3NP5A

Crystal structure of an abridged form of the mature ectodomain of the human receptor-type protein tyrosine phosphatase ica512/ia-2 at ph 4.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Receptor-Type Protein-Tyrosine Phosphatase Ia-2-Ica512
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase-like N
total genus 21
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3np5A00
3NG8A 3N01A 4HTIA 3NP5A 3N4WA 2QT7A 4HTJA
chains in the Genus database with same CATH superfamily
2L08A 3NNAA 3KK3B 4FYYB 2GIRA 4MKAA 2JNJA 1P1LA 5KFUA 5F3TA 2O3DA 4NXMF 1F3FA 4KY3A 2E9TA 3Q8SB 4JI0J 2PEBA 4LF9F 1FNMA 1ZM3A 2DHXA 3AT1B 1LW0B 2C2ZB 2JOQA 3A3OB 1VC6A 4A8YA 2OEMA 3OL8A 2RUGA 1QDUB 3MURP 2CPXA 4DL5A 5L9XA 3B8HA 3BGUA 3DNCA 3HFZB 2IRYA 1XMQF 1S0OA 2BA9A 2M5YA 1UEKA 1X4BA 3VV2B 4F4YA 4WP8A 2NZCA 3MAAB 2VV5A 4M5KA 4PUOA 4HL9A 4ELVA 2N7CA 3D0GE 2IYGA 2BQUA 1L3UA 3FEZA 3JXOA 3E01A 1Y9OA 2B51A 3MDFA 2CJXB 2HRUA 5A2QU 2VDHA 4DX8H 2CJKA 4U67Q 1YKWA 3IWLA 2ZDPA 3B82A 2H54B 3N6NA 2F9JA 2MQPA 1N54B 2VL1A 2A3JA 2YNHB 2YBVA 4FNHA 4NLVA 2RVJA 5AXKA 4DSLA 1RBAA 3EUNA 4BWJA 2P8IA 5F8GA 3DM2A 2RF2A 2B5JA 2HMIA 4M5NA 2E1RA 1B3TA 2GVZB 3GONA 1BQMA 3M8RA 5KFMA 2ILYA 1NHKL 4A8FA 1HARA 3I56S 3UR3C 1SKWA 2VPXB 2PGCA 5GMKa 4DEZA 1AFJA 5SZTA 4QIVA 3RG6A 1J5EJ 3QAEA 4C3LA 3CO0P 3ULHA 3D0IE 4ECQA 1X5OA 2XMAA 2BW7A 4AUKA 3N79A 1R3NA 1KTQA 3O1LA 1UFWA 3EVOA 3JSMA 3VZIA 1O8BA 3P5BP 5J1EA 1FDDA 3QGGA 2YKNA 4J9VA 3WX8A 3EZUA 2CZ4A 3BQ2A 3W2VB 2J6SA 4AE5A 3H40A 2W8KA 2F7VA 2CPDA 3SDEA 3H25A 3ZZUA 1N48A 2U1AA 3ISZA 3D2WA 1JJ2R 3DLEA 2H5EA 2HQIA 4D3HA 5F8MA 2R7TA 5AT1B 1FNXH 3BSOA 2NREA 2HNZB 3KLHA 2E44A 3WX4A 2HPUA 3S8SA 1S10A 2E1CA 2QLFB 5HAOA 4WF9Q 1FESA 2A6OA 4MJKA 5K8PA 3E2EA 3Q22A 2HYIB 1FF2A 1NHVA 1OS5A 2QTWA 1Q0NA 4ID8A 5F41A 1N88A 1SIZA 3THPA 5KFNA 5IWAF 4R5PA 3KMSA 3M32B 3UR0A 3D1HA 3PG9A 3W2WA 4B17A 3AJ1A 5ADZA 1NCLA 5HQ8A 2VG7A 4WWSA 3BN7A 2EFPA 3D6HB 2EFQA 4C11A 5DQHA 4HDHA 1MU2A 2AYMA 3HKZD 2XO7A 2UUCF 1KN6A 1NMEB 3BH6B 1H2TZ 1G6BA 1NBEB 2KJVA 3T41A 4R8UA 2BVZA 3L3CA 3GILA 3IM9A 4K0KF 4KH0B 4OQJA 1HHQA 2HEKA 1IWAA 2VA2A 2Y8WA 2WOMB 4JV5F 2XHCA 3GG0A 5GADI 3VAIA 2A0FB 4LIRA 5FIIA 5BJRA 4WU2A 4BHQA 3LPEA 1L3SA 2HVDA 3M1VA 3RZAA 2O1PA 5KAKA 3G6VA 5LXYA 1LEOA 2RQKA 2KFNA 4YQWA 1DQAA 3EJMA 1RTZA 3V4MA 3ILJA 2MGZB 3MMAB 1FK9B 4A48A 3FQKA 4WP9A 4JYAF 1VFJA 5I3PA 4KV8A 4U96A 4GKJF 2OD6A 4ZCKA 3WBZA 1AZSA 1UVKA 4M5GA 2MKKA 3D67A 3ZTSA 4C4WA 2WVCA 5I3UB 4WJBA 3TVKA 2VKZG 1IR1A 2CJAA 3LQVA 1DLOB 2XLKA 1S9EA 3FVYA 3OTCA 4LSLB 3J81Y 3MR7A 1FTCA 1KDNA 1LWEA 3MEDA 4CLTA 4X4VA 4KGVB 1L3KA 1K47A 3C6UB 4JI2F 4R5PB 3R7SB 3Q8RB 5E7OB 4MIBA 5BYQA 3KLEA 1RLCL 2ZHOA 1C1BB 1HBUB 3VGUA 4X66J 4YDDB 2CG8A 2PDAA 1PJ5A 2RILA 4WYLA 3DCAA 3GCWP 5KT7A 3IRXA 4JBCA 4OHXA 1SJFA 4HHJA 4MKBA 1PYOB 3OTOF 1JMTA 5EHHA 2R8HA 1T11A 3PIOQ 3HHNB 1WTBA 1YRTA 1TU0B 2HAIA 3HJVA 3CPWR 1JLAB 3R5AA 5FD1A 1HR0F 1QSLA 3RR8A 2R42A 2RHSB 3SDEB 3BGLA 2V2QA 2BANA 4LBHA 2YWGA 1HKAA 4WFXA 4IG3B 2V4JA 1GX6A 2XYPB 1FRLA 4ZITA 4OZ2A 1N33F 1I94F 4A4JA 1PILA 1YVFA 1FRXA 4RW8A 2ZNZA 3AH6A 5KFXA 5BR8F 2ZOGA 3OFFA 2Z8QA 5K14A 1QAYA 3W8GA 4F36A 3QBCA 3TZYA 4NLWA 1VQ8S 4L74A 2E9ZA 2UXDJ 4NYOA 5DDRC 2W9AA 2R2UA 3MOJB 3NL0A 1H98A 5HJYA 1D0EA 2HHTA 4CP5A 4USTA 4IG0B 3FGVA 4CLLA 1NJIT 4USKA 2E9RX 3M2UA 5KFLA 4LFBJ 3FEYB 4R8UB 1TVRA 2MJUA 1TUVA 2R8GA 1VHFA 2HVIA 1NXIA 2UP1A 1VBXA 5DDOC 4B9NA 3ENAA 2W2OP 2A10A 2FHMA 3WC0A 6FD1A 1U45A 1QSYA 3HO1A 1EZZB 1RKIA 5D3GB 2B4UA 4OJGA 3QIPB 2GHWA 2ABYA 2YX4A 4U8VA 4Y65A 2MY7A 4ER8A 2WSEC 3HSGA 5J2QA 2AX1A 3NMRA 1RZMA 4Y34A 2AX0A 2DNMA 2NXCA 3D5MA 2BE9B 2HFVA 3KXDA 4PR6A 2N4CA 1P1TA 4DL0C 2ACYA 1QVGR 4K4ZA 3VAKA 2CXEA 3K7RA 3FEXB 1N5VA 1NB2A 2CNOB 4Y2IA 4WE1A 1U1RA 1FNOA 2BANB 1S97A 2H4YB 1RT5A 1X0FA 4H4OA 2ZBCA 4DN0A 1M5OC 3AQOA 2IBOA 2VD3A 1JX4A 1FWLA 3IWNC 2IHR1 3HHKA 1NJWA 3KLFA 2YX1A 4RUBA 3DLKA 4FBUA 2EK6A 4NEZA 4DI6A 3HI9A 1IKWB 5HSPA 3IGVA 2BM0A 2H5JB 4O4GB 2VQFF 3E01B 3KTQA 5DLGA 1CJTA 3DXBA 1HBMA 1KONA 1FXDA 2WSFC 4JI6F 1VRTA 5CD4H 1N34F 3CC2S 3RRGA 2C3YA 2HQFA 2MY8A 4ED5A 2J0XA 5KFHA 1ULRA 4S0MA 4TLQA 5ETTA 5D6GA 3BSNA 1GXTA 1N5SA 1X9SA 3UCZP 1SC4B 3RTVA 2HSEB 3M8QA 4WK1A 4P2MA 2JC0A 3HF5A 4Y2CA 3KG0A 2PO4A 4C8YA 3SCKE 3N28A 5KG0A 5DS7A 1Y3JA 1PO6A 1U1PA 3HX9A 5EGYA 4C97A 2VASA 4X65F 2AYGA 2BQRA 4ZN3A 2QSWA 4ECYA 2F4VJ 3QGIA 2JVOA 3I87A 3NAHA 2Y1JA 1NO8A 2H5IB 2KT2A 5G4DA 1R0BG 4HH0A 4OZLA 4JUZA 4I6WA 3R6GB 2LDIA 1X8DA 3AD9C 4LIWA 3RB3A 2J7WA 3TEGA 2PMZD 2AF6A 1ZOTA 2W4DA 2XZTB 2F63A 2XZWA 1YBAA 4RW7A 1RUSA 1EETA 1YJ7A 4OZ1A 4B9LA 2IY5B 2LU2A 4JI2J 1LNQA 1MMDA 1RT2A 2FGOA 4DS5A 1NSAA 1REVB 3RAXA 2LEAA 3H5SA 3TOQA 3WQPA 2K1RA 2F4VF 4WYWA 1X5SA 1C0TA 1OY6A 2WW4A 1TELA 2VC1A 3MEKA 2OFGX 3IS9A 1U4BA 3PEHA 4NMLA 4Q7AA 4YN3B 2COLA 5E3QA 1MU2B 3MMJA 5C42A 2CJBA 4RW6B 3NGSA 4ALZA 2D3ZA 4UOHA 2V5HG 5U47A 2E5LF 1GXLA 3K0JA 2QRRA 4PCQA 1TZ0A 3M32A 1KNZA 3M8YA 3D4JA 5LL6d 3WDOA 5D0GA 1LW2A 4HVZA 5J2MB 3M9MB 4LF7J 1TFYA 4GKJJ 3PKMA 4ZHRA 4PZVA 3V4IB 2ZE2B 3P8BB 2KO1A 3WIVA 1RJJA 2DNHA 2KM8C 1S1WB 2OD4A 3DN9A 1S49A 1UCNA 3MD3A 1Q16B 2DNQA 2QE5A 3KLIB 1O51A 4N8NA 1OYDA 1RTIA 4LRFA 1XERA 2OPRB 2ALZA 4L73A 2W2PP 4Q2LA 5AJ3F 1LOUA 4L75A 3LP0A 3MUMP 4AQYF 4ED1A 1XMBA 3W9IA 4NLXA 3W2VA 3T5LA 1M5HA 2V94A 2OTLS 1H6KX 1RXOB 4KH1B 3M6VA 3CCZA 4C11B 2ZH3A 3L4BC 2FJVA 4NLOA 1IR2A 2UXBF 3HSDA 3DOMA 3POTA 2KU7A 2C3PA 2J9EA 1RWVB 4AL5A 1SI9A 3MCOA 4LSZB 4UY8T 2ATCB 2ZVSA 1N5YB 4P74A 3HMJG 4A8QA 1SKUB 3CJTA 3T5JA 4O4RA 1BGXT 3RRHA 5HBMA 2X3DA 2HGLA 2GVDB 3W7BA 1YDLA 3IP0A 2YKOA 3IAS9 5K8MA 5HMYA 4JI3F 3UW1A 5IV3A 1VJWA 3DLKB 3ZTQA 4KPCA 2LA6A 4PQUB 3G8TA 4ZCLA 4DX5A 1RCOB 3M6XA 3V6DB 2HHUA 3NOCA 1TK0A 3H0PA 3LGNA 2ZZNA 2C22A 3DRRB 2MQNA 5AXLA 4KO0A 3MCNA 4PPZA 1TKZA 2I5JA 2XMVA 3HLUA 3TX0A 2DO0A 3T1HF 2F3JA 2HK2A 2AJ2A 1S6PB 3PJ9A 4Q45A 3QMQA 3JYTB 2CA9A 4DV0F 1QUVA 2HKEA 3KFWX 5GMDA 2K7KA 3TEHB 2WTFA 1SUQB 4E0DA 4P2SA 3UQSA 3GSDA 3CD7A 1RADB 2V63A 4NMXA 1RHKB 5A8KA 1RLDA 3KNAA 1JLCB 2FGCA 1RYRA 3IMQJ 4AFFA 3KLGA 3X3UA 1HI0P 2Z2MA 3VTIA 4LRCA 5HI7A 2JEJA 3WIUA 5CHCB 1LFWA 1HW8A 3PR5B 3ZC4A 3OTEA 2MZSA 4AXJA 4EI2A 3E3XA 4I2PA 1ZPWX 2H9ZA 3GTYX 2MQ8A 3FKBA 1RTJB 3FSXA 2PA3A 1U2CA 2NZ4A 2Z2YB 3HD1A 1JLEB 4O44A 3S1TA 4JYAJ 3DRYA 4OJ3A 2HQGA 4OYPA 4P52A 5IT0A 1F5AA 2CPEA 2IC3A 3G2XA 2DHGA 2HIYA 3CJKA 1UA1A 4BLGA 2XS7A 2J5AA 1OIAA 1V9OA 3ZO7A 4J9MA 2B7CB 1RB0A 1S99A 2CQ0A 3H2VE 3EVWA 3R6LB 4IH7A 3BB5A 4OYIA 4JI8J 3J80U 4CTAB 4A8WA 1NRKA 1B99A 5BYRA 2QA4S 4OLPA 1RTDA 2ZBQA 3VF0B 5D3GA 4D3GA 3DM2B 5C2CA 2C3OA 3NEKA 2DEJA 4HHHA 2EFNA 2L9NA 4X64F 4EK2A 3H4BA 3DHWC 4X66F 4F3QA 1FKAF 2AT1B 2V67A 5ETQA 2NUHA 3T1AA 4DZ6A 2N3OA 1VQ9S 4Y6IA 2MQQA 4IR1A 4GO7X 4BS2A 4FF4A 2ZOFA 3M2UB 3LP0B 5LOQA 3OL6A 1FKOA 2Z2ZA 4NA3A 3QLHA 2YTCA 9RUBA 4IOAQ 1H2UX 2YX7A 2BJ7A 2DIVA 4ZVFA 4HHUA 3MR5A 1R89A 4DV6J 3QPIA 1W2BR 5B0FA 5IQ6A 4OHZA 1S6UA 2C2NA 2IJRA 3X1LB 3POTB 3NOGA 2AJ0A 4JB8B 4W98A 4EFAC 4USHA 2X1FA 3W63A 3LP1A 3MF5A 2KI2A 2MSTA 4HDGA 4J91A 1AFIA 3B4MA 1N8RT 1TAUA 2M70A 1TKXA 3O8WA 1TL7B 2JRSA 2B3TB 2BZ2A 4CO0A 2MZ1A 3TJAA 4QYZJ 3EM1A 1Q4RA 1XNQF 2WBMA 3W5YA 5I4MA 3PX4A 1JLBB 3DI6A 1HBOB 1CVJA 3TI0A 2J8AA 1NK4A 5BYSA 2G9OA 3BEGB 4YB1P 3H2UB 2UZAA 3BV8A 3GFXA 2VOOA 5D0EA 5H9FJ 2XMMA 4K50A 1BUXA 1EP4A 5SUHA 1S9GB 3QATA 5KFTA 2PIIA 3BBBA 5AXMA 2IPOB 1NPPA 2VICA 2AZ1A 1S6QB 1URRA 3Q83A 4RLEA 1M1KT 4LF9J 1TP7A 2FY1A 2Q43A 1YSJA 4UOFA 2LKZA 5ITHA 4TYBA 2L9DA 4LBPA 5D4NA 1X4AA 4WZQA 1TL1A 1Q8KA 2Q6CA 4HACA 2HG4A 4EYHB 2B7BB 1R0AB 1SH0A 3T9NA 2YY3A 1G4CA 3DU6A 3IWXA 2G2ZA 2WZ1A 5L1LA 1D9AA 2AW0A 3DRSA 1S6OA 1NPRA 2XS2A 3QFHA 2FYXA 2J0WA 2MYFA 3DC2A 3UNYA 1FWKA 2YNIB 3P5TL 5B7WA 3NLCA 4FYWB 3W5XA 5I42A 2UUBF 3LTOA 3QSIA 4GKKF 3TA2A 3RW6A 1VCTA 1RTDB 1FVQA 3ZZYA 1H0HB 3MWBA 2P2CB 4FVMA 4ZPVR 1U1QA 2QLJB 3PW4A 3BKTA 2UUAF 2Z58B 2C1EB 2ATLA 4WU3A 4N41A 2WVEA 1NK7A 2MEWA 3PACA 3MM6A 5IM0A 3KG4A 3TARA 1JLQB 2HS3A 3TQ1A 3HK2A 3Q0AA 4K4SA 2HVEA 3IAM9 2VPYB 4IUFA 3US5A 1S72S 1SL2A 4ZOSA 1J5EF 4QYZK 3PXGa 5C24A 4NX9A 5ETOA 5C42B 2PC6A 3ZZTA 2EFOA 3ISNC 2NR0A 5D4OA 4A46A 2HNYB 4OYAA 2QEXS 2DRAA 2PEHA 3IS9B 2G0JA 4PG4A 2XI2A 3BGRB 4LF5F 2V2KA 4LVNP 4JI4J 1SXLA 4TY8B 2MZJA 1VBZA 3J7AN 2RDDA 3MAHA 2BW2A 2ZH4A 1E6VB 1U1MA 2WONA 4C0BA 3AD7C 1OY9A 1IVZA 3I96A 2DBBA 2FJEB 3JB9k 1EETB 3HHLD 3FZ2A 2Z57B 5C2GA 2VJVA 2DR9A 3RW7A 2HIQA 4QR2A 1JJ4A 1OPZA 1RT7B 2CYYA 5HMWA 2H4WB 2HW3A 4FPIA 3MMCB 4G3IA 5AE1A 5EUHA 3OJSA 1WKLA 2RKIA 4U7UK 3ITHA 3SXLA 2DY1A 3TAMA 5MAOA 3J81j 2V0NA 1O5JA 1JLGB 2IM0A 4Y00A 1HWJA 4Y0FA 1FRMA 2RU9A 2YKAA 2GQQA 1U8SA 2HGNA 5LM7E 3OVSA 2R7SA 1C0UA 2WRMA 2XMWA 2IDEA 2GVDA 2GQCA 3BYPA 3M2RA 1B7YB 2IJFA 2R7OA 1T9UA 3EVMA 4ANCA 4QWDA 5F0WA 2RSQA 3BQ0A 3CEDA 1FERA 4IOCQ 4PUOB 4A8SA 2VA3A 4ECWA 1WHXA 4M5JA 2DCLA 4KIAA 4EGLA 5KFOA 1AUDA 4OX9J 4LF7F 4FF2A 2OHDA 2ROGA 4YR2A 1FXRA 3DGVA 4OHWA 4TYAA 2HFUA 4DX6A 3GYXB 1U47A 5KFIA 3GJTB 2MQMA 3A12A 4RW8B 1WI8A 4ZP6A 4MT1A 4ZN1A 1HNWF 1Y5LB 5HMZA 2OFHX 4I64A 4O0NA 2D3UA 4OIXA 3W5ZA 3KJVB 3D0HE 3DRRA 2AZ3A 3VGVA 3HDSA 3HHLA 5HLFA 3QT6A 2YNHA 4ANDA 1UEUA 5F8HA 1XQIA 4HTJA 1PAUB 4CM2A 5AJ3J 2CQDA 2A18A 1JLQA 3OVAA 4X4TA 1U1KA 5A6WA 2XCAA 2BE2B 2N3LA 1X0PA 3AOAA 4IDKA 3PRVA 4WFAQ 5JVHQ 2QFIA 5IOLA 1P9QC 2KTQA 3BPDA 3WC2A 3MPVA 4CM0A 1NSQA 1S1TA 2K3IA 1EHWA 2QA1A 2ZUAA 1YG0A 2FHOB 1V6HA 4OLOA 3JYTA 3MPDA 1XMOF 4NRUA 3KHHA 4OZ0A 4F2SA 3GP9A 2D1CA 2QGFB 2BJ8A 1FI4A 2DHHA 4IG3A 3MFHA 2DNYA 4XTTA 1FFWB 1J27A 3LF0A 3OR1A 3SCIE 4DSFA 2HNYA 3N5BA 4J9RA 4ZCMA 2DXDA 2B6AB 4KTQA 1TVRB 2N82B 2YPYA 5IC4B 1GH8A 1PC5A 2EEYA 4KYZA 4CLZA 4RNFA 2ZBIA 4ECVA 4LF4F 3C6TB 4PRFA 2ZC3A 3KWMA 3D28A 3H4DA 3PW5A 2HHVA 4GC7A 4DR4F 4LREA 3BREA 3MM6B 3UN2A 1LV5A 4Q8EA 4OV6A 3OL7A 4EEYA 4B3RJ 4OYOA 3MHYA 2BABA 2JL9A 1NDKA 3HT3A 1QAIA 2AQ4A 3LWLA 3PRDA 2BR0A 4ZPAA 2AMCB 4DR1F 1I94J 3SCJE 2EI5A 2UU9J 1JNZB 1N0UA 2AJ1A 4EWTA 2ZHBA 4DV0J 2FD2A 5L9NA 1J5OA 3G9CA 4MTPA 2QSFA 2GGPB 1VS3A 1DRZA 1KQKA 4Q0BB 3LGMA 3LP2A 1TV6B 2MZRA 4LFAF 4ECZA 2HRTA 3OPKA 2C2DA 4FXVA 2UXDF 4M5LA 2FLNA 2RAQA 4X84A 4CLWA 1NK9A 1FJGF 2OKQA 4TN2A 3OR2A 4YMEA 4FNIA 2W2MP 4N8OA 2CPJA 1AXQA 3ICLA 4Z37A 3HM9A 3G71S 1P27B 4OJ1A 4YP3A 4B3SJ 1MW7A 1K73T 3LP1B 3BO2A 5DDPC 2J0SD 3F41A 2MMYA 3K59A 4IQXA 4ILLA 2OMOA 3IM8A 2C2EA 1NJXA 3GSIA 4ZVGA 1V5IB 4GO5X 4JV0A 2GCFA 3JAMY 1QAXA 4IOBA 2KT5A 3UO0A 2FDNA 1ICEB 2V34A 1IKYB 1ZETA 1Q86T 1Q78A 1WTFA 2C2MB 4TVAB 4DWIA 3FJ2A 2LU1A 4ECXA 2PN6A 1LQ9A 2D9OA 3MECA 1T8EA 2UVVA 1UPPA 4JI8F 4Y3CA 3ZZRA 1T95A 3NWGA 1DLOA 4JI3J 3SFGA 3CD6S 2KZMA 4E2FB 1UVMA 2CQPA 3LH2S 4CO1A 4F8RA 4YDXA 2D9PA 2LVWA 3CDBA 3OR1B 4G65A 2GAGC 3Q8YA 1SKSA 2EG2A 3AHPA 2UVWA 1UZDA 2V8VA 3MPWA 1Q8IA 2AHOB 4F02A 4P10A 2FPHX 1VQLS 1FK9A 3J7ZT 2X1BA 3M4XA 3V5RA 4KHRA 2CDQA 1PSDA 1SL1A 4F4KA 2JHEA 4C6AA 2UVRA 5A6PA 5ETNA 4ZVSB 3SEOA 4RW9A 5B08A 1AYEA 3AFGA 1HWUA 1T0TV 3LA0A 4DV1J 1MWQA 4NI2A 3RBZA 3F44A 4KBIA 1BE4A 1HWKA 1C1CA 2F40A 4DUYJ 2LECA 3OT9A 4JI7J 5EX3A 1SQGA 3C6TA 1RISA 4O3RA 1I5OB 1MMNA 3A3NB 3CIMA 3DGPB 1Y5IB 5IXUA 5T7LB 4DV4J 3ZZOA 1T9TA 1MN7A 1WORA 2YNFB 3UDLA 2NXEA 1XJWB 2W4CA 1WEXA 1NDLA 1TR0A 3DU5A 3G82B 3QO9A 4IQMA 5LSLA 3IN5A 3QRPA 3AY0A 3SZ2A 4DS4A 4F25A 5HP1A 1HYSB 4F26A 2QC3A 5HVHA 3CSKA 2EXUA 5K20B 3U27A 4X4NA 5K14B 1IKVB 1AT1B 4W4MA 4HT7A 2XMKA 3UNGC 3CO9A 4X65J 3PYGA 1FDBA 3W8PA 1T05B 3BSCA 1KLNA 4CO5A 1DARA 2UXCJ 3FBFA 3QT7A 4PG6A 2V4RA 3GJSB 2R7UA 3DXSX 3EPGA 3MXHP 4C8NA 4XPCA 4I0WA 4N76A 3NKYA 4ZPBA 3NCRA 3KLFB 2QFJA 4NRTA 4WKRA 1YZ7A 2BKNA 2AV5A 2VPZB 5KT6A 4YOEA 4J9KA 1Q1KA 4LJMA 1YJUA 3FSYA 1U2RA 1MWYA 2F8MA 2XHWA 4WP3A 5C24B 2FJXA 4A8MP 1RACB 3LO3A 8ATCB 2XY6A 1GT8A 3CCMS 2CQGA 3DOKA 5C5JA 3KLGB 1QVFR 3VQSA 5KT3A 4DL6A 1N0VC 2LP4A 2O5DA 3NCQA 3NXZA 4DR4J 4K4XA 1DBDA 4ZLNA 1DAXA 2DXEA 2EBGA 4YS2A 4DV6F 3NY0A 3TZXA 4TY8A 4CNZA 3K17A 1XEZA 3R5JB 4OL8A 1IR0A 4ZVRB 2ZBRA 4MK8A 3J7Z5 2W7OA 4DFKA 1S6PA 5CABA 5L1KA 3C14A 2WW8A 3MR3A 1NK0A 1VIOA 2ASYA 2DKOB 2HQ3A 2VBXA 4ZP8A 2E5LJ 2VB6A 4ZMMA 2MQOA 4M5DB 5KFSA 1Q7LB 2H51B 4ECTA 3GQCA 1OQ3A 4KKOB 3LW5C 4K2XA 3V6DA 4IG0A 3O2IA 5L1JA 4B3OB 2XSJB 3G86A 1FO1A 2IVFB 4JI5F 2MB0B 3U1NA 2JLEA 4OZ3A 5B0CA 2DHAA 4ICLB 4QWEA 1HD0A 4FYXB 1JWWA 2QJ3A 4DL3A 1Y4ZB 4NI2B 5KFBA 1PAEX 2WVDA 1DZ5A 4NYPA 1R7IA 2H48B 2OMLA 3M1VB 4ED6A 2XZDB 2YWEA 4WFBQ 2IRUA 3KMQA 1CBKA 1FFSB 4USMA 2WONB 1WF1A 2B8QA 1N5QA 4C7QA 2QL9B 2JFKA 4RW4A 1VI7A 2DGSA 4ECRA 1MLAA 2Q79A 3TYTA 5A0YB 3A8EA 4NZ0A 3V6JA 4G1QA 1VISA 2FHJD 4I7FA 5CXTA 1EKRA 1Q8BA 1B64A 1VDHA 3HXMA 1VBKA 1VQYA 2PMHA 3AB4B 1BQNA 5DQGA 2APOA 1Z2LA 3QFWA 1X4HA 2DGWA 1VRQC 3BBCA 3WHIA 4EBDA 3P49B 2VKRA 4DQSA 5KG2A 4B3TJ 1W7WA 3HCXA 1NEEA 2D3O1 1CC8A 1SQFA 3H5UA 3C3LA 2QZ8A 3M30B 1S57A 2E29A 1G7CB 2QT7A 3HFVA 3MM9A 4AL7A 3P4UB 2GC8A 3FMWA 1ZA2B 4L72B 4RW7B 2HHXA 3H5XA 2UUAJ 2XYHB 3AD8C 4ZLLA 2VUGA 4IDKB 4ENOA 4J90A 1SJRA 4ZVQB 4TXSA 2ZD1B 5ETRA 2V9KA 5LMNF 4KPYA 4NLPA 4ZJQA 3PRBA 1PGZA 1IBKJ 1BMQB 1JLBA 2VFSA 3C19A 3PY8A 4NLRA 2VPWB 3UN5A 4M5DA 1H7XA 1EAYC 2CJQA 3EWGA 1GMWA 4KV8B 4ATNA 3J80Y 4DV4F 5J1NA 1NM2A 1S7IA 5KFQA 2XCPA 1VQ7S 1HHTP 2DPIA 1RA6A 2NXJA 3AB2B 2VG7B 2XMUA 3KUEA 4DR5J 1S0NA 2KRRA 4RNHA 4YEAA 3GJQB 4WIQA 1HWIA 1RHMB 2ZITA 3I32A 4DMZA 4EUVA 1RT2B 1WC3A 4PPDA 3G6YA 4EBEA 3ILOA 2GJ2A 4U7CA 2FVQA 3J7A1 2V2ZA 1FHTA 2FVCA 1LWCA 2DVIA 5A76A 4R0EA 2YH0A 4B02A 1V3RA 1KQGB 2MTLA 1CG2A 4NEYA 5HJXA 1S9GA 2POKA 4UQTA 4OZNA 1R8BA 1R31A 1F3VA 2ZM6J 4LF6J 3C66A 5CD4A 4J9OA 2H3EB 3IG1A 3H59A 4NASA 4ZP7A 1WKKA 3HP6A 4PWDA 2R7QA 3JSYA 4X4OA 1K0VA 2CNKB 2YQ0A 4FP9A 2RRNA 3A8IA 3MM5A 4F0HA 1QSSA 1RT6A 1WSRA 2GQ2A 2KYXA 1KSPA 4X64J 4V19X 3RB0A 1Y10A 3I0SB 4HT5A 2L9WA 4MYTA 1XR7A 3IBCB 4P72A 4AD6A 3J7YU 1JJHA 1FRHA 4HI2A 2I9SA 2ZZTA 3UCGA 3GIRA 3EZOA 4ES2A 4C3MA 1OQ6A 2HURA 2XM3A 4OX9F 4J9QA 2CWXA 4OI3A 3ET6A 3UDVA 1UJ6A 2W25A 3DDIA 4XDCA 2YPZA 5IQQA 2JJ4D 1S48A 1YLXA 2M2BA 2XNQA 1YWXA 2HNDB 3TZZA 5J2PB 4QW9A 2GVZA 3F56A 2I5JB 1WOPA 1TKZB 1S7HA 3THTA 1UW4A 2M8DB 3UD4P 4EBCA 2GHVC 4EO6A 5L38A 3H98A 5T7LA 4OX6A 4CLKA 2UU9F 4DR6J 4R25A 5EDWA 1QE1A 1REGX 3ITHB 3Q8VA 4Q5VA 7FD1A 3DLGB 3P45B 2M8HA 2Z30B 3TR5A 4IYQA 2ADBA 3I4HX 2XMTA 2BQ3A 3TQEA 1RT7A 1JLCA 4I2QA 3TVYA 1RCXB 4YY3F 2IA6A 2O66A 2E66A 3ADAC 3CIZA 5HBMB 3CCQS 3CDUA 1BD6A 2LA4A 4NWBA 1QY7A 1WOOA 3U1MA 2HBYB 1SUQA 4DPUA 2EBEA 3AOCA 1ELOA 2AEFA 2IA0A 2UV8G 3NP5A 4MH8A 4F7VA 4DV3J 1TK5A 1VQ6S 3W62A 5IFMA 4LF2A 2IM2A 2J76E 4RL1A 2W2NP 2W7AA 3W66A 3CCUS 2MKSA 3MM5B 4IKAA 2LQ8A 4U8YA 5GADU 4IFVA 4PWDB 4KGMA 3I82A 1XBWA 2AKWB 3TUPA 2GJFA 4DG1A 1TK8A 2QYGA 4Y2KA 5D78A 4W92B 3A4TA 1UWAA 4I2PB 5LXRA 3MPYA 2K2PA 4IO9Q 4CLUA 3SBMA 1OMSA 4LR9A 4LF8F 3BH7B 4ZVUB 4DV5F 2YQ3A 3ENVA 2KZZA 1SJQA 3ETMA 3W9HA 5E33A 1TFWA 4IRKA 2NPIA 2JDJA 2DGUA 5G0RA 2CNNB 1S9FA 2BEFA 2GFFA 1RTHB 3I0RA 4L3KA 4HYKA 1UVLA 4I67A 2DH8A 4N5SA 4MAKA 4ZJLA 4UY85 2PE8A 1GXUA 3BPSP 3NBPA 4ES3A 2FLLA 3JTPA 4V1Ak 3JTNA 4FN5A 4Z7YA 1H38A 1ZS6A 3AQPA 1KP6A 4M5IA 4DN9A 1WHYA 3A8KA 1VYAA 3CJ0A 2B0GA 5JJBA 2V68A 3RUBL 1Y7PA 4KO0B 3Q8PB 3SSQA 4GKKJ 5M2PA 1HBOA 4CCHA 2IBKA 4TU9A 2VQEJ 4FZVA 1IQTA 1VGYA 1P9YA 2VG6A 3GE9A 3LPYA 1RGVA 2QMWA 3Q86A 2ZFHA 4DR3J 4WFZA 3IC1A 1R27B 4PXEA 2J0QD 4YUDA 1MG7A 2KH9A 2ZJPQ 4QIFA 1ZM4A 1TL3B 2I0XA 2PFDA 4FKYA 3SMZA 2VHGA 1UVIA 1JLFA 2ZE2A 4KGZB 1RWWB 3IR5B 3MTJA 4NLDA 2UV8A 1RT1A 4PXCA 3VAGA 1HMVB 1MN9A 1RA7A 2OSQA 1FKOB 2LQBA 4CRJA 4O3QA 2BV3A 2CJYB 3Q89A 2R7XA 1WG5A 3MMBA 5DG7A 4PG8A 2Q1LA 2RB7A 4USJC 3ZFVA 2GJIA 2G4BA 1VQOS 4TQSA 3MCSA 3SV3A 2A6MA 2ZOMA 2RUSA 4JI0F 5KFPA 4UZCA 4UT4A 3VGSA 2MHNA 1YITS 2Y9HA 4DJBA 3HZEA 2EKYA 1HNZJ 2QLXA 4CNYA 3CJ5A 2ZWPA 4F67A 5GAEI 1RT3A 3BO3A 3SI8A 2R8JA 2B43A 4PKDB 4YHHF 1TL1B 4JOUA 1B7FA 1IJFB 2L41A 3CDAA 4CLSA 3HSZA 3NBPB 2P5VA 1NZ8A 2J7UA 3RB4A 4Y2MA 4MKYA 1RWMB 1KWMA 1VQKS 1RAOA 4QWCA 1IQZA 3F73A 1JKHB 3V4IA 3GJRB 4A8KA 2BMBA 4JV2A 3TRGA 4DBQA 4CWBA 4XIUA 3T6BA 4FBTA 1LXJA 5HANA 5DLFA 3T1HJ 1VMBA 2PSZA 2JSXA 1HWLA 3HVAA 3DI6B 2NLWA 3O5TB 4WKYA 2KM8B 3KYLA 1K1SA 5H9EK 2L48A 2HWTA 3CJ8A 3P3DA 5H1SV 3K2YA 3PR4A 1WNEA 4RBTA 1HNWJ 3HKWA 4L6V3 4IFVB 1OPIA 4RBVA 1C0TB 3CMAS 1SJ4P 4X4UA 3VR1A 2CQHA 4KQZA 4CT9A 1WHWA 1VQ4S 9ATCB 1ZA1B 4DV2J 1E6YB 1S1UB 2KG1A 3R27A 1JXLA 1FVSA 2KHDA 5AE3A 2AYBA 3IR7B 3SQGB 2BJDA 5HVFA 1YI2S 1YK9A 1BLUA 3VHQA 4LSNB 1XNRJ 2NSBA 1N56A 3FRZA 1VLYA 2HFSA 4GC6A 4CYUA 1F5BA 3FQLA 3UVJB 2JZ5A 3RAMA 3P96A 3O6QA 4A47A 2JLGA 1A9NB 4RBUA 4KAIA 2ZZMA 3BBFA 1NHUA 3H7HB 5K9FA 4BC9A 5IT9Y 1A7GE 2KT3A 1VRUA 4WFNQ 4DF4A 1DQ9A 1UJ5A 1WC0A 1QD1A 2GMJA 1HFEL 3I9V9 1SVDA 1ZPVA 4QU6A 1RI7A 1TL5A 1RDRA 2FVRA 2CQIA 2YKNB 1HQEA 3D3CJ 4O3OA 1SC6A 4DQQA 1YJNS 1WACA 2LQJA 5KG1A 4LF8J 4F50A 4K4YA 3M8QB 1RWXB 3R7NB 2KB2A 1FD2A 2RE1A 3H5YA 2OELA 4FS2A 3P6YC 3W61A 2AJQA 5CYMB 1E6VA 3AJDA 4J9UE 1FE4A 2E1PA 4N77A 3NGRA 4PXBA 3CXCR 3OFEA 4TU8A 3OTBA 5F8NA 2Z0GA 3QGHA 1HHSA 5ETVA 1LWFB 2IFXA 3IO1A 3W64A 1UKUA 1PBUA 4FVCA 4K5RA 4ECSA 1SIWB 2L3MA 2LMIA 1YGYA 3KNGA 2BUNA 2ZC4A 3MOZA 4H4KC 4P6QA 3TZWA 4ES1A 2GHPA 1XIQA 2RT3A 5B0BA 1S1VB 1YX2A 3VVUA 5KOWA 3FBCA 2CQBA 1NUEA 3PFEA 4NCAA 4RU2A 4B3RF 3BS9A 2HHHF 1RT5B 2MPUA 1O0PA 1S12A 1VOMA 3A13A 3AOBA 1K9MT 2HAFA 4B9TA 4PQUA 1W26A 3N6MA 4MFBB 5E3CA 4NXNJ 1F2GA 2OI2A 3O44A 3T6JA 4DHVA 3ZNUA 3W65A 4RUAA 1IBLF 2V6AA 1WDDA 4JV5J 1GFWB 3ENQA 5L8RC 3KHGA 2LFVA 2HWHA 2XYGB 3W60A 1KC8T 3LAMA 1N32J 3GB0A 3FNNA 4AL6A 1NSPA 3V81A 3DRXA 2A2DA 4RZRA 2E7XA 1KLMB 2HQCA 2V2VA 4BBYA 3FDSA 3BGRA 1XR5A 3K57A 1U0HB 5KG3A 1UFLA 4USWA 4USVA 1ZZFA 1QJHA 3PX0A 1BWVA 3QJLA 4F04B 2K1RB 3SSRA 4MMOA 4UOGA 4B3TF 3I5CA 3VAMA 4LF6F 1BY9A 4B9SA 2YH1A 1B70B 4DQPA 5CYJA 4OYMA 4RNMA 1JNRB 5HP1B 1VR6A 1CULA 2D41A 3KK1A 2P6SA 4CIOA 2KFYA 4C8ZA 5F0UA 3MEGA 4DSEA 1FDNA 3THVA 1RKJA 1JXEA 3MZIA 3D66A 4M5MA 3OLBA 1KTVA 1R0CB 2WAQD 2Y1RI 3QZ7A 2OPSB 5J2MA 2UUBJ 5H9EJ 3KJNB 2CJ9A 2E5GA 1CPZA 3FCVA 3DLLQ 1FWPA 1VHIA 2OJ3A 3OR2B 2OP5A 1FE0A 2OPQA 3FK4A 2HS4A 2QMUB 4ZLPA 1NJZA 1Q95G 4AYBD 5CA5A 2OH2A 3DYAA 1NKCA 1U6ZA 5DGBA 1CEZA 3DDKA 4IRDA 2IJNA 2CVIA 1YJWS 4I6AA 4Q0BA 3NNHA 3MMAA 1RTIB 1SCJB 5CQGA 3GIJA 4ZKAA 1RAHB 3G8SA 3R5BA 3GR0A 4G1QB 5MLCV 3R1LA 1YIJS 4BWMA 2O01C 4DR5F 1SC1B 4WCEQ 3IR6B 5IZHA 3A1YG 1C2PA 4QIGA 4QQBA 1ROFA 4ED2A 4DSKA 7AT1B 1MSWD 3M8SA 3GFZA 5THWA 1S6QA 1LW2B 3H42A 3JS9A 4EMDA 4CI0B 1ZTWA 3CCES 1YTYA 2VFTA 4ICLA 3GIKA 2R7WA 6AT1B 5ETSA 2Z2LA 3AJ2A 3TX8A 2HFOA 4RW6A 4XDDA 3CDWA 3J7YI 3OQ2A 4DG1B 2LQ9A 5CZXA 1U1OA 1S1VA 1KFDA 1HNXF 2N7YA 3KLVA 3QRQA 3PTWA 8RUCA 3RR7A 5GAHU 3UWTA 4I7FB 1FCAA 1RBOB 2EW9A 2FY8A 2ACMA 1TKXB 4PYDA 2I6WA 4FYVB 4F0KA 2R7RA 4DPXA 3U1LA 1LK7A 5C7PA 4TU7A 3PV8A 2DGOA 3W1YC 2R9LA 1V3SA 4RPFA 4NYZA 1ZYQA 3VAJA 3RB6A 2HGMA 2VFVA 4H4MA 2VH7A 5GAEU 1F0XA 3PIPQ 1ZH5A 1RTHA 3I0RB 1T02A 2VG5B 4CH0S 2HHQA 2G2YA 4DXLA 3AXKA 1FKPA 3MM7B 3HT0A 1QTMA 5KFRA 1VQPS 3LGHA 3LALA 2VFRA 4HTIA 4RO0A 5DETA 5KT2A 4HI1A 1TAQA 4ZVEA 4CLPA 3KK2A 1WD6A 2RF2B 3Q24A 2CVEA 4C8OA 2B4VA 1RQ0A 2F65A 3V2UC 2HHWA 2W2QP 1EB0A 3KUHA 3HPOA 1JLGA 1S1XA 2YNGB 4YR3A 3ZZ0A 2ZH7A 3NAIA 4RWWA 3UPFA 3JSMB 4CO2A 3NGTA 5GVQA 1HNIA 4XK8C 5KG6A 2E1AA 3BM7A 4ZVOB 3NS6A 2W8LA 3SIPB 3DMJB 4EU0A 1W25A 4TQRA 1ZBTA 3CCRS 1OY8A 1B4SA 1SB6A 5CCMA 2WB4A 4AT1B 5E41A 2HZCA 2I38A 4UQGA 1F5CA 4B08A 4RW9B 5ETLA 3N9UC 1NKBA 1FTRA 4RWXA 2RQMA 3TW0A 2XC9A 2XB2D 1N5TA 3IA0A 4ZK7M 1YRUA 2IIHA 3FRYA 3M2RB 5D8HB 1G3OA 2DT9A 3L95X 3QIPA 4O4GA 2HMIB 3BN4A 4G1PA 4NZ6A 2W01A 3M8WA 2G13A 4KR0B 1C4AA 3N01A 4ZDNA 3HHLB 5HLFB 1HL6A 2HQDA 3IBFB 3KDOA 1NLKL 1SKRA 3OVBA 3CW2C 1KVJA 2ZHAA 1SC3B 4ANEA 3IRWP 1S4EA 1LWCB 2HBQB 2ZDOA 4K5SA 3AAWB 2HVZA 3C15A 2H1YA 4XAKA 2FVPA 3PO5A 4KB7A 1VLOA 2ALYB 4KHMA 3VVTA 1UAWA 5CYMA 4CQ1A 4ZPWR 2HRYA 4H4KA 4J7CA 3Q23A 1Y5NB 5L1IA 2QL7B 5KG7A 3RAQA 4NCGB 2RMLA 2B9WA 3TO8A 3UDCA 4LF4J 3CCSS 3ETOA 2G1HA 2YNFA 4YB6A 1FRKA 4ED0A 2DGXA 2RH3A 2WHOA 5HO4A 4QYRA 2VONA 3ZTPA 4DL7A 1U2FA 2W9BB 1NU4A 2NS1B 3CJ3A 4Q43A 3CD0A 1UJ4A 3MMCA 3G6XA 1FKPB 3EDRB 1BHNA 2RQCA 1U8WA 2FC9A 1IBKF 4Y28C 4QZVB 2DNZA 1KS2A 1I3OB 1HQ2A 1RSCA 2DHSA 3LUYA 4X62J 3OV7A 5LMNJ 3SYZA 3C46A 4F0MA 1HBNA 1WC4A 2QIFA 1FEHA 3FFIA 4ID5B 4ZVPB 2PFFB 4C9DA 2Q66A 4DV2F 2WOMA 3ILLA 1MROB 1LWEB 1R6VA 4MK7A 1CQMA 2XWYA 1KHVA 2Y1IA 1NSKL 1TUGB 2XG8A 4UF4A 4M94A 3K8WA 5KOXA 3RYLA 3UCUP 1NDCA 4P2XA 4QWBA 3T9ZA 2QA2A 3BJYA 2MKHA 4KJIA 2WK4A 5EWEA 3HULA 5C25A 4M95A 1UWBB 2EC2A 4LFCJ 1M90T 2LQ5A 1HNVA 4K8RA 4LF5J 4DLGA 1N36J 1ZM9A 1HNXJ 2GS8A 5D0HA 2ZM6F 1H72C 2C3UA 4WFYA 4ZP9A 4NLSA 3V81B 2GGPA 4KFBA 2RS8A 1LXNA 3HHEA 2VJUA 4USUA 1KVIA 4M8LA 3M6UA 2CPZA 1S1TB 1U48A 2EK1A 1RABB 4G1IA 4ZPDA 2QG9B 3ILIA 3UD5A 2FC8A 3UN3A 3C6UA 4P9SA 3EZ5A 4DFPA 1PJ6A 3GYGA 4OI0A 3GYNA 2J9CA 4ZPCA 2CWKA 3R8YA 2JWNA 1U1NA 3N5FA 4NLQA 5F8LA 1UVNA 5IWAJ 4LSLA 2VDIA 3QLHB 3PNIA 8AT1B 1KEKA 1HPZB 3M9NB 2J6TA 2HWIA 5LMUF 3GFYA 2DYAA 2IM1A 5JMNA 1GAOA 2V8GA 4KKOA 5K8OA 3BR8A 2B6AA 5KFJA 2OPQB 1J2VA 2ZH6A 1BQNB 2QA4G 2ZH9A 1TKDA 4TLRA 1D3WA 2CZ9A 1KVKA 2KVIA 4OYZA 3OUYB 1EX8A 3NS7B 4DUYF 4C0OC 1VQNS 4X4RA 4DR6F 1AUSL 4QCLA 2W1BA 1PYSB 3ZZPA 5A8RB 3VGTA 3W9JA 1UZHA 2DO4A 2DITA 5A8WB 5DRKA 2FZGB 3CJRA 2Y1LB 3PVXA 5KT5A 3D1OA 2H65B 3DLJA 4LF1A 2OEJA 3CB4A 3EICA 1AA1B 1AROP 2IRXA 4U7UD 2EC0A 1YBUA 3B6BA 2XSJA 4KGXB 2KHCA 1FJEB 4Z2XA 4B3MF 2B8PA 4FKXA 4DV3F 2V8PA 2VC0A 1MWZA 2EKNA 2M4MA 3FBBA 1IWGA 3L7UA 3MTKA 2OAUA 1HIYA 5ETKA 5F9LA 2RKIB 3TJ9A 1UEVA 4EYIB 3ZTRA 2OO4A 2AP6A 3DOLA 2EFVA 4DPTA 5J1EB 4ED8A 3TUIC 1CS4A 3HVWA 2MDAA 4B9VA 1G2EA 2MZTA 1L3VA 1TKTA 2B9XA 3M9OB 3PYDA 3BKFA 3PO4A 4NXMJ 3JQMA 1EQ0A 3ET6B 1H7WA 1VIXA 4OJHA 5DO2A 1APSA 4ED4A 3GV5B 4U6PA 2XLIA 2YWFA 3G96A 3JSBA 1F2HA 2IAJA 4OX8A 2F1FA 1CQNA 1IBMJ 1X4DA 1KR4A 2QL5B 2OGUA 1OWXA 4LR8A 4PG5A 3OSNA 1OJ4A 2B5JB 1IKWA 1WEYA 2WVFA 1GK8A 3OTOJ 1RAJA 5FLXY 3PDNA 4P7VA 4YR0A 1IJEB 4GVBA 3TA0A 2DD8S 3EYZA 2ADCA 1F6TA 4NE9C 3IFEA 3PJXA 2BOAA 3TWZA 5I3QA 2ZBPA 3Q8UA 4K7QA 5LSOA 1VQ5S 4WE1B 1RU1A 2Q3PA 1IM6A 3N0VA 2AIRB 4OX7A 1F9HA 3E51A 2GIQA 3UVJA 4H54A 5A8KB 5LSRA 2AU0A 2FJWA 3BDPA 4WK3A 2FJAB 1Z1ZA 4ZIVA 3PX6A 1KQSR 2FB0A 2E7VA 2DNLA 3TJ8A 1S59A 2BRKA 2M9KA 3G8QA 4I56A 4O23A 3OXFA 2VQEF 1GMVA 4LR7A 2DR7A 3EGNA 2DR6A 1S1UA 1Y11A 2QMXA 3NS5A 2IC3B 2VBZA 4LFAJ 4X4PA 4C8MA 3OUYA 1S76D 2KXFA 4ZCIA 2KDOA 2R8KA 2RIJA 5D4LA 1FJGJ 3JSRA 3IG1B 1HI1A 4CT8A 3QZ8A 2DNRA 1Q81T 1S5ZA 2X7IA 4CH7A 1X5TA 3OXGA 1WG4A 5FDLA 3PW7A 3TAPA 1YBTA 4LFCF 3VQTA 1GMWD 3A8JA 3MUTP 1GQEA 4PXDA 2VU5A 2HNDA 1AW0A 2DY9A 5ETPA 4EO8A 3N4WA 2AD9A 2PD1A 1XC9A 1TQLA 2DNNA 5B0AA 1IKXA 4EZ6A 3VAFA 2PMWA 1Y0HA 4QWAA 2C42A 1U26A 4DLEA 3CJSA 1UETA 4RNOA 2BKOA 1JK9B 3IXQA 1RAGB 2DGVA 4ED3A 5B0GA 4C98A 4P7TA 3K58A 2LCWA 3DRPB 1YQHA 1DY3A 1RHJB 3GIIA 2OSRA 5LJ3Y 2XS5A 5GAGU 2CRLA 2V4JB 3M8ZA 5KFYA 1IN0A 2XTJP 3KDNA 1U09A 3BSAA 3NNCA 1WF2A 4JV1A 2GV1A 1A6LA 3V6KA 3RBXA 3L7OA 4QW8A 2OPRA 3CMES 1J5OB 3TA1A 3C8YA 3EGZA 2MGZA 2X51A 2OPPA 1FFGB 1B0VA 1WHVA 2MLZA 1M1HA 4M63A 2MKIA 2UUCJ 4OI1A 1XK8A 1FX2A 1RWNB 1X4GA 4DPYA 2ZWOA 4ZHRB 2DR5A 3MEEB 2NSCA 4KSEB 2DK2A 1VK3A 4ZVHA 2MKCA 2GIFA 3GV7B 4DFMA 1ZZNA 2QO3A 3R2CJ 2DH7A 4WIIA 3HVTB 3OBIA 1JIHA 2GNKA 1EP4B 1RAFB 4WPAA 2DXFA 1TL4A 1RE1B 2G0IA 4B9UA 3C16B 4C8LA 1D8YA 3L7PA 3QIDA 1GEHA 3CULA 2CQ4A 1XNRF 1ZAWA 3CC7S 2OLWA 4Z7CA 3ZTOA 1WC6A 3BR9A 5I3UA 2Q6BA 3HVRA 2HZVA 1XNQJ 4KHPF 4LVOP 2HLTA 4FS1A 3I4PA 2DIUA 5L39A 3MMBB 2LXFA 1KLMA 1Q5VA 1H74A 1R0AA 4JI4F 3D6FB 1BXNA 3QT8A 4N7TA 3D54A 5DJBA 4RW4B 1HMVA 5H9FK 2ZH1A 1RT1B 1WC1A 4DCOB 2ERRA 2Y0SD 3FFIB 4ID5A 4TNOA 3SSSA 1UTAA 4FPRA 2Z56B 1L5UA 1FXLA 3OHBA 1JLFB 4G6VB 1IXKA 2KL8A 2M52A 2YWKA 2AGQA 1NK8A 5HN0A 4ECUA 2G2OA 1NB7A 1DHMA 3GV8B 2PI4A 2ZJRQ 2XMJA 2M88A 3CCJS 4YFUA 4UW2A 1WC5A 4KFBB 1U0SA 2UUWA 2ZH2A 4NLUA 4F3MA 2YXLA 2IVMA 5E3PA 3DHXA 4PAAA 1B0TA 1WSVA 2GW8A 3BDEA 1OO0B 4Y2AA 5KFVA 1JQGA 5DM7Q 3JAMU 2Y8YA 4OFZA 1Q8LA 2EVZA 3PEJA 3W3SA 4NL5A 1U02A 4ZPTR 1WF0A 2EG1A 4PYAA 1T9VA 3CUNA 2M7SA 3KHLA 2BX6A 3HHDA 1RWUA 1RYSA 1VQSA 3J81U 3FBEA 3ISND 2IMOA 3M6WA 1ITPA 1C4CA 1HQUB 2R3VA 4QR1A 4J9NA 2V8DA 2AJ4A 3NRBA 4KRWA 1DJ0A 4IFYA 3CCWA 1KD1T 5KFGA 1N33J 3EXYA 3PCOB 5D15A 5D0RA 1HYSA 2GAHC 2ILZA 1P8GA 2HNZA 2LLZA 5CYQB 3GMGA 4JI1J 4GMKA 1WDTA 1JLEA 2BJ1A 4O44B 4DUTA 3T5KA 2ROPA 4LRDA 1N32F 2AEMA 5M2RA 2CZVC 3FC9A 4YY3J 2W7PA 4AQYJ 4NCBA 3ENWA 3H90A 4I6YA 2JFDA 2C2RA 4FYDA 1X4CA 3FMBA 3KOAA 4MIWA 1RAEB 3EGVA 4E98A 3CD5A 3KJVA 2WSCC 3QNWB 3DDNA 3DGPA 2C2KB 4J37A 4PABA 1ZAVA 4HR2A 1MNEA 2UVUA 3CWJA 1T05A 1I51B 4PEOA 1GNKA 1NK6A 1RWOB 1TUWA 2PA8D 2BOPA 3MM7A 4K4WA 5DGAA 1D9FA 4DU8A 1C1CB 3HHLC 2P9CA 3ONQA 4NOHA 4QOTA 4HKQA 1LKZA 2Y0BB 3L09A 5J2QB 3SQGA 2B9EA 2DGTA 4PWUA 1FDAA 2FVSA 2IVYA 2J9DA 2DGQA 2RU3A 5CCLA 2RD5C 1SJ1A 2AYEA 4KT0C 5DG9A 3R2DJ 2CQ3A 5E2QA 3R5DA 1CS4B 4CZCA 4DV7J 1LWXA 1FT8A 4UUXA 2I1RA 1QE1B 3BKUA 1GX5A 3G82A 2VBWA 3I5BA 1NH8A 2GMLA 3I31A 1LK5A 1OSCA 2NCKL 3D6MB 4PWWA 2MQLA 4QPTA 2EPIA 4PG7A 5B0EA 1XMQJ 2Y3YA 1HI8A 2B56A 5F8JA 3TAMB 4FF1A 4N47A 4JP8A 3T1YF 1VBYA 3DLHA 5CH7B 3K89A 5LMUJ 2J8SA 3KUGA 1T7PA 2KXHA 1WI6A 3GZ7A 1S77D 1JKHA 2IDLA 2BBEA 1FJ7A 4W90B 1Y00A 2P9EA 2VIHA 2F4FA 4IFYB 1O6XA 2F8EX 4P2FA 4RX6A 5J2NB 4BCAA 2VZ9A 5FLXU 1YJTA 1W2IA 4RNNA 3PZPA 1QAJA 1T3OA 2U2FA 2HZAA 5A8RA 2DNPA 4U95A 1SV5B 3NGUA 4K2JA 2ZH8A 3VAHA 3FUYA 3I0SA 2V4QA 4LQ3A 1S79A 3OFGA 1T03B 3DMJA 5D77A 5EWGA 3BGFA 2VBYA 5T41A 1Y3KA 4XPEA 3B4DA 4DR3F 4YB7A 4C8KA 5IT4A 1XTZA 4F3OA 1S4FA 3CE8A 3RU0A 3DKDA 2D69A 2OEKA 1YJ9S 1WJ9A 2JLFA 4K59A 4A8OA 2K06A 2LEPA 2JX2A 2VODA 1H3DA 1N6QB 1CSJA 3PW2A 1G1XA 1Z4UA 2CPHA 3M2VA 3UE2A 2EFGA 4M1KA 2BJ9A 3PYFA 2R2SA 1N36F 1REVA 4UZBA 3K5MA 2KKHA 2MLXA 2XLJA 1IBLJ 2PT0A 3TAQA 1CJKB 4K4UA 1N4LA 5KFEA 1KHWA 2XEXA 2VOPA 1S1WA 1V5VA 1X4FA 2RS2A 1EKSA 4X2BA 4NA2A 3ZZZA 4F2RA 5JVGQ 2W9CA 3ELHA 1RHUB 1CJVA 5ETMA 5GAHI 4DSIA 1WG1A 2QYCA 2X1AA 4DCJB 4DSJA 1R43A 2M0GB 5KFFA 1NNDA 4B3OA 2NYHA 2Z4PA 3I55S 1VQMS 2KN4A 2BJEA 1M5KC 5E3RA 5DG8A 1PJ7A 1WEZA 3CVKA 2MXYA 1RAIB 1V3ZA 3OFHA 4NCGA 3T19A 1XWLA 3C14B 3M7VA 4NLGA 3KLIA 3BQ1A 2BE7D 1R8AA 1U1LA 1MROA 3MEGB 2W24A 4OI2A 4ZLJA 4ERDA 1SV5A 3CJQA 4OHVA 4DR7F 2XBPA 5KT4A 4RU9A 2CQCA 3C15B 3E8OA 2K3KA 4CO4A 1M5VC 2I8EA 2HS0A 3NMAA 1NZAA 4ILRA 4NLYA 4O3PA 1NK5A 4JI7F 2BYCA 4ZS6A 2R2TA 4DR1J 2OPPB 2JEFA 2O67A 1RAAB 1BQXA 2ZUGA 1IM4A 3HJFA 4GRSA 5EX0A 4CO3A 3T5HA 1N6QA 1R8PA 2HLUA 4IH5A 1UWBA 4LQ9A 4ETZA 2ZH5A 2D3OR 2VG6B 1K44A 4OYWA 1S0MA 2LXIA 2ZVIA 1OSDA 1K0TA 2E5HA 4IO1A 7FDRA 4U9RA 3SFUA 1SL0A 1NPKA 3UI3A 4FXDA 5A0YA 3CMQA 3CJ4A 3QWUA 4RUCA 4DL2A 1T03A 4MKVA 5DDQC 4B3SF 2XI3A 5KFDA 2FUG9 1R8HA 3EE3A 2FLPA 3VCDA 3MI7X 4DL4A 1SJ3P 4KC5A 1WOSA 1CJVB 3RBDA 2V9WA 3G87A 3M8PA 1H73A 5J2NA 3EDQB 1HA1A 2OIHA 2UXBJ 2W4PA 1QUPA 3LANA 4OZ5A 2IYIA 1PIEA 2YQ1A 5E3AA 4C3KA 4YB5A 3LWMA 1BQMB 1CJTB 2HBZB 3DLEB 3S01A 4BC7A 4ETXA 1IBMF 2MKYA 1EIYB 1F9FA 2ZEJA 3MD1A 1B0PA 1QTNB 1S1XB 2YNGA 3AA9A 2HK3A 3I6PA 4URGA 4DV7F 1F1BB 2KVQE 4B9MA 2JC1A 3UDEA 2MKJA 3U02A 2YKMB 2G0CA 1YZ6A 3ZNJ1 3KK2B 1L3TA 1WWHA 3CT9A 1YHQS 3H8YA 4UUWA 3DLBA 2I2YA 3M05A 2RQ4A 3GLJA 4J9LA 2P6TA 2VF3A 4CYUB 1D1UA 3RJMB 1ZTTA 1JXVA 4P71A 5F3ZA 1IKVA 2MJNA 3R9LA 1UA0A 5AXNA 2OUGA 4JI5J 1DQ8A 4DV1F 3G4SS 3DOKB 3LOUA 3VALA 2DRBA 3EMTA 5BR8J 4QU7A 2BE2A 2KRBA 3DOLB 4I2QB 1C0UB 3KLHB 1RT6B 2HHHJ 2XY7A 3JQKA 3OW2R 1EJ7L 1TMMA 4L3NA 4X4QA 3UD3P 1T3NA 3PYEA 3JQJA 5KTQA 4DFJA 2FZCB 3MPUB 4H4OB 4WBFA 2WB1D 3D68A 1OYEA 2CPIA 2N4DA 3B78A 5J1PA 4ZA1A 3MGJA 3NGKA 2KFZA 4IR9A 1Q53A 1YJRA 2RDIA 3QO9B 4J5OA 5D4PA 3K8VA 2NPFA 1JB0C 4DUZJ 1KFSA 2XNRA 2RRBA 1RP5A 4C2MA 1U6FA 2CDRB 5GAGI 5A8WA 3SV4A 4KHPJ 2NYIA 4LRAA 2JEIA 2VG5A 3CTRA 1HQUA 2BKPA 2JH3A 4AXIA 3D9BA 3R1HA 2DNKA 5K8NA 2K8GA 3PHTA 3U7JA 3M8PB 1DURA 5EWFA 1X9WA 4LMZA 1MMLA 3DOMB 1U24A 4DQRA 1DTTA 1EARA 4C0HA 1R6YA 1HNIB 1TKTB 3VWSA 1Q5YA 2YWWA 3EX7B 1S9EB 1T9YA 2GX8A 2RRAA 1Z2ZA 2UXCF 5KG5A 2YKMA 1RT4A 4BDPA 4ILMA 4NPOA 3PW0A 2CIMA 2WBRA 4LRBA 5EN1A 2RNEA 1AZSB 1HNZF 3BO4A 1PG5B 2CKWA 1T94A 4CLYA 3DFEA 2ZJQQ 1RU2A 4OYBA 2J6UA 3LP2B 2XGPA 3RRKA 3OJUA 2WCXA 5F8IA 1Q7YT 2CADA 3GU0A 1LFPA 2AEJA 3MECB 3OTDA 1YJVA 3S7RA 4CLFA 3IRXB 3Q2TC 1U7LA 4DPOA 3D7SB 4EZ9A 1PKUA 2FQQB 3MAAA 2K7JA 4RR5A 3MFIA 1RK8A 5LJ5Y 3WZ0A 2VQFJ 2D7SA 1Q79A 1N52B 1X60A 4O3NA 2XSFA 3BF4A 1X4EA 3EXCX 1N5YA 2QLWA 1WUUA 3MEDB 4P75A 3IBWA 2MLYA 3GIMA 2FLOA 1UMJA 1KOHA 3AA8A 3CC4S 3R3TA 5L46A 1R8CA 5KG4A 4WTOB 4RUHA 4K0KJ 1PCAA 3SQOP 4JI6J 3DYAB 3MR6A 1JJCB 2V50A 1U0HA 5HMXA 3CJ2A 3VZHA 3PM9A 4JI1F 4OI4A 2KG0A 2DCUB 2VFUA 2XGQA 4K4TA 4K4VA 2OTJS 6FDRA 2HFZA 1URNA 3KLEB 1VK8A 4TKTA 5HK4A 2PI5A 4J9SA 1FA0A 3QT5A 4B3MJ 2DTJA 2RJZA 2ZNYA 3BGOP 3D6TB 4HEA9 5B09A 1M5PC 2NXUA 4ED7A 3HFKA 2ASDA 1FJCA 3QGPA 4MFBA 2DJWA 2DISA 2XQCA 5IC6B 1D8ZA 2CPYA 3OLAA 2MHEA 1PC4A 5KFKA 1XMOJ 2CQ2A 1RT3B 2DNOA 1CLFA 2F5GA 4ELUA 1FEEA 2E5JA 4NA1A 1PBAA 3AODA 4F4AA 4ITSA 5FDLB 4DOZA 2FHKA 2BDPA 1U6BA 3CCVS 4HH1A 4M5HA 1UW9A 4V19J 2HVHA 2YNIA 4NZ7A 1TTHB 1CC7A 3AXMA 5C25B 4A8XA 5IV4A 4RKUC 1VJQA 2R7VA 4LT6A 3OXLA 1HW9A 5DZ7A 4N56A 2J7KA 4YHHJ 3A3PB 3N6LA 2LYVA 3MM8A 2ZKUA 2WVBA 3PHEA 3TNVA 2RDJA 3IGNA 4PQAA 2B9YA 3W2WB 3HVTA 2FTRA 3H2LA 3QQCD 2CUYA 1FRJA 2AWZA 2C2OB 5E5NA 1F9EB 3T1YJ 3TANA 4F4XA 5DM6Q 1VRTB 2HFNA 2MZQA 3NCPA 2JEGA 3CCLS 1DTQA 4QPXA 3KHRA 3GG1A 1NDPA 1GMUA 4ELTA 3FSIA 3QJPA 1BC6A 2IMWP 2YKPA 1A0OB 2SXLA 3M2VB 5CZVA 4OMFG 4DZDA 3OHAA 3QAUA 2HHSA 4E8UA 4DQIA 4WZMA 1UP1A 2IM3A 2BACA 2CFXA 3OD2A 5JXSA 2CPFA 3RBEA 1RTJA 1WELA 4KGKA 4GVLA 2DEIA 1U25A 3R5GA 4OZJA 3H20A 4QR0A 5KFZA 1UL3A 3EGWB 4USIA 4CDIA 5BXIA 4F4WA 3C2PA 3CGIA 4MK9A 1TL7A 1T9XA 2BXJA 4NXNF 5GMEA 3D3BJ 4UTGA 4WXOA 2DR8A 4DUZF 3V6HA 3CNQP 4LSNA 3ZXWA 2LXUA 2V69A 5HROA 2UUTA 1EQMA 2DH9A 3D1QA 2AGOA 3PKYA 2F9DA 3HD2A 5HATA 1E6YA 5HQMA 3GPAA 3CJKB 4DR2J 2NXNA 1HBMB 2M3DA 2XO6A 2FZKB 3CDEA 5T14A 4MYUA 2F8HA 2DNGA 1I1GA 3GWCA 1SPBP 4OI6A 2R4FA 1D09B 2GMHA 5HVGA 2NUUG 1ACMB 1ZM2A 4QIWD 3MUVP 2R8IA 1U49A 5JUMA 3Q2SC 3EPIA 1SQEA 3RGIA 2EWHA 3BZQA 3NWRA 3R97A 4ZVTB 4DV5J 2NQPA 3GR1A 4URQU 5J2PA 1RHRB 2HHPA 5HQLA 1KRPA 1LWFA 5RUBA 5KFCA 2IAJB 3Q8QB 3KJFB 1DTQB 2V8HA 3QWPA 2YKQA 2G1DA 1X5PA 1IBCB 4H4MB 4O3SA 1FRIA 1P6TA 4WXWA 2ZKTA 3NGDA 2A2CA 2GO8A 3MR2A 1HR0J 1X9MA 1NKEA 1DFDA 3R5CA 1X7VA 2AGPA 2BJ3A 2LDYA 1RWKB 2DB1A 2QV6A 2BM1A 2DPJA 4P73A 4UOCA 1HQEB 4OV1A 3MM8B 3UFCX 4DU7A 4DR7J 3BYRA 4URSA 5I42B 3LAKA 1LW0A 1YRXA 3DLGA 3K5OA 4QIEA 3TP2A 4ZIWA 1X31C 2J9DE 1VRUB 2X1GA 4RJVA 3MAQA 4OHYA 1RBLA 4GVBB 4QJVA 1UFKA 4X62F 3KK3A 3K5LA 3CF5Q 1K1QA 3HSJA 1Q82T 3QRRA 5CYQA 1BWEA 2LEBA 4HACB 1NAQA 4J9PA 2RHQB 4CH1A 3O3LA 2ASLA 1C1BA 1HBUA 4HLBA 1KOOA 4I68A 4DX7A 5LT5A 5IM0B 1VC0A 5HL7Q 5AE2A 2JVRA 1M5SA 2D74B 2HBRB 3CCTA 4TY9A 4I69A 4LFBF 5HROB 4ZJOA 4FDFA 1T9WA 3MM9B 1CJUB 2B4OA 3S6EA 1NJYA 3KG1A 3SCLE 3TVZA 5E0OA 1XR6A 2DRDA 1M0SA 1QLNA 2ROEA 3JTOA 3K5PA 4Q8FA 1S0VA 3NG8A 4IH6A 1TMJA 4MIAA 1FD8A 3K5NA 1TV6A 1JLAA 2GA7A 4R0JA 1H2VZ 2W9BA 2OPSA 1KKHA 3GFHA 1UVJA 3DRPA 1UPMB 2R2RA 2C3MA 3B54A 2X3GA 2MSSA 4I4BA 2FJBB 1WKJA 3KKFA 2CAJA 1CULB 1IKYA 1SBRA 2GO9A 3FZBA 3MEEA 3KK1B 5FJ4A 2XULA 5DQIA 4F4ZA 2BRLA 5IS2A 1HD1A 5G0RB 2QN6B 3QSYB 1KBRA 2GZOA 4DCPB 1M1GA 1D9DA 4X4SA 4L76A 3PJWA 5M2UA 1SH2A 3QYYA 4WTYA 3PFOA 2XY5A 1K8AT 2E1MC 5KFWA 4DF8A 1HNVB 5K5MA 2KYZA 2A1BA 4LBIA 3TUJC 4NLTA 3OSPA 2C28A 3G6ES 4XO0A 3DRSB 1N34J 2KJWA 2ASJA 3L9ZA 1HLWA 2YVSA 1SH3A 4QBUA 5IT9U 1GTEA 5CAAA 3C16A 1RT4B 2KXNB 4FF3A 1XN9A 2P9GA 1AB8A 4LUBA 1KQFB 1HPZA 1RWPB 4Q2MA 5F9NA 3FCHA 2ZD1A 3FCWA 2E7WA 2CQ1A 3R7BB 2QLBB 1F60B 4OYXA 1DTTB 1CJUA 2B4PA 2FHJA 2XWXA 3TUZC 2E5IA 1IUJA 1NH7A 3I9ZA 1HBNB 4CTAA 4C48A 2AJFE 1QM9A 2W9CB 4KE5A 1TL3A 5B0DA 3GCXP 3F0NA 2CG4A 4DDFA 2FJDB 1IKXB 2CNLB 2YWHA 2FIUA 3M30A 5DZ6A 3KJQB 1CJKA 4DPWA 1VC5A 3T3FA 1I6JA 1GTHA 1ZAXA 2QX0A 1RHQB 3HZGA 4IRCA 3I5AA 5KFAA 1FX4A 1PYTA 5A2QY 4Q44A 4DR2F 3OL9A 3MCMA 4I1TA 4FXWA 4O0IA 3QJJA
chains in the Genus database with same CATH topology
2L08A 3NNAA 3KK3B 2GIRA 4MKAA 1P1LA 5KFUA 5F3TA 2O3DA 4NXMF 2E9TA 3Q8SB 4LF9F 1FNMA 1ZM3A 2DHXA 1LW0B 2JOQA 1VC6A 4A8YA 3OL8A 2RUGA 3MURP 2CPXA 4DL5A 5L9XA 3B8HA 3BGUA 3DNCA 1S0OA 2IRYA 1XMQF 2BA9A 2M5YA 4F4YA 1X4BA 2VV5A 4PUOA 4HL9A 4ELVA 2N7CA 3D0GE 2IYGA 2BQUA 1L3UA 3FEZA 3E01A 1Y9OA 2B51A 3MDFA 2HRUA 4DX8H 2CJKA 4U67Q 3IWLA 2ZDPA 3B82A 2MQPA 3N6NA 2F9JA 1N54B 2VL1A 2A3JA 2YNHB 4NLVA 4FNHA 5AXKA 2RVJA 4DSLA 3EUNA 4BWJA 5F8GA 3DM2A 2RF2A 2B5JA 2HMIA 2E1RA 3M8RA 1BQMA 5KFMA 2ILYA 4A8FA 1HARA 3I56S 3UR3C 1SKWA 2VPXB 2PGCA 5GMKa 4DEZA 1AFJA 5SZTA 4QIVA 3QAEA 4C3LA 3ULHA 3D0IE 4ECQA 1X5OA 4AUKA 3N79A 1R3NA 1KTQA 3O1LA 1UFWA 3JSMA 3VZIA 1O8BA 5J1EA 1FDDA 3QGGA 2YKNA 3EZUA 2CZ4A 3BQ2A 3W2VB 2J6SA 4AE5A 3H40A 2W8KA 2F7VA 2CPDA 3SDEA 3H25A 3ZZUA 1N48A 2U1AA 3ISZA 3D2WA 1JJ2R 3DLEA 2H5EA 2HQIA 4D3HA 5F8MA 2R7TA 1FNXH 3BSOA 2NREA 2HNZB 3KLHA 2E44A 3WX4A 2HPUA 3S8SA 1S10A 2E1CA 4WF9Q 1FESA 4MJKA 5K8PA 3E2EA 3Q22A 2HYIB 1FF2A 1NHVA 1OS5A 4ID8A 5F41A 3THPA 5KFNA 1N88A 1SIZA 5IWAF 4R5PA 3OHBA 3KMSA 3M32B 3UR0A 3D1HA 3W2WA 5ADZA 4B17A 3AJ1A 5HQ8A 2VG7A 3BN7A 2EFPA 4C11A 2EFQA 5DQHA 4HDHA 1MU2A 2AYMA 3HKZD 2XO7A 2UUCF 1KN6A 1H2TZ 1G6BA 2KJVA 4R8UA 2BVZA 3L3CA 3GILA 4K0KF 4OQJA 2VA2A 2WOMB 3GG0A 5GADI 3VAIA 5BJRA 4LIRA 5FIIA 4WU2A 4BHQA 1L3SA 3M1VA 3RZAA 5KAKA 2O1PA 3G6VA 5LXYA 2RQKA 2KFNA 4YQWA 1DQAA 3V4MA 2MGZB 3MMAB 1FK9B 4A48A 3FQKA 4JYAF 1VFJA 5I3PA 4KV8A 4GKJF 2OD6A 4ZCKA 3WBZA 4C4WA 1UVKA 2MKKA 5I3UB 4WJBA 3TVKA 2VKZG 2CJAA 3LQVA 1DLOB 2XLKA 1S9EA 3FVYA 3OTCA 4LSLB 3J81Y 1FTCA 1LWEA 3MEDA 4X4VA 1L3KA 4JI2F 3C6UB 4R5PB 3Q8RB 5E7OB 4MIBA 5BYQA 3KLEA 2ZHOA 1VC0A 1C1BB 1HBUB 4YDDB 2PDAA 4WYLA 2RILA 3DCAA 5KT7A 3IRXA 4JBCA 4OHXA 1SJFA 4HHJA 4MKBA 3OTOF 1JMTA 5EHHA 2R8HA 3PIOQ 3HHNB 1WTBA 1YRTA 2HAIA 3CPWR 1JLAB 3R5AA 5FD1A 1HR0F 1QSLA 3RR8A 3SDEB 3BGLA 2BANA 2YWGA 4WFXA 4IG3B 2V4JA 1GX6A 1FRLA 1N33F 1I94F 4A4JA 1PILA 1YVFA 1FRXA 4RW8A 2ZNZA 3AH6A 5KFXA 5BR8F 2ZOGA 3OFFA 2Z8QA 5K14A 1QAYA 4NLWA 1VQ8S 4NYOA 5DDRC 2W9AA 2R2UA 3MOJB 3NL0A 1H98A 1D0EA 2HHTA 4IG0B 3FGVA 1NJIT 2E9RX 3M2UA 5KFLA 3FEYB 4R8UB 1TVRA 2MJUA 1TUVA 2R8GA 1VHFA 2HVIA 2UP1A 1VBXA 5DDOC 4B9NA 6FD1A 2A10A 2FHMA 3WC0A 1U45A 1QSYA 3HO1A 1RKIA 5D3GB 2B4UA 4OJGA 3QIPB 2GHWA 2ABYA 2YX4A 4Y65A 2MY7A 2WSEC 5J2QA 2AX1A 3NMRA 4Y34A 2AX0A 2DNMA 3D5MA 4PR6A 2N4CA 1P1TA 4DL0C 2ACYA 1QVGR 4K4ZA 3VAKA 1U1RA 3K7RA 3FEXB 1N5VA 4Y2IA 4WE1A 1FNOA 2BANB 1S97A 1RT5A 1X0FA 4H4OA 2ZBCA 4DN0A 1M5OC 3AQOA 2IBOA 2VD3A 1JX4A 3IWNC 2IHR1 3HHKA 1NJWA 3KLFA 2YX1A 3DLKA 4FBUA 2EK6A 3HI9A 1IKWB 2VQFF 3IGVA 2BM0A 4O4GB 3E01B 3KTQA 5DLGA 3DXBA 1HBMA 1FXDA 1KONA 2WSFC 4JI6F 1VRTA 5CD4H 1N34F 3CC2S 3RRGA 2C3YA 2MY8A 4ED5A 2J0XA 5KFHA 1ULRA 4TLQA 3BSNA 5D6GA 1N5SA 1GXTA 1X9SA 3UCZP 3RTVA 3M8QA 4WK1A 4Y2CA 2JC0A 3HF5A 3KG0A 2PO4A 4C8YA 3SCKE 3N28A 5KG0A 5DS7A 1Y3JA 1PO6A 1U1PA 3HX9A 5EGYA 4C97A 2VASA 4X65F 2AYGA 2BQRA 2QSWA 4ECYA 3QGIA 2JVOA 3I87A 3NAHA 2Y1JA 1NO8A 2KT2A 5G4DA 4HH0A 4OZLA 4JUZA 4I6WA 2LDIA 1X8DA 4LIWA 3RB3A 2J7WA 2PMZD 2AF6A 1ZOTA 2W4DA 2XZWA 1YBAA 4RW7A 4OZ1A 1EETA 4B9LA 2LU2A 1MMDA 1RT2A 2FGOA 4DS5A 1REVB 3RAXA 2LEAA 3H5SA 3TOQA 2K1RA 4WYWA 1X5SA 1C0TA 2VC1A 3MEKA 2OFGX 3IS9A 1U4BA 3PEHA 4NMLA 4Q7AA 2COLA 5E3QA 1MU2B 3MMJA 5C42A 2CJBA 4RW6B 4ALZA 2E5LF 2D3ZA 5U47A 2V5HG 3K0JA 1GXLA 2QRRA 4PCQA 1TZ0A 3M32A 1KNZA 5LL6d 3WDOA 5J2MB 1LW2A 4HVZA 3M9MB 1TFYA 3PKMA 4ZHRA 3V4IB 2ZE2B 2KO1A 1RJJA 2DNHA 2KM8C 1S1WB 2OD4A 3DN9A 1S49A 3MD3A 1Q16B 2DNQA 2QE5A 3KLIB 1O51A 4N8NA 1RTIA 1XERA 2OPRB 2ALZA 2RRAA 5AJ3F 4Q2LA 3MUMP 1LOUA 4AQYF 3LP0A 4ED1A 1CPZA 1XMBA 4NLXA 3W2VA 3T5LA 1M5HA 2V94A 2OTLS 1H6KX 3M6VA 3CCZA 4C11B 2ZH3A 2FJVA 2UXBF 4NLOA 3DOMA 3POTA 2KU7A 2C3PA 2J9EA 4AL5A 1SI9A 4UY8T 2ZVSA 1N5YB 3HMJG 4A8QA 3T5JA 4O4RA 1BGXT 3RRHA 5HBMA 2HGLA 3W7BA 2YKOA 3IAS9 5K8MA 5HMYA 4JI3F 3UW1A 1VJWA 3DLKB 4PQUB 2LA6A 3G8TA 4ZCLA 2HHUA 3M6XA 3V6DB 1TK0A 3LGNA 2ZZNA 3DRRB 2MQNA 5AXLA 4KO0A 4PPZA 1TKZA 2I5JA 2XMVA 3HLUA 3T1HF 2DO0A 2F3JA 4Q45A 1S6PB 3JYTB 3QMQA 4DV0F 1QUVA 3KFWX 4E0DA 2K7KA 2WTFA 1SUQB 4P2SA 3UQSA 3GSDA 3CD7A 5A8KA 3KNAA 1JLCB 2FGCA 1RYRA 4AFFA 3KLGA 3X3UA 1HI0P 2Z2MA 3VTIA 5HI7A 2JEJA 5CHCB 1LFWA 1HW8A 3PR5B 3ZC4A 3OTEA 2MZSA 4AXJA 3E3XA 4I2PA 1ZPWX 2H9ZA 1RTJB 3FSXA 2PA3A 2NZ4A 1JLEB 4O44A 3S1TA 3DRYA 4OJ3A 5IT0A 1F5AA 2CPEA 2IC3A 3CJKA 2DHGA 1UA1A 2XS7A 2J5AA 1OIAA 1V9OA 4J9MA 2B7CB 4Y2KA 1S99A 2CQ0A 3H2VE 4IH7A 3BB5A 4CTAB 4A8WA 1NRKA 5BYRA 2QA4S 4OLPA 1RTDA 3VF0B 5D3GA 4D3GA 3DM2B 2C3OA 2EFNA 2L9NA 4X64F 3H4BA 1FKAF 3DHWC 4X66F 4F3QA 2NUHA 3T1AA 2N3OA 1VQ9S 4Y6IA 2MQQA 4IR1A 4GO7X 4BS2A 4FF4A 2ZOFA 3M2UB 3LP0B 3OL6A 1FKOA 4NA3A 3QLHA 2YTCA 4IOAQ 1H2UX 2YX7A 2DIVA 4ZVFA 3MR5A 1R89A 3QPIA 1W2BR 5B0FA 5IQ6A 4OHZA 1S6UA 3X1LB 3POTB 4EFAC 2AJ0A 4USHA 2X1FA 3LP1A 3MF5A 2KI2A 2MSTA 4HDGA 1AFIA 3B4MA 1N8RT 1TAUA 2M70A 1TKXA 3O8WA 4CO0A 2JRSA 2B3TB 2BZ2A 2MZ1A 4QYZJ 1Q4RA 1XNQF 2WBMA 5I4MA 3PX4A 1JLBB 3DI6A 1HBOB 1CVJA 3TI0A 2J8AA 1NK4A 5BYSA 2G9OA 3BEGB 4YB1P 3H2UB 2UZAA 3GFXA 2VOOA 5H9FJ 2XMMA 4K50A 1EP4A 5SUHA 1S9GB 5KFTA 2PIIA 5AXMA 1S6QB 1URRA 4RLEA 1M1KT 1TP7A 2FY1A 2Q43A 1YSJA 2LKZA 5ITHA 4TYBA 2L9DA 5D4NA 1X4AA 4WZQA 1TL1A 2Q6CA 4EYHB 2HG4A 2B7BB 1R0AB 1SH0A 3T9NA 2YY3A 3DU6A 3IWXA 5L1LA 1D9AA 2AW0A 3DRSA 1S6OA 2XS2A 2MYFA 2J0WA 3DC2A 5B7WA 3P5TL 2YNIB 3NLCA 2UUBF 5I42A 4GKKF 3TA2A 1RTDB 1FVQA 3ZZYA 1H0HB 3MWBA 4FVMA 4ZPVR 1U1QA 2UUAF 2ATLA 4WU3A 4N41A 1NK7A 3PACA 3MM6A 5IM0A 3KG4A 3TARA 1JLQB 2HS3A 3TQ1A 3HK2A 3Q0AA 4K4SA 3IAM9 4IUFA 2VPYB 3US5A 1S72S 1SL2A 4ZOSA 1J5EF 3PXGa 5C24A 4NX9A 5C42B 2PC6A 3ZZTA 2EFOA 3ISNC 2NR0A 5D4OA 4A46A 2HNYB 2QEXS 2DRAA 2PEHA 3IS9B 4PG4A 2XI2A 3BGRB 4LF5F 2V2KA 4LVNP 1SXLA 4TY8B 2MZJA 1VBZA 3MAHA 2BW2A 2ZH4A 1E6VB 1U1MA 2WONA 4C0BA 3I96A 2DBBA 2FJEB 3JB9k 1EETB 3HHLD 3FZ2A 2DR9A 3RW7A 2HIQA 4QR2A 1JJ4A 1OPZA 1RT7B 2CYYA 5HMWA 2HW3A 3MMCB 4G3IA 5AE1A 5EUHA 3OJSA 2RKIA 4U7UK 3ITHA 3SXLA 3TAMA 5MAOA 2V0NA 1O5JA 1JLGB 2IM0A 4Y00A 1HWJA 4Y0FA 1FRMA 2RU9A 2YKAA 2GQQA 1U8SA 2HGNA 3OVSA 2R7SA 1C0UA 2WRMA 2XMWA 2GQCA 3M2RA 2IJFA 2R7OA 4QWDA 4X2BA 3BQ0A 5F0WA 2RSQA 4IOCQ 3CEDA 1FERA 4PUOB 4A8SA 2VA3A 4ECWA 1WHXA 5KFOA 2DCLA 4KIAA 4EGLA 1AUDA 4FF2A 2ROGA 4YR2A 1FXRA 4OHWA 4TYAA 1U47A 3GYXB 5KFIA 2MQMA 4RW8B 1WI8A 4ZP6A 1HNWF 1Y5LB 5HMZA 2OFHX 4I64A 2D3UA 4OIXA 3KJVB 3D0HE 3DRRA 3HDSA 3HHLA 5HLFA 2YNHA 1UEUA 5F8HA 4HTJA 2CQDA 2A18A 1JLQA 3OVAA 4X4TA 1U1KA 5A6WA 2XCAA 2BE2B 2N3LA 1X0PA 4IDKA 4WFAQ 5JVHQ 1P9QC 2KTQA 3WC2A 3MPVA 1S1TA 2K3IA 2QA1A 1YG0A 2FHOB 1V6HA 4OLOA 3JYTA 1XMOF 4NRUA 3KHHA 4OZ0A 4F2SA 2D1CA 4IG3A 3MFHA 2DNYA 3LF0A 3OR1A 3SCIE 4DSFA 2HNYA 3N5BA 4J9RA 4ZCMA 2B6AB 4KTQA 1TVRB 2N82B 1PC5A 4RNFA 2ZBIA 4ECVA 4LF4F 3C6TB 4PRFA 2ZC3A 3KWMA 3D28A 3H4DA 3PW5A 2HHVA 4GC7A 4DR4F 3BREA 3MM6B 1LV5A 4Q8EA 3OL7A 4EEYA 3MHYA 2BABA 2JL9A 3HT3A 1QAIA 2AQ4A 3LWLA 3PRDA 2BR0A 4ZPAA 4DR1F 3SCJE 2EI5A 1JNZB 1N0UA 2AJ1A 4EWTA 2ZHBA 2FD2A 5L9NA 1J5OA 3G9CA 4MTPA 2QSFA 2GGPB 1VS3A 1DRZA 1KQKA 4Q0BB 3LGMA 3LP2A 1TV6B 2MZRA 4LFAF 4ECZA 3OPKA 2C2DA 4FXVA 2UXDF 2FLNA 4X84A 1NK9A 1FJGF 2OKQA 4TN2A 3OR2A 4YMEA 4FNIA 4N8OA 4Z37A 2CPJA 1AXQA 3ICLA 3HM9A 3G71S 1P27B 4OJ1A 4YP3A 1MW7A 1K73T 3LP1B 3BO2A 5DDPC 2J0SD 3F41A 2MMYA 3K59A 4IQXA 4ILLA 2OMOA 2C2EA 1NJXA 4ZVGA 4GO5X 4JV0A 2GCFA 3JAMY 1QAXA 4IOBA 2KT5A 2FDNA 1ZETA 1IKYB 4DWIA 1Q86T 1Q78A 1WTFA 3FJ2A 2LU1A 4ECXA 2PN6A 1LQ9A 2D9OA 3MECA 1T8EA 2UVVA 4JI8F 4Y3CA 3ZZRA 1T95A 3NWGA 1DLOA 3CD6S 3SFGA 2KZMA 1UVMA 2CQPA 3LH2S 4CO1A 4F8RA 4YDXA 2D9PA 2LVWA 3CDBA 3OR1B 1SKSA 2EG2A 3AHPA 2UVWA 2V8VA 3MPWA 1Q8IA 4F02A 2FPHX 1VQLS 1FK9A 3J7ZT 2X1BA 3M4XA 3V5RA 4KHRA 2CDQA 1PSDA 1SL1A 4F4KA 2JHEA 2UVRA 5A6PA 5B08A 3SEOA 4RW9A 1HWUA 3F44A 4KBIA 1HWKA 1C1CA 2F40A 2LECA 5EX3A 3C6TA 1RISA 4O3RA 5IXUA 1MMNA 3CIMA 1Y5IB 5T7LB 3ZZOA 2YNFB 3UDLA 2W4CA 1WEXA 3QO9A 1TR0A 3DU5A 4IQMA 5LSLA 3IN5A 3AY0A 3SZ2A 4DS4A 4F25A 5HP1A 1HYSB 4F26A 3CSKA 3U27A 4X4NA 5K14B 1IKVB 4HT7A 2XMKA 3UNGC 3CO9A 1FDBA 1T05B 3BSCA 1KLNA 4CO5A 1DARA 4PG6A 2V4RA 2R7UA 3DXSX 3EPGA 3MXHP 4C8NA 4XPCA 4I0WA 4N76A 3NKYA 4ZPBA 3NCRA 3KLFB 2QFJA 4NRTA 4WKRA 2AV5A 2VPZB 5KT6A 4YOEA 4J9KA 1Q1KA 4LJMA 1YJUA 3FSYA 1U2RA 1MWYA 2F8MA 2XHWA 5C24B 2FJXA 4A8MP 3LO3A 2XY6A 1GT8A 3CCMS 2CQGA 3DOKA 5C5JA 3KLGB 1QVFR 3VQSA 5KT3A 4DL6A 1N0VC 2O5DA 3NCQA 4K4XA 1DBDA 1DAXA 4DV6F 2EBGA 4TY8A 4CNZA 1XEZA 4OL8A 1IR0A 4DFKA 4MK8A 3J7Z5 2W7OA 5HP1B 4LF7F 1S6PA 5L1KA 3MR3A 2WW8A 1NK0A 1VIOA 2ASYA 2HQ3A 2VBXA 4ZP8A 2VB6A 4ZMMA 2MQOA 4M5DB 5KFSA 1Q7LB 4ECTA 3GQCA 1OQ3A 4KKOB 3LW5C 4K2XA 3V6DA 4IG0A 3O2IA 5L1JA 4B3OB 2XSJB 3G86A 1FO1A 2IVFB 2MB0B 3U1NA 2JLEA 5B0CA 2DHAA 4ICLB 4QWEA 1HD0A 4DL3A 1Y4ZB 5KFBA 1DZ5A 4NYPA 1R7IA 2OMLA 3M1VB 4ED6A 2YWEA 4WFBQ 2IRU<