EC1A 1XXFC 3BAEH 3FT2B 5EC1B 2OW6A 4R4FL 3VRIB 1FH5H 1CGSL 1LL1A 1V5JA 3ZDYE 1AHMA 1UYWH 2CCVA 3UYPB 2QPDB 5LCVL 4I9XA 4QOKB 4HU8A 1DN0B 1Z9NA 2D3JA 4BCZA 2DYSB 4WK2B 3EUUA 4YDZA 5D1ZC 3TH3T 3TOPA 4IYKA 2AQRA 3U30C 3I6LD 1NEUA 1KJ3H 2PWEA 1IM3D 5LWYH 1AO7E 4AQ8C 2H0FA 4R84A 4NXSA 2L8AA 4JO3L 1BF8A 1NDMB 4UTBH 2ADGB 4DO5A 1ZJBA 3VMNA 2FHBA 5HI3C 3HI5H 2WUBL 2C4FT 2VXSL 4P4KD 5EDXA 1T5KA 1MJ8L 3NEOA 35C8L 2FEEL 1TO5A 4LLMA 4B9JA 3NGBC 4WTZG 3ARBA 2LVEA 5F7MC 4XO4A 3JT2A 2FSEA 1BFVH 2NCMA 3B9KD 4YDKL 1F6AB 4A6YA 2YD8A 1U21A 2FO4B 1G7JA 4URTB 3TVMD 5JLZA 2D3LA 1O6TA 3MA7A 3H9SE 2FT6A 3LIUA 3TBSA 2YWYA 2R0LL 2JI1A 4YLCA 4UTAA 3SYQA 4DKTA 3PLYA 5CSGA 2D03H 1ACYH 4BGLA 4MMZB 3MV11 4RRPM 2B77A 3TZVA 3V0VB 4IOFC 1KTKE 5CKAA 1D9KD 1D6EA 3N85H 4HJ0D 3VD3A 4RX4A 3RQ3A 4QRUB 2FLMA 5IZ7A 5DJAA 3WDIA 1SYVA 5EZIH 3VG9B 3MLSL 1EEZB 1VFBB 4HXBL 2HT3C 4MTMA 4DK6A 1Z5LA 3TO4A 3NH7L 4NKQB 5INCA 4AYFA 4XAWH 1PZBA 5I6LA 3C09B 1QATA 5DXWA 3WLBA 3QYNA 2XNAA 3QZPA 2QKIC 12E8L 4ISVA 3EH1A 1JHKL 4KKAD 4PS3A 1CZ8L 1D7CA 2IIJA 3BKYL 3KLSA 3D9AL 3PL6C 3APCA 3FOMB 3KS0H 4DGIH 5FYLE 2FZ3B 4XPAH 4AMKH 2OR9H 4MZRA 1U6AL 3FTZA 2PCPA 1WG3A 1XF3A 4MD4B 5CXPA 5H94B 3VFSA 3VFMA 1OCCB 2R1XB 2EACA 1FVEB 5HDBB 2H0EA 4IRZL 3HUJB 3F7VA 4PFEA 2WYZA 2BSED 4UM9B 1NANH 1HWGB 2ZCHH 4ZZKA 2C3HA 5E23A 2Y3NA 2NTFB 4EZJA 1HN1A 1HZHL 2D8KA 5EO1A 1X5AA 1NICA 3K71A 2X53A 2Z8SA 5DFVC 5CGYC 4YGVB 3UPAA 1VGEH 5IROA 5DD6A 3QDAA 1T0NA 4UNTA 4X7FC 4XP1L 1YY8A 4IBUA 1ID2A 1PDKB 4HLZG 1W8EA 4MQ7B 3EO0B 4R2GB 3LRGA 5K9OA 2VC2B 1C5DB 4U6VH 3PP3H 4HMDA 5IJBC 1YEEL 2A9NH 4HETA 4L0PB 5GRVK 2AF2A 1ZK5A 4HK3J 2OZ4L 1WRFA 1BGXH 2Z8VC 3FHQA 3Q8FA 4FQXB 3KBPA 2ADIA 4XHJD 1EFXA 1UA7A 3V6BR 3JV4A 4FNTA 5JORA 5FO2A 4HWZA 4AQOA 5C3IA 2NR6D 4ODUA 5IVNA 1KEGL 3BUBA 3FOLB 3L7FA 4IMKA 3SB3A 1FV1B 2EDKA 2ZTBA 3U1SL 1B4JH 3GXDA 1KBGH 1HEZA 2EH8L 4LCYA 4QHUA 4CC4C 3BVNA 5IGXH 3VXTA 1NCDL 3QCTL 3NACH 4X6CA 2ZUYA 4QGTA 1PS3A 2W9LA 5IB4A 1CR9H 3GS7A 5ETUB 5BJTB 5MENE 1E0OB 5AB1A 2VMEA 4H8PA 5SWQA 4RAVB 3LQAH 3N3EA 1ZTXH 3DMMD 5CFAA 1E27A 3IU4L 1LD9B 2VDRH 1WT5A 4YAQA 3DO7B 4PJBF 5B3JE 1NDTA 1XB3A 3PGCA 5HHPA 2BCKA 4G70B 2ZAHA 4Y5XA 5I18L 2E3VA 1A6PA 3N06B 3W38A 3HZMA 5CGBA 3RL2B 4ZFGL 5AW6B 5F0JB 1E3ZA 3L7EB 3Q9PA 3FHEA 3U4EB 5DURD 2VL5A 5HHOE 2B9BA 2BIQA 4XO8A 3RNKB 4LKCB 5D1QC 3P73B 3BKYH 3BP6B 4Z7VF 3RTQD 4X8JB 4EKXA 3MBXH 2KZ1B 1U3HC 5EUKB 1GC1C 2F53A 4YSAA 3VSUA 1QRNA 3WHE0 4JO3H 4G72B 2VAAB 1P5UA 4Z7AA 5DC4B 3EBIA 1KCRL 3S0PA 1XGYL 4LAQL 1BZ7A 5LGHH 3TIEB 2AV1B 1A9EB 1C1EH 3V9FA 1FJ1A 2Y5QA 4HAGA 3GBML 2HT4C 1TJGL 1WS7A 4BUQA 3HG1E 1CICA 3VA6A 4FAAB 2IG2L 4IK6A 5D72L 1ERNA 3AAZB 3O41A 1DDTA 3M1BA 4PWKA 3RFZA 1U8NA 1C5CH 5EZOL 5I8EB 1M3IA 1R75A 4BKTC 4G9DA 4H8WC 4GRLA 4U3CA 1F58H 3D4YA 2QSTA 1IFRA 3BDXA 1WBXB 3F7KA 4F15C 3AM8A 1GTNA 3RZCA 1A9BA 2AJSL 2ROXA 3KLDA 1QKZH 4JG0L 1PCSA 3ARWA 3F62A 3OAYK 3PIQA 5JZ7C 1F02I 1HZKA 4FXGA 2XVKA 5EU5B 4ZUUB 1M7IA 4YDVB 5EOCH 4JZNA 1M7DB 5E8DL 4IJ3B 4OJYA 2ZX5A 3O8XD 4AH2A 4AY0A 4KK5D 1DN0A 4PJ8B 1HHJA 4M4PA 5IJCC 3ZZ1A 2BSSA 3BZ4B 2FO8A 3P0GB 4NYLA 1Z7JA 1XX9C 3F7LA 3WE6A 4FYQA 1DQQA 5FOBA 4ESKA 1SXAA 4GBXA 2NY1B 4E9TA 5C0CA 1MHPH 5JW4M 4FTDA 3G08B 4JFZH 4XB7A 5TE4H 1AE6H 3GZOA 2AQ3A 4D9RD 1E7UA 1NM9A 1H5BB 4XVOA 3UXFA 4JKMA 2CJSA 1INQA 3O2DH 5EV7A 1UADC 3VXOA 2XWDA 3NCEB 1E5UI 2IO5A 4AVJA 2LU5A 1R5IA 3ZT5A 2ENQA 3VFOA 4QJ3B 1ZE3C 4XGZA 2X4UB 2UZXA 4FG6D 4XPFH 4KPHL 4YR6B 5H4YA 4MJ4A 1WGOA 4XMLL 4JG5A 3B9AA 3RIAF 3ULSA 3WDHA 3QUGA 4GG6A 3MLZL 4L2LA 3VGDA 5IHUL 3DIFA 4OLVH 2H2SC 3OKMA 2RIKA 1DFBL 1IBZA 1SRDA 3Q5TA 4X4XA 4OY9A 4ODWA 3SDCC 3WFEL 2VERA 1QX1A 1MHEA 3TTSA 5B22A 4D8PA 5C8JB 1FNSH 2MQCA 5J1AA 3M6DA 2ALWA 2G3ZA 3IS1X 5HGBB 1ED3B 1QMUA 1KN4L 1XGPB 1TZHB 3ZGHA 1ZPUA 2FJUB 1VERA 1MRDL 3KG5A 3RX9A 4U1SA 1I85A 1LXMA 1MW0A 3E6HA 3QEQD 1MCLA 3VWJB 3CDGB 3PHQA 4OGYH 4QAMB 2AAAA 4BIKA 4CL7A 3VFNA 5E6SB 5IJKC 3QPQD 4OKVA 1IVLA 4QWWD 2CKNA 4M9PA 5GZOC 4JG1L 4LSUH 1CGWA 2F15A 2PW1A 2COQA 2XWCA 1RJYA 1LWHA 1QZNA 4JRXE 4D0BB 5J13B 3BVWA 4C54A 1TU2B 1NFDA 4K9EL 1R1CA 4L37A 3D39B 1ZS2A 4NPJA 4PY8I 3P3RA 2Q86B 5EO9B 5D96C 1FL5A 2X4RA 5AW7B 4KKCC 1CR9L 2QADB 3U83A 3AADB 4FMFA 2YHGA 1A7QH 2NNAB 4BH8A 4KK6C 3IFNL 1IGML 2V5TA 3KXFB 3CV5A 3GBEA 5KS9E 2G9KA 3W0WE 2OMVA 3UJIL 1TQBB 1HK6A 2JB6A 1J1XH 1E67A 4DP1X 1PLBA 4XMVA 2EUVA 1L3NA 1U8KA 4BFFA 4MYWB 1IM9A 1YEHH 1G7LB 3UAAA 4AQAA 4KJWD 1AHWA 2Z7ZA 1EDYA 2G2RB 1G1OA 3GZQA 1F97A 3B5TA 4JM4H 4Y2DD 3MRNB 3QARA 1R9FA 3F7YA 3COOA 2PP8A 3QDJE 1WICA 4ODXB 3CU1A 4F3FB 2ETWA 2B0SH 2HKHL 3BYTA 4PLOB 1IBGH 1Z9SB 1T1YB 3JWNC 2R2EA 2ENSA 1PCXA 4EDWH 3MJ8B 3C8KA 2E46A 4FZ8L 5EC2A 1F42A 2K78A 4Z0BL 5EOQL 2IV9A 5I1LB 5LGJA 2Z64C 5I74C 4HQQH 4LAQH 1DCLA 2EDDA 3L2MA 5I5JA 5FYKU 1ZIBA 5MEND 1LO3H 3D6GA 3B9DA 1K8IA 1DQJB 4GT7A 3GKZA 4DP6X 3CFEA 4ZXBD 1IGCH 2W0LA 3HG5A 5DUPL 1TETH 4LEOA 2Z31B 2ZCLH 3ZTNL 5AENA 4Z7QE 5I1KL 4P07A 1DLHA 5J11C 4XP5H 3C8DA 3HE7B 1OGSA 1VESA 1CDCA 5GSRB 1PKQA 4F37F 4F57H 3QJRB 5E5UB 4DN4H 1FF5A 3HBQA 3WTSA 3CLFH 3TVMC 2VR4A 2FECL 4M56A 1F56A 2DAVA 4RESB 1S9VB 2OA9A 4ZAKD 3MO1B 4WY7L 4JFQB 4DVBB 2A0LC 5ID0B 2X41A 1BAFH 3WKNA 7PAZA 2QT6A 4HS6B 4L3ED 3U46B 2ZXBA 1JWMB 4IQHA 3F5WB 3O9WA 3IDIB 3RFZC 4JRLA 1C16A 3GJFH 3BWAB 4PJFF 1ZV5A 5IQ7L 2BERA 3WXWL 3NZUA 2I32A 4HS3B 1DYZA 4GKNB 4OU3A 1EAPA 1RHHB 1T7WA 3IRPX 1R24B 1PX3A 4MA1C 1U42A 2NY0B 3KPTA 5GPRA 1IGTA 1HINH 4KY1L 1OB1B 3KW8A 3DO7A 3HS8A 3FH5A 1WE5A 2DYRB 3EYVA 4TXVB 3HLAA 1IGFH 5C92A 4CNIA 1T21B 3LXAA 4HIIB 5B3JF 4G8IB 4AVKA 4QOKE 1HXMB 4PRBB 4M8QA 1KJVA 4Q6IB 2ITDB 3WTXA 1F8TL 3D0AA 4ZUTB 2YAMA 4U1HB 3QXDB 1MRFL 1M57B 2MOVA 2YEZB 1CE1L 2AP2A 4K3EL 3G6JF 3MOBL 1AXTL 4X4ME 5C97A 4DGIL 1KT2A 4MJ6A 3P02A 1IVTA 2H0JA 5EMYA 4MZ2A 3E8UH 3FRPG 3I50L 5E2UH 5KVGL 5CJXC 5DJXB 4KBPA 4EVNB 3ARGC 3ZT7A 1HNGA 2DTMH 4BWTA 3MRCB 3BAKA 4RAUA 4ZMLA 4BV1A 3CE1A 2D7PA 4OIFA 3ARGB 1IILE 4G9FE 2RFXA 1BVOA 4FQHB 5MENB 4PJCE 3KW7A 1BZEA 1F1GA 1A6WL 3NEEA 3HJ0A 4I77H 4WI6A 3WKQA 1KZQA 2VSKB 4BFJA 1AG0A 3IYLW 4ZW6A 2ATKB 2Y7LA 3HZYB 3U2SA 4PJ9A 3F7RA 1A4CA 2X4QB 4IBLT 3MXVH 5CJQH 4HD5A 1MCIA 4BQBA 5FO7A 3T04D 4NKOA 4Y88A 5I1CL 3CFMA 3IEAA 4IM8A 2BSDA 2ZD0A 3S96B 5CBEB 3LQAC 4XTRC 4OCYL 3QWRD 2DKSA 1OGAB 2CAKA 2FZ3A 1N0LA 5IF0A 1DHKA 4H20H 4OZIE 4PJEB 4YZFE 5B4MD 4QRRE 2DDQL 1ZPLA 1RSFA 2OMVB 3PUCA 1XZ0A 3IMWA 4M62L 4EDXB 4GAJH 4U1JA 3WNLA 1EO8H 1PSKL 3IKCA 2B5IB 1R24A 3L5XH 3BIBX 4F58H 3N1QC 2EZ0C 4AUUA 4OZHB 3OPZL 3G9AB 3GIVB 5INCB 3X11A 4DP8X 2GCYB 4GINA 1J1XL 1JSYA 1KBWA 3A3YB 3FCSA 2VTFA 4J3SA 3VVWA 5JXAL 1EHXA 1WD8A 2CWRA 3T3MF 5HDLA 3TV3L 2EQDA 3QFGA 5K59E 1OP4A 3C9NA 4LDCA 2GJZB 1NFDB 5IVXB 3EZ8A 1EEYA 3ZHFA 2OMNA 4RSYA 3VGHA 3BVUA 1TTCA 4J6IA 2PO6C 4W1TA 1AHKA 4W9JC 2YRZA 3A4AA 5AVQB 1ECYA 5AD0B 5FIEA 2EVFA 1U91B 3QH3B 1N19A 4M5ZL 1KB5L 3K80A 2J73A 1Q9KA 1YG9A 3RWJA 3CUPA 3F65A 4PH8A 1EFQA 1IC7L 1OOAA 1DSFH 5DJ6B 1WA1X 4C47A 4WFGE 2WIIB 4HPYL 1I8LC 3O2DA 3UTQA 4PG9A 2QR0B 1YEEH 4QO1B 3FTGB 4Q58C 5BO1H 2K6WA 1O6SA 1SJEB 2AW2A 1N5AB 2BRRH 4PGEB 1DVSA 1MLBA 4JQVC 4JFUA 4UAOB 1SUJA 2CIIA 2A9BA 3LEXB 3P4MB 3MJ8A 4KKBD 4OCWH 1JXFA 2IPKA 3D05A 5IT2H 5LCVA 4H26A 1EERB 2BS8A 2BW5A 1WTGT 2OKMA 3CH1B 1AZZC 1LP9B 3F5WA 3NG5A 5K9JL 5DEFA 4KKRA 1PX8A 4I77L 3VGAC 5E7FA 2OMZA 3IJYB 5MEQB 4YQXL 2YA2A 1P7QB 1ZA3A 2H26B 3DXAE 4KFMA 1CXKA 1TJHH 5CP7A 2HVBA 3VXOB 2BSRA 1XCTA 4ADGA 1YYLL 2XWZA 3SDXF 1VADB 1YMME 2JB6B 1TTBA 4APQC 5JA9A 1ASQA 4QOKA 3GEWB 1IMHC 2P47B 2HG5A 2OSXA 1RIUL 1TMCB 4GS7C 2NY7L 4XHQA 3KWUA 2NXYC 1GMEA 2VDRL 3VGAB 5FB8B 3JWDH 3WS3A 1HC1A 3D0LB 1DQQB 4JL1A 2WBJB 1ZLUH 4IMLB 2IH1B 1SMOA 1P84K 4M1CD 4KJPD 1UH2A 4MB1A 2ZUTA 1P4BH 4ACTA 1MFMA 3QWNA 1HQRB 5JMRA 4X7TA 5I8CB 3VXMA 4AYSA 3P3TA 2GYSA 5MERB 1YMHB 1IAMA 1ILSA 2F5AH 4O2EA 4CVZA 1RPUA 1U8IB 4Z95H 1MZZA 2Y6SD 3IAQA 1Q38A 2H6UA 4NC0B 4Q6IA 1CDJA 2X89A 1L0YA 4IHOA 3RIKA 1KIUB 1M6UA 3SIKA 5GGQL 3FT4A 3NJKA 4IRSC 4JCLA 4RAHA 2WXGA 4TRPH 4XO9A 2R29L 4CNIB 1AGFA 3TZVD 3PGDB 4AEIL 1B0WA 1RUPH 3VH8A 2WP3T 3QAZC 4OZ4B 1XGPA 4HHWA 1WBZB 1NBYA 1IAIH 4FFZH 4NM8H 2DWDB 3IWUA 5I8EA 1UM6H 4R90L 5LG6A 3TPKA 4HH9A 3NOIA 4J3OD 1JZFA 5DA0B 5JHMA 1SYSB 4KUCD 4NENB 5JZ7D 5T1MB 2E9IA 4ODWB 5DDHB 3WKMH 4HFUL 4R2GC 1GCFA 4HS3A 2DW5A 1MWAB 5I76B 4IRSB 1CO1A 4MVBD 1ETZB 2VLKD 3DX6A 4IRJA 3N42B 5L2KA 5DD0L 1FHGA 1S7SB 2MWCA 3FU3A 2SODB 3P9LA 4GRWF 4WUKL 5EZOH 3BGMB 4D9LL 2FD6H 5KBMA 1NKOA 1T04B 2O6FA 4BM7A 3HG1A 3LSOA 3VGEA 3OAZH 2LT9A 5ID0A 2VXTL 3QFDB 3H9SA 2YD5A 3HLKA 2ZYHA 4PB9L 1INQB 1ETZA 5HYJD 1E6JH 1TYRA 3ULUD 3U79A 2P8PB 3ZYZA 4JJ5A 2QKIB 1F2XK 1PBYA 3HMWL 1MREH 1NLBH 5D4JA 2FQFA 2VL5B 1SJVA 3FUDA 4MXWH 2QQLH 4NO3A 3ATBA 3QCUL 3MUZ1 2K7QA 4LLUA 1TVDA 5E8EA 5FUOL 5D7SH 1UWXH 5DQDH 3U1QA 2WM0A 3W3BA 4UIKL 4KROD 4H8QA 1OM3L 3VCLB 2N1TE 4ETQA 1MWAH 2IPTL 1S5IH 3CWGA 5EC2B 4HZLA 2YQ2A 1F11A 2B1AL 2G3XA 3EO1B 3IDGA 4TOYL 4XAKE 2EYSB 1D5ZB 5E99H 3T4AB 2Y7SA 4L8SB 2HSIA 2H2SD 1L4IA 3D39D 5GJSH 5TF1H 5AAPA 5F6IB 1MCQA 4HUKB 2VZ1A 1BMWA 1HQRA 3AW5A 4DEWA 4PR5A 2GK0A 4FFYL 3U9PH 1YEHL 3W39A 1A9BB 1XR9B 1Z5YD 2IOOA 4QRFA 3VFUB 4HLEA 1E2WA 3NFSL 1RIVL 5H2BA 1TJGH 1ES0A 2DRUA 5KYXB 4XZ4A 3ETBF 2FEDD 2P28B 1ZLDA 1CFVL 4OCRL 5ICZB 4JN2A 3BPCA 3RTQB 4FDWA 1NTDA 3UTTD 4BUGA 4MQ7A 3LXCA 3TNNA 2V4LA 4G5ZL 3OMNB 3VSVA 5L4FA 1NIEA 3LIZL 3WL9B 2I25N 4MZ3A 1GYCA 1H19A 2XY1A 3B56A 4F9PC 1SM3H 5MP6H 1UC6A 2WP3O 3V55A 2XACC 5A2JH 3MMEB 1OSEA 5KVEE 4ZUVB 1L9OA 4Y4HA 3QHTC 5F6IC 2C9UA 4WSJA 1H8NA 2BNUA 1SEBA 3GDBA 3HNSL 2P5PA 3QEGH 1HOEA 4R4ND 3JTBA 1ADQH 4QXUL 5CHNA 5BQ7A 5J7CC 4G71B 4YHNA 2B20A 8PAZA 2E56A 4NOFA 1A2YB 2WCGA 3LD8B 4Z7UE 3SDDD 4LPCA 2DM7A 4JPWH 3D07A 3V7MA 3RHWK 1YECL 4NZ8A 2F1EA 3P3YA 1L7IH 2A6IA 4K7PX 5T3ZL 1IE5A 1H6EA 4PW3A 5KSUB 3JWOC 2AJ3A 1G6RA 3DBXB 5JDSA 1MHEB 3NEXA 1XF5B 4ZDHB 3ENEA 4FTVB 4OBRA 3WIHH 3RWFA 4YEFA 5A6LA 4DTGH 1ROWA 3MV8D 3MREB 3FQRA 5DLMH 4H25B 2Q10A 2F19L 3X14B 3C5SA 2HZHA 3O2DL 4YL4A 2MNUA 5G4MA 1YNLH 3D2UA 3P4LA 4YR6A 3B2MA 3DOIA 3RDTD 2H45A 1UZ8A 1ASOA 2I60H 4F2EA 2PCYA 4YBLB 3UADA 1U3YA 3MR9A 1R5IB 1ZY9A 2AXWA 3MRGB 5KYYA 2HLAA 4MBRA 5FR3A 3ARDA 1R3JA 1U95A 2HKFL 5GJSL 5JORB 1H5BA 4Z7WA 5IW3A 1TJIH 4L4VA 4C56D 4K94H 4YZFF 2IH3B 4Y1AB 1SDAB 1HHGA 3C2AH 2P5WD 3BAXA 3IFPA 4HBCL 5T1KD 4NQXA 4N5ED 1NBZB 1SHSA 3QZBA 4AZ8A 4Z3HA 4EPSA 3TCLB 4ADJA 4F15B 4I85A 1HZHH 1IL1A 1NA8A 5JLZB 2UY6B 4YAQB 1H6FA 3QUZB 4R7NB 1IGCL 5DUPH 3WKPA 3ZDZF 5JPNA 5AG8A 4ZTOH 5BVPL 5JIDA 4MJ5B 4G7VH 5GHWH 3P2BA 2WXPA 4Q97A 1BECA 2A38A 3S5YA 3MTXA 1TCRB 2VO5A 1Z66A 2Q7YB 3HN8A 4G5ZH 3G6DH 4J6RH 1XBRA 2DIAA 5SX4H 2GK2A 5KANI 1AXIB 3D4ZA 2MRYA 3R4DA 4RNRA 4BSWB 2PXYA 2GW5A 4ZUUA 1D5XB 2EEDA 3BDYH 4XMPH 2CD0A 2J20A 4FXGB 5KG9A 4DN4L 4DSYA 5GGSB 3L7FB 5LN8A 3KWWA 1QSZA 1ILUA 1EJOH 3FOMA 1VFAB 2HJFB 2RFXB 3H9ZA 4MSWA 2B2XH 3QP3A 4OB5L 3LH2H 4EMZA 5HYQA 4P59L 4IU3B 4LVEA 1JCKA 1THCA 3U1SH 3I9GL 4GQZA 1G7QB 1AQKH 1MFAL 4IBQA 4PP1C 4FLSA 2C4XA 3PYCA 4FQ2L 3GTNA 1UJ3A 1JTTA 4EQ3A 1M71A 4H88L 1HKLH 3VYNA 2A9MH 5FM5M 1X7QA 2CCWA 4NQCA 5DQDL 4CVUA 1DE4B 3FO2B 2LTQB 2VL4A 5AOMA 4F2ME 3Q2LA 3FQXB 3T0DA 5B39B 3MYJA 3RGBA 1MWAL 4ZFOB 4OD1L 4BWWA 2Y1AA 3GSNB 4DN3L 1OANA 2Z6FA 4DP7X 3TEUA 5D7LB 4IS6A 5DVNA 3OB0H 4W9LC 1YEFH 1QUPA 1W0VB 4YWGH 4XMUA 3BUYA 3MV9E 1AQ8A 2ZWLT 2YPVL 3FCBA 4P2OB 2FBJH 3ES6B 2VQUA 3P77A 3S5LA 3UC2A 3UZEA 2JJTC 3KCPB 1ETJA 2OM5A 3IF1A 4NCC2 3UBXA 3GZKA 2PXYD 5ILTH 1KBKA 4G3YH 5KBLA 1HE7A 3LPFA 5E2TL 1CFVH 4OCRH 1W9XA 4H1LA 2D9QB 3EH3B 3MCYA 1AJ7L 4IOSA 4G8AC 4KXAA 1AYOA 1KTBA 1N3NB 4FA6A 4TPRH 1WFNA 1BD2E 2F5BL 5I6MA 5CEZL 1BVKB 3CPLA 5DRXA 2VR8A 3WGVB 5IG7A 4GAYB 4D0CA 1CLZL 3VO0A 2Q87A 2BXZA 2DTML 3H0TA 4IGBD 1XCQB 4FI8A 4LCYB 4PLKD 3EG9A 2ZG2A 3OVUB 4PN6A 3M45A 5BRZB 4JFQA 3QIUA 4EZLA 3VXUE 3CXDH 5ICUA 1R34A 4OUUA 3VG0H 3W9EB 4I2XE 5FKPB 3LRLA 1WCQA 4E41E 4XC1L 2R2CA 4PG2C 5BOPA 5TDPB 2GT9A 2DN7A 2WWMD 3AG2B 1SJHB 4X5WB 3VDCA 3IJHB 1IGYA 4OV5A 1IV8A 5CLWA 2W95A 2HFEA 2XCMC 5BZZA 4ONFH 1OHQA 3EH2A 3DVFA 3SPVA 4R5XA 3NDYE 5HGGS 1PIFA 1SFHA 4Z0XA 1TFPA 4M7LT 2WINA 4ZS7L 3SDYL 4ZMZA 5F1SA 4D3CL 1YY8B 1DZBA 3EXJA 3E3QE 3CFBA 3MC0A 1FSKC 4K71B 2C34A 2NYZA 4MNQB 4QXWA 4X9BA 5C0ND 4FQ2H 3K71B 3GHBH 4KK8C 4RMQA 3ASWA 1RHFA 4AV4A 4MB5A 1JV5A 1T5XA 3C8KB 4A7TA 1BVLA 1KY7A 1P69B 2JV6A 2R23B 1SQ2N 2ZUVA 4XCEB 1QHQA 2DLHA 1AKJA 2PN5A 4QNPF 2JIXB 4EI5D 3LH8A 3QJHA 1GHFH 4ODXA 4A38A 3RWDB 2ADGA 3TF4A 3NQIA 2XQYG 1MNUH 5KS9F 3B83A 1GYWA 1F3RB 1TNMA 5MEOA 4FQQA 2XXMB 5B1KA 3UX9B 2J8UF 5I6OA 2P5ED 5E5LA 3GINA 1FNFA 4ZNCD 4F93B 3IMVA 2AJXH 4ISVB 4LHQB 3TZVC 4IBWA 2CJUL 2Z34A 4D0DB 3N5AA 2ZUWA 4JFOB 3FT3B 1GGCL 2GAZB 4F8OA 5ILTL 4A2HA 1MH5B 1EEZA 3BVVA 3QNZB 1CG9B 2GSIA 1HILB 4XCNA 1FYTE 1HWWA 1GIGL 4EI6B 5AYUL 1A5FL 2RTTA 1DSFL 4AGLA 3UYRL 2A4EA 4U1IA 1NPNA 2P8PA 4M4RB 4V1DB 2JKXA 1CPUA 2JSFA 5EOTA 3TZVB 5L8LB 1CGVA 1TJMA 2DWXA 1DUZB 3ZZSA 2DWYA 3FCGA 4DZ8A 1LP9E 4NHCL 5DSCA 2G5BB 4G6KL 4DKFL 4L8BB 1VFUA 5DJDB 2V3FA 2OXHB 3HN5A 4J3XA 4NQCE 4ABVA 1OCWL 1HL4A 2WIMA 3P0YH 5FCUH 1B2YA 2PPCA 4PJAB 1T2XA 2YOCA 5D71H 2ZX7A 2W1NA 4WI5A 4WNJA 5JNYA 3VX1A 4M5TA 4NFBA 1YLBB 5JYLA 1RV6X 1IUZA 1MQ8A 3C8HA 1OE1A 1VAHA 1EA9C 3KEHA 2RJMA 2ZE0A 3QEQA 3SEPA 2OJEB 3ARSA 3CC5A 2YEVB 4M1GL 3ZE2F 3S35H 3LB6D 1A7QL 2HRPL 4PVMA 3FFCA 2C9VA 3QE5A 3A0OA 5JQ6H 5KOMC 3JWNH 4TNVF 5HPMB 4G8GA 3G3LA 2X6UA 4KRPB 3VH8B 5CJ5A 1BHGA 3BH8A 1DQIA 4UT9L 4YHPB 4CUCA 2J8HA 4NZTL 1KIUA 4CVXB 1J5HA 1MJJB 3OQ3B 5E08H 4M5YL 5F70A 3QQ9C 2FX8H 3B5HA 4XNDA 2R4SL 4FKHA 5CN2A 3V4UH 4RH4A 4RVBA 4GUCA 4X6FB 1NEZA 4W6YB 1I8IA 2GFBB 2QSCH 1IM3A 4P4RB 1FFPB 2BVPB 3HG3A 2FBJL 3RHWF 3T6XA 8FABA 3LS5L 3QIWB 2GQHA 4TQEL 2DBLL 4PV8B 1JZ5A 3ZRCC 5I9QB 3IDYB 4LSRL 1BVZA 2VE6B 4QHNB 3HJEA 2V2WB 3KDPB 4JKPH 5CS7A 1YNKL 5IVZA 4JFFB 3S4SB 1K3ZA 1PTZA 5CIPA 4AL8C 1D5MA 3RTLA 3D5OF 3NRFA 3CD4A 5EEVA 1TQSA 3GPSA 1G7HA 1ITBB 1RIVH 2UX6A 3GLEA 5GGTH 1HHIA 5FKPA 4HWEH 3DC0A 3K8KA 4PWEA 2ATPB 3KWWB 5HYFA 4YBQC 1QLEH 4PWHA 3LEYL 3RIFF 4I4WA 3CJJA 2BC4A 5DWPA 2WBJC 3ZKMC 1RJZB 4NJ9H 3KCWA 3J8F7 1RURL 2JI3A 1UM5L 1AIZA 2BP8A 2Z91A 2DJSA 4Y16B 4JQIL 4WU7A 3Q2CA 5D6DC 4XNMB 5IEKB 3D30A 4QRQA 4MX7B 2NCEA 4UQ3A 4U6HB 4AK1A 3L2NA 3HNSH 4ANXA 1U3HA 1J5OH 4K9EH 2QQLL 4Z77A 2F53E 2NY7H 1KCVH 1T5WA 3D18B 4KTEH 4DGWC 2XQBL 3TO2B 2A7BA 4GSXA 3L4XA 4D3CH 1U8PA 1YJDC 4UOQA 5CLZA 3TCLA 4OD3H 3QCTH 5LBGA 5CFHA 5J8OA 4GFTB 5D7EA 2R83A 3JQOB 3QPXL 5AAMC 3TT3L 4PI2A 1UKSA 4YFLI 3U0PA 2CK0L 3IPFA 3WS6A 4KU1A 1W0VA 5AD0A 1BQSA 4L4VB 4QHMB 2WYTA 4KX9A 5E6IA 5EUKA 5ENWB 4WTZA 3WEBA 3BC9A 3RFRA 2F58H 3ARQA 4U4BA 1OKEA 2FB4H 4LSSH 1PZCA 3U0PB 3P3UA 4Q9BA 3F58L 4FFYH 2EIBA 2Q8BH 5KSAA 3ATFA 5FYLD 1H8SA 1U9KA 4N86A 5TF1L 3DJTA 1PEZA 2VISB 3SDDA 3ZHNA 1IAIL 4FFZL 4GBXD 4J3TA 4HUMB 4TQPA 1KV7A 2QSCL 4XZUB 4GRWE 4N5EC 5DGQA 3E2HB 2Z92B 3IKCB 3D52A 4TN9A 3NJJA 4J3WA 1G7PB 5G4OA 2VM3A 3HNVL 3KDMA 4UINL 5J3HC 1NCAH 2WXFA 3QZMA 4K3DH 4AL8L 4G42A 3KPSA 2SEBA 2XHNA 2VXVH 5I0XA 3V4LA 4ANVA 4XH2B 1J0YA 2GPZA 3KPRB 5JTWA 2A6KB 1HEJC 4R97C 2IALB 4NGHL 4UTAH 3BQUA 3QUYD 2A4ZA 1J1OL 2EXWC 1I1RA 3T5WA 1KTLA 4HCRH 3V4VA 3SD5A 2DY2A 4AG4H 4L4JA 3UBFA 3VI3E 1SOXA 4O58L 3AS1A 3NPSB 1TITA 1WISA 3BEWB 1KFAH 3GSWB 4WRLA 5AW3B 5DUML 4Q56A 4DNLA 4LGPB 4N9GA 3HAEA 5EEUA 3WNNA 3PGFH 4P5KA 2WXLA 1BFOB 2ADJA 3CDZB 3DO3A 1WUZA 1TVHA 1WAEA 2VNCA 5JO5B 4PRAB 2OCCB 4PLJC 2O61A 1F45A 4QR7A 3U36B 2DEYX 3FRPB 3PWPD 3ZKQD 1EZVX 5AW8B 5J57B 1U8CA 3WY4A 3CDCA 1KACB 5AW2B 3U9UB 3CFUA 3EDJA 4UQEA 4GG6E 1I8IB 1ES0B 2H47C 1YPZB 3ZR6A 4U0RC 3BIKB 2QPFA 1UURA 1KJ2L 4F7TB 4K8RL 2IDSA 3OSVA 2WUCL 1BEYL 1WBYB 3TEZA 4URKA 1NMAL 3CSTA 4NS0A 1VZHA 4OT1L 3DVGA 1YMMD 3T4YA 5F3HA 2DMBA 4MCYA 3L9RA 2IGTA 4OUOA 1RLWA 2I9LA 1MFBH 4LLYA 1K72A 1UD3A 1QRKA 2HUEA 4RSVA 3EFFA 3VB8A 4MKMA 4WLCA 3NFPB 4ES8A 4KDVA 1UA6L 3IGLA 4XVTH 2C7UB 5HHNB 4KVNH 4GP5B 3NVQA 1SF3A 2DD8H 1BWWA 1OB1A 4NQTA 2XA8L 3O6FB 1OSYA 3L5WB 4APQD 1QZ1A 2Z3FA 5HDQL 3VI4E 4XBPA 4DQAA 3UTPE 4R8WH 1XAKA 3D39E 5FW6A 1UOLA 2Z1PA 4GIOA 4UUJA 3EH4B 4NN5C 4Y4KA 1C16B 3BW9A 3KNBA 3D06A 3LPOA 4LZKA 5IM7B 3VXRE 5JIKA 4GPVA 1K2DA 1Y1DA 3GO1L 4DQOH 3PHOA 3MAWA 2ZCKH 1UXWB 5IBUB 1MJ8H 4NGHH 1PYWA 5C08E 1RURH 1QYGL 5EN2A 5D1QD 3I6GA 2AEPH 5HXMA 3S37X 4PREA 3RTQC 1PJ9A 3MRJB 2OP4H 1F90L 4S1DD 4CJ0A 1AQKL 2KDGA 3CXDL 3HBGA 1SHMA 1H3XA 4NENA 3DV6A 4NO0A 4WI8A 5I66B 3ULVE 4OB5H 3ME0A 4R3SB 2MCAA 2J1ZA 1NBYB 2XOTA 5DF0A 5LAXB 5H2BB 1NBQA 1K8IB 3T09A 1KZYA 1NBVH 3QQ3A 3QO1A 2QDWA 3EJZD 4V33A 5E4IA 3NA9H 1JXGA 5L6YH 2OCFD 4A6YL 1P6FA 3IFOA 4MYPA 2X2JA 2VLRA 4J3OG 3UEQA 3ZDYF 3MXWL 5EZIL 1FGVH 4K8RD 3KYMA 3TJEH 3UZVA 4R7DB 4YMPA 1T66D 2FB4L 1E4XI 1JXDA 3NCCB 4IW4C 4JY6A 3DI2B 3SKOB 4U0QB 3DJRA 3QXWA 4DAGH 4J2QA 3PWNA 2CDEA 2VLJD 3CQPA 3QQ3B 1CB4A 3LCYA 3D8MA 5A7BA 3FT2A 3QORA 3RDTB 3CN0A 5LBSL 3BAYA 5CNHA 4YFLF 4JB9H 3KLAB 2VAJA 2PYFA 3K72B 1I31A 4AMKL 1KXVC 2HFEB 2Y0SA 3PWLB 3IDNA 1X5LA 1NOFA 3G5XA 4EI5B 2CDGB 5IW1B 2YPLE 2GT9B 2VRQA 3QZWG 3OXRA 4IRZH 1BM3H 5CBAA 5CF3A 4WSGA 3RGVC 3OM3B 2VXVL 1FNSL 1ZCRA 3BXNB 3ZL4L 1ZLWK 5C07A 4BXVA 3DOHA 2VWEC 1JK9B 4HJSA 4JFVA 5D7JA 2K6ZA 2APXA 3KPQA 4KOBA 3RURA 1LNUB 4OVUA 3R7RA 4DERA 2N4IA 1BZ9A 1FLRL 3NUKA 4QUOA 4HHAA 2NY0D 3G6JE 3A21A 5EU6E 3ML8A 4JE4B 3T08A 4G6ML 1AI1H 4KJQC 4PG9B 4POUB 1ZDSA 1AFVL 1Z9PA 2OZ4H 1ED3A 3FZUC 5SX5H 2JQZA 3RA7H 1GOHA 2F8XC 4EZKA 1JZ2A 3MRRB 4NO2A 4LASH 3LNGA 4IRJD 5C8JA 1HQ4A 1DFXA 1XGRA 5B3SB 3NIDF 5CLYA 4KQ4L 4LGSB 5FYJE 4X4XB 5EEXA 4JDTL 4LBAA 4NWUH 1V7MH 4JZOB 3BAEL 3CK0H 4PJFA 3L4TA 2W0FB 4J27A 5FUOH 5JOFA 4NUGL 2MHAB 2AXFB 3R1GH 4HPHA 4XXDB 2A1WL 5LLIC 2ZF8A 2H2PD 2CKBH 3K1KC 4M03A 4XE0A 4ANKA 3RWEB 5DMGC 1A4JB 3LMJL 1DDHB 4PD4J 3BN9D 3WN6A 1RULL 1W16A 5IOPA 3QR1A 3ZJAA 5KJRL 3D7PA 3R19A 1ACCA 3F6LA 4ONGH 2EABA 5AZEH 3QQ9D 4AUJA 1ND0B 3WO4C 2CRYA 2FL5B 4YHIB 2F7OA 3AQXA 1MNUL 3GIVA 5J6SA 5C0AD 5E08L 4JREC 2YC1B 3SDDC 2EP6A 4PRHE 3VW3L 4N3UA 1DQTA 4QMEA 3U7WL 4EDXA 1R5WA 1CFBA 3I74A 1PJWA 2UY7B 4B50A 4D8OA 1P9MA 2F1AA 3OR6A 3K6IA 4ZUWA 3VE0A 5HYQB 2BWDA 4MGXA 3SPIA 5EHFA 3CVDA 4HQQL 4Y5VC 4N9GB 4S10A 4AYEC 1LO3L 1W6LA 2NQCA 4PJ8A 3MJ6A 2W65A 1B4TA 1FVDA 3BKMH 3QUKA 1BXVA 4LHUD 4XCCH 4KK9C 5GS0C 4N28A 1JOIA 2FATH 2PXYB 3MLRL 1Y0LA 4Z7IA 4KOCA 3D85D 4RFEA 4FFVC 3CHOA 4LKXA 3ZDZE 2H3XC 1RZGB 1XIWB 3QDGA 4W9KC 4XNYL 6PCYA 5ITFA 1DVXA 3GRGA 4I0PC 2MNJB 3L5JA 5E5MB 3CHXA 5E6RB 1MFCH 1WZMA 2AQ2A 3HPJA 1DBAH 2Y9RT 5JW4Q 3NCYP 4HWBL 2XZQH 1FNAA 1QVOA 5EORH 2AQSA 1YEWA 3O8XB 1RZ8B 2IH8A 1KB5A 2X4OB 4RMSA 4U6YA 2UY6A 4MXVF 3EFDH 4Q7DA 3RVTC 5EB9A 2IQ9L 3S98A 1D5IH 3RFZB 3GB7B 4PJXA 4S0HA 4AT6B 1TLMA 1FZJB 4OZIA 4NQXB 3U0WH 1TEGA 1NAMB 1Z2KA 2R1WA 3O0RL 5EWIH 1L5GB 1KBBA 2OAAA 3DTUB 3KPNA 2I7OA 4L5FH 4XXCA 2ROYA 3U4BL 4FYRA 3CN3A 5L88L 2WLJA 4GRWB 1IC5H 4R7VA 1A14H 2NY5L 3IU4H 4KRNA 3ZDWA 4NAQA 3CK0L 5I1DA 1GW0A 2CPUA 2OR8A 4Y9BA 5BMFH 1FA4A 3D2UB 3R1GL 4JKLA 2ZYRA 1KPRA 1OLZA 4XXDA 1HHKA 1UH3A 2W07B 1IX2A 2K9UA 1IEAB 2XV0A 1MI5E 2O5ZH 3HMXH 4ZAKC 2DOCA 2N59A 1NAMA 5FO9A 1Z1WA 1FQ9C 1JGLH 3MLTB 1RK0B 1ETA1 4U1JB 2OW7A 1U8QB 3DX1A 1OAZL 3FO9A 4A2LA 4WV1B 4OGZA 2Z7UA 4ZTPL 4X8GA 3D0VA 4KJYB 3UYOD 5D1XD 4TUKL 4YDMA 1MEXH 4PP1D 4BQCA 1A2YA 2DJ4A 4AKPA 5BZWB 3C60D 5HHOD 1JHTB 5I23A 2NYYC 5F9WB 4ZMQA 3HFMH 2YQBA 1HT6A 3KLHC 4CC1A 3PWJA 4O02B 4M5ZH 4BUHA 3ZDXF 4WW1A 4PS4H 1XAUA 4ERSL 2AI0L 3RWIA 5KS9A 3VWJD 3DSNA 3GM8A 1J5CA 1YAIA 2R8SH 3QUKB 2W65B 3PV6A 2LU4A 1A6AA 2X6AA 1ZKAA 4FX5A 5IWLC 2L4OA 1OE2A 4PY8J 2V3EA 4JFWA 4FQHA 4FP8H 4KDTA 4BFBD 2I69A 4JHUA 1JF1B 3OHXA 5F9WC 1T4KB 4NJ9L 2OSLA 2BLFA 5D2NC 5JQIB 4PUBH 5I5RA 2DKMA 4ZK8A 4BD4A 4FERA 2DMHA 2WTPA 4AG4L 5DJXA 4EVNA 1TZAA 1X6LA 3EO0A 5C0RL 4P23C 4KX7A 3GJFK 1S5HB 4JFFA 4YQXH 4ZO7A 3S4SA 1RK1A 2FK9A 3SCMC 2F74B 1DQLL 4RETB 4S0SD 3B7RL 1AR1D 3VFUA 1MN4A 2EECA 4PP2B 5HJBA 3BESR 3EYFB 4FZEL 5DWUL 5GGSY 1EZUA 4P04A 4AWJC 1DQDL 2BVPA 5DD1H 8FABB 4ADIA 4NIKB 4FD0A 1KDJA 3KYKL 3P11L 3UZVB 4I48A 4IBVA 3CNKA 4HUNB 2XXFA 3VXRD 5C0DA 2XZAH 1F4WH 4UDTA 4Y2DB 3QYCA 5JHDB 3VVVA 2C9RA 2NMSA 3QDMA 3LRSB 3DRQA 4UDUB 3MJ7A 3FQNA 5L4MA 3LS5H 4GB9A 1QSED 4Z7OE 1L0QA 3LH9A 5FYJU 3PP3K 1F4YH 2DQIH 5EU7C 1ROCA 4CDGC 4YUEL 2NR6A 3LPGA 3T0EB 1PPIA 5ANHA 1BFTA 2CO3A 3DV6B 4NO0B 1HH6A 4RIRB 4XX1G 5ANME 4MMYB 2ED7A 1QEXA 2NNAA 2WOYA 3B9KA 1BQHG 3TO4B 3T0EC 1ZAGA 1RK7A 5HGDA 3IDMB 1FAIL 2H8PA 1VACA 2B59A 1IQWL 3KPQB 1A1OA 4H2CA 2NZ9D 3QIWD 1UM4H 1M05A 4DKDC 4AMWA 1O9ZA 5C0NC 1JZEA 3BXNA 3UMNA 5DA4A 4PJXE 1Q94A 4N22A 4AL8H 2ITEA 4NCC1 3VB9A 4GRMB 2H6OA 1AGBA 3IDJB 4L0ZA 3ZDYB 2OR7A 3CVBA 4YDJA 4XBPB 2ZCLL 3EDDA 5HJDA 3RILA 4JAMA 4G43A 4KH2A 2AK4B 2IJ0C 4L2YA 1GS7A 3JWDC 3T1WA 1IKFL 3SE8H 3TN0A 4OLUH 2DIEA 4GUPB 1G5GA 3A4DA 3X2QB 2GAZA 4NDMA 3QUXA 4MMZC 4AEHH 4LDEB 3S5LG 5J6GB 4GT0A 4H8HA 3GF8A 3D12B 3OG6B 4K3GA 2YD4A 4KRLB 2XKSA 3KH4A 2XN2A 3K2UH 4RBPK 1ZHNA 5ITBH 1JYXA 4BXSV 1AS6A 1QSEA 5AW1B 3DGDA 3DUSA 5DYFA 4RDBA 4Q0XH 3T4YB 2XWEA 2Y72A 3RB5A 1T20B 5IV2A 3DI3B 4OT1H 4R4FH 2PO6A 5BMFL 2JIXA 3T0XA 2YPLB 1KJ2H 1YN7B 3H3KA 5BS0D 5D7KE 2OMYB 2YGVA 3IU3A 4ZPVA 2BSTA 4YEEA 2K1MA 5EEZA 4NJAH 4MMXC 2GKIA 4O5LL 4NQUA 3UTTB 4GFXA 1I7TB 3BOVA 3RY6A 1JP5A 3ABKB 4X0NA 2WAHA 2GJ6E 2Z9TA 5FGSA 3IB4A 4LQFL 3RWCA 4JS7A 4EIGB 1CGTA 4HXAL 1QRNE 4XMLH 3QHZL 3DXAB 5EFIB 2VUOA 4GSDH 5GGQH 4LOUD 2EH7L 3ZL1A 1PG7X 1YDPA 5I71C 1U8LB 4MQXC 4AEIH 4OFDA 4Y5XC 5EN2B 3TPUA 1N26A 3GSWA 3MJWA 2ZOWA 2NXZD 3PV7A 4FQPA 2VH5L 2A6DA 4AH2B 1UCBH 4ORZC 3CH8A 4N8CH 4JMNA 2ZICA 3B1TA 5FX3A 4Z3FA 1MRCH 3APDA 1KGCD 5IQNA 4GQQA 3IXAA 5L4JA 2VMCA 3NJGA 5AAWA 4MDJB 3WFHA 4U0RB 1E40A 5HTSA 5GZNC 3UJJH 3S8GB 2SEBB 2ZT9C 1IJ9A 3CZFB 3RNQB 1OSZB 2DLTA 3CXHK 3EGSB 4LMQI 5LXVA 3WTVA 1EEUA 5HGBA 3WNPA 4JKKA 3CCHA 3ZBMA 5EUOA 4G6AC 4OZFH 2Y7OA 4PJIF 4D8PB 1JGVL 4RGNC 2AK4A 4H1LB 4MJID 3GMNB 2IANB 4L3CB 3GXUB 5EG6C 3FZUD 4W81A 4Q74A 1A4BA 5J1SC 3KYOB 3QR2A 1BSIA 3SY0B 4TUUA 3HUJF 3B6SA 3Q5OA 2FWOB 3ZKSD 1IGMH 1QNZL 1JPFB 4WFED 3T3ME 3MNMA 3NA9L 4J8QA 5FECB 3WU1A 1XGTB 4CJ1A 4NFCA 1BBJA 3N0PB 3S96A 1MF2H 4M00A 4I2XB 5HYEA 5D1ZA 1SEQH 4YPGB 3V4VH 1WBYA 3DK2A 3NDZE 1FIEA 1NEZG 2CO7A 3GIZL 3L3IB 1INDL 1R46A 4Y5YC 3TBVA 5FPIA 3CFNA 2YA1A 5FYLH 1I1AA 2F08A 3NYKA 3O6ML 1CD0A 5HGDB 1OP9A 3M46A 3MODL 3K81A 4LSPH 4JFXA 4JRWA 4NUGH 1HSAB 2FHFA 1ZGLM 4WWKB 1TLKA 2IOMA 3OF6D 1B0RA 1KIRA 5AAMA 3TO2A 3MBWB 1MAMH 1QFWM 1AXTH 2NTSP 4ZS6C 1XF1A 1ZHLA 2XWBA 4OD2B 3UTZA 3T2LA 3X3FH 3QEHA 4GW5B 5I17A 1U3HB 1G7QA 3AY4A 4XPBH 2HFGL 3UG5A 4ETYA 1WFTA 3FYIB 3ZTNH 4BFIA 3OHMB 2HT2D 3H9HB 4OCMC 4JM2A 1AAJA 4NN6C 1J8HD 5IY5B 2OI9B 2JJUA 4LCWA 4ZTEA 2IALA 3VXUD 4HOXA 4WHTA 1UCBL 4EN3B 5HYIA 3SE3C 5K9KB 1ZA6A 1G6VK 3DPBB 1SVCP 3EYFA 3S35X 3UTSD 3JWOH 3PREA 3NIGB 2VQ1A 2WQAA 3C6LA 4ODTL 1EFXB 5C3TA 1S5HA 4HYTB 3T71A 1UA3A 5IW6A 4K4KA 1BWMA 1DZ0A 3GBDA 2EDTA 3RZWA 1JZIA 2Z92A 3DWTA 1UWGL 1P7HL 4HWUA 3H3BC 4F8QA 3ZKXB 1P5VA 2Q3AA 3N9GH 4WU5A 4ODSH 3B3IA 2EH8H 4AEHL 1T2QH 4ZX3A 3K91A 2OTUB 1N12A 4OCYH 1U0QA 1KT2B 4HOMA 2YUWA 4GBXC 2FWUA 3ZDXE 3RWGB 1BZ7B 4PB0L